BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF043E02

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD18097.1|  putative serine/threonine protein kinase               169   3e-67   Ipomoea batatas [batate]
dbj|BAD18102.1|  leucine-rich repeat receptor-like kinase               169   6e-67   Ipomoea batatas [batate]
ref|XP_009800027.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        151   4e-61   Nicotiana sylvestris
ref|XP_009626005.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        151   6e-61   
ref|XP_002315684.2|  hypothetical protein POPTR_0010s05300g             153   1e-60   
ref|XP_006378225.1|  hypothetical protein POPTR_0010s05300g             153   1e-60   
ref|XP_007044708.1|  Nsp-interacting kinase 3 isoform 1                 152   3e-60   Theobroma cacao [chocolate]
ref|XP_011086598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        149   3e-60   
ref|XP_011045286.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        153   3e-60   Populus euphratica
ref|XP_010651607.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        151   3e-60   Vitis vinifera
emb|CAN75190.1|  hypothetical protein VITISV_035381                     151   3e-60   Vitis vinifera
ref|XP_006366916.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    149   1e-59   Solanum tuberosum [potatoes]
ref|XP_004142972.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    147   2e-59   Cucumis sativus [cucumbers]
ref|XP_004159592.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    147   2e-59   
ref|XP_008444352.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    147   2e-59   Cucumis melo [Oriental melon]
ref|XP_008444353.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    147   2e-59   Cucumis melo [Oriental melon]
ref|XP_011034114.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    149   2e-59   Populus euphratica
ref|XP_011034116.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    149   3e-59   Populus euphratica
ref|XP_004489819.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    151   5e-59   Cicer arietinum [garbanzo]
emb|CDP13189.1|  unnamed protein product                                148   7e-59   Coffea canephora [robusta coffee]
ref|XP_010100426.1|  Protein NSP-INTERACTING KINASE 3                   149   1e-58   Morus notabilis
ref|XP_003613191.1|  Leucine-rich repeat receptor-like kinase           152   1e-58   Medicago truncatula
ref|XP_004297396.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    146   1e-58   Fragaria vesca subsp. vesca
ref|XP_011463143.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    146   2e-58   Fragaria vesca subsp. vesca
ref|XP_010251173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        147   3e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010319667.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    142   8e-58   Solanum lycopersicum
ref|XP_004237339.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    142   9e-58   Solanum lycopersicum
gb|EYU28436.1|  hypothetical protein MIMGU_mgv1a002888mg                142   1e-57   Erythranthe guttata [common monkey flower]
ref|XP_010248542.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    147   1e-57   Nelumbo nucifera [Indian lotus]
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    147   1e-57   Nelumbo nucifera [Indian lotus]
gb|KHN14560.1|  Protein NSP-INTERACTING KINASE 3                        145   1e-57   Glycine soja [wild soybean]
ref|XP_007157369.1|  hypothetical protein PHAVU_002G064400g             145   1e-57   Phaseolus vulgaris [French bean]
ref|XP_003517653.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    145   1e-57   Glycine max [soybeans]
ref|XP_003519642.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    144   2e-57   Glycine max [soybeans]
gb|KHN00370.1|  Protein NSP-INTERACTING KINASE 3                        144   2e-57   Glycine soja [wild soybean]
ref|XP_006438322.1|  hypothetical protein CICLE_v10030967mg             144   3e-57   Citrus clementina [clementine]
ref|XP_006483905.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    144   4e-57   Citrus sinensis [apfelsine]
gb|KDO82334.1|  hypothetical protein CISIN_1g006968mg                   144   4e-57   Citrus sinensis [apfelsine]
ref|XP_007222912.1|  hypothetical protein PRUPE_ppa003642mg             144   4e-57   
ref|XP_007222911.1|  hypothetical protein PRUPE_ppa003642mg             144   4e-57   
ref|XP_008221850.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    144   4e-57   Prunus mume [ume]
ref|XP_008221852.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    144   5e-57   Prunus mume [ume]
ref|XP_008221853.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    144   5e-57   Prunus mume [ume]
ref|XP_008389688.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    143   8e-57   Malus domestica [apple tree]
ref|XP_008389685.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    143   9e-57   Malus domestica [apple tree]
ref|XP_008389687.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    143   9e-57   Malus domestica [apple tree]
ref|XP_010023506.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        138   1e-55   Eucalyptus grandis [rose gum]
ref|XP_006356418.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    135   1e-54   Solanum tuberosum [potatoes]
ref|XP_008340070.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    135   1e-54   
ref|XP_008340072.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    135   1e-54   
ref|XP_010682518.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        137   2e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008340071.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    135   2e-54   
ref|XP_009596637.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    134   2e-54   Nicotiana tomentosiformis
ref|XP_010940158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        135   2e-54   Elaeis guineensis
ref|XP_010910388.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    134   2e-54   Elaeis guineensis
ref|XP_008813583.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    134   4e-54   Phoenix dactylifera
ref|XP_006841062.1|  hypothetical protein AMTR_s00085p00173590          131   4e-54   Amborella trichopoda
ref|XP_008813582.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    134   4e-54   Phoenix dactylifera
ref|XP_008812173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        132   7e-54   Phoenix dactylifera
ref|XP_009390158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    130   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403878.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    125   6e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403877.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    125   7e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH21800.1|  NSP-interacting kinase-like protein                     124   1e-50   Medicago truncatula
ref|XP_004238998.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        125   1e-50   Solanum lycopersicum
ref|XP_004238646.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        120   3e-50   Solanum lycopersicum
ref|XP_002532890.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    124   3e-50   Ricinus communis
ref|XP_010261784.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    122   4e-50   Nelumbo nucifera [Indian lotus]
ref|XP_002455108.1|  hypothetical protein SORBIDRAFT_03g004450          123   4e-50   
ref|XP_002269902.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        122   4e-50   Vitis vinifera
emb|CAN63733.1|  hypothetical protein VITISV_025883                     122   4e-50   Vitis vinifera
ref|XP_010261776.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    122   4e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010257839.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    123   4e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010681338.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    120   4e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006348615.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    124   5e-50   
ref|XP_011070875.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    123   5e-50   Sesamum indicum [beniseed]
ref|XP_011077619.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        122   5e-50   Sesamum indicum [beniseed]
emb|CDP00520.1|  unnamed protein product                                122   6e-50   Coffea canephora [robusta coffee]
ref|XP_004968347.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    122   7e-50   Setaria italica
ref|XP_003637897.1|  Receptor-like kinase                               121   2e-49   
ref|XP_007033440.1|  NSP-interacting kinase 1                           121   2e-49   
ref|XP_009625494.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    123   2e-49   Nicotiana tomentosiformis
gb|KDP24340.1|  hypothetical protein JCGZ_25636                         120   2e-49   Jatropha curcas
dbj|BAD68255.1|  putative brassinosteroid insensitive 1-associate...    120   3e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006643812.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    120   3e-49   
gb|KEH17048.1|  NSP-interacting kinase-like protein                     120   4e-49   Medicago truncatula
gb|KDO58880.1|  hypothetical protein CISIN_1g036225mg                   121   4e-49   Citrus sinensis [apfelsine]
ref|XP_006482337.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    121   4e-49   Citrus sinensis [apfelsine]
ref|XP_006344295.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    121   4e-49   Solanum tuberosum [potatoes]
ref|XP_006430876.1|  hypothetical protein CICLE_v10011302mg             121   4e-49   Citrus clementina [clementine]
gb|KEH17047.1|  NSP-interacting kinase-like protein                     120   4e-49   Medicago truncatula
ref|XP_008797566.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    123   4e-49   Phoenix dactylifera
ref|XP_007153543.1|  hypothetical protein PHAVU_003G044400g             120   5e-49   Phaseolus vulgaris [French bean]
ref|XP_006603947.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    119   5e-49   
ref|XP_007045670.1|  LRR receptor-like serine/threonine-protein k...    122   6e-49   
ref|XP_010032589.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        119   6e-49   Eucalyptus grandis [rose gum]
gb|KHN30771.1|  Protein NSP-INTERACTING KINASE 1                        119   6e-49   Glycine soja [wild soybean]
ref|XP_003572984.2|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    121   6e-49   Brachypodium distachyon [annual false brome]
ref|XP_010236002.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    121   6e-49   Brachypodium distachyon [annual false brome]
ref|XP_004135130.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    123   6e-49   Cucumis sativus [cucumbers]
ref|XP_003555046.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    119   6e-49   Glycine max [soybeans]
ref|XP_008446507.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    122   6e-49   Cucumis melo [Oriental melon]
ref|XP_008446508.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    122   7e-49   Cucumis melo [Oriental melon]
ref|XP_006593318.1|  PREDICTED: NSP-interacting kinase isoform X2       119   7e-49   Glycine max [soybeans]
ref|XP_008446509.1|  PREDICTED: protein NSP-INTERACTING KINASE 2 ...    122   7e-49   Cucumis melo [Oriental melon]
ref|XP_008465988.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    119   8e-49   Cucumis melo [Oriental melon]
ref|XP_006593317.1|  PREDICTED: NSP-interacting kinase isoform X1       119   8e-49   Glycine max [soybeans]
ref|XP_004236956.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        120   8e-49   Solanum lycopersicum
ref|XP_007139356.1|  hypothetical protein PHAVU_008G022700g             121   8e-49   Phaseolus vulgaris [French bean]
ref|NP_001238448.1|  NSP-interacting kinase precursor                   119   8e-49   Glycine max [soybeans]
ref|XP_010091686.1|  Protein NSP-INTERACTING KINASE 2                   118   9e-49   
ref|XP_002305306.2|  hypothetical protein POPTR_0004s10790g             117   9e-49   Populus trichocarpa [western balsam poplar]
ref|XP_006384231.1|  hypothetical protein POPTR_0004s10790g             117   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_004953781.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    120   1e-48   Setaria italica
ref|XP_004490300.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    120   1e-48   Cicer arietinum [garbanzo]
ref|XP_008459453.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        118   1e-48   Cucumis melo [Oriental melon]
ref|XP_002436855.1|  hypothetical protein SORBIDRAFT_10g010010          119   1e-48   Sorghum bicolor [broomcorn]
ref|XP_004141483.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    118   1e-48   Cucumis sativus [cucumbers]
ref|XP_006301740.1|  hypothetical protein CARUB_v10022201mg             116   1e-48   
ref|XP_002886588.1|  nsp-interacting kinase 3                           115   2e-48   
gb|EEE57731.1|  hypothetical protein OsJ_08242                          120   2e-48   Oryza sativa Japonica Group [Japonica rice]
gb|EEC73926.1|  hypothetical protein OsI_08784                          120   2e-48   Oryza sativa Indica Group [Indian rice]
emb|CDP02372.1|  unnamed protein product                                119   2e-48   Coffea canephora [robusta coffee]
gb|KHN07168.1|  Protein NSP-INTERACTING KINASE 1                        118   2e-48   Glycine soja [wild soybean]
ref|XP_010942232.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    119   2e-48   Elaeis guineensis
ref|XP_006647834.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    119   2e-48   Oryza brachyantha
gb|EYU28925.1|  hypothetical protein MIMGU_mgv1a003010mg                116   2e-48   Erythranthe guttata [common monkey flower]
gb|KHN07744.1|  Protein NSP-INTERACTING KINASE 2                        118   2e-48   Glycine soja [wild soybean]
ref|XP_003517902.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    118   2e-48   Glycine max [soybeans]
ref|XP_006574993.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    118   2e-48   
emb|CDY61508.1|  BnaCnng37930D                                          115   2e-48   Brassica napus [oilseed rape]
emb|CDY44608.1|  BnaCnng11570D                                          115   2e-48   Brassica napus [oilseed rape]
ref|NP_176279.1|  NSP-interacting kinase 3                              114   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011012714.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    116   3e-48   Populus euphratica
ref|XP_011012715.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    116   3e-48   Populus euphratica
ref|XP_004507264.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    120   3e-48   Cicer arietinum [garbanzo]
ref|XP_010473259.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    115   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010418023.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    115   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010510906.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    115   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010473260.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    115   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010418025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    115   3e-48   Camelina sativa [gold-of-pleasure]
gb|KHN14464.1|  Protein NSP-INTERACTING KINASE 1                        119   4e-48   Glycine soja [wild soybean]
gb|AAB71968.1|  Putative Serine/Threonine protein kinase                114   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510907.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    115   4e-48   Camelina sativa [gold-of-pleasure]
ref|XP_011020829.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    122   4e-48   Populus euphratica
ref|XP_009765506.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    119   4e-48   Nicotiana sylvestris
gb|ABG73621.1|  leucine-rich repeat receptor-like kinase                122   4e-48   Populus tomentosa [Chinese white poplar]
ref|XP_011009019.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    122   5e-48   Populus euphratica
ref|XP_004171526.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    116   5e-48   
ref|XP_004149504.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    115   6e-48   Cucumis sativus [cucumbers]
ref|XP_008243752.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        117   6e-48   
tpg|DAA53257.1|  TPA: putative leucine-rich repeat receptor-like ...    116   6e-48   
ref|NP_001169689.1|  LOC100383570 precursor                             115   7e-48   Zea mays [maize]
gb|KJB43139.1|  hypothetical protein B456_007G186300                    117   7e-48   Gossypium raimondii
ref|XP_009356495.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    117   7e-48   Pyrus x bretschneideri [bai li]
ref|XP_002311408.2|  hypothetical protein POPTR_0008s10970g             121   9e-48   Populus trichocarpa [western balsam poplar]
ref|XP_002514536.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    121   1e-47   
gb|KJB43138.1|  hypothetical protein B456_007G186300                    117   1e-47   Gossypium raimondii
ref|XP_003531900.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    117   1e-47   Glycine max [soybeans]
ref|XP_004965216.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    116   1e-47   Setaria italica
ref|XP_008389350.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    115   1e-47   
dbj|BAK02609.1|  predicted protein                                      120   1e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011099082.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    114   1e-47   Sesamum indicum [beniseed]
ref|XP_003563960.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    117   1e-47   Brachypodium distachyon [annual false brome]
ref|XP_010492459.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    115   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_008339771.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    115   1e-47   
ref|XP_011099081.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    114   1e-47   Sesamum indicum [beniseed]
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    115   1e-47   Elaeis guineensis
ref|XP_010230510.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    119   1e-47   
dbj|BAJ89901.1|  predicted protein                                      117   1e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008807033.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    115   1e-47   Phoenix dactylifera
ref|XP_003569325.2|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    119   1e-47   Brachypodium distachyon [annual false brome]
ref|XP_010230509.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    119   2e-47   Brachypodium distachyon [annual false brome]
ref|XP_010230511.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    118   2e-47   
ref|XP_004297175.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        115   2e-47   Fragaria vesca subsp. vesca
ref|XP_006287253.1|  hypothetical protein CARUB_v10000442mg             114   2e-47   Capsella rubella
ref|XP_010453748.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        114   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_004232118.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        114   2e-47   Solanum lycopersicum
ref|NP_001140727.1|  uncharacterized LOC100272802                       114   2e-47   
ref|XP_011011496.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    120   2e-47   Populus euphratica
ref|XP_006400129.1|  hypothetical protein EUTSA_v10012948mg             114   2e-47   Eutrema salsugineum [saltwater cress]
ref|XP_007221991.1|  hypothetical protein PRUPE_ppa002873mg             114   2e-47   Prunus persica
ref|XP_011021146.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    115   3e-47   Populus euphratica
ref|XP_006373507.1|  hypothetical protein POPTR_0017s14360g             115   3e-47   
ref|XP_011021148.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    115   3e-47   Populus euphratica
gb|KEH25223.1|  NSP-interacting kinase-like protein                     115   3e-47   Medicago truncatula
ref|XP_006392114.1|  hypothetical protein EUTSA_v10023342mg             111   4e-47   Eutrema salsugineum [saltwater cress]
gb|KDO70180.1|  hypothetical protein CISIN_1g007025mg                   117   4e-47   Citrus sinensis [apfelsine]
gb|AFO67891.1|  leucine-rich repeat receptor-like kinase                111   4e-47   Brassica rapa subsp. oleifera [biennial turnip rape]
emb|CDY46185.1|  BnaA01g23070D                                          111   4e-47   Brassica napus [oilseed rape]
ref|XP_004304172.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        118   4e-47   Fragaria vesca subsp. vesca
gb|EYU44266.1|  hypothetical protein MIMGU_mgv1a002951mg                116   4e-47   Erythranthe guttata [common monkey flower]
ref|XP_010528022.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        117   4e-47   Tarenaya hassleriana [spider flower]
gb|KDO70181.1|  hypothetical protein CISIN_1g007025mg                   117   4e-47   Citrus sinensis [apfelsine]
ref|XP_009104025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    111   5e-47   Brassica rapa
ref|XP_009104018.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    111   5e-47   Brassica rapa
emb|CDY61461.1|  BnaC01g43240D                                          111   5e-47   Brassica napus [oilseed rape]
ref|XP_010929457.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    117   5e-47   Elaeis guineensis
ref|XP_006484307.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    117   6e-47   Citrus sinensis [apfelsine]
ref|XP_006437790.1|  hypothetical protein CICLE_v10030970mg             117   6e-47   Citrus clementina [clementine]
gb|ABD96908.1|  hypothetical protein                                    111   7e-47   Tarenaya spinosa
ref|XP_004491764.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    112   7e-47   Cicer arietinum [garbanzo]
ref|XP_002452616.1|  hypothetical protein SORBIDRAFT_04g029170          114   8e-47   Sorghum bicolor [broomcorn]
ref|XP_010558545.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    111   9e-47   Tarenaya hassleriana [spider flower]
gb|AHF18212.1|  brassinosteroid insensitive 1-associated receptor...    114   9e-47   Saccharum hybrid cultivar [sugarcane]
ref|XP_009803320.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    114   1e-46   Nicotiana sylvestris
ref|XP_009131513.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        113   1e-46   Brassica rapa
ref|XP_009803321.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    114   1e-46   Nicotiana sylvestris
ref|XP_009396215.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    121   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008783060.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    114   1e-46   Phoenix dactylifera
ref|XP_010549936.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        114   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_009803965.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    111   2e-46   Nicotiana sylvestris
ref|XP_009803966.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    111   2e-46   Nicotiana sylvestris
ref|XP_009596696.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    111   2e-46   Nicotiana tomentosiformis
ref|XP_009596697.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    111   3e-46   Nicotiana tomentosiformis
ref|XP_010533910.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        110   4e-46   Tarenaya hassleriana [spider flower]
ref|XP_006380012.1|  hypothetical protein POPTR_0008s19310g             152   4e-46   
ref|NP_001146634.1|  uncharacterized LOC100280233 precursor             112   4e-46   Zea mays [maize]
ref|XP_002312685.1|  leucine-rich repeat family protein                 152   4e-46   
ref|XP_006290715.1|  hypothetical protein CARUB_v10016813mg             112   5e-46   Capsella rubella
gb|EPS73511.1|  hypothetical protein M569_01245                         105   5e-46   Genlisea aurea
ref|XP_010502426.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        112   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006395648.1|  hypothetical protein EUTSA_v10003811mg             112   6e-46   Eutrema salsugineum [saltwater cress]
dbj|BAB01326.1|  receptor-like kinase                                   112   7e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525400.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    152   8e-46   
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    109   9e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002876917.1|  nsp-interacting kinase 2                           111   9e-46   
gb|KFK39862.1|  hypothetical protein AALP_AA3G298400                    113   9e-46   Arabis alpina [alpine rockcress]
gb|KDP26621.1|  hypothetical protein JCGZ_17779                         151   1e-45   Jatropha curcas
ref|XP_007044709.1|  Nsp-interacting kinase 3 isoform 2                 151   1e-45   
ref|XP_008658828.1|  PREDICTED: uncharacterized LOC100382590 isof...    115   2e-45   
gb|AFW86330.1|  putative leucine-rich repeat receptor-like protei...    115   2e-45   
ref|NP_001168791.1|  uncharacterized LOC100382590                       115   2e-45   Zea mays [maize]
gb|ACN30679.1|  unknown                                                 115   2e-45   Zea mays [maize]
ref|XP_008658830.1|  PREDICTED: uncharacterized LOC100382590 isof...    115   2e-45   
ref|XP_009417562.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    113   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009152132.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    109   3e-45   Brassica rapa
emb|CDX83534.1|  BnaC07g22740D                                          109   3e-45   
emb|CDY48073.1|  BnaA06g33550D                                          109   4e-45   Brassica napus [oilseed rape]
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    110   5e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    110   5e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    110   6e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP31451.1|  hypothetical protein JCGZ_11827                         119   9e-45   Jatropha curcas
ref|XP_010044332.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        113   3e-44   Eucalyptus grandis [rose gum]
gb|KCW86687.1|  hypothetical protein EUGRSUZ_B03306                     104   4e-44   Eucalyptus grandis [rose gum]
ref|XP_010044599.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    103   6e-44   Eucalyptus grandis [rose gum]
ref|XP_010044598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    103   8e-44   
ref|XP_010044597.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    103   8e-44   
ref|XP_010044594.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    103   9e-44   Eucalyptus grandis [rose gum]
ref|XP_010044596.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    103   9e-44   
ref|XP_010044595.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    103   9e-44   
emb|CDX69484.1|  BnaA10g18330D                                          108   1e-43   
gb|AFO67892.1|  leucine-rich repeat receptor-like kinase                107   1e-43   Brassica rapa subsp. oleifera [biennial turnip rape]
gb|KJB60823.1|  hypothetical protein B456_009G327400                    108   2e-43   Gossypium raimondii
ref|XP_009121529.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        107   2e-43   Brassica rapa
gb|AFW76897.1|  putative leucine-rich repeat receptor-like protei...    100   9e-43   
ref|XP_010100900.1|  Protein NSP-INTERACTING KINASE 1                 94.7    1e-42   
ref|NP_001147975.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    100   1e-42   Zea mays [maize]
emb|CDY26481.1|  BnaC09g41870D                                          104   1e-42   Brassica napus [oilseed rape]
ref|XP_008647815.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    100   1e-42   Zea mays [maize]
gb|AFW76893.1|  putative leucine-rich repeat receptor-like protei...    100   2e-42   
gb|ADD60669.1|  putative somatic embryogenesis protein kinase 1         100   4e-42   Oryza meyeriana var. granulata
ref|XP_009400102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    102   9e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009400110.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    102   9e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB61045.1|  hypothetical protein B456_009G337000                    136   3e-41   Gossypium raimondii
gb|KJB61041.1|  hypothetical protein B456_009G337000                    136   3e-41   Gossypium raimondii
dbj|BAF79962.1|  receptor-like kinase                                   101   5e-41   Marchantia polymorpha
gb|ADD60706.1|  putative somatic embryogenesis protein kinase 1       99.0    8e-41   Oryza brachyantha
ref|XP_010914291.1|  PREDICTED: probable LRR receptor-like serine...  89.7    7e-40   
ref|XP_002965655.1|  hypothetical protein SELMODRAFT_167872             103   2e-39   
ref|XP_002971685.1|  hypothetical protein SELMODRAFT_172211             103   2e-39   
ref|XP_009394555.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  94.0    2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006845438.1|  hypothetical protein AMTR_s00019p00103320        83.2    1e-38   Amborella trichopoda
ref|XP_008664633.1|  PREDICTED: probable LRR receptor-like serine...  92.4    2e-38   Zea mays [maize]
ref|XP_008781387.1|  PREDICTED: probable LRR receptor-like serine...  85.5    2e-38   Phoenix dactylifera
ref|XP_008664636.1|  PREDICTED: probable LRR receptor-like serine...  92.8    2e-38   Zea mays [maize]
ref|XP_009390157.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    130   2e-38   
ref|XP_008664634.1|  PREDICTED: probable LRR receptor-like serine...  92.4    3e-38   Zea mays [maize]
ref|XP_008664637.1|  PREDICTED: probable LRR receptor-like serine...  92.8    3e-38   Zea mays [maize]
ref|XP_010277987.1|  PREDICTED: probable LRR receptor-like serine...  87.0    3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010277988.1|  PREDICTED: probable LRR receptor-like serine...  87.0    3e-38   
ref|XP_008664635.1|  PREDICTED: probable LRR receptor-like serine...  92.8    4e-38   
dbj|BAD10033.1|  somatic embryogenesis receptor kinase-like protein   90.5    9e-38   
ref|XP_010268431.1|  PREDICTED: probable LRR receptor-like serine...  86.7    1e-37   
ref|NP_001061919.1|  Os08g0442700                                     90.9    1e-37   
gb|EAZ42894.1|  hypothetical protein OsJ_27488                        88.6    1e-37   
ref|XP_006844161.1|  hypothetical protein AMTR_s00006p00261510          129   1e-37   
ref|XP_010047875.1|  PREDICTED: probable LRR receptor-like serine...  87.4    1e-37   
ref|XP_008664639.1|  PREDICTED: probable LRR receptor-like serine...  93.2    1e-37   
gb|EAZ07144.1|  hypothetical protein OsI_29394                        89.0    1e-37   
ref|XP_006659455.1|  PREDICTED: probable LRR receptor-like serine...  91.7    2e-37   
dbj|BAJ91470.1|  predicted protein                                    94.0    2e-37   
ref|XP_002325107.1|  leucine-rich repeat family protein               87.4    3e-37   
ref|XP_004973571.1|  PREDICTED: probable LRR receptor-like serine...  92.8    4e-37   
gb|EPS59992.1|  hypothetical protein M569_14812                       92.4    5e-37   
ref|XP_011018089.1|  PREDICTED: probable LRR receptor-like serine...  86.7    5e-37   
ref|XP_009345903.1|  PREDICTED: probable LRR receptor-like serine...  85.1    5e-37   
ref|XP_009360005.1|  PREDICTED: probable LRR receptor-like serine...  84.7    7e-37   
ref|XP_011462643.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  85.9    7e-37   
ref|XP_011033358.1|  PREDICTED: probable LRR receptor-like serine...  85.9    7e-37   
ref|XP_007013912.1|  Leucine-rich repeat protein kinase family pr...  87.0    1e-36   
ref|XP_007225632.1|  hypothetical protein PRUPE_ppa003371mg           85.9    1e-36   
emb|CDP02874.1|  unnamed protein product                              84.7    2e-36   
ref|XP_008223590.1|  PREDICTED: probable LRR receptor-like serine...  85.5    2e-36   
ref|XP_010235160.1|  PREDICTED: probable LRR receptor-like serine...  91.3    2e-36   
ref|XP_002309372.1|  leucine-rich repeat family protein               84.0    2e-36   
ref|XP_004242632.1|  PREDICTED: probable LRR receptor-like serine...  85.5    2e-36   
ref|XP_009611184.1|  PREDICTED: probable LRR receptor-like serine...  85.5    2e-36   
ref|XP_011069822.1|  PREDICTED: probable LRR receptor-like serine...  82.0    3e-36   
ref|XP_006343723.1|  PREDICTED: probable LRR receptor-like serine...  85.1    3e-36   
ref|XP_009796362.1|  PREDICTED: probable LRR receptor-like serine...  85.1    3e-36   
ref|XP_001785606.1|  predicted protein                                92.0    3e-36   
ref|XP_002445573.1|  hypothetical protein SORBIDRAFT_07g021820        90.9    4e-36   
gb|KDP38737.1|  hypothetical protein JCGZ_04090                       82.4    5e-36   
gb|EYU37129.1|  hypothetical protein MIMGU_mgv1a003448mg              85.9    5e-36   
ref|XP_008359493.1|  PREDICTED: probable LRR receptor-like serine...  82.0    5e-36   
ref|XP_003633168.1|  PREDICTED: probable LRR receptor-like serine...  82.0    5e-36   
ref|XP_009390537.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  92.0    5e-36   
emb|CAN63294.1|  hypothetical protein VITISV_040285                   81.3    8e-36   
gb|KCW86693.1|  hypothetical protein EUGRSUZ_B03306                   77.0    9e-36   
gb|KCW86692.1|  hypothetical protein EUGRSUZ_B03306                   77.0    9e-36   
gb|KCW86691.1|  hypothetical protein EUGRSUZ_B03306                   76.6    1e-35   
gb|KCW86690.1|  hypothetical protein EUGRSUZ_B03306                   77.0    1e-35   
ref|XP_002976976.1|  hypothetical protein SELMODRAFT_443356           94.7    1e-35   
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                   77.0    1e-35   
ref|XP_006453537.1|  hypothetical protein CICLE_v10007718mg           81.3    1e-35   
ref|XP_006474063.1|  PREDICTED: probable LRR receptor-like serine...  81.3    1e-35   
ref|XP_002980714.1|  hypothetical protein SELMODRAFT_444590           94.7    1e-35   
gb|KDO62317.1|  hypothetical protein CISIN_1g039819mg                 80.9    1e-35   
ref|XP_001756895.1|  predicted protein                                92.0    2e-35   
ref|XP_009417455.1|  PREDICTED: probable LRR receptor-like serine...  84.3    2e-35   
ref|XP_008647814.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  76.3    2e-35   
ref|XP_010108365.1|  putative LRR receptor-like serine/threonine-...  80.5    2e-35   
ref|XP_003518230.1|  PREDICTED: probable LRR receptor-like serine...  80.9    3e-35   
gb|KHN30285.1|  Putative LRR receptor-like serine/threonine-prote...  80.5    3e-35   
gb|AAC63680.1|  putative LRR receptor protein kinase                  81.3    3e-35   
ref|NP_179973.2|  leucine-rich repeat protein kinase family protein   80.9    4e-35   
ref|NP_001042146.2|  Os01g0171000                                       120   4e-35   
gb|KHG07759.1|  hypothetical protein F383_34545                       82.0    5e-35   
ref|XP_001763339.1|  predicted protein                                88.6    5e-35   
ref|XP_011079354.1|  PREDICTED: probable LRR receptor-like serine...  76.6    5e-35   
ref|XP_006605000.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    119   7e-35   
emb|CBI16897.3|  unnamed protein product                                120   8e-35   
ref|XP_002278965.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        120   8e-35   
gb|KFK32690.1|  hypothetical protein AALP_AA6G276300                  79.3    8e-35   
dbj|BAF79935.1|  receptor-like kinase                                 89.4    8e-35   
gb|KJB76635.1|  hypothetical protein B456_012G097800                  80.9    9e-35   
gb|AIA99455.1|  putative somatic embryogenesis receptor kinase        89.4    9e-35   
ref|XP_002880534.1|  leucine-rich repeat family protein               79.3    1e-34   
gb|KJB76637.1|  hypothetical protein B456_012G097800                  80.5    1e-34   
gb|KJB76636.1|  hypothetical protein B456_012G097800                  80.5    1e-34   
emb|CDY65182.1|  BnaC04g56200D                                        79.3    2e-34   
ref|XP_007154851.1|  hypothetical protein PHAVU_003G152900g           78.2    2e-34   
ref|XP_010417134.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-34   
gb|ACZ56417.1|  somatic embryogenesis receptor-like kinase 1          90.5    2e-34   
gb|KJB53859.1|  hypothetical protein B456_009G008400                  80.5    2e-34   
emb|CDY39685.1|  BnaA04g14020D                                        79.3    2e-34   
ref|XP_009140509.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-34   
ref|XP_006659883.1|  PREDICTED: somatic embryogenesis receptor ki...  86.7    2e-34   
ref|XP_010429349.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-34   
ref|XP_010472390.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-34   
emb|CDX72249.1|  BnaC07g42710D                                        77.8    2e-34   
gb|AGS80343.1|  somatic embryogenesis receptor kinase 1               90.1    2e-34   
gb|ACY91853.1|  somatic embryogenesis receptor-like kinase 1          90.5    2e-34   
ref|XP_009137929.1|  PREDICTED: probable LRR receptor-like serine...  77.8    2e-34   
ref|XP_008443821.1|  PREDICTED: probable LRR receptor-like serine...  77.8    2e-34   
ref|XP_001767678.1|  predicted protein                                87.8    2e-34   
gb|KFK29623.1|  hypothetical protein AALP_AA7G158000                  76.6    3e-34   
ref|XP_004146714.1|  PREDICTED: probable LRR receptor-like serine...  77.4    3e-34   
ref|XP_006295562.1|  hypothetical protein CARUB_v10024669mg           79.0    3e-34   
ref|XP_010548642.1|  PREDICTED: probable LRR receptor-like serine...  79.3    3e-34   
ref|XP_003552626.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    120   4e-34   
ref|XP_008379484.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    116   4e-34   
gb|KHN13790.1|  Protein NSP-INTERACTING KINASE 1                        120   4e-34   
gb|EMT30099.1|  Putative LRR receptor-like serine/threonine-prote...    120   4e-34   
ref|XP_004975833.1|  PREDICTED: somatic embryogenesis receptor ki...  89.0    5e-34   
ref|XP_006584457.1|  PREDICTED: somatic embryogenesis receptor-li...  89.4    5e-34   
dbj|BAF79961.1|  receptor-like kinase                                 91.7    5e-34   
ref|XP_003547599.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  89.4    5e-34   
ref|NP_001237909.1|  somatic embryogenesis receptor-like kinase-l...  89.7    5e-34   
ref|XP_009409904.1|  PREDICTED: somatic embryogenesis receptor ki...  88.6    6e-34   
ref|XP_009409903.1|  PREDICTED: somatic embryogenesis receptor ki...  88.6    6e-34   
gb|KHN33505.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...  89.4    6e-34   
ref|XP_009409905.1|  PREDICTED: somatic embryogenesis receptor ki...  88.6    6e-34   
ref|XP_006282454.1|  hypothetical protein CARUB_v10004330mg           78.2    7e-34   
gb|AHI59639.1|  somatic embryogenesis receptor-like kinase            88.2    7e-34   
ref|XP_007148432.1|  hypothetical protein PHAVU_006G208100g           88.6    7e-34   
ref|XP_006404888.1|  hypothetical protein EUTSA_v10000081mg           77.0    7e-34   
ref|XP_003571417.1|  PREDICTED: somatic embryogenesis receptor ki...  88.2    8e-34   
gb|EMS65008.1|  Somatic embryogenesis receptor kinase 2               88.2    9e-34   
gb|KHG18235.1|  hypothetical protein F383_07279                       78.2    9e-34   
emb|CAM31941.1|  hypothetical protein                                   116   9e-34   
ref|XP_010059023.1|  PREDICTED: probable LRR receptor-like serine...  72.4    9e-34   
gb|EPS63998.1|  somatic embryogenesis receptor-like kinase 1          87.4    1e-33   
ref|XP_009378313.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    116   1e-33   
emb|CDX72833.1|  BnaC06g32810D                                        87.4    1e-33   
gb|EEC82980.1|  hypothetical protein OsI_28003                        87.4    1e-33   
ref|XP_002867342.1|  predicted protein                                76.3    1e-33   
ref|NP_001061108.1|  Os08g0174700                                     87.4    1e-33   
ref|XP_010274431.1|  PREDICTED: probable LRR receptor-like serine...  71.6    1e-33   
ref|NP_197104.1|  NSP-interacting kinase 1                              115   1e-33   
gb|AAM65586.1|  receptor protein kinase-like protein                    115   1e-33   
ref|XP_007151443.1|  hypothetical protein PHAVU_004G046800g             116   1e-33   
gb|AFW62720.1|  putative leucine-rich repeat receptor-like protei...  86.3    1e-33   
gb|AFO67896.1|  leucine-rich repeat receptor-like kinase              87.4    1e-33   
gb|KHN17525.1|  Putative LRR receptor-like serine/threonine-prote...  75.1    1e-33   
ref|XP_010525766.1|  PREDICTED: probable LRR receptor-like serine...  75.1    1e-33   
ref|XP_009105842.1|  PREDICTED: somatic embryogenesis receptor ki...  87.4    1e-33   
ref|XP_003549524.2|  PREDICTED: probable LRR receptor-like serine...  75.1    1e-33   
gb|AAR26543.1|  benzothiadiazole-induced somatic embryogenesis re...  87.4    1e-33   
gb|EYU36529.1|  hypothetical protein MIMGU_mgv1a002850mg              87.0    2e-33   
emb|CDY36679.1|  BnaCnng07810D                                        87.0    2e-33   
ref|XP_009104891.1|  PREDICTED: somatic embryogenesis receptor ki...  87.0    2e-33   
ref|NP_001052975.1|  Os04g0457800                                     87.0    2e-33   
gb|AAU88198.1|  somatic embryogenesis protein kinase 1                87.0    2e-33   
emb|CDX68299.1|  BnaA07g23390D                                        84.7    2e-33   
ref|XP_009373732.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    114   2e-33   
ref|XP_004972726.1|  PREDICTED: somatic embryogenesis receptor ki...  87.0    2e-33   
gb|KJB80538.1|  hypothetical protein B456_013G102600                    120   2e-33   
gb|KHG05227.1|  nsp-interacting kinase 2 -like protein                  120   2e-33   
ref|XP_008341829.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    114   2e-33   
gb|KHN00710.1|  Somatic embryogenesis receptor kinase 1               82.8    2e-33   
ref|NP_194781.2|  senescence-associated receptor-like kinase          76.3    2e-33   
ref|XP_003610256.1|  Somatic embryogenesis receptor-like kinase       75.5    2e-33   
ref|XP_010937037.1|  PREDICTED: somatic embryogenesis receptor ki...  87.0    2e-33   
ref|XP_010438169.1|  PREDICTED: probable LRR receptor-like serine...  76.3    2e-33   
ref|XP_010939572.1|  PREDICTED: somatic embryogenesis receptor ki...  86.3    2e-33   
gb|ABO14173.1|  somatic embryogenesis receptor-like kinase 1          85.5    2e-33   
ref|XP_010432978.1|  PREDICTED: probable LRR receptor-like serine...  76.3    2e-33   
dbj|BAK05837.1|  predicted protein                                    86.7    2e-33   
ref|XP_006300879.1|  hypothetical protein CARUB_v10019969mg           86.3    3e-33   
ref|XP_010447704.1|  PREDICTED: probable LRR receptor-like serine...  76.3    3e-33   
ref|XP_010471192.1|  PREDICTED: somatic embryogenesis receptor ki...  86.3    3e-33   
ref|XP_010428030.1|  PREDICTED: somatic embryogenesis receptor ki...  86.3    3e-33   
ref|XP_010415894.1|  PREDICTED: somatic embryogenesis receptor ki...  86.3    3e-33   
gb|EYU43606.1|  hypothetical protein MIMGU_mgv1a021039mg              85.9    3e-33   
ref|XP_008807034.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    116   3e-33   
emb|CAB79770.1|  receptor-like kinase homolog                         76.3    3e-33   
dbj|BAK03316.1|  predicted protein                                    85.9    3e-33   
gb|AAK82463.1|  At1g71830/F14O23_24                                   85.9    3e-33   
ref|NP_177328.1|  somatic embryogenesis receptor kinase 1             85.9    3e-33   
ref|XP_010530140.1|  PREDICTED: somatic embryogenesis receptor ki...  85.9    3e-33   
ref|XP_008230341.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        115   3e-33   
ref|XP_002276414.2|  PREDICTED: somatic embryogenesis receptor ki...  85.9    3e-33   
emb|CDP01160.1|  unnamed protein product                              85.5    3e-33   
ref|NP_001233866.1|  somatic embryogenesis receptor kinase 1          85.5    3e-33   
gb|AAF43236.1|AC012654_20  Contains similarity to the somatic emb...  85.9    4e-33   
ref|XP_009387847.1|  PREDICTED: somatic embryogenesis receptor ki...  85.9    4e-33   
ref|NP_001275293.1|  somatic embryogenesis receptor-like kinase 1     85.5    4e-33   
ref|NP_001105133.1|  somatic embryogenesis receptor-like kinase2 ...  85.9    4e-33   
ref|XP_010927979.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    116   4e-33   
gb|ABR18800.1|  somatic embryogenesis receptor-like kinase 1          85.5    4e-33   
gb|ACL53442.1|  unknown                                               85.9    4e-33   
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    116   4e-33   
emb|CAC37641.1|  somatic embryogenesis receptor-like kinase 2         85.9    4e-33   
ref|XP_002978309.1|  hypothetical protein SELMODRAFT_268158           83.6    4e-33   
gb|KDP35227.1|  hypothetical protein JCGZ_09386                       85.5    4e-33   
gb|AEC46975.1|  somatic embryogenesis receptor-like kinase            85.5    4e-33   
ref|XP_008678722.1|  PREDICTED: somatic embryogenesis receptor ki...  85.5    4e-33   
ref|XP_003579889.1|  PREDICTED: somatic embryogenesis receptor ki...  85.5    4e-33   
ref|XP_010543171.1|  PREDICTED: somatic embryogenesis receptor ki...  85.5    5e-33   
gb|ACT22809.1|  somatic embryogenesis receptor kinase-1               85.5    5e-33   
ref|XP_002447957.1|  hypothetical protein SORBIDRAFT_06g018760        85.5    5e-33   
ref|XP_008809509.1|  PREDICTED: somatic embryogenesis receptor ki...  85.5    5e-33   
gb|AFX61784.1|  somatic embryogenesis receptor-like kinase            85.5    5e-33   
ref|XP_008662792.1|  PREDICTED: somatic embryogenesis receptor ki...  86.7    5e-33   
ref|XP_002454054.1|  hypothetical protein SORBIDRAFT_04g023810        85.5    5e-33   
ref|XP_002966264.1|  hypothetical protein SELMODRAFT_85471            83.6    5e-33   
ref|XP_010274437.1|  PREDICTED: probable LRR receptor-like serine...  69.3    5e-33   
ref|XP_006653479.1|  PREDICTED: somatic embryogenesis receptor ki...  85.1    5e-33   
ref|XP_008809508.1|  PREDICTED: somatic embryogenesis receptor ki...  85.5    6e-33   
ref|XP_010274432.1|  PREDICTED: probable LRR receptor-like serine...  69.3    6e-33   
ref|XP_004496399.1|  PREDICTED: somatic embryogenesis receptor ki...  85.5    6e-33   
ref|XP_006390738.1|  hypothetical protein EUTSA_v10019435mg           85.1    6e-33   
gb|KFK41603.1|  hypothetical protein AALP_AA2G149900                  86.3    6e-33   
ref|NP_174683.1|  somatic embryogenesis receptor kinase 2             85.1    6e-33   
gb|AAK68073.1|AF384969_1  somatic embryogenesis receptor-like kin...  85.1    6e-33   
ref|XP_010274433.1|  PREDICTED: probable LRR receptor-like serine...  69.3    6e-33   
gb|AET86626.2|  somatic embryogenesis receptor kinase 1               85.5    6e-33   
gb|ADT91694.1|  somatic embryogenesis receptor-like kinase 1          84.7    6e-33   
ref|XP_010692604.1|  PREDICTED: somatic embryogenesis receptor ki...  85.1    6e-33   
ref|XP_010274436.1|  PREDICTED: probable LRR receptor-like serine...  69.3    6e-33   
ref|XP_010274434.1|  PREDICTED: probable LRR receptor-like serine...  69.3    6e-33   
ref|XP_008654537.1|  PREDICTED: uncharacterized LOC100272802 isof...    114   7e-33   
ref|XP_002887392.1|  hypothetical protein ARALYDRAFT_895025           84.7    7e-33   
ref|XP_010063799.1|  PREDICTED: somatic embryogenesis receptor ki...  85.1    7e-33   
ref|XP_002270847.1|  PREDICTED: somatic embryogenesis receptor ki...  85.1    7e-33   
ref|XP_009339058.1|  PREDICTED: somatic embryogenesis receptor ki...  84.3    7e-33   
ref|XP_010274435.1|  PREDICTED: probable LRR receptor-like serine...  69.3    7e-33   
dbj|BAD32780.1|  somatic embryogenesis receptor kinase 1              84.3    8e-33   
ref|XP_009773846.1|  PREDICTED: somatic embryogenesis receptor ki...  84.3    8e-33   
ref|XP_002326014.1|  somatic embryogenesis receptor-like kinase 2...  84.7    8e-33   
ref|XP_008366148.1|  PREDICTED: somatic embryogenesis receptor ki...  84.7    8e-33   
ref|XP_006827082.1|  hypothetical protein AMTR_s00010p00238570        84.7    8e-33   
ref|NP_001275800.1|  somatic embryogenesis receptor-like kinase p...  84.3    8e-33   
ref|XP_008245841.1|  PREDICTED: somatic embryogenesis receptor ki...  84.3    8e-33   
gb|EMT31112.1|  Somatic embryogenesis receptor kinase 2               85.1    8e-33   
ref|XP_010245869.1|  PREDICTED: somatic embryogenesis receptor ki...  84.7    8e-33   
ref|XP_009339751.1|  PREDICTED: somatic embryogenesis receptor ki...  84.3    8e-33   
ref|XP_007020220.1|  Somatic embryogenesis receptor-like kinase 2...  84.3    9e-33   
ref|XP_007213585.1|  hypothetical protein PRUPE_ppa003046mg           68.9    9e-33   



>dbj|BAD18097.1| putative serine/threonine protein kinase [Ipomoea batatas]
Length=232

 Score =   169 bits (429),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 80/81 (99%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPR+RTHENTPQR
Sbjct  152  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRYRTHENTPQR  211

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSLIVEAMELSGPR
Sbjct  212  YSDFIEESSLIVEAMELSGPR  232


 Score = 70.1 bits (170),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  66   SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  98


 Score = 64.7 bits (156),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKAVDFGRGANQKGVILDW
Sbjct  98   FGILLLELITGQKAVDFGRGANQKGVILDW  127



>dbj|BAD18102.1| leucine-rich repeat receptor-like kinase [Ipomoea batatas]
Length=627

 Score =   169 bits (428),  Expect(3) = 6e-67, Method: Compositional matrix adjust.
 Identities = 80/81 (99%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPR+RTHENTPQR
Sbjct  547  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRYRTHENTPQR  606

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSLIVEAMELSGPR
Sbjct  607  YSDFIEESSLIVEAMELSGPR  627


 Score = 69.7 bits (169),  Expect(3) = 6e-67, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  461  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  493


 Score = 64.3 bits (155),  Expect(3) = 6e-67, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKAVDFGRGANQKGVILDW
Sbjct  493  FGILLLELITGQKAVDFGRGANQKGVILDW  522



>ref|XP_009800027.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana sylvestris]
Length=626

 Score =   151 bits (382),  Expect(3) = 4e-61, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCT F+PSHRPKMSEVLRMLEGDGLAEKWEASQ+ +TPR+RT ENTP+R
Sbjct  546  IELEEMVQVALLCTHFSPSHRPKMSEVLRMLEGDGLAEKWEASQKVETPRYRTSENTPKR  605

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSL+VEAMELSGPR
Sbjct  606  YSDYIEESSLVVEAMELSGPR  626


 Score = 68.6 bits (166),  Expect(3) = 4e-61, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 63.2 bits (152),  Expect(3) = 4e-61, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKAVDFGRGANQKGV+LDW
Sbjct  492  FGILLLELITGQKAVDFGRGANQKGVMLDW  521



>ref|XP_009626005.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana tomentosiformis]
Length=626

 Score =   151 bits (382),  Expect(3) = 6e-61, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCT F+PSHRPKMSEVLRMLEGDGLAEKWEASQ+ +TPR+RT ENTP+R
Sbjct  546  IELEEMVQVALLCTHFSPSHRPKMSEVLRMLEGDGLAEKWEASQKVETPRYRTSENTPKR  605

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSL+VEAMELSGPR
Sbjct  606  YSDYIEESSLVVEAMELSGPR  626


 Score = 68.6 bits (166),  Expect(3) = 6e-61, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 63.2 bits (152),  Expect(3) = 6e-61, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKAVDFGRGANQKGV+LDW
Sbjct  492  FGILLLELITGQKAVDFGRGANQKGVMLDW  521



>ref|XP_002315684.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|EEF01855.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=628

 Score =   153 bits (387),  Expect(3) = 1e-60, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQR +TPRFR+ EN PQR
Sbjct  548  IELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQRVETPRFRSCENPPQR  607

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSL+VEAMELSGPR
Sbjct  608  YSDYIEESSLVVEAMELSGPR  628


 Score = 68.9 bits (167),  Expect(3) = 1e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  462  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  494


 Score = 59.3 bits (142),  Expect(3) = 1e-60, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLEL+TGQKA+DFGR ANQKGV+LDW
Sbjct  494  FGILLLELVTGQKALDFGRAANQKGVMLDW  523



>ref|XP_006378225.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|ERP56022.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=624

 Score =   153 bits (387),  Expect(3) = 1e-60, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQR +TPRFR+ EN PQR
Sbjct  544  IELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQRVETPRFRSCENPPQR  603

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSL+VEAMELSGPR
Sbjct  604  YSDYIEESSLVVEAMELSGPR  624


 Score = 68.9 bits (167),  Expect(3) = 1e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  458  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  490


 Score = 59.3 bits (142),  Expect(3) = 1e-60, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLEL+TGQKA+DFGR ANQKGV+LDW
Sbjct  490  FGILLLELVTGQKALDFGRAANQKGVMLDW  519



>ref|XP_007044708.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY00540.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   152 bits (384),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRP+MSEVLRMLEGDGLAEKWEASQ+ +TPRFR+ +N PQR
Sbjct  546  IELEEMVQVALLCTQFNPSHRPRMSEVLRMLEGDGLAEKWEASQKVETPRFRSCDNPPQR  605

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL++EAMELSGPR
Sbjct  606  YSDFIEESSLVIEAMELSGPR  626


 Score = 68.9 bits (167),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 59.7 bits (143),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  492  FGILLLELITGQKALDFGRAANQKGVMLDW  521



>ref|XP_011086598.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Sesamum indicum]
Length=625

 Score =   149 bits (376),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWE SQ  +TPR+R+ E+ PQR
Sbjct  545  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEQSQNIETPRYRSFEHPPQR  604

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL+VEAMELSGPR
Sbjct  605  YSDFIEESSLVVEAMELSGPR  625


 Score = 68.9 bits (167),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 62.8 bits (151),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKAVDFGRG NQKGVILDW
Sbjct  491  FGILLLELITGQKAVDFGRGTNQKGVILDW  520



>ref|XP_011045286.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Populus euphratica]
Length=452

 Score =   153 bits (386),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQR +TPRFR+ EN PQR
Sbjct  372  IELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQRVETPRFRSCENPPQR  431

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSL+VEAMELSGPR
Sbjct  432  YSDYIEESSLVVEAMELSGPR  452


 Score = 68.2 bits (165),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGF
Sbjct  286  SHVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGF  318


 Score = 59.3 bits (142),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  318  FGILLLELITGQKALDFGRAANQKGVMLDW  347



>ref|XP_010651607.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Vitis vinifera]
 emb|CBI28568.3| unnamed protein product [Vitis vinifera]
Length=626

 Score =   151 bits (382),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMV+VALLCTQFNPSHRPKMSE+LRMLEGDGLAEKWEASQ+ +TPRFR+ EN PQR
Sbjct  546  VELEEMVKVALLCTQFNPSHRPKMSEILRMLEGDGLAEKWEASQKVETPRFRSCENPPQR  605

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSL++EAMELSGPR
Sbjct  606  YSDYIEESSLVIEAMELSGPR  626


 Score = 69.3 bits (168),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 59.7 bits (143),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  492  FGILLLELITGQKALDFGRAANQKGVMLDW  521



>emb|CAN75190.1| hypothetical protein VITISV_035381 [Vitis vinifera]
Length=608

 Score =   151 bits (382),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMV+VALLCTQFNPSHRPKMSE+LRMLEGDGLAEKWEASQ+ +TPRFR+ EN PQR
Sbjct  528  VELEEMVKVALLCTQFNPSHRPKMSEILRMLEGDGLAEKWEASQKVETPRFRSCENPPQR  587

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSL++EAMELSGPR
Sbjct  588  YSDYIEESSLVIEAMELSGPR  608


 Score = 69.3 bits (168),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  442  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  474


 Score = 59.7 bits (143),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  474  FGILLLELITGQKALDFGRAANQKGVMLDW  503



>ref|XP_006366916.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Solanum tuberosum]
Length=622

 Score =   149 bits (375),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQF P++RPKMSEVLRMLEGDGLAEKWEASQ+ +TPR+RT ENTP+R
Sbjct  542  IELEEMVQVALLCTQFIPTYRPKMSEVLRMLEGDGLAEKWEASQKVETPRYRTSENTPKR  601

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSL+VEAMELSGPR
Sbjct  602  YSDYIEESSLVVEAMELSGPR  622


 Score = 68.6 bits (166),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  456  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  488


 Score = 61.2 bits (147),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKAVDFGRG NQKGV+LDW
Sbjct  488  FGILLLELITGQKAVDFGRGVNQKGVMLDW  517



>ref|XP_004142972.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cucumis sativus]
 gb|KGN62304.1| hypothetical protein Csa_2G348900 [Cucumis sativus]
Length=621

 Score =   147 bits (372),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +TPR R  EN PQR
Sbjct  541  VELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQHIETPRCRPCENPPQR  600

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSLIVEAMELSGPR
Sbjct  601  YSDYIEESSLIVEAMELSGPR  621


 Score = 68.9 bits (167),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  487


 Score = 61.6 bits (148),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGRGANQKGV+LDW
Sbjct  487  FGILLLELITGQKALDFGRGANQKGVMLDW  516



>ref|XP_004159592.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like, partial [Cucumis 
sativus]
Length=235

 Score =   147 bits (372),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +TPR R  EN PQR
Sbjct  155  VELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQHIETPRCRPCENPPQR  214

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSLIVEAMELSGPR
Sbjct  215  YSDYIEESSLIVEAMELSGPR  235


 Score = 68.9 bits (167),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  69   SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  101


 Score = 61.6 bits (148),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGRGANQKGV+LDW
Sbjct  101  FGILLLELITGQKALDFGRGANQKGVMLDW  130



>ref|XP_008444352.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Cucumis 
melo]
Length=621

 Score =   147 bits (372),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +TPR R  EN PQR
Sbjct  541  VELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQHIETPRCRPCENPPQR  600

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSLIVEAMELSGPR
Sbjct  601  YSDYIEESSLIVEAMELSGPR  621


 Score = 68.9 bits (167),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  487


 Score = 61.6 bits (148),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGRGANQKGV+LDW
Sbjct  487  FGILLLELITGQKALDFGRGANQKGVMLDW  516



>ref|XP_008444353.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Cucumis 
melo]
Length=609

 Score =   147 bits (371),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ  +TPR R  EN PQR
Sbjct  529  VELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQHIETPRCRPCENPPQR  588

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSLIVEAMELSGPR
Sbjct  589  YSDYIEESSLIVEAMELSGPR  609


 Score = 68.6 bits (166),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  443  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  475


 Score = 61.6 bits (148),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGRGANQKGV+LDW
Sbjct  475  FGILLLELITGQKALDFGRGANQKGVMLDW  504



>ref|XP_011034114.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011034115.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   149 bits (377),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR+ EN  Q+
Sbjct  547  IELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRSCENPAQK  606

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL+VEAMELSGPR
Sbjct  607  YSDFIEESSLVVEAMELSGPR  627


 Score = 68.6 bits (166),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGF
Sbjct  461  SHVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGF  493


 Score = 59.7 bits (143),  Expect(3) = 2e-59, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  493  FGILLLELITGQKALDFGRAANQKGVMLDW  522



>ref|XP_011034116.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Populus 
euphratica]
Length=624

 Score =   149 bits (377),  Expect(3) = 3e-59, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR+ EN  Q+
Sbjct  544  IELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRSCENPAQK  603

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL+VEAMELSGPR
Sbjct  604  YSDFIEESSLVVEAMELSGPR  624


 Score = 68.6 bits (166),  Expect(3) = 3e-59, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGF
Sbjct  458  SHVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGF  490


 Score = 59.7 bits (143),  Expect(3) = 3e-59, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  490  FGILLLELITGQKALDFGRAANQKGVMLDW  519



>ref|XP_004489819.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cicer arietinum]
Length=625

 Score =   151 bits (381),  Expect(3) = 5e-59, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VEL EMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE+WEASQR +TPRFR  EN PQR
Sbjct  545  VELGEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAERWEASQRIETPRFRLCENPPQR  604

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSLIVEAMELSGPR
Sbjct  605  YSDFIEESSLIVEAMELSGPR  625


 Score = 67.8 bits (164),  Expect(3) = 5e-59, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            +HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  THVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 57.8 bits (138),  Expect(3) = 5e-59, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG KA+DFGR ANQKGV+LDW
Sbjct  491  FGILLLELITGHKALDFGRAANQKGVMLDW  520



>emb|CDP13189.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   148 bits (373),  Expect(3) = 7e-59, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCT FNPS+RPKMSEVLRMLEGDGLAEKWEASQ  +TPRFRT E+ PQR
Sbjct  544  VELEEMVQVALLCTVFNPSNRPKMSEVLRMLEGDGLAEKWEASQTIETPRFRTFEHIPQR  603

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSL+VEAMELSGPR
Sbjct  604  YSDYIEESSLVVEAMELSGPR  624


 Score = 68.9 bits (167),  Expect(3) = 7e-59, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  458  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  490


 Score = 58.9 bits (141),  Expect(3) = 7e-59, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGRGA QKG++LDW
Sbjct  490  FGILLLELITGQKALDFGRGAKQKGIMLDW  519



>ref|XP_010100426.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
 gb|EXB82560.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
Length=637

 Score =   149 bits (377),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQ+ALLCTQFNPSHRPKMS+VL+MLEGDGLAEKWEASQ+ +TPR R+ EN PQR
Sbjct  557  VELEEMVQIALLCTQFNPSHRPKMSDVLKMLEGDGLAEKWEASQKVETPRIRSCENPPQR  616

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL++EAMELSGPR
Sbjct  617  YSDFIEESSLVIEAMELSGPR  637


 Score = 69.3 bits (168),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  471  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  503


 Score = 56.2 bits (134),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR A QKGV+LDW
Sbjct  503  FGILLLELITGQKALDFGRQAKQKGVMLDW  532



>ref|XP_003613191.1| Leucine-rich repeat receptor-like kinase [Medicago truncatula]
 gb|ADO15296.1| somatic embryogenesis receptor kinase-like protein 2 [Medicago 
truncatula]
 gb|AES96149.1| LRR receptor-like kinase [Medicago truncatula]
Length=625

 Score =   152 bits (384),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VEL EMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQR +TPRFR  EN PQR
Sbjct  545  VELGEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQRIETPRFRFCENPPQR  604

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSLIVEAMELSGPR
Sbjct  605  YSDFIEESSLIVEAMELSGPR  625


 Score = 66.2 bits (160),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            +HV+TAVRGT+GHIAPEYLSTGQSSEKTDVFG+
Sbjct  459  THVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGY  491


 Score = 56.6 bits (135),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            +GILLLELITG KA+DFGR ANQKGV+LDW
Sbjct  491  YGILLLELITGHKALDFGRAANQKGVMLDW  520



>ref|XP_004297396.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=629

 Score =   146 bits (369),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ  +TPRFR+ E+ PQR
Sbjct  549  IELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQGVETPRFRSCEHPPQR  608

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFI+ESSL+VEAMELSGPR
Sbjct  609  YSDFIDESSLVVEAMELSGPR  629


 Score = 68.9 bits (167),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  463  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  495


 Score = 59.7 bits (143),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  495  FGILLLELITGQKALDFGRAANQKGVMLDW  524



>ref|XP_011463143.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=626

 Score =   146 bits (369),  Expect(3) = 2e-58, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ  +TPRFR+ E+ PQR
Sbjct  546  IELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQGVETPRFRSCEHPPQR  605

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFI+ESSL+VEAMELSGPR
Sbjct  606  YSDFIDESSLVVEAMELSGPR  626


 Score = 68.9 bits (167),  Expect(3) = 2e-58, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 59.3 bits (142),  Expect(3) = 2e-58, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  492  FGILLLELITGQKALDFGRAANQKGVMLDW  521



>ref|XP_010251173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
 ref|XP_010251174.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
Length=628

 Score =   147 bits (370),  Expect(3) = 3e-58, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQF+PS RPKM EVLRMLEGDGLAEKWEASQ+ +TPRFR+ E  PQR
Sbjct  548  VELEEMVQVALLCTQFHPSQRPKMCEVLRMLEGDGLAEKWEASQKVETPRFRSSETMPQR  607

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL+VEAMELSGPR
Sbjct  608  YSDFIEESSLVVEAMELSGPR  628


 Score = 69.3 bits (168),  Expect(3) = 3e-58, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  462  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  494


 Score = 58.2 bits (139),  Expect(3) = 3e-58, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  494  FGILLLELITGQKALDFGRVANQKGVMLDW  523



>ref|XP_010319667.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
lycopersicum]
Length=575

 Score =   142 bits (357),  Expect(3) = 8e-58, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 77/84 (92%), Gaps = 2/84 (2%)
 Frame = -3

Query  505  GVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRND--TPRFRTHENT  332
            G+ELEEMVQVALLCT F P++RPKMSEVLRMLEGDGLAEKWEASQ+ +  TPRF T ENT
Sbjct  492  GIELEEMVQVALLCTHFIPTYRPKMSEVLRMLEGDGLAEKWEASQKVETPTPRFTTSENT  551

Query  331  PQRYSDFIEESSLIVEAMELSGPR  260
            P+RYSD+I+ESSL+VEAMELSGPR
Sbjct  552  PKRYSDYIQESSLVVEAMELSGPR  575


 Score = 68.9 bits (167),  Expect(3) = 8e-58, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  407  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  439


 Score = 61.6 bits (148),  Expect(3) = 8e-58, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKAV+FGRGANQKGV+LDW
Sbjct  439  FGILLLELITGQKAVEFGRGANQKGVMLDW  468



>ref|XP_004237339.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319665.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319666.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
Length=623

 Score =   142 bits (357),  Expect(3) = 9e-58, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 77/84 (92%), Gaps = 2/84 (2%)
 Frame = -3

Query  505  GVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRND--TPRFRTHENT  332
            G+ELEEMVQVALLCT F P++RPKMSEVLRMLEGDGLAEKWEASQ+ +  TPRF T ENT
Sbjct  540  GIELEEMVQVALLCTHFIPTYRPKMSEVLRMLEGDGLAEKWEASQKVETPTPRFTTSENT  599

Query  331  PQRYSDFIEESSLIVEAMELSGPR  260
            P+RYSD+I+ESSL+VEAMELSGPR
Sbjct  600  PKRYSDYIQESSLVVEAMELSGPR  623


 Score = 68.6 bits (166),  Expect(3) = 9e-58, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  487


 Score = 61.6 bits (148),  Expect(3) = 9e-58, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKAV+FGRGANQKGV+LDW
Sbjct  487  FGILLLELITGQKAVEFGRGANQKGVMLDW  516



>gb|EYU28436.1| hypothetical protein MIMGU_mgv1a002888mg [Erythranthe guttata]
Length=628

 Score =   142 bits (357),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 3/84 (4%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRF---RTHENT  332
            +ELEEMVQVALLCT FNP+HRPKMSEVLRMLEGDGLAEKWE SQ+ DTPR+   R+ +N 
Sbjct  545  IELEEMVQVALLCTHFNPTHRPKMSEVLRMLEGDGLAEKWEQSQKVDTPRYNNSRSFQNL  604

Query  331  PQRYSDFIEESSLIVEAMELSGPR  260
            PQRYSD+IEESSL+VE MELSGPR
Sbjct  605  PQRYSDYIEESSLVVEDMELSGPR  628


 Score = 67.8 bits (164),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTLGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 62.4 bits (150),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG KAVDFGRGANQKGVILDW
Sbjct  491  FGILLLELITGHKAVDFGRGANQKGVILDW  520



>ref|XP_010248542.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Nelumbo 
nucifera]
Length=582

 Score =   147 bits (372),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMV+VALLCTQF+PS RPKMSEVLRMLEGDGLAEKWEASQR +TPR R+ EN PQR
Sbjct  502  VELEEMVKVALLCTQFHPSQRPKMSEVLRMLEGDGLAEKWEASQRAETPRLRSSENLPQR  561

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSL+VEAMELSGPR
Sbjct  562  YSDYIEESSLVVEAMELSGPR  582


 Score = 68.6 bits (166),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TA+RGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  416  SHVTTAIRGTVGHIAPEYLSTGQSSEKTDVFGF  448


 Score = 55.8 bits (133),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR  +QKGV+LDW
Sbjct  448  FGILLLELITGQKALDFGRAVSQKGVMLDW  477



>ref|XP_010248541.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Nelumbo 
nucifera]
Length=626

 Score =   147 bits (372),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMV+VALLCTQF+PS RPKMSEVLRMLEGDGLAEKWEASQR +TPR R+ EN PQR
Sbjct  546  VELEEMVKVALLCTQFHPSQRPKMSEVLRMLEGDGLAEKWEASQRAETPRLRSSENLPQR  605

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSL+VEAMELSGPR
Sbjct  606  YSDYIEESSLVVEAMELSGPR  626


 Score = 68.6 bits (166),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TA+RGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAIRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 55.8 bits (133),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR  +QKGV+LDW
Sbjct  492  FGILLLELITGQKALDFGRAVSQKGVMLDW  521



>gb|KHN14560.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=623

 Score =   145 bits (366),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 76/81 (94%), Gaps = 2/81 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE+WEASQR +TPRFR+ E  PQR
Sbjct  545  IELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAERWEASQRIETPRFRSCE--PQR  602

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD IEESSLIVEAMELSGPR
Sbjct  603  YSDLIEESSLIVEAMELSGPR  623


 Score = 68.9 bits (167),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 57.8 bits (138),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG KA+DFGR ANQKGV+LDW
Sbjct  491  FGILLLELITGHKALDFGRAANQKGVMLDW  520



>ref|XP_007157369.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
 gb|ESW29363.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
Length=623

 Score =   145 bits (366),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 76/81 (94%), Gaps = 2/81 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE+WEASQR +TPRFR+ E  PQR
Sbjct  545  IELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAERWEASQRIETPRFRSCE--PQR  602

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD IEESSLIVEAMELSGPR
Sbjct  603  YSDLIEESSLIVEAMELSGPR  623


 Score = 68.6 bits (166),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 57.8 bits (138),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG KA+DFGR ANQKGV+LDW
Sbjct  491  FGILLLELITGHKALDFGRAANQKGVMLDW  520



>ref|XP_003517653.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Glycine max]
Length=623

 Score =   145 bits (366),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 76/81 (94%), Gaps = 2/81 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE+WEASQR +TPRFR+ E  PQR
Sbjct  545  IELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAERWEASQRIETPRFRSCE--PQR  602

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD IEESSLIVEAMELSGPR
Sbjct  603  YSDLIEESSLIVEAMELSGPR  623


 Score = 68.9 bits (167),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 57.8 bits (138),  Expect(3) = 1e-57, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG KA+DFGR ANQKGV+LDW
Sbjct  491  FGILLLELITGHKALDFGRAANQKGVMLDW  520



>ref|XP_003519642.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform 1 [Glycine 
max]
Length=624

 Score =   144 bits (364),  Expect(3) = 2e-57, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 76/81 (94%), Gaps = 2/81 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE+WEASQR +TPRFR+ E  PQR
Sbjct  546  IELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAERWEASQRIETPRFRSCE--PQR  603

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD IEESSL+VEAMELSGPR
Sbjct  604  YSDLIEESSLVVEAMELSGPR  624


 Score = 68.9 bits (167),  Expect(3) = 2e-57, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 57.8 bits (138),  Expect(3) = 2e-57, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG KA+DFGR ANQKGV+LDW
Sbjct  492  FGILLLELITGHKALDFGRAANQKGVMLDW  521



>gb|KHN00370.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=624

 Score =   144 bits (364),  Expect(3) = 2e-57, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 76/81 (94%), Gaps = 2/81 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAE+WEASQR +TPRFR+ E  PQR
Sbjct  546  IELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAERWEASQRIETPRFRSCE--PQR  603

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD IEESSL+VEAMELSGPR
Sbjct  604  YSDLIEESSLVVEAMELSGPR  624


 Score = 68.9 bits (167),  Expect(3) = 2e-57, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 57.8 bits (138),  Expect(3) = 2e-57, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG KA+DFGR ANQKGV+LDW
Sbjct  492  FGILLLELITGHKALDFGRAANQKGVMLDW  521



>ref|XP_006438322.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
 gb|ESR51562.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
Length=623

 Score =   144 bits (362),  Expect(3) = 3e-57, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 76/81 (94%), Gaps = 3/81 (4%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ+ +TPR+RTHE   +R
Sbjct  546  IELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKIETPRYRTHE---KR  602

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL++EAMELSGPR
Sbjct  603  YSDFIEESSLVIEAMELSGPR  623


 Score = 68.9 bits (167),  Expect(3) = 3e-57, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 57.8 bits (138),  Expect(3) = 3e-57, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+DFGR ANQ+GV+LDW
Sbjct  492  FGILLLELITGQRALDFGRAANQRGVMLDW  521



>ref|XP_006483905.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Citrus sinensis]
Length=623

 Score =   144 bits (362),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 76/81 (94%), Gaps = 3/81 (4%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ+ +TPR+RTHE   +R
Sbjct  546  IELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKIETPRYRTHE---KR  602

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL++EAMELSGPR
Sbjct  603  YSDFIEESSLVIEAMELSGPR  623


 Score = 68.9 bits (167),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 57.8 bits (138),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+DFGR ANQ+GV+LDW
Sbjct  492  FGILLLELITGQRALDFGRAANQRGVMLDW  521



>gb|KDO82334.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=623

 Score =   144 bits (362),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 76/81 (94%), Gaps = 3/81 (4%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ+ +TPR+RTHE   +R
Sbjct  546  IELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKIETPRYRTHE---KR  602

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL++EAMELSGPR
Sbjct  603  YSDFIEESSLVIEAMELSGPR  623


 Score = 68.9 bits (167),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 57.4 bits (137),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+DFGR ANQ+GV+LDW
Sbjct  492  FGILLLELITGQRALDFGRAANQRGVMLDW  521



>ref|XP_007222912.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
 gb|EMJ24111.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
Length=560

 Score =   144 bits (364),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR+ E+  QR
Sbjct  480  VELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRSCEHPRQR  539

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL++EAMELSGPR
Sbjct  540  YSDFIEESSLVLEAMELSGPR  560


 Score = 67.4 bits (163),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  394  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  426


 Score = 58.2 bits (139),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  426  FGILLLELITGQKALDFGRVANQKGVMLDW  455



>ref|XP_007222911.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
 gb|EMJ24110.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
Length=559

 Score =   144 bits (363),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR+ E+  QR
Sbjct  479  VELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRSCEHPRQR  538

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL++EAMELSGPR
Sbjct  539  YSDFIEESSLVLEAMELSGPR  559


 Score = 67.4 bits (163),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  393  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  425


 Score = 58.2 bits (139),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  425  FGILLLELITGQKALDFGRVANQKGVMLDW  454



>ref|XP_008221850.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Prunus 
mume]
Length=656

 Score =   144 bits (363),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR+ E+  QR
Sbjct  576  VELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKIETPRFRSCEHPRQR  635

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL++EAMELSGPR
Sbjct  636  YSDFIEESSLVLEAMELSGPR  656


 Score = 67.8 bits (164),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  490  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  522


 Score = 58.2 bits (139),  Expect(3) = 4e-57, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  522  FGILLLELITGQKALDFGRVANQKGVMLDW  551



>ref|XP_008221852.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Prunus 
mume]
Length=655

 Score =   144 bits (363),  Expect(3) = 5e-57, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR+ E+  QR
Sbjct  575  VELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKIETPRFRSCEHPRQR  634

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL++EAMELSGPR
Sbjct  635  YSDFIEESSLVLEAMELSGPR  655


 Score = 67.8 bits (164),  Expect(3) = 5e-57, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  489  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  521


 Score = 58.2 bits (139),  Expect(3) = 5e-57, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  521  FGILLLELITGQKALDFGRVANQKGVMLDW  550



>ref|XP_008221853.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Prunus 
mume]
Length=560

 Score =   144 bits (363),  Expect(3) = 5e-57, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR+ E+  QR
Sbjct  480  VELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKIETPRFRSCEHPRQR  539

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL++EAMELSGPR
Sbjct  540  YSDFIEESSLVLEAMELSGPR  560


 Score = 67.4 bits (163),  Expect(3) = 5e-57, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  394  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  426


 Score = 58.2 bits (139),  Expect(3) = 5e-57, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  426  FGILLLELITGQKALDFGRVANQKGVMLDW  455



>ref|XP_008389688.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=630

 Score =   143 bits (361),  Expect(3) = 8e-57, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR+ E+  QR
Sbjct  550  VELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRSCEHPRQR  609

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL+VEAMELSGPR
Sbjct  610  YSDFIEESSLVVEAMELSGPR  630


 Score = 67.8 bits (164),  Expect(3) = 8e-57, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  464  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  496


 Score = 58.2 bits (139),  Expect(3) = 8e-57, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  496  FGILLLELITGQKALDFGRVANQKGVMLDW  525



>ref|XP_008389685.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
 ref|XP_008389686.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=632

 Score =   143 bits (360),  Expect(3) = 9e-57, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR+ E+  QR
Sbjct  552  VELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRSCEHPRQR  611

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL+VEAMELSGPR
Sbjct  612  YSDFIEESSLVVEAMELSGPR  632


 Score = 67.8 bits (164),  Expect(3) = 9e-57, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  466  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  498


 Score = 58.2 bits (139),  Expect(3) = 9e-57, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  498  FGILLLELITGQKALDFGRVANQKGVMLDW  527



>ref|XP_008389687.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=631

 Score =   143 bits (360),  Expect(3) = 9e-57, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR+ E+  QR
Sbjct  551  VELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRSCEHPRQR  610

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL+VEAMELSGPR
Sbjct  611  YSDFIEESSLVVEAMELSGPR  631


 Score = 67.8 bits (164),  Expect(3) = 9e-57, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  465  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  497


 Score = 58.2 bits (139),  Expect(3) = 9e-57, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  497  FGILLLELITGQKALDFGRVANQKGVMLDW  526



>ref|XP_010023506.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Eucalyptus grandis]
 gb|KCW59799.1| hypothetical protein EUGRSUZ_H02547 [Eucalyptus grandis]
Length=621

 Score =   138 bits (348),  Expect(3) = 1e-55, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMV+V+LLCT+FNP  RPKMSEVLRMLEGDGLAEKWEASQ+ +TPRFR+ EN   R
Sbjct  541  IELEEMVKVSLLCTKFNPLERPKMSEVLRMLEGDGLAEKWEASQKVETPRFRSCENPTPR  600

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL+VEAMELSGPR
Sbjct  601  YSDFIEESSLVVEAMELSGPR  621


 Score = 68.9 bits (167),  Expect(3) = 1e-55, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  487


 Score = 57.8 bits (138),  Expect(3) = 1e-55, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  487  FGILLLELITGQKALDFGRVANQKGVMLDW  516



>ref|XP_006356418.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356419.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006356420.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Solanum 
tuberosum]
Length=600

 Score =   135 bits (339),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 1/81 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMV+VALLCT FNPSHRPKMSE LRMLEGDGLAEKWEASQ+ +TPR R  E+TPQR
Sbjct  521  IELEEMVKVALLCTHFNPSHRPKMSEALRMLEGDGLAEKWEASQKLETPRNRAFEHTPQR  580

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YS+F+E+SSL VE MELSGPR
Sbjct  581  YSNFVEDSSL-VEPMELSGPR  600


 Score = 68.6 bits (166),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGF
Sbjct  434  SHVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGF  466


 Score = 58.2 bits (139),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 1/31 (3%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVI-LDW  504
            FGILLLELITGQKA+DFGRGANQKGV+ LDW
Sbjct  466  FGILLLELITGQKAMDFGRGANQKGVVMLDW  496



>ref|XP_008340070.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=630

 Score =   135 bits (340),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 1/81 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR  +   QR
Sbjct  551  VELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRPCD-PRQR  609

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL++EAMELSGPR
Sbjct  610  YSDFIEESSLVLEAMELSGPR  630


 Score = 68.9 bits (167),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHVSTAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  465  SHVSTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  497


 Score = 57.4 bits (137),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+DFGR ANQKGV+LDW
Sbjct  497  FGILLLELITGQRALDFGRVANQKGVMLDW  526



>ref|XP_008340072.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=628

 Score =   135 bits (340),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 1/81 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR  +   QR
Sbjct  549  VELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRPCD-PRQR  607

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL++EAMELSGPR
Sbjct  608  YSDFIEESSLVLEAMELSGPR  628


 Score = 68.9 bits (167),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHVSTAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  463  SHVSTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  495


 Score = 57.4 bits (137),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+DFGR ANQKGV+LDW
Sbjct  495  FGILLLELITGQRALDFGRVANQKGVMLDW  524



>ref|XP_010682518.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Beta vulgaris subsp. 
vulgaris]
Length=621

 Score =   137 bits (345),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 2/81 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VEL EMVQVALLCTQFNP HRPKMS+VLRMLE DGLAEKW+ASQR++TPR R+ E  PQR
Sbjct  543  VELGEMVQVALLCTQFNPLHRPKMSDVLRMLEDDGLAEKWDASQRSETPRSRSSE--PQR  600

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+IEESSL+VEAMELSGPR
Sbjct  601  YSDYIEESSLVVEAMELSGPR  621


 Score = 65.9 bits (159),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGT+GHIAPEYL TGQSSEKTDVFG+
Sbjct  457  SHVTTAVRGTIGHIAPEYLCTGQSSEKTDVFGY  489


 Score = 58.5 bits (140),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            +GILLLELITGQKA+DFGR +NQKGV+LDW
Sbjct  489  YGILLLELITGQKAIDFGRASNQKGVMLDW  518



>ref|XP_008340071.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=629

 Score =   135 bits (340),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 1/81 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR  +   QR
Sbjct  550  VELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRPCD-PRQR  608

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL++EAMELSGPR
Sbjct  609  YSDFIEESSLVLEAMELSGPR  629


 Score = 68.9 bits (167),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHVSTAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  464  SHVSTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  496


 Score = 57.4 bits (137),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+DFGR ANQKGV+LDW
Sbjct  496  FGILLLELITGQRALDFGRVANQKGVMLDW  525



>ref|XP_009596637.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Nicotiana tomentosiformis]
Length=601

 Score =   134 bits (338),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 1/81 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMV+VALLCTQFNPSHRPKMSE LRMLEGDGLAEKWEASQ+ + PR R  E+TPQR
Sbjct  522  IELEEMVKVALLCTQFNPSHRPKMSEALRMLEGDGLAEKWEASQKLEAPRNRAFEHTPQR  581

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YS+++EESSL VE MELSGPR
Sbjct  582  YSNYVEESSL-VEPMELSGPR  601


 Score = 68.9 bits (167),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGF
Sbjct  435  SHVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGF  467


 Score = 58.2 bits (139),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 1/31 (3%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVI-LDW  504
            FGILLLELITGQKA+DFGRGANQKGV+ LDW
Sbjct  467  FGILLLELITGQKAMDFGRGANQKGVVMLDW  497



>ref|XP_010940158.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Elaeis guineensis]
Length=629

 Score =   135 bits (339),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDGLAEKWEASQ+ DTP+  + E  P +
Sbjct  549  VELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAEKWEASQKTDTPKSLSSEQPPPK  608

Query  322  YSDFIEESSLIVEAMELSGPR  260
            Y DF+EESSL+V+A+ELSGPR
Sbjct  609  YLDFVEESSLVVDAIELSGPR  629


 Score = 69.3 bits (168),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  463  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  495


 Score = 57.4 bits (137),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FG+LLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  495  FGVLLLELITGQKALDFGRLANQKGVMLDW  524



>ref|XP_010910388.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Elaeis guineensis]
Length=629

 Score =   134 bits (338),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGLAEKWEASQ+ +TP+ R+ E  P +
Sbjct  549  VELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLAEKWEASQKIETPKSRSCEQPPPK  608

Query  322  YSDFIEESSLIVEAMELSGPR  260
            Y DF+E+SSL+VEA+ELSGPR
Sbjct  609  YLDFVEDSSLVVEAIELSGPR  629


 Score = 68.9 bits (167),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  463  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  495


 Score = 57.8 bits (138),  Expect(3) = 2e-54, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  495  FGILLLELITGQKALDFGRLANQKGVMLDW  524



>ref|XP_008813583.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Phoenix 
dactylifera]
Length=643

 Score =   134 bits (338),  Expect(3) = 4e-54, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGLAEKWEASQ+ DTP+  + E  P +
Sbjct  563  VELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLAEKWEASQKVDTPKSGSSEQAPPK  622

Query  322  YSDFIEESSLIVEAMELSGPR  260
            +SD++E+SSL+VEA+ELSGPR
Sbjct  623  HSDYVEDSSLVVEAIELSGPR  643


 Score = 68.9 bits (167),  Expect(3) = 4e-54, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  477  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  509


 Score = 56.6 bits (135),  Expect(3) = 4e-54, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+DFGR ANQKGV+LDW
Sbjct  509  FGILLLELITGQRALDFGRLANQKGVMLDW  538



>ref|XP_006841062.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
 gb|ERN02737.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
Length=629

 Score =   131 bits (330),  Expect(3) = 4e-54, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRN-DTPRFRTHENTPQ  326
            VELEEMV+VALLCTQF+P+ RPKMSEV+RMLEGDGLAEKWEASQ+  +TPRFR  E  P+
Sbjct  548  VELEEMVRVALLCTQFHPACRPKMSEVVRMLEGDGLAEKWEASQQKVETPRFRGSEFFPR  607

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            +YSD IEESSL+VEAMELSGPR
Sbjct  608  KYSDLIEESSLVVEAMELSGPR  629


 Score = 69.3 bits (168),  Expect(3) = 4e-54, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  462  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  494


 Score = 59.3 bits (142),  Expect(3) = 4e-54, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKAVDFGR ANQKGV+LDW
Sbjct  494  FGILLLELITGQKAVDFGRLANQKGVMLDW  523



>ref|XP_008813582.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Phoenix 
dactylifera]
Length=649

 Score =   134 bits (338),  Expect(3) = 4e-54, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGLAEKWEASQ+ DTP+  + E  P +
Sbjct  569  VELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLAEKWEASQKVDTPKSGSSEQAPPK  628

Query  322  YSDFIEESSLIVEAMELSGPR  260
            +SD++E+SSL+VEA+ELSGPR
Sbjct  629  HSDYVEDSSLVVEAIELSGPR  649


 Score = 68.9 bits (167),  Expect(3) = 4e-54, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  483  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  515


 Score = 56.6 bits (135),  Expect(3) = 4e-54, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+DFGR ANQKGV+LDW
Sbjct  515  FGILLLELITGQRALDFGRLANQKGVMLDW  544



>ref|XP_008812173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Phoenix dactylifera]
Length=629

 Score =   132 bits (333),  Expect(3) = 7e-54, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDGLAEKWEASQ+ D P+  + E  P R
Sbjct  549  VELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAEKWEASQKIDAPKSLSSEQPPPR  608

Query  322  YSDFIEESSLIVEAMELSGPR  260
            Y DF+EESSL+V+A+ELSGPR
Sbjct  609  YLDFVEESSLVVDAIELSGPR  629


 Score = 69.3 bits (168),  Expect(3) = 7e-54, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  463  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  495


 Score = 57.4 bits (137),  Expect(3) = 7e-54, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FG+LLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  495  FGVLLLELITGQKALDFGRLANQKGVMLDW  524



>ref|XP_009390158.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=659

 Score =   130 bits (327),  Expect(3) = 1e-52, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEM+QVALLCTQF+PS RPKMSEV+RMLEGDGLAEKWEASQR DTP+ R+ E    +
Sbjct  579  VELEEMIQVALLCTQFHPSQRPKMSEVVRMLEGDGLAEKWEASQRMDTPKSRSSEQLTPK  638

Query  322  YSDFIEESSLIVEAMELSGPR  260
            Y DF+E+SS +VEA+ELSGPR
Sbjct  639  YIDFMEDSSFVVEAIELSGPR  659


 Score = 68.9 bits (167),  Expect(3) = 1e-52, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  493  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  525


 Score = 55.8 bits (133),  Expect(3) = 1e-52, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR  NQKGV+LDW
Sbjct  525  FGILLLELITGQKALDFGRLTNQKGVMLDW  554



>ref|XP_009403878.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=607

 Score =   125 bits (315),  Expect(3) = 6e-52, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGL E W+A Q+ DTP+ R+ E    +
Sbjct  527  VELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLVESWDALQKMDTPKCRSLERQSPK  586

Query  322  YSDFIEESSLIVEAMELSGPR  260
            Y DF+E+SSL++EA+ELSGPR
Sbjct  587  YVDFMEDSSLVLEAIELSGPR  607


 Score = 69.3 bits (168),  Expect(3) = 6e-52, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  441  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  473


 Score = 57.4 bits (137),  Expect(3) = 6e-52, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  473  FGILLLELITGQKALDFGRLANQKGVMLDW  502



>ref|XP_009403877.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=626

 Score =   125 bits (315),  Expect(3) = 7e-52, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDGL E W+A Q+ DTP+ R+ E    +
Sbjct  546  VELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDGLVESWDALQKMDTPKCRSLERQSPK  605

Query  322  YSDFIEESSLIVEAMELSGPR  260
            Y DF+E+SSL++EA+ELSGPR
Sbjct  606  YVDFMEDSSLVLEAIELSGPR  626


 Score = 69.3 bits (168),  Expect(3) = 7e-52, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 57.4 bits (137),  Expect(3) = 7e-52, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  492  FGILLLELITGQKALDFGRLANQKGVMLDW  521



>gb|KEH21800.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=626

 Score =   124 bits (312),  Expect(3) = 1e-50, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENT-PQ  326
            +ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE+WEASQ+ DT +F+  E++   
Sbjct  545  IELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAERWEASQKTDTSKFKHQESSLSD  604

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++S L+V+AMELSGPR
Sbjct  605  RYSDLTDDSLLLVQAMELSGPR  626


 Score = 69.3 bits (168),  Expect(3) = 1e-50, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 54.3 bits (129),  Expect(3) = 1e-50, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  491  FGILLLELITGQRALEFGKAANQKGAMLDW  520



>ref|XP_004238998.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=621

 Score =   125 bits (315),  Expect(3) = 1e-50, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVAL+CTQ++PSHRPKMSEV+RMLEGDGLAEKWEASQR ++ R R +E ++ +
Sbjct  540  IELEEMVQVALICTQYHPSHRPKMSEVVRMLEGDGLAEKWEASQRAESTRCRANEFSSSE  599

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  600  RYSDLTDDSSLLVQAMELSGPR  621


 Score = 67.8 bits (164),  Expect(3) = 1e-50, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  454  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  486


 Score = 54.3 bits (129),  Expect(3) = 1e-50, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKGV+LDW
Sbjct  486  FGILLLELISGQRALEFGKAANQKGVMLDW  515



>ref|XP_004238646.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Solanum lycopersicum]
Length=603

 Score =   120 bits (301),  Expect(3) = 3e-50, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMV+VALLCT FNP HRPKMSE LRMLEGDGLAE+W ASQ  +T R R  E TPQ 
Sbjct  524  IELEEMVKVALLCTHFNPCHRPKMSEALRMLEGDGLAEQWAASQNLETRRKRAFEPTPQT  583

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD++++SSL VE MELSGPR
Sbjct  584  YSDYVQDSSL-VEPMELSGPR  603


 Score = 68.6 bits (166),  Expect(3) = 3e-50, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGF
Sbjct  437  SHVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGF  469


 Score = 58.2 bits (139),  Expect(3) = 3e-50, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 1/31 (3%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVI-LDW  504
            FGILLLELITGQKA+DFGRGANQKGV+ LDW
Sbjct  469  FGILLLELITGQKAMDFGRGANQKGVVMLDW  499



>ref|XP_002532890.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF29495.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=624

 Score =   124 bits (310),  Expect(3) = 3e-50, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQF PSHRPKMSEV+RMLEGDGLAE+WEASQR ++ + + HE ++  
Sbjct  543  IELEEMVQVALLCTQFLPSHRPKMSEVVRMLEGDGLAERWEASQRAESTKSKLHEFSSSD  602

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  603  RYSDLTDDSSLLVQAMELSGPR  624


 Score = 68.9 bits (167),  Expect(3) = 3e-50, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 54.3 bits (129),  Expect(3) = 3e-50, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  489  FGILLLELITGQRALEFGKAANQKGAMLDW  518



>ref|XP_010261784.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Nelumbo 
nucifera]
Length=550

 Score =   122 bits (305),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            VELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR +  + + HE ++ +
Sbjct  469  VELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRAEATKCKPHEFSSSE  528

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  529  RYSDLTDDSSLLVQAMELSGPR  550


 Score = 68.9 bits (167),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  383  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  415


 Score = 55.8 bits (133),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+DFG+ ANQKG +LDW
Sbjct  415  FGILLLELITGQRALDFGKAANQKGAMLDW  444



>ref|XP_002455108.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
 gb|EES00228.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
Length=615

 Score =   123 bits (308),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAEKWEASQ  DTP+  + E  P +
Sbjct  534  VELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAEKWEASQNVDTPKSVSSEILPPK  593

Query  322  YSDF-IEESSLIVEAMELSGPR  260
            Y DF  +ESSL +EAMELSGPR
Sbjct  594  YMDFAADESSLGLEAMELSGPR  615


 Score = 68.9 bits (167),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  448  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  480


 Score = 54.7 bits (130),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FG+LL+ELITGQKA+DFGR ANQKG +LDW
Sbjct  480  FGVLLVELITGQKALDFGRVANQKGGVLDW  509



>ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
 emb|CBI27432.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   122 bits (307),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEA+QR +  R + +E ++ +
Sbjct  544  IELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEATQRAEATRCKANEFSSSE  603

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  604  RYSDLTDDSSLLVQAMELSGPR  625


 Score = 69.7 bits (169),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  458  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  490


 Score = 54.7 bits (130),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  490  FGILLLELITGQRALEFGKAANQKGAMLDW  519



>emb|CAN63733.1| hypothetical protein VITISV_025883 [Vitis vinifera]
Length=609

 Score =   122 bits (307),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEA+QR +  R + +E ++ +
Sbjct  528  IELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEATQRAEATRCKANEFSSSE  587

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  588  RYSDLTDDSSLLVQAMELSGPR  609


 Score = 69.3 bits (168),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  442  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  474


 Score = 54.7 bits (130),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  474  FGILLLELITGQRALEFGKAANQKGAMLDW  503



>ref|XP_010261776.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   122 bits (305),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            VELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR +  + + HE ++ +
Sbjct  542  VELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRAEATKCKPHEFSSSE  601

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  602  RYSDLTDDSSLLVQAMELSGPR  623


 Score = 68.9 bits (167),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  456  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  488


 Score = 55.8 bits (133),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+DFG+ ANQKG +LDW
Sbjct  488  FGILLLELITGQRALDFGKAANQKGAMLDW  517



>ref|XP_010257839.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Nelumbo nucifera]
Length=624

 Score =   123 bits (309),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR +T + + HE ++ +
Sbjct  543  IELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRAETTKCKPHEFSSSE  602

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  603  RYSDLTDDSSLLVQAMELSGPR  624


 Score = 69.3 bits (168),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 54.3 bits (129),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  489  FGILLLELITGQRALEFGKAANQKGAMLDW  518



>ref|XP_010681338.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Beta vulgaris 
subsp. vulgaris]
Length=627

 Score =   120 bits (301),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLCTQF P+ RP+MSEV+RMLEGDGLAEKWEASQR D+ R R  E ++ +
Sbjct  546  IELEEIVQVALLCTQFLPNQRPRMSEVVRMLEGDGLAEKWEASQRADSTRSRVTEFSSSE  605

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  606  RYSDLTDDSSLLVQAMELSGPR  627


 Score = 69.3 bits (168),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 57.0 bits (136),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+DFG+ ANQKG +LDW
Sbjct  492  FGILLLELITGQRAIDFGKAANQKGAMLDW  521



>ref|XP_006348615.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=621

 Score =   124 bits (312),  Expect(3) = 5e-50, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVAL+CTQ++PSHRPK+SEV+RMLEGDGLAEKWEASQR ++ R R +E ++ +
Sbjct  540  IELEEMVQVALICTQYHPSHRPKISEVVRMLEGDGLAEKWEASQRAESTRCRANEFSSSE  599

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  600  RYSDLTDDSSLLVQAMELSGPR  621


 Score = 68.2 bits (165),  Expect(3) = 5e-50, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  454  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  486


 Score = 53.9 bits (128),  Expect(3) = 5e-50, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKG++LDW
Sbjct  486  FGILLLELISGQRALEFGKAANQKGIMLDW  515



>ref|XP_011070875.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Sesamum indicum]
Length=623

 Score =   123 bits (308),  Expect(3) = 5e-50, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAEKWEASQR +  R R +E ++ +
Sbjct  542  IELEEMVQVALLCTQYLPNHRPKMSEVVRMLEGDGLAEKWEASQRAEVTRCRANEFSSSE  601

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  602  RYSDLTDDSSLLVQAMELSGPR  623


 Score = 69.3 bits (168),  Expect(3) = 5e-50, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  456  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  488


 Score = 54.3 bits (129),  Expect(3) = 5e-50, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  488  FGILLLELITGQRALEFGKAANQKGAMLDW  517



>ref|XP_011077619.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Sesamum indicum]
Length=648

 Score =   122 bits (307),  Expect(3) = 5e-50, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            VELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAEKWEASQR +  R R +E ++  
Sbjct  567  VELEEMVQVALLCTQFLPIHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSG  626

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  627  RYSDLTDDSSLLVQAMELSGPR  648


 Score = 69.3 bits (168),  Expect(3) = 5e-50, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  481  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  513


 Score = 54.3 bits (129),  Expect(3) = 5e-50, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  513  FGILLLELITGQRALEFGKAANQKGAMLDW  542



>emb|CDP00520.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   122 bits (306),  Expect(3) = 6e-50, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEM QVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQR +  R R +E ++ +
Sbjct  542  IELEEMAQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSE  601

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  602  RYSDLTDDSSLLVQAMELSGPR  623


 Score = 69.3 bits (168),  Expect(3) = 6e-50, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  456  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  488


 Score = 54.3 bits (129),  Expect(3) = 6e-50, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  488  FGILLLELITGQRALEFGKAANQKGAMLDW  517



>ref|XP_004968347.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Setaria italica]
Length=633

 Score =   122 bits (306),  Expect(3) = 7e-50, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDGLAEKWEASQ  DTP+  + E  P +
Sbjct  552  VELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAEKWEASQNVDTPKSVSSELLPPK  611

Query  322  YSDF-IEESSLIVEAMELSGPR  260
            Y DF  +ESSL +EAMELSGPR
Sbjct  612  YMDFAADESSLGLEAMELSGPR  633


 Score = 68.9 bits (167),  Expect(3) = 7e-50, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  466  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  498


 Score = 54.7 bits (130),  Expect(3) = 7e-50, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FG+LL+ELITGQKA+DFGR ANQKG +LDW
Sbjct  498  FGVLLVELITGQKALDFGRVANQKGGVLDW  527



>ref|XP_003637897.1| Receptor-like kinase [Medicago truncatula]
Length=496

 Score =   121 bits (304),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQR ++ R R +E ++ +
Sbjct  415  IELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAESTRSRGNELSSSE  474

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  475  RYSDLTDDSSLLAQAMELSGPR  496


 Score = 69.3 bits (168),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  329  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  361


 Score = 53.9 bits (128),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKG +LDW
Sbjct  361  FGILLLELISGQRALEFGKAANQKGAMLDW  390



>ref|XP_007033440.1| NSP-interacting kinase 1 [Theobroma cacao]
 gb|EOY04366.1| NSP-interacting kinase 1 [Theobroma cacao]
Length=649

 Score =   121 bits (303),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR +  + + HE ++  
Sbjct  548  IELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRAEATKCKPHEFSSSD  607

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  608  RYSDLTDDSSLLVQAMELSGPR  629


 Score = 69.3 bits (168),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  462  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  494


 Score = 54.3 bits (129),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  494  FGILLLELITGQRALEFGKAANQKGAMLDW  523



>ref|XP_009625494.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana tomentosiformis]
Length=624

 Score =   123 bits (309),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +E+EEMVQVAL+CTQ++PSHRPKMSEV+RMLEGDGLAEKWEASQ+ ++ R R +E ++ +
Sbjct  543  IEVEEMVQVALICTQYHPSHRPKMSEVVRMLEGDGLAEKWEASQKAESTRCRANEFSSSE  602

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  603  RYSDLTDDSSLLVQAMELSGPR  624


 Score = 67.8 bits (164),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  489


 Score = 53.1 bits (126),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKG +LDW
Sbjct  489  FGILLLELISGQRALEFGKAANQKGAMLDW  518



>gb|KDP24340.1| hypothetical protein JCGZ_25636 [Jatropha curcas]
Length=624

 Score =   120 bits (300),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLCTQF PSHRPKMSEV+RMLEGDGLAE+WEASQR +  + + HE ++  
Sbjct  543  IELEEIVQVALLCTQFLPSHRPKMSEVVRMLEGDGLAERWEASQRVEATKPKPHEFSSSD  602

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  603  RYSDLTDDSSLLVQAMELSGPR  624


 Score = 68.9 bits (167),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 55.5 bits (132),  Expect(3) = 2e-49, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG ILDW
Sbjct  489  FGILLLELITGQRALEFGKAANQKGAILDW  518



>dbj|BAD68255.1| putative brassinosteroid insensitive 1-associated receptor kinase 
1 [Oryza sativa Japonica Group]
 dbj|BAE96298.1| SERK like protein kinase [Oryza sativa Japonica Group]
 gb|EAZ10713.1| hypothetical protein OsJ_00547 [Oryza sativa Japonica Group]
 dbj|BAG94399.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70017.1| hypothetical protein OsI_00578 [Oryza sativa Indica Group]
Length=628

 Score =   120 bits (301),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDGLAEKWEASQ  DTP+  + E  P +
Sbjct  547  VELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAEKWEASQNVDTPKSVSSELLPPK  606

Query  322  YSDF-IEESSLIVEAMELSGPR  260
            + DF  +ESSL +EAMELSGPR
Sbjct  607  FMDFAADESSLGLEAMELSGPR  628


 Score = 69.3 bits (168),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  461  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  493


 Score = 54.3 bits (129),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FG+LL+ELITGQKA+DFGR ANQKG +LDW
Sbjct  493  FGVLLVELITGQKALDFGRLANQKGGVLDW  522



>ref|XP_006643812.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Oryza brachyantha]
Length=590

 Score =   120 bits (301),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDGLAEKWEASQ  DTP+  + E  P +
Sbjct  509  VELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAEKWEASQNVDTPKSVSSELLPPK  568

Query  322  YSDF-IEESSLIVEAMELSGPR  260
            + DF  +ESSL +EAMELSGPR
Sbjct  569  FMDFAADESSLGLEAMELSGPR  590


 Score = 69.3 bits (168),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  423  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  455


 Score = 54.3 bits (129),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FG+LL+ELITGQKA+DFGR ANQKG +LDW
Sbjct  455  FGVLLVELITGQKALDFGRIANQKGGVLDW  484



>gb|KEH17048.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=558

 Score =   120 bits (302),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQR ++ R R +E ++ +
Sbjct  477  IELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAESTRSRGNELSSSE  536

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  537  RYSDLTDDSSLLAQAMELSGPR  558


 Score = 69.3 bits (168),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  391  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  423


 Score = 53.1 bits (126),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKG +LDW
Sbjct  423  FGILLLELISGQRALEFGKAANQKGAMLDW  452



>gb|KDO58880.1| hypothetical protein CISIN_1g036225mg [Citrus sinensis]
Length=622

 Score =   121 bits (303),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAE+WEASQR +  + + HE ++  
Sbjct  541  IELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAERWEASQRAEATKSKPHEFSSSD  600

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  601  RYSDLTDDSSLLVQAMELSGPR  622


 Score = 69.3 bits (168),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  487


 Score = 53.1 bits (126),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+++G+ ANQKG +LDW
Sbjct  487  FGILLLELITGQRALEYGKAANQKGAMLDW  516



>ref|XP_006482337.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Citrus sinensis]
Length=622

 Score =   121 bits (303),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAE+WEASQR +  + + HE ++  
Sbjct  541  IELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAERWEASQRAEATKSKPHEFSSSD  600

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  601  RYSDLTDDSSLLVQAMELSGPR  622


 Score = 68.9 bits (167),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  487


 Score = 53.1 bits (126),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+++G+ ANQKG +LDW
Sbjct  487  FGILLLELITGQRALEYGKAANQKGAMLDW  516



>ref|XP_006344295.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Solanum tuberosum]
Length=620

 Score =   121 bits (303),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRF-RTHE-NTP  329
            +ELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDGLAEKWEASQR +  R  R +E ++ 
Sbjct  538  IELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAEKWEASQRAEPTRCSRANEFSSS  597

Query  328  QRYSDFIEESSLIVEAMELSGPR  260
            +RYSD  ++SSL+V+AMELSGPR
Sbjct  598  ERYSDLTDDSSLLVQAMELSGPR  620


 Score = 68.2 bits (165),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  452  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  484


 Score = 54.3 bits (129),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  484  FGILLLELITGQRALEFGKAANQKGAMLDW  513



>ref|XP_006430876.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
 gb|ESR44116.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
Length=622

 Score =   121 bits (303),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAE+WEASQR +  + + HE ++  
Sbjct  541  IELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAERWEASQRAEATKSKPHEFSSSD  600

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  601  RYSDLTDDSSLLVQAMELSGPR  622


 Score = 68.9 bits (167),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  487


 Score = 53.1 bits (126),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+++G+ ANQKG +LDW
Sbjct  487  FGILLLELITGQRALEYGKAANQKGAMLDW  516



>gb|KEH17047.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=621

 Score =   120 bits (302),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQR ++ R R +E ++ +
Sbjct  540  IELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAESTRSRGNELSSSE  599

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  600  RYSDLTDDSSLLAQAMELSGPR  621


 Score = 69.7 bits (169),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  454  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  486


 Score = 53.1 bits (126),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKG +LDW
Sbjct  486  FGILLLELISGQRALEFGKAANQKGAMLDW  515



>ref|XP_008797566.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score =   123 bits (308),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAE+WEASQR + P+F+  E ++ +
Sbjct  543  IELEETVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAERWEASQRAEAPKFKMPEVSSSE  602

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  603  RYSDLTDDSSLLVQAMELSGPR  624


 Score = 69.3 bits (168),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 50.8 bits (120),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQKG +LDW
Sbjct  489  FGILLLELITGLRAMEFGKAANQKGAMLDW  518



>ref|XP_007153543.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
 gb|ESW25537.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
Length=621

 Score =   120 bits (301),  Expect(3) = 5e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQR ++ R R +E ++ +
Sbjct  540  IELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAESTRSRGNELSSSE  599

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  600  RYSDLTDDSSLLTQAMELSGPR  621


 Score = 69.3 bits (168),  Expect(3) = 5e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  454  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  486


 Score = 53.1 bits (126),  Expect(3) = 5e-49, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKG +LDW
Sbjct  486  FGILLLELISGQRALEFGKAANQKGAMLDW  515



>ref|XP_006603947.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Glycine 
max]
Length=510

 Score =   119 bits (298),  Expect(3) = 5e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAEKWEASQ  DT + +  E ++  
Sbjct  429  IELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQSADTTKCKPQELSSSD  488

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  489  RYSDLTDDSSLLVQAMELSGPR  510


 Score = 69.3 bits (168),  Expect(3) = 5e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  343  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  375


 Score = 54.3 bits (129),  Expect(3) = 5e-49, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  375  FGILLLELITGQRALEFGKAANQKGAMLDW  404



>ref|XP_007045670.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
 gb|EOY01502.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
Length=926

 Score =   122 bits (306),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEM QVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQR +  R R +E ++ +
Sbjct  845  IELEEMAQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRSRANEFSSSE  904

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  905  RYSDLTDDSSLLVQAMELSGPR  926


 Score = 71.2 bits (173),  Expect(3) = 6e-49, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  759  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  791


 Score = 49.3 bits (116),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+G +A++FG+ ANQKG +LDW
Sbjct  791  FGILLLELISGLRALEFGKTANQKGAMLDW  820



>ref|XP_010032589.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Eucalyptus grandis]
 gb|KCW52001.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
 gb|KCW52002.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
Length=629

 Score =   119 bits (298),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAE+WEASQR ++ + + HE ++  
Sbjct  548  IELEEIVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAERWEASQRVESNKGKPHEFSSSD  607

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  608  RYSDLTDDSSLLVQAMELSGPR  629


 Score = 69.3 bits (168),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  462  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  494


 Score = 54.3 bits (129),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  494  FGILLLELITGQRALEFGKAANQKGAMLDW  523



>gb|KHN30771.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=619

 Score =   119 bits (298),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAEKWEASQ  DT + +  E ++  
Sbjct  538  IELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQSADTTKCKPQELSSSD  597

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  598  RYSDLTDDSSLLVQAMELSGPR  619


 Score = 69.3 bits (168),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  452  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  484


 Score = 53.9 bits (128),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  484  FGILLLELITGQRALEFGKAANQKGAMLDW  513



>ref|XP_003572984.2| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Brachypodium 
distachyon]
Length=628

 Score =   121 bits (304),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR D+ +F+  E T  R
Sbjct  547  IELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRTDSHKFKVPEFTFGR  606

Query  322  -YSDFIEESSLIVEAMELSGPR  260
             YSD  ++SSL+V+A+ELSGPR
Sbjct  607  CYSDLTDDSSLLVQAVELSGPR  628


 Score = 69.3 bits (168),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  461  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  493


 Score = 52.0 bits (123),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ +NQKG +LDW
Sbjct  493  FGILLLELITGQTALEFGKSSNQKGAMLDW  522



>ref|XP_010236002.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Brachypodium 
distachyon]
Length=627

 Score =   121 bits (303),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR D+ +F+  E T  R
Sbjct  546  IELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRTDSHKFKVPEFTFGR  605

Query  322  -YSDFIEESSLIVEAMELSGPR  260
             YSD  ++SSL+V+A+ELSGPR
Sbjct  606  CYSDLTDDSSLLVQAVELSGPR  627


 Score = 69.3 bits (168),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 52.0 bits (123),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ +NQKG +LDW
Sbjct  492  FGILLLELITGQTALEFGKSSNQKGAMLDW  521



>ref|XP_004135130.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 ref|XP_004155284.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 gb|KGN52017.1| hypothetical protein Csa_5G608050 [Cucumis sativus]
Length=623

 Score =   123 bits (308),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAEKWEASQR D  R+R +E ++ +
Sbjct  542  IELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAEKWEASQRADANRYRVNEFSSSE  601

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  602  RYSDLTDDSSLLAQAMELSGPR  623


 Score = 68.2 bits (165),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+
Sbjct  456  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGY  488


 Score = 51.6 bits (122),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            +GILLLELITGQ+A++FG+  NQKG +LDW
Sbjct  488  YGILLLELITGQRALEFGKAVNQKGAMLDW  517



>ref|XP_003555046.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoformX1 [Glycine 
max]
Length=624

 Score =   119 bits (298),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAEKWEASQ  DT + +  E ++  
Sbjct  543  IELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQSADTTKCKPQELSSSD  602

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  603  RYSDLTDDSSLLVQAMELSGPR  624


 Score = 69.3 bits (168),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 53.9 bits (128),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  489  FGILLLELITGQRALEFGKAANQKGAMLDW  518



>ref|XP_008446507.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X1 [Cucumis 
melo]
Length=624

 Score =   122 bits (307),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAEKWEASQR D  R+R +E ++ +
Sbjct  543  IELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAEKWEASQRADANRYRVNEFSSSE  602

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  603  RYSDLTDDSSLLAQAMELSGPR  624


 Score = 68.2 bits (165),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGY  489


 Score = 51.6 bits (122),  Expect(3) = 6e-49, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            +GILLLELITGQ+A++FG+  NQKG +LDW
Sbjct  489  YGILLLELITGQRALEFGKAVNQKGAMLDW  518



>ref|XP_008446508.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Cucumis 
melo]
Length=622

 Score =   122 bits (307),  Expect(3) = 7e-49, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAEKWEASQR D  R+R +E ++ +
Sbjct  541  IELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAEKWEASQRADANRYRVNEFSSSE  600

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  601  RYSDLTDDSSLLAQAMELSGPR  622


 Score = 68.2 bits (165),  Expect(3) = 7e-49, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGY  487


 Score = 51.6 bits (122),  Expect(3) = 7e-49, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            +GILLLELITGQ+A++FG+  NQKG +LDW
Sbjct  487  YGILLLELITGQRALEFGKAVNQKGAMLDW  516



>ref|XP_006593318.1| PREDICTED: NSP-interacting kinase isoform X2 [Glycine max]
Length=510

 Score =   119 bits (297),  Expect(3) = 7e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAEKWEASQ  DT   +  E ++  
Sbjct  429  IELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQSADTSNCKPQELSSSD  488

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  489  RYSDLTDDSSLLVQAMELSGPR  510


 Score = 69.7 bits (169),  Expect(3) = 7e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  343  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  375


 Score = 54.3 bits (129),  Expect(3) = 7e-49, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  375  FGILLLELITGQRALEFGKAANQKGAMLDW  404



>ref|XP_008446509.1| PREDICTED: protein NSP-INTERACTING KINASE 2 isoform X3 [Cucumis 
melo]
Length=510

 Score =   122 bits (307),  Expect(3) = 7e-49, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDGLAEKWEASQR D  R+R +E ++ +
Sbjct  429  IELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDGLAEKWEASQRADANRYRVNEFSSSE  488

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  489  RYSDLTDDSSLLAQAMELSGPR  510


 Score = 68.2 bits (165),  Expect(3) = 7e-49, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+
Sbjct  343  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGY  375


 Score = 51.6 bits (122),  Expect(3) = 7e-49, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            +GILLLELITGQ+A++FG+  NQKG +LDW
Sbjct  375  YGILLLELITGQRALEFGKAVNQKGAMLDW  404



>ref|XP_008465988.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cucumis melo]
Length=623

 Score =   119 bits (297),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEE+V+VALLC Q+ PSHRPKMSEV+RMLEGDGLAEKWEASQR +  R R +E + +R
Sbjct  543  IELEEIVRVALLCIQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAEASRSRANEFSSER  602

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD  ++SSL  +A+ELSGPR
Sbjct  603  YSDLTDDSSLFAQAIELSGPR  623


 Score = 69.3 bits (168),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 54.3 bits (129),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKG ILDW
Sbjct  489  FGILLLELISGQRALEFGKAANQKGAILDW  518



>ref|XP_006593317.1| PREDICTED: NSP-interacting kinase isoform X1 [Glycine max]
 gb|KHN02661.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=624

 Score =   119 bits (297),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAEKWEASQ  DT   +  E ++  
Sbjct  543  IELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQSADTSNCKPQELSSSD  602

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  603  RYSDLTDDSSLLVQAMELSGPR  624


 Score = 69.3 bits (168),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 54.3 bits (129),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  489  FGILLLELITGQRALEFGKAANQKGAMLDW  518



>ref|XP_004236956.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Solanum lycopersicum]
Length=620

 Score =   120 bits (302),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 73/83 (88%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRF-RTHE-NTP  329
            +ELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDGLAEKWEASQ  +  R+ R +E ++ 
Sbjct  538  IELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDGLAEKWEASQTAEPTRYSRANEFSSS  597

Query  328  QRYSDFIEESSLIVEAMELSGPR  260
            +RYSD  ++SSL+V+AMELSGPR
Sbjct  598  ERYSDLTDDSSLLVQAMELSGPR  620


 Score = 68.2 bits (165),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  452  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  484


 Score = 53.1 bits (126),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG++A++FG+ ANQKG +LDW
Sbjct  484  FGILLLELITGERALEFGKAANQKGAMLDW  513



>ref|XP_007139356.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 ref|XP_007139357.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11350.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11351.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
Length=623

 Score =   121 bits (303),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQ-  326
            +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR DT +++  E++   
Sbjct  542  IELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVDTTKYKPQESSSSD  601

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++S L+V+AMELSGPR
Sbjct  602  RYSDLTDDSLLLVQAMELSGPR  623


 Score = 68.9 bits (167),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  456  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  488


 Score = 52.0 bits (123),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ AN KG +LDW
Sbjct  488  FGILLLELITGQRALEFGKSANNKGAMLDW  517



>ref|NP_001238448.1| NSP-interacting kinase precursor [Glycine max]
 gb|ACM89473.1| NSP-interacting kinase [Glycine max]
Length=600

 Score =   119 bits (297),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAEKWEASQ  DT   +  E ++  
Sbjct  519  IELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQSADTSNCKPQELSSSD  578

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  579  RYSDLTDDSSLLVQAMELSGPR  600


 Score = 69.3 bits (168),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  433  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  465


 Score = 54.3 bits (129),  Expect(3) = 8e-49, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  465  FGILLLELITGQRALEFGKAANQKGAMLDW  494



>ref|XP_010091686.1| Protein NSP-INTERACTING KINASE 2 [Morus notabilis]
 gb|EXB44952.1| Protein NSP-INTERACTING KINASE 2 [Morus notabilis]
Length=619

 Score =   118 bits (295),  Expect(3) = 9e-49, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE++QVALLCTQ+ PS+RPKMSEV+RMLEGDGLAEKWEASQR ++ R R ++ ++ +
Sbjct  538  IELEEIIQVALLCTQYLPSYRPKMSEVVRMLEGDGLAEKWEASQRAESTRCRANDFSSSE  597

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  598  RYSDLTDDSSLLAQAMELSGPR  619


 Score = 69.3 bits (168),  Expect(3) = 9e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  458  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  490


 Score = 54.7 bits (130),  Expect(3) = 9e-49, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A+DFG+ ANQKG +LDW
Sbjct  490  FGILLLELISGQRALDFGKAANQKGAMLDW  519



>ref|XP_002305306.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|EEE85817.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=627

 Score =   117 bits (294),  Expect(3) = 9e-49, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALL TQ+ PSHRPKMSEV+RMLEGDGLAE+WEASQR +  + + HE ++  
Sbjct  546  IELEEMVQVALLSTQYLPSHRPKMSEVVRMLEGDGLAERWEASQRAEATKSKPHEFSSSD  605

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  606  RYSDLTDDSSLLVQAMELSGPR  627


 Score = 68.9 bits (167),  Expect(3) = 9e-49, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 55.5 bits (132),  Expect(3) = 9e-49, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  492  FGILLLELITGQRAIEFGKAANQKGAMLDW  521



>ref|XP_006384231.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|ERP62028.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=626

 Score =   117 bits (294),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALL TQ+ PSHRPKMSEV+RMLEGDGLAE+WEASQR +  + + HE ++  
Sbjct  545  IELEEMVQVALLSTQYLPSHRPKMSEVVRMLEGDGLAERWEASQRAEATKSKPHEFSSSD  604

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  605  RYSDLTDDSSLLVQAMELSGPR  626


 Score = 68.9 bits (167),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 55.5 bits (132),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  491  FGILLLELITGQRAIEFGKAANQKGAMLDW  520



>ref|XP_004953781.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Setaria 
italica]
 ref|XP_004953782.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Setaria 
italica]
 ref|XP_004953783.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X3 [Setaria 
italica]
Length=624

 Score =   120 bits (302),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE+WEASQ  D+ +F+  E T  R
Sbjct  543  IELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLAERWEASQHTDSHKFKVPEFTFSR  602

Query  322  -YSDFIEESSLIVEAMELSGPR  260
             YSD  ++SSL+V+A+ELSGPR
Sbjct  603  CYSDLTDDSSLLVQAVELSGPR  624


 Score = 68.9 bits (167),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 52.0 bits (123),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ +NQKG +LDW
Sbjct  489  FGILLLELITGQTALEFGKSSNQKGAMLDW  518



>ref|XP_004490300.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cicer arietinum]
Length=622

 Score =   120 bits (301),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQR ++ R R +E ++ +
Sbjct  541  IELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAESTRSRGNELSSSE  600

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  601  RYSDLTDDSSLLAQAMELSGPR  622


 Score = 68.2 bits (165),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  487


 Score = 53.1 bits (126),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKG +LDW
Sbjct  487  FGILLLELISGQRALEFGKAANQKGAMLDW  516



>ref|XP_008459453.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Cucumis melo]
Length=626

 Score =   118 bits (295),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            VELEEMVQVALLCTQ+ P HRPKMSEV+RMLEG+GLA +WEASQR D+ + + H+ ++  
Sbjct  545  VELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGEGLAVRWEASQRVDSTKCKPHDFSSSD  604

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  605  RYSDLTDDSSLLVQAMELSGPR  626


 Score = 69.3 bits (168),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 54.3 bits (129),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG ILDW
Sbjct  491  FGILLLELITGQRALEFGKAANQKGGILDW  520



>ref|XP_002436855.1| hypothetical protein SORBIDRAFT_10g010010 [Sorghum bicolor]
 gb|EER88222.1| hypothetical protein SORBIDRAFT_10g010010 [Sorghum bicolor]
Length=629

 Score =   119 bits (299),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR D+ +F+  + T  R
Sbjct  548  IELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRADSHKFKVPDFTFSR  607

Query  322  -YSDFIEESSLIVEAMELSGPR  260
             YSD  ++SSL+V+A+ELSGPR
Sbjct  608  CYSDLTDDSSLLVQAVELSGPR  629


 Score = 68.9 bits (167),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  462  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  494


 Score = 53.1 bits (126),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ ANQKG +LDW
Sbjct  494  FGILLLELITGQTALEFGKAANQKGAMLDW  523



>ref|XP_004141483.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 gb|KGN52542.1| hypothetical protein Csa_5G642730 [Cucumis sativus]
Length=626

 Score =   118 bits (295),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            VELEEMVQVALLCTQ+ P HRPKMSEV+RMLEG+GLA +WEASQR D+ + + H+ ++  
Sbjct  545  VELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGEGLAVRWEASQRVDSTKCKPHDFSSSD  604

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  605  RYSDLTDDSSLLVQAMELSGPR  626


 Score = 69.3 bits (168),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 54.3 bits (129),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG ILDW
Sbjct  491  FGILLLELITGQRALEFGKAANQKGGILDW  520



>ref|XP_006301740.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
 gb|EOA34638.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
Length=634

 Score =   116 bits (291),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 69/89 (78%), Gaps = 8/89 (9%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDT--------PRFR  347
            VELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEASQ  +         P   
Sbjct  546  VELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEASQTGNGDSQPPPLPPGMV  605

Query  346  THENTPQRYSDFIEESSLIVEAMELSGPR  260
            +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  606  SSSPRVRYYSDYIQESSLVVEAIELSGPR  634


 Score = 68.9 bits (167),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 56.2 bits (134),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  492  FGILLLELITGQKALDFGRSSHQKGVMLDW  521



>ref|XP_002886588.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62847.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   115 bits (287),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 8/89 (9%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDT--------PRFR  347
            VELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q            P   
Sbjct  541  VELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGTAEHQPPPLPPGMV  600

Query  346  THENTPQRYSDFIEESSLIVEAMELSGPR  260
            +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  601  SSSPRVRYYSDYIQESSLVVEAIELSGPR  629


 Score = 68.6 bits (166),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  487


 Score = 57.4 bits (137),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR A+QKGV+LDW
Sbjct  487  FGILLLELITGQKALDFGRSAHQKGVMLDW  516



>gb|EEE57731.1| hypothetical protein OsJ_08242 [Oryza sativa Japonica Group]
Length=627

 Score =   120 bits (300),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE+WEASQR D+ +F+  E T  R
Sbjct  546  VELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAERWEASQRADSHKFKVPEFTFGR  605

Query  322  -YSDFIEESSLIVEAMELSGPR  260
             YSD  ++SSL+V+A+ELSGPR
Sbjct  606  CYSDLTDDSSLLVQAVELSGPR  627


 Score = 69.3 bits (168),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 52.4 bits (124),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ +NQKG +LDW
Sbjct  492  FGILLLELITGQTALEFGKSSNQKGAMLDW  521



>gb|EEC73926.1| hypothetical protein OsI_08784 [Oryza sativa Indica Group]
Length=627

 Score =   120 bits (300),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE+WEASQR D+ +F+  E T  R
Sbjct  546  VELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAERWEASQRADSHKFKVPEFTFGR  605

Query  322  -YSDFIEESSLIVEAMELSGPR  260
             YSD  ++SSL+V+A+ELSGPR
Sbjct  606  CYSDLTDDSSLLVQAVELSGPR  627


 Score = 69.3 bits (168),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 52.0 bits (123),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ +NQKG +LDW
Sbjct  492  FGILLLELITGQTALEFGKSSNQKGAMLDW  521



>emb|CDP02372.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   119 bits (299),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +E+EEMVQVALLCTQ+ PSHRPKMSEV++MLEGDGLAE+WE SQR ++ ++RT E +  +
Sbjct  543  IEVEEMVQVALLCTQYLPSHRPKMSEVIQMLEGDGLAERWEVSQRLESSKYRTQELSASE  602

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  603  RYSDLTDDSSLLAQAMELSGPR  624


 Score = 69.7 bits (169),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 52.0 bits (123),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++F + ANQKG +LDW
Sbjct  489  FGILLLELITGQRALEFNKAANQKGAMLDW  518



>gb|KHN07168.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=582

 Score =   118 bits (296),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +EL+E+VQVALLCTQ+ PS+RPKMSEV+RMLEGDGLAEKWEASQR ++ R R +E ++ +
Sbjct  501  IELDEIVQVALLCTQYLPSYRPKMSEVVRMLEGDGLAEKWEASQRAESTRSRGNELSSSE  560

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  561  RYSDLTDDSSLLAQAMELSGPR  582


 Score = 69.7 bits (169),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  415  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  447


 Score = 53.1 bits (126),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKG +LDW
Sbjct  447  FGILLLELISGQRALEFGKAANQKGAMLDW  476



>ref|XP_010942232.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score =   119 bits (298),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE V+VALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR + P+F+  E ++ +
Sbjct  543  IELEETVRVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVEAPKFKMPEVSSSE  602

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  603  RYSDLTDDSSLLVQAMELSGPR  624


 Score = 69.3 bits (168),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 52.4 bits (124),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +AV+FG+ ANQKG +LDW
Sbjct  489  FGILLLELITGLRAVEFGKAANQKGAMLDW  518



>ref|XP_006647834.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Oryza brachyantha]
Length=626

 Score =   119 bits (299),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE+WEASQR D+ +F+  E T  R
Sbjct  545  VELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAERWEASQRADSHKFKVPEFTFGR  604

Query  322  -YSDFIEESSLIVEAMELSGPR  260
             YSD  ++SSL+V+A+ELSGPR
Sbjct  605  CYSDLTDDSSLLVQAVELSGPR  626


 Score = 68.9 bits (167),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 52.0 bits (123),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ +NQKG +LDW
Sbjct  491  FGILLLELITGQTALEFGKSSNQKGAMLDW  520



>gb|EYU28925.1| hypothetical protein MIMGU_mgv1a003010mg [Erythranthe guttata]
Length=616

 Score =   116 bits (291),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 2/84 (2%)
 Frame = -3

Query  505  GVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE--NT  332
            G+E+EE VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQR +  R R +   ++
Sbjct  533  GMEVEETVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAEAMRCRANNEFSS  592

Query  331  PQRYSDFIEESSLIVEAMELSGPR  260
             +RYSD  ++S L V+AMELSGPR
Sbjct  593  SERYSDLTDDSLLFVQAMELSGPR  616


 Score = 68.9 bits (167),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  447  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  479


 Score = 55.5 bits (132),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+G+NQKG +LDW
Sbjct  479  FGILLLELITGQRALEFGKGSNQKGAMLDW  508



>gb|KHN07744.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=621

 Score =   118 bits (295),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  ++ R R +E ++ +
Sbjct  540  IELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQSAESTRSRGNELSSSE  599

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  600  RYSDLTDDSSLLAQAMELSGPR  621


 Score = 69.3 bits (168),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  454  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  486


 Score = 53.1 bits (126),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKG +LDW
Sbjct  486  FGILLLELISGQRALEFGKAANQKGAMLDW  515



>ref|XP_003517902.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Glycine max]
Length=621

 Score =   118 bits (295),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +EL+E+VQVALLCTQ+ PS+RPKMSEV+RMLEGDGLAEKWEASQR ++ R R +E ++ +
Sbjct  540  IELDEIVQVALLCTQYLPSYRPKMSEVVRMLEGDGLAEKWEASQRAESTRSRGNELSSSE  599

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  600  RYSDLTDDSSLLAQAMELSGPR  621


 Score = 69.3 bits (168),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  454  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  486


 Score = 53.1 bits (126),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKG +LDW
Sbjct  486  FGILLLELISGQRALEFGKAANQKGAMLDW  515



>ref|XP_006574993.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Glycine 
max]
 ref|XP_006574994.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Glycine 
max]
Length=621

 Score =   118 bits (295),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ  ++ R R +E ++ +
Sbjct  540  IELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQSAESTRSRGNELSSSE  599

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  600  RYSDLTDDSSLLAQAMELSGPR  621


 Score = 69.3 bits (168),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  454  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  486


 Score = 53.1 bits (126),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKG +LDW
Sbjct  486  FGILLLELISGQRALEFGKAANQKGAMLDW  515



>emb|CDY61508.1| BnaCnng37930D [Brassica napus]
Length=507

 Score =   115 bits (289),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 5/81 (6%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA++WEASQ             P  
Sbjct  432  VELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLADRWEASQSGGAKSL-----PPPY  486

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+I+ESSL+VEA+ELSGPR
Sbjct  487  YSDYIQESSLVVEAIELSGPR  507


 Score = 68.6 bits (166),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  346  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  378


 Score = 56.2 bits (134),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  378  FGILLLELITGQKALDFGRSSHQKGVMLDW  407



>emb|CDY44608.1| BnaCnng11570D [Brassica napus]
Length=507

 Score =   115 bits (289),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 5/81 (6%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA++WEASQ             P  
Sbjct  432  VELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLADRWEASQSGGAKSL-----PPPY  486

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD+I+ESSL+VEA+ELSGPR
Sbjct  487  YSDYIQESSLVVEAIELSGPR  507


 Score = 68.6 bits (166),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  346  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  378


 Score = 56.2 bits (134),  Expect(3) = 2e-48, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  378  FGILLLELITGQKALDFGRSSHQKGVMLDW  407



>ref|NP_176279.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
 sp|Q93ZS4.1|NIK3_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 3; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL07143.1| putative receptor kinase [Arabidopsis thaliana]
 gb|AAN12912.1| putative receptor kinase [Arabidopsis thaliana]
 gb|ACN59261.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE33734.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
Length=632

 Score =   114 bits (286),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 8/89 (9%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDT--------PRFR  347
            VELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q            P   
Sbjct  544  VELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGTGEHQPPPLPPGMV  603

Query  346  THENTPQRYSDFIEESSLIVEAMELSGPR  260
            +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  604  SSSPRVRYYSDYIQESSLVVEAIELSGPR  632


 Score = 68.6 bits (166),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  458  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  490


 Score = 57.4 bits (137),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR A+QKGV+LDW
Sbjct  490  FGILLLELITGQKALDFGRSAHQKGVMLDW  519



>ref|XP_011012714.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   116 bits (291),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALL TQ+ P+HRPKMSEV+RMLEGDGLAE+WEASQR +  + + HE ++  
Sbjct  546  IELEEMVQVALLSTQYLPNHRPKMSEVVRMLEGDGLAERWEASQRAEATKSKPHEFSSSD  605

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  606  RYSDLTDDSSLLVQAMELSGPR  627


 Score = 68.6 bits (166),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 55.5 bits (132),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  492  FGILLLELITGQRAIEFGKAANQKGAMLDW  521



>ref|XP_011012715.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score =   116 bits (291),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALL TQ+ P+HRPKMSEV+RMLEGDGLAE+WEASQR +  + + HE ++  
Sbjct  545  IELEEMVQVALLSTQYLPNHRPKMSEVVRMLEGDGLAERWEASQRAEATKSKPHEFSSSD  604

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  605  RYSDLTDDSSLLVQAMELSGPR  626


 Score = 68.6 bits (166),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 55.1 bits (131),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  491  FGILLLELITGQRAIEFGKAANQKGAMLDW  520



>ref|XP_004507264.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cicer arietinum]
Length=626

 Score =   120 bits (300),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 3/84 (4%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRN--DTPRFRTHE-NT  332
            +EL+EMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLA+KWEASQ+N  +T + + HE ++
Sbjct  543  IELDEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLADKWEASQKNVDNTTKCKQHELSS  602

Query  331  PQRYSDFIEESSLIVEAMELSGPR  260
              RYSD  ++SSL+++AMELSGPR
Sbjct  603  SDRYSDLTDDSSLLIQAMELSGPR  626


 Score = 69.7 bits (169),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 50.8 bits (120),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQKG +LDW
Sbjct  489  FGILLLELITGLRALEFGKAANQKGAMLDW  518



>ref|XP_010473259.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score =   115 bits (287),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 8/89 (9%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDT--------PRFR  347
            VELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q            P   
Sbjct  548  VELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGTGESQPPPLPPGMM  607

Query  346  THENTPQRYSDFIEESSLIVEAMELSGPR  260
            +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  608  SSSPRVRYYSDYIQESSLVVEAIELSGPR  636


 Score = 68.6 bits (166),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  462  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  494


 Score = 56.6 bits (135),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  494  FGILLLELITGQKALDFGRSSHQKGVMLDW  523



>ref|XP_010418023.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score =   115 bits (287),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 8/89 (9%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDT--------PRFR  347
            VELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q            P   
Sbjct  548  VELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGTGESQPPPLPPGMM  607

Query  346  THENTPQRYSDFIEESSLIVEAMELSGPR  260
            +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  608  SSSPRVRYYSDYIQESSLVVEAIELSGPR  636


 Score = 68.9 bits (167),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  462  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  494


 Score = 56.6 bits (135),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  494  FGILLLELITGQKALDFGRSSHQKGVMLDW  523



>ref|XP_010510906.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Camelina 
sativa]
Length=636

 Score =   115 bits (287),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 8/89 (9%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDT--------PRFR  347
            VELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q            P   
Sbjct  548  VELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGTGESQPPPLPPGMM  607

Query  346  THENTPQRYSDFIEESSLIVEAMELSGPR  260
            +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  608  SSSPRVRYYSDYIQESSLVVEAIELSGPR  636


 Score = 68.9 bits (167),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  462  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  494


 Score = 56.2 bits (134),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  494  FGILLLELITGQKALDFGRSSHQKGVMLDW  523



>ref|XP_010473260.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score =   115 bits (287),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 8/89 (9%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDT--------PRFR  347
            VELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q            P   
Sbjct  545  VELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGTGESQPPPLPPGMM  604

Query  346  THENTPQRYSDFIEESSLIVEAMELSGPR  260
            +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  605  SSSPRVRYYSDYIQESSLVVEAIELSGPR  633


 Score = 68.6 bits (166),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 56.6 bits (135),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  491  FGILLLELITGQKALDFGRSSHQKGVMLDW  520



>ref|XP_010418025.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score =   115 bits (287),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 8/89 (9%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDT--------PRFR  347
            VELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q            P   
Sbjct  545  VELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGTGESQPPPLPPGMM  604

Query  346  THENTPQRYSDFIEESSLIVEAMELSGPR  260
            +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  605  SSSPRVRYYSDYIQESSLVVEAIELSGPR  633


 Score = 68.9 bits (167),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 56.6 bits (135),  Expect(3) = 3e-48, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  491  FGILLLELITGQKALDFGRSSHQKGVMLDW  520



>gb|KHN14464.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=623

 Score =   119 bits (298),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQ-  326
            +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR DT + +  E++   
Sbjct  542  IELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVDTTKCKPQESSSSD  601

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++S L+V+AMELSGPR
Sbjct  602  RYSDLTDDSLLLVQAMELSGPR  623


 Score = 68.9 bits (167),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  456  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  488


 Score = 52.0 bits (123),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ AN KG +LDW
Sbjct  488  FGILLLELITGQRALEFGKSANNKGAMLDW  517



>gb|AAB71968.1| Putative Serine/Threonine protein kinase [Arabidopsis thaliana]
Length=588

 Score =   114 bits (285),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 8/89 (9%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDT--------PRFR  347
            VELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q            P   
Sbjct  500  VELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGTGEHQPPPLPPGMV  559

Query  346  THENTPQRYSDFIEESSLIVEAMELSGPR  260
            +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  560  SSSPRVRYYSDYIQESSLVVEAIELSGPR  588


 Score = 68.6 bits (166),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  414  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  446


 Score = 57.0 bits (136),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR A+QKGV+LDW
Sbjct  446  FGILLLELITGQKALDFGRSAHQKGVMLDW  475



>ref|XP_010510907.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Camelina 
sativa]
Length=633

 Score =   115 bits (287),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 8/89 (9%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDT--------PRFR  347
            VELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDGLAE+WEA+Q            P   
Sbjct  545  VELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDGLAERWEATQNGTGESQPPPLPPGMM  604

Query  346  THENTPQRYSDFIEESSLIVEAMELSGPR  260
            +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  605  SSSPRVRYYSDYIQESSLVVEAIELSGPR  633


 Score = 68.9 bits (167),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 56.2 bits (134),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  491  FGILLLELITGQKALDFGRSSHQKGVMLDW  520



>ref|XP_011020829.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   122 bits (307),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQR +  R R +E ++ +
Sbjct  541  IELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAEETRSRANEFSSSE  600

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  601  RYSDLTDDSSLLVQAMELSGPR  622


 Score = 69.3 bits (168),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  487


 Score = 48.1 bits (113),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+G +A++FG+  NQKG +LDW
Sbjct  487  FGILLLELISGLRALEFGKSTNQKGALLDW  516



>ref|XP_009765506.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana sylvestris]
Length=624

 Score =   119 bits (297),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +E+EE+VQVAL+CTQ++PS RPKMSEV+RMLEGDGLAEKWEASQ+ ++ R R +E ++ +
Sbjct  543  IEVEELVQVALICTQYHPSQRPKMSEVVRMLEGDGLAEKWEASQKAESTRCRANEFSSSE  602

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  603  RYSDLTDDSSLLVQAMELSGPR  624


 Score = 68.2 bits (165),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  489


 Score = 53.1 bits (126),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKG +LDW
Sbjct  489  FGILLLELISGQRALEFGKAANQKGAMLDW  518



>gb|ABG73621.1| leucine-rich repeat receptor-like kinase [Populus tomentosa]
Length=622

 Score =   122 bits (306),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQR +  R R +E ++ +
Sbjct  541  IELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAEESRSRANEFSSSE  600

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  601  RYSDLTDDSSLLVQAMELSGPR  622


 Score = 69.3 bits (168),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  487


 Score = 48.1 bits (113),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+G +A++FG+  NQKG +LDW
Sbjct  487  FGILLLELISGLRALEFGKSTNQKGALLDW  516



>ref|XP_011009019.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   122 bits (306),  Expect(3) = 5e-48, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQR +  R R +E ++ +
Sbjct  541  IELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAEETRSRANEFSSSE  600

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  601  RYSDLTDDSSLLVQAMELSGPR  622


 Score = 69.3 bits (168),  Expect(3) = 5e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  487


 Score = 48.1 bits (113),  Expect(3) = 5e-48, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+G +A++FG+  NQKG +LDW
Sbjct  487  FGILLLELISGLRALEFGKSTNQKGALLDW  516



>ref|XP_004171526.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
2-like, partial [Cucumis sativus]
Length=287

 Score =   116 bits (291),  Expect(3) = 5e-48, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            VELEEMVQVALLCTQ+ P HRP MSEV+RMLEG+GLA +WEASQR D+ + + H+ ++  
Sbjct  206  VELEEMVQVALLCTQYLPGHRPXMSEVVRMLEGEGLAVRWEASQRVDSTKCKPHDFSSSD  265

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  266  RYSDLTDDSSLLVQAMELSGPR  287


 Score = 68.9 bits (167),  Expect(3) = 5e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  120  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  152


 Score = 54.3 bits (129),  Expect(3) = 5e-48, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG ILDW
Sbjct  152  FGILLLELITGQRALEFGKAANQKGGILDW  181



>ref|XP_004149504.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cucumis sativus]
 ref|XP_004164846.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cucumis sativus]
Length=623

 Score =   115 bits (289),  Expect(3) = 6e-48, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+V+VALLC Q+ PSHRPKMSEV+RMLEGDGLAEKWEASQR +  R R +E ++ +
Sbjct  542  IELEEIVRVALLCIQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAEASRSRANEFSSSE  601

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL V+A++LSGPR
Sbjct  602  RYSDLTDDSSLFVQAIQLSGPR  623


 Score = 69.3 bits (168),  Expect(3) = 6e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  456  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  488


 Score = 54.3 bits (129),  Expect(3) = 6e-48, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+GQ+A++FG+ ANQKG ILDW
Sbjct  488  FGILLLELISGQRALEFGKAANQKGAILDW  517



>ref|XP_008243752.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Prunus mume]
 ref|XP_008243753.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Prunus mume]
Length=625

 Score =   117 bits (292),  Expect(3) = 6e-48, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEM+QVALLCTQ  PS RPKMSEV+RMLEGDGLAEKWEASQR ++ R R +E ++ +
Sbjct  544  IELEEMIQVALLCTQNLPSQRPKMSEVVRMLEGDGLAEKWEASQRAESNRCRANEFSSSE  603

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  604  RYSDLTDDSSLLAQAMELSGPR  625


 Score = 68.9 bits (167),  Expect(3) = 6e-48, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SH++TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  458  SHITTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  490


 Score = 53.5 bits (127),  Expect(3) = 6e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGIL+LELI+GQ+A++FG+ ANQKG ILDW
Sbjct  490  FGILILELISGQRALEFGKAANQKGAILDW  519



>tpg|DAA53257.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=428

 Score =   116 bits (290),  Expect(3) = 6e-48, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQV+LLCTQ++PSHRP+MSEV+RMLEGDGLAE+WEASQ  DTP   + E   Q+
Sbjct  347  VELEEMVQVSLLCTQYHPSHRPRMSEVIRMLEGDGLAERWEASQNVDTPESVSSELLLQK  406

Query  322  YSDF-IEESSLIVEAMELSGPR  260
            Y DF  +E SL +EAMELSGPR
Sbjct  407  YMDFAADECSLGLEAMELSGPR  428


 Score = 68.6 bits (166),  Expect(3) = 6e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  261  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  293


 Score = 54.7 bits (130),  Expect(3) = 6e-48, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FG+LL+ELITGQKA+DFGR ANQKG +LDW
Sbjct  293  FGVLLVELITGQKALDFGRVANQKGGVLDW  322



>ref|NP_001169689.1| LOC100383570 precursor [Zea mays]
 gb|ACN34528.1| unknown [Zea mays]
 tpg|DAA53256.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=634

 Score =   115 bits (289),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQV+LLCTQ++PSHRP+MSEV+RMLEGDGLAE+WEASQ  DTP   + E   Q+
Sbjct  553  VELEEMVQVSLLCTQYHPSHRPRMSEVIRMLEGDGLAERWEASQNVDTPESVSSELLLQK  612

Query  322  YSDF-IEESSLIVEAMELSGPR  260
            Y DF  +E SL +EAMELSGPR
Sbjct  613  YMDFAADECSLGLEAMELSGPR  634


 Score = 68.9 bits (167),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  467  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  499


 Score = 54.7 bits (130),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FG+LL+ELITGQKA+DFGR ANQKG +LDW
Sbjct  499  FGVLLVELITGQKALDFGRVANQKGGVLDW  528



>gb|KJB43139.1| hypothetical protein B456_007G186300 [Gossypium raimondii]
Length=475

 Score =   117 bits (292),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 71/83 (86%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFR-THE-NTP  329
            +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR ++ + +  HE ++ 
Sbjct  393  IELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRAESTKCKPPHEFSSS  452

Query  328  QRYSDFIEESSLIVEAMELSGPR  260
             RYSD  ++SSL+V+AMELSGPR
Sbjct  453  DRYSDLTDDSSLLVQAMELSGPR  475


 Score = 67.8 bits (164),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  307  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  339


 Score = 54.3 bits (129),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  339  FGILLLELITGQRALEFGKAANQKGAMLDW  368



>ref|XP_009356495.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Pyrus x bretschneideri]
 ref|XP_009356496.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Pyrus x bretschneideri]
Length=624

 Score =   117 bits (292),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEM+QVALLCTQ  PS RPKMSEV+RMLEGDGLAEKWEASQR ++ R R +E ++ +
Sbjct  543  IELEEMIQVALLCTQNLPSQRPKMSEVVRMLEGDGLAEKWEASQRAESNRCRANEFSSSE  602

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  603  RYSDLTDDSSLLAQAMELSGPR  624


 Score = 68.9 bits (167),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SH++TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHITTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 53.5 bits (127),  Expect(3) = 7e-48, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGIL+LELI+GQ+A++FG+ ANQKG ILDW
Sbjct  489  FGILILELISGQRALEFGKAANQKGAILDW  518



>ref|XP_002311408.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
 gb|EEE88775.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
Length=622

 Score =   121 bits (303),  Expect(3) = 9e-48, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQR +  + R +E ++ +
Sbjct  541  IELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAEETKSRANEFSSSE  600

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  601  RYSDLTDDSSLLVQAMELSGPR  622


 Score = 69.3 bits (168),  Expect(3) = 9e-48, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  487


 Score = 48.1 bits (113),  Expect(3) = 9e-48, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+G +A++FG+  NQKG +LDW
Sbjct  487  FGILLLELISGLRALEFGKSTNQKGALLDW  516



>ref|XP_002514536.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF47642.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=576

 Score =   121 bits (304),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+V+VALLCTQF P HRPKMSEV+RMLEGDGLAEKWEASQR +  R R +E ++ +
Sbjct  495  IELEEIVRVALLCTQFIPGHRPKMSEVVRMLEGDGLAEKWEASQRAEATRSRANEFSSSE  554

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  555  RYSDLTDDSSLLVQAMELSGPR  576


 Score = 69.3 bits (168),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  409  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  441


 Score = 47.8 bits (112),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLEL+ G +A++FG+ ANQKG +LDW
Sbjct  441  FGILLLELVHGLRALEFGKSANQKGAMLDW  470



>gb|KJB43138.1| hypothetical protein B456_007G186300 [Gossypium raimondii]
Length=625

 Score =   117 bits (292),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 71/83 (86%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFR-THE-NTP  329
            +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR ++ + +  HE ++ 
Sbjct  543  IELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRAESTKCKPPHEFSSS  602

Query  328  QRYSDFIEESSLIVEAMELSGPR  260
             RYSD  ++SSL+V+AMELSGPR
Sbjct  603  DRYSDLTDDSSLLVQAMELSGPR  625


 Score = 67.8 bits (164),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  489


 Score = 54.3 bits (129),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  489  FGILLLELITGQRALEFGKAANQKGAMLDW  518



>ref|XP_003531900.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Glycine max]
Length=623

 Score =   117 bits (294),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQ-  326
            +E EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR DT + +  E++   
Sbjct  542  IEFEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVDTTKCKPQESSSSD  601

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++S L+V+AMELSGPR
Sbjct  602  RYSDLTDDSLLLVQAMELSGPR  623


 Score = 68.9 bits (167),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  456  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  488


 Score = 52.0 bits (123),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ AN KG +LDW
Sbjct  488  FGILLLELITGQRALEFGKSANNKGAMLDW  517



>ref|XP_004965216.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Setaria italica]
Length=661

 Score =   116 bits (291),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQ  D+ +F+  E + +R
Sbjct  580  IELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQCADSHKFKVPEFSFRR  639

Query  322  -YSDFIEESSLIVEAMELSGPR  260
             YSD  ++SSL+V+A+ELSGPR
Sbjct  640  CYSDLTDDSSLLVQAVELSGPR  661


 Score = 68.9 bits (167),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  494  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  526


 Score = 53.1 bits (126),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ ANQKG +LDW
Sbjct  526  FGILLLELITGQTALEFGKAANQKGAMLDW  555



>ref|XP_008389350.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
2-like [Malus domestica]
Length=621

 Score =   115 bits (289),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEM+QVALLCTQ  P+ RPKMSEV+RMLEGDGLAEKWEASQR ++ R R +E ++ +
Sbjct  540  IELEEMIQVALLCTQNLPNQRPKMSEVVRMLEGDGLAEKWEASQRAESNRCRANEFSSSE  599

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  600  RYSDLTDDSSLLAQAMELSGPR  621


 Score = 68.9 bits (167),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SH++TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  454  SHITTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  486


 Score = 53.5 bits (127),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGIL+LELI+GQ+A++FG+ ANQKG ILDW
Sbjct  486  FGILILELISGQRALEFGKAANQKGAILDW  515



>dbj|BAK02609.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=632

 Score =   120 bits (301),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDGLAEKWEASQ  DTP+  + E  P +
Sbjct  550  VELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAEKWEASQNVDTPKSVSSELLPLK  609

Query  322  YSDF--IEESSLIVEAMELSGPR  260
            ++DF   +ESS+ +EAMELSGPR
Sbjct  610  FTDFAGADESSVGLEAMELSGPR  632


 Score = 68.2 bits (165),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            +HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  464  THVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  496


 Score = 50.1 bits (118),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILD  507
            FG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  496  FGVLLVELITGQKALDFGRLANQKGGVLD  524



>ref|XP_011099082.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Sesamum 
indicum]
Length=627

 Score =   114 bits (286),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE+WEASQR ++ + +T E ++ +
Sbjct  546  IELEEMVQVALLCTQYLPGLRPKMSEVVRMLEGDGLAERWEASQRLESNKLKTQELSSSE  605

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +A+ELSGPR
Sbjct  606  RYSDLTDDSSLLAQAIELSGPR  627


 Score = 69.7 bits (169),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 53.9 bits (128),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+ FG+ ANQKG +LDW
Sbjct  492  FGILLLELITGQRALQFGKSANQKGAVLDW  521



>ref|XP_003563960.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Brachypodium 
distachyon]
Length=629

 Score =   117 bits (293),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE+W+ASQR D+ +F   E T  R
Sbjct  548  IELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAERWQASQRADSHKFTVPEFTFSR  607

Query  322  -YSDFIEESSLIVEAMELSGPR  260
             YSD  ++SSL+V+A+ELSGPR
Sbjct  608  CYSDLTDDSSLLVQAVELSGPR  629


 Score = 68.9 bits (167),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  462  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  494


 Score = 52.0 bits (123),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ +NQKG +LDW
Sbjct  494  FGILLLELITGQTALEFGKASNQKGAMLDW  523



>ref|XP_010492459.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Camelina sativa]
Length=640

 Score =   115 bits (288),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 69/87 (79%), Gaps = 6/87 (7%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTP------RFRTH  341
            +EL+EMV+VALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR+DT       R    
Sbjct  554  IELDEMVRVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRSDTSTSKCSNRINEL  613

Query  340  ENTPQRYSDFIEESSLIVEAMELSGPR  260
             ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  614  MSSSDRYSDLTDDSTLLVQAMELSGPR  640


 Score = 68.2 bits (165),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            +HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  466  THVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  498


 Score = 54.7 bits (130),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLEL+TGQ+A +FG+ ANQKGV+LDW
Sbjct  498  FGILLLELVTGQRAFEFGKAANQKGVMLDW  527



>ref|XP_008339771.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Malus domestica]
Length=625

 Score =   115 bits (289),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +E+EEM+QVALLCTQ  PS RPKMSEV+RMLEGDGLAEKWEASQR ++ R R +E ++ +
Sbjct  544  IEVEEMIQVALLCTQNLPSQRPKMSEVVRMLEGDGLAEKWEASQRAESNRCRANEFSSSE  603

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  604  RYSDLTDDSSLLAQAMELSGPR  625


 Score = 68.9 bits (167),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SH++TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  458  SHITTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  490


 Score = 53.5 bits (127),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGIL+LELI+GQ+A++FG+ ANQKG ILDW
Sbjct  490  FGILILELISGQRALEFGKAANQKGAILDW  519



>ref|XP_011099081.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Sesamum 
indicum]
Length=631

 Score =   114 bits (286),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE+WEASQR ++ + +T E ++ +
Sbjct  550  IELEEMVQVALLCTQYLPGLRPKMSEVVRMLEGDGLAERWEASQRLESNKLKTQELSSSE  609

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +A+ELSGPR
Sbjct  610  RYSDLTDDSSLLAQAIELSGPR  631


 Score = 69.7 bits (169),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  464  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  496


 Score = 53.9 bits (128),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A+ FG+ ANQKG +LDW
Sbjct  496  FGILLLELITGQRALQFGKSANQKGAVLDW  525



>ref|XP_010905760.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=635

 Score =   115 bits (289),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR +  + + HE + +R
Sbjct  554  IELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVEAYKCKLHEFSSER  613

Query  322  Y-SDFIEESSLIVEAMELSGPR  260
              SD  ++SSL+V+AMELSGPR
Sbjct  614  CSSDLTDDSSLLVQAMELSGPR  635


 Score = 69.3 bits (168),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  468  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  500


 Score = 53.1 bits (126),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ ANQKG +LDW
Sbjct  500  FGILLLELITGQTALEFGKAANQKGAMLDW  529



>ref|XP_010230510.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Brachypodium 
distachyon]
Length=603

 Score =   119 bits (297),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAEKWEASQ  DTP+  + E  P +
Sbjct  521  VELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAEKWEASQNVDTPKSVSSELIPPK  580

Query  322  YSDF--IEESSLIVEAMELSGPR  260
            + D    +ESSL +EAMELSGPR
Sbjct  581  FMDLAAADESSLGLEAMELSGPR  603


 Score = 68.9 bits (167),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  435  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  467


 Score = 50.1 bits (118),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILD  507
            FG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  467  FGVLLVELITGQKALDFGRLANQKGGVLD  495



>dbj|BAJ89901.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=625

 Score =   117 bits (292),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDGLAE+W+ASQR D+ +F   E T  R
Sbjct  544  IELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDGLAERWQASQRADSHKFTVPEFTFSR  603

Query  322  -YSDFIEESSLIVEAMELSGPR  260
             YSD  ++SSL+V+A+ELSGPR
Sbjct  604  CYSDLTDDSSLLVQAVELSGPR  625


 Score = 68.9 bits (167),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  458  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  490


 Score = 52.0 bits (123),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ +NQKG +LDW
Sbjct  490  FGILLLELITGQTALEFGKASNQKGAMLDW  519



>ref|XP_008807033.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Phoenix 
dactylifera]
Length=624

 Score =   115 bits (289),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR D   F+  E + +R
Sbjct  543  IELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRVDAHMFKLPEFSSER  602

Query  322  -YSDFIEESSLIVEAMELSGPR  260
             +SD  ++SSL+ +AMELSGPR
Sbjct  603  CFSDLTDDSSLLAQAMELSGPR  624


 Score = 69.3 bits (168),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 53.1 bits (126),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ ANQKG +LDW
Sbjct  489  FGILLLELITGQTALEFGKAANQKGAMLDW  518



>ref|XP_003569325.2| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brachypodium 
distachyon]
Length=631

 Score =   119 bits (297),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAEKWEASQ  DTP+  + E  P +
Sbjct  549  VELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAEKWEASQNVDTPKSVSSELIPPK  608

Query  322  YSDF--IEESSLIVEAMELSGPR  260
            + D    +ESSL +EAMELSGPR
Sbjct  609  FMDLAAADESSLGLEAMELSGPR  631


 Score = 68.9 bits (167),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  463  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  495


 Score = 50.1 bits (118),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILD  507
            FG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  495  FGVLLVELITGQKALDFGRLANQKGGVLD  523



>ref|XP_010230509.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brachypodium 
distachyon]
Length=633

 Score =   119 bits (297),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAEKWEASQ  DTP+  + E  P +
Sbjct  551  VELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAEKWEASQNVDTPKSVSSELIPPK  610

Query  322  YSDF--IEESSLIVEAMELSGPR  260
            + D    +ESSL +EAMELSGPR
Sbjct  611  FMDLAAADESSLGLEAMELSGPR  633


 Score = 68.9 bits (167),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  465  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  497


 Score = 50.1 bits (118),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILD  507
            FG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  497  FGVLLVELITGQKALDFGRLANQKGGVLD  525



>ref|XP_010230511.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X4 [Brachypodium 
distachyon]
Length=601

 Score =   118 bits (296),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDGLAEKWEASQ  DTP+  + E  P +
Sbjct  519  VELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDGLAEKWEASQNVDTPKSVSSELIPPK  578

Query  322  YSDF--IEESSLIVEAMELSGPR  260
            + D    +ESSL +EAMELSGPR
Sbjct  579  FMDLAAADESSLGLEAMELSGPR  601


 Score = 68.9 bits (167),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  433  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  465


 Score = 50.1 bits (118),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILD  507
            FG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  465  FGVLLVELITGQKALDFGRLANQKGGVLD  493



>ref|XP_004297175.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Fragaria vesca subsp. 
vesca]
Length=624

 Score =   115 bits (289),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHEN--TP  329
            +ELEEM+QVALLCTQ  P  RPKMSEV+RMLEGDGLAEKWEASQR ++ R RT+ +  + 
Sbjct  542  IELEEMIQVALLCTQNLPGQRPKMSEVVRMLEGDGLAEKWEASQRAESNRCRTNNDFSSS  601

Query  328  QRYSDFIEESSLIVEAMELSGPR  260
            +RYSD  ++SSL+ +AMELSGPR
Sbjct  602  ERYSDLTDDSSLLAQAMELSGPR  624


 Score = 68.9 bits (167),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SH++TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  456  SHITTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  488


 Score = 53.5 bits (127),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGIL+LELI+GQ+A++FG+ ANQKG ILDW
Sbjct  488  FGILVLELISGQRALEFGKAANQKGAILDW  517



>ref|XP_006287253.1| hypothetical protein CARUB_v10000442mg [Capsella rubella]
 gb|EOA20151.1| hypothetical protein CARUB_v10000442mg [Capsella rubella]
Length=640

 Score =   114 bits (284),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 5/86 (6%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTP-----RFRTHE  338
            +EL+EMV+VALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR D+      R     
Sbjct  555  IELDEMVRVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRTDSTSKCSNRINELI  614

Query  337  NTPQRYSDFIEESSLIVEAMELSGPR  260
            ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  615  SSSDRYSDLTDDSTLLVQAMELSGPR  640


 Score = 69.3 bits (168),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  467  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  499


 Score = 55.1 bits (131),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLEL+TGQ+A +FG+ ANQKGV+LDW
Sbjct  499  FGILLLELVTGQRAFEFGKAANQKGVMLDW  528



>ref|XP_010453748.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Camelina sativa]
Length=639

 Score =   114 bits (286),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 69/87 (79%), Gaps = 6/87 (7%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTP------RFRTH  341
            +EL+EMV+VALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR+DT       R    
Sbjct  553  IELDEMVRVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRSDTSTSKCSNRINEL  612

Query  340  ENTPQRYSDFIEESSLIVEAMELSGPR  260
             ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  613  MSSSDRYSDLNDDSTLLVQAMELSGPR  639


 Score = 68.6 bits (166),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            +HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  465  THVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  497


 Score = 54.7 bits (130),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLEL+TGQ+A +FG+ ANQKGV+LDW
Sbjct  497  FGILLLELVTGQRAFEFGKAANQKGVMLDW  526



>ref|XP_004232118.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=626

 Score =   114 bits (286),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 72/83 (87%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRND-TPRFRTHE-NTP  329
            +ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE+WEASQ+ D + +++T E ++ 
Sbjct  544  IELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAERWEASQKFDGSNKYKTKELSSS  603

Query  328  QRYSDFIEESSLIVEAMELSGPR  260
            +R+SD  ++S L+V+AMELSGPR
Sbjct  604  ERFSDLTDDSLLLVQAMELSGPR  626


 Score = 68.9 bits (167),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  458  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  490


 Score = 53.9 bits (128),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQKGV+LDW
Sbjct  490  FGILLLELITGMRAIEFGKAANQKGVMLDW  519



>ref|NP_001140727.1| uncharacterized LOC100272802 [Zea mays]
 gb|ACF84475.1| unknown [Zea mays]
 gb|ACR35282.1| unknown [Zea mays]
 gb|AFW80156.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=251

 Score =   114 bits (285),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 4/86 (5%)
 Frame = -3

Query  505  GVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGD-GLAEKWEASQRN-DTPRFRTHENT  332
            GVELEEMVQ+ALLCTQ++PSHRP+MSEV+RMLEG+ GLAE+WEASQ N DTP+  + E  
Sbjct  166  GVELEEMVQLALLCTQYHPSHRPRMSEVIRMLEGEPGLAERWEASQSNVDTPKSVSSELL  225

Query  331  PQRYSDF--IEESSLIVEAMELSGPR  260
            P +Y DF   +ESSL +EAMELSGPR
Sbjct  226  PPKYVDFAAADESSLGLEAMELSGPR  251


 Score = 68.9 bits (167),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  81   SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  113


 Score = 54.7 bits (130),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FG+LL+EL+TGQKA+DFGR ANQKG +LDW
Sbjct  113  FGVLLVELVTGQKALDFGRVANQKGGVLDW  142



>ref|XP_011011496.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   120 bits (300),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLC Q+ PSHRPKMSEV+RMLEGDGLAEKWEASQR +  R R +E ++ +
Sbjct  541  IELEEIVQVALLCIQYLPSHRPKMSEVVRMLEGDGLAEKWEASQRAEETRSRANEFSSSE  600

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  601  RYSDMTDDSSLLVQAMELSGPR  622


 Score = 69.3 bits (168),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  487


 Score = 48.1 bits (113),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+G +A++FG+  NQKG +LDW
Sbjct  487  FGILLLELISGLRALEFGKSTNQKGALLDW  516



>ref|XP_006400129.1| hypothetical protein EUTSA_v10012948mg [Eutrema salsugineum]
 gb|ESQ41582.1| hypothetical protein EUTSA_v10012948mg [Eutrema salsugineum]
Length=637

 Score =   114 bits (285),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 5/86 (6%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTP-----RFRTHE  338
            +ELEEMV+VALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR+D+      R     
Sbjct  552  IELEEMVRVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRSDSASKCSNRITEFM  611

Query  337  NTPQRYSDFIEESSLIVEAMELSGPR  260
            ++  RYSD  ++S+L+ +AMELSGPR
Sbjct  612  SSSDRYSDLTDDSTLLAQAMELSGPR  637


 Score = 69.3 bits (168),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  464  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  496


 Score = 53.9 bits (128),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLEL+TGQ+A++FG+ ANQKG +LDW
Sbjct  496  FGILLLELVTGQRALEFGKAANQKGAMLDW  525



>ref|XP_007221991.1| hypothetical protein PRUPE_ppa002873mg [Prunus persica]
 gb|EMJ23190.1| hypothetical protein PRUPE_ppa002873mg [Prunus persica]
Length=625

 Score =   114 bits (286),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEM+QVALLCTQ  P  RPKMSEV+RMLEGDGLAEKWEASQR ++ R R +E ++ +
Sbjct  544  IELEEMIQVALLCTQNLPRQRPKMSEVVRMLEGDGLAEKWEASQRAESNRCRANEFSSSE  603

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+ +AMELSGPR
Sbjct  604  RYSDLTDDSSLLAQAMELSGPR  625


 Score = 68.9 bits (167),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SH++TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  458  SHITTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  490


 Score = 53.5 bits (127),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGIL+LELI+GQ+A++FG+ ANQKG ILDW
Sbjct  490  FGILILELISGQRALEFGKAANQKGAILDW  519



>ref|XP_011021146.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   115 bits (287),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ PS RPKM EV++MLEGDGLAE WEASQR +  + + HE ++  
Sbjct  546  IELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDGLAESWEASQRAEATKSKPHEFSSSD  605

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  606  RYSDLTDDSSLLVQAMELSGPR  627


 Score = 67.8 bits (164),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  492


 Score = 54.3 bits (129),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  492  FGILLLELITGQRALEFGKAANQKGAMLDW  521



>ref|XP_006373507.1| hypothetical protein POPTR_0017s14360g [Populus trichocarpa]
 gb|ERP51304.1| hypothetical protein POPTR_0017s14360g [Populus trichocarpa]
Length=596

 Score =   115 bits (287),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ PS RPKM EV++MLEGDGLAE WEASQR +  + + HE ++  
Sbjct  515  IELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDGLAESWEASQRAEATKSKPHEFSSSD  574

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  575  RYSDLTDDSSLLVQAMELSGPR  596


 Score = 67.8 bits (164),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  429  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  461


 Score = 54.3 bits (129),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  461  FGILLLELITGQRALEFGKAANQKGAMLDW  490



>ref|XP_011021148.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score =   115 bits (287),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ PS RPKM EV++MLEGDGLAE WEASQR +  + + HE ++  
Sbjct  545  IELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDGLAESWEASQRAEATKSKPHEFSSSD  604

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  605  RYSDLTDDSSLLVQAMELSGPR  626


 Score = 67.8 bits (164),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  491


 Score = 54.3 bits (129),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  491  FGILLLELITGQRALEFGKAANQKGAMLDW  520



>gb|KEH25223.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=625

 Score =   115 bits (287),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 71/82 (87%), Gaps = 2/82 (2%)
 Frame = -3

Query  499  ELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRND-TPRFRTHE-NTPQ  326
            ELEE+VQVALLCTQ+ P+HRPKMSEV+RMLEGDGLAEKWEASQR D T + + +E ++  
Sbjct  544  ELEEIVQVALLCTQYLPAHRPKMSEVVRMLEGDGLAEKWEASQRADNTTKGKPYELSSSD  603

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            R+SD  ++SSL+++AMELSGPR
Sbjct  604  RFSDLTDDSSLLIQAMELSGPR  625


 Score = 69.7 bits (169),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 52.4 bits (124),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQKGV+LDW
Sbjct  489  FGILLLELITGLRALEFGKAANQKGVMLDW  518



>ref|XP_006392114.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
 gb|ESQ29400.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
Length=634

 Score =   111 bits (278),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 69/96 (72%), Gaps = 22/96 (23%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQR---------------  368
            VELEE+VQVALLCTQFNPS RPKMSEV++MLEGDGLAE+WEASQ                
Sbjct  546  VELEEIVQVALLCTQFNPSFRPKMSEVMKMLEGDGLAERWEASQNGAAESLPPPLPSGMV  605

Query  367  NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  260
            + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  606  SSSPRVR-------YYSDYIQESSLVVEAIELSGPR  634


 Score = 68.9 bits (167),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 56.2 bits (134),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  492  FGILLLELITGQKALDFGRSSHQKGVMLDW  521



>gb|KDO70180.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=552

 Score =   117 bits (294),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAEKW ASQ+ +  R R +E ++ +
Sbjct  471  IELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAEKWAASQKAEATRSRANEFSSSE  530

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  531  RYSDLTDDSSLLVQAMELSGPR  552


 Score = 69.7 bits (169),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  385  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  417


 Score = 49.3 bits (116),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+G +A++FG+ ANQKG +LDW
Sbjct  417  FGILLLELISGLRALEFGKTANQKGAMLDW  446



>gb|AFO67891.1| leucine-rich repeat receptor-like kinase (mitochondrion) [Brassica 
rapa subsp. oleifera]
Length=635

 Score =   111 bits (278),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 22/96 (23%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQR---------------  368
            VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA++WEASQ                
Sbjct  547  VELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLADRWEASQSGGAKSLPPPLPSGMV  606

Query  367  NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  260
            + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  607  SSSPRVR-------YYSDYIQESSLVVEAIELSGPR  635


 Score = 68.9 bits (167),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  461  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  493


 Score = 56.2 bits (134),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  493  FGILLLELITGQKALDFGRSSHQKGVMLDW  522



>emb|CDY46185.1| BnaA01g23070D [Brassica napus]
Length=636

 Score =   111 bits (278),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 22/96 (23%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQR---------------  368
            VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA++WEASQ                
Sbjct  548  VELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLADRWEASQSGGAKSLPPPLPSGMV  607

Query  367  NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  260
            + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  608  SSSPRVR-------YYSDYIQESSLVVEAIELSGPR  636


 Score = 68.9 bits (167),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  462  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  494


 Score = 56.2 bits (134),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  494  FGILLLELITGQKALDFGRSSHQKGVMLDW  523



>ref|XP_004304172.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Fragaria vesca subsp. 
vesca]
Length=622

 Score =   118 bits (296),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEM+QVALLCTQ+ P HRP+MSEV+RMLEGDGL E+WEASQR ++ + + + ++  R
Sbjct  542  IELEEMIQVALLCTQYLPGHRPRMSEVVRMLEGDGLVERWEASQRAESTKSKAYFSSSDR  601

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD  ++SSL+V+AMELSGPR
Sbjct  602  YSDLTDDSSLLVQAMELSGPR  622


 Score = 67.8 bits (164),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGT+GHIAPEYLSTGQSS+KTDVFGF
Sbjct  456  SHVTTAVRGTIGHIAPEYLSTGQSSDKTDVFGF  488


 Score = 50.4 bits (119),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++F +  NQKG ILDW
Sbjct  488  FGILLLELITGQTALEFAKSTNQKGAILDW  517



>gb|EYU44266.1| hypothetical protein MIMGU_mgv1a002951mg [Erythranthe guttata]
Length=622

 Score =   116 bits (290),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEE+VQVALLCTQ+ P  RPKMSE++RMLEGDGLAE+WEASQR ++ +F+T E ++ +
Sbjct  541  IELEEIVQVALLCTQYLPGLRPKMSEIVRMLEGDGLAERWEASQRLESNKFKTQELSSSE  600

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSLI +A+ELSGPR
Sbjct  601  RYSDLTDDSSLIAQAIELSGPR  622


 Score = 69.7 bits (169),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  487


 Score = 50.8 bits (120),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A+ FG+ ANQKG +LDW
Sbjct  487  FGILLLELITGLRALQFGKSANQKGAVLDW  516



>ref|XP_010528022.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Tarenaya hassleriana]
Length=637

 Score =   117 bits (292),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 72/86 (84%), Gaps = 5/86 (6%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-----  338
            +E+EEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDGLAEKWEASQ+ ++   R++      
Sbjct  552  IEVEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDGLAEKWEASQQRNSETHRSYSRPNEF  611

Query  337  NTPQRYSDFIEESSLIVEAMELSGPR  260
            ++ +RYSD  ++S+L+V+AMELSGPR
Sbjct  612  SSSERYSDLTDDSTLLVQAMELSGPR  637


 Score = 69.3 bits (168),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  466  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  498


 Score = 50.1 bits (118),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+G +A++FG+ ANQKG +LDW
Sbjct  498  FGILLLELISGLRALEFGKAANQKGAMLDW  527



>gb|KDO70181.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=549

 Score =   117 bits (294),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAEKW ASQ+ +  R R +E ++ +
Sbjct  468  IELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAEKWAASQKAEATRSRANEFSSSE  527

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  528  RYSDLTDDSSLLVQAMELSGPR  549


 Score = 69.3 bits (168),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  382  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  414


 Score = 49.3 bits (116),  Expect(3) = 4e-47, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+G +A++FG+ ANQKG +LDW
Sbjct  414  FGILLLELISGLRALEFGKTANQKGAMLDW  443



>ref|XP_009104025.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brassica 
rapa]
Length=635

 Score =   111 bits (277),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 22/96 (23%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQR---------------  368
            VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA++WEASQ                
Sbjct  547  VELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLADRWEASQSGGAKSLPPPLPSGMV  606

Query  367  NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  260
            + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  607  SSSPRVR-------YYSDYIQESSLVVEAIELSGPR  635


 Score = 68.6 bits (166),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  461  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  493


 Score = 56.2 bits (134),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  493  FGILLLELITGQKALDFGRSSHQKGVMLDW  522



>ref|XP_009104018.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brassica 
rapa]
Length=636

 Score =   111 bits (277),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 22/96 (23%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQR---------------  368
            VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA++WEASQ                
Sbjct  548  VELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLADRWEASQSGGAKSLPPPLPSGMV  607

Query  367  NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  260
            + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  608  SSSPRVR-------YYSDYIQESSLVVEAIELSGPR  636


 Score = 68.6 bits (166),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  462  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  494


 Score = 56.2 bits (134),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  494  FGILLLELITGQKALDFGRSSHQKGVMLDW  523



>emb|CDY61461.1| BnaC01g43240D [Brassica napus]
Length=635

 Score =   111 bits (277),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 22/96 (23%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQR---------------  368
            VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDGLA++WEASQ                
Sbjct  547  VELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDGLADRWEASQSGGAKSLPPPLPSGMV  606

Query  367  NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  260
            + +PR R        YSD+I+ESSL+VEA+ELSGPR
Sbjct  607  SSSPRVR-------YYSDYIQESSLVVEAIELSGPR  635


 Score = 68.6 bits (166),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  461  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  493


 Score = 56.2 bits (134),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  493  FGILLLELITGQKALDFGRSSHQKGVMLDW  522



>ref|XP_010929457.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score =   117 bits (292),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDGLAE+WEASQR +  +F+  E ++ +
Sbjct  543  IELEEMVQVALLCTQYLPGQRPKMSEVVRMLEGDGLAERWEASQRVEAHKFKMPEFSSSE  602

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  603  RYSDLTDDSSLLVQAMELSGPR  624


 Score = 69.3 bits (168),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 50.1 bits (118),  Expect(3) = 5e-47, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGIL+LELITG +A++FG+ ANQKG +LDW
Sbjct  489  FGILILELITGLRAMEFGKAANQKGAMLDW  518



>ref|XP_006484307.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Citrus sinensis]
 gb|KDO70177.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=621

 Score =   117 bits (293),  Expect(3) = 6e-47, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAEKW ASQ+ +  R R +E ++ +
Sbjct  540  IELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAEKWAASQKAEATRSRANEFSSSE  599

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  600  RYSDLTDDSSLLVQAMELSGPR  621


 Score = 69.3 bits (168),  Expect(3) = 6e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  454  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  486


 Score = 48.9 bits (115),  Expect(3) = 6e-47, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+G +A++FG+ ANQKG +LDW
Sbjct  486  FGILLLELISGLRALEFGKTANQKGAMLDW  515



>ref|XP_006437790.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
 gb|ESR51030.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
Length=621

 Score =   117 bits (293),  Expect(3) = 6e-47, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDGLAEKW ASQ+ +  R R +E ++ +
Sbjct  540  IELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDGLAEKWAASQKAEATRSRANEFSSSE  599

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  600  RYSDLTDDSSLLVQAMELSGPR  621


 Score = 69.3 bits (168),  Expect(3) = 6e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  454  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  486


 Score = 48.9 bits (115),  Expect(3) = 6e-47, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELI+G +A++FG+ ANQKG +LDW
Sbjct  486  FGILLLELISGLRALEFGKTANQKGAMLDW  515



>gb|ABD96908.1| hypothetical protein [Cleome spinosa]
Length=630

 Score =   111 bits (277),  Expect(3) = 7e-47, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 67/89 (75%), Gaps = 8/89 (9%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTP--------RFR  347
            +ELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR D+         R  
Sbjct  542  LELEETVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRTDSTAKCSSSSSRRL  601

Query  346  THENTPQRYSDFIEESSLIVEAMELSGPR  260
               ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  602  NELSSSDRYSDLTDDSTLLVQAMELSGPR  630


 Score = 68.9 bits (167),  Expect(3) = 7e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  456  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  488


 Score = 55.8 bits (133),  Expect(3) = 7e-47, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG ILDW
Sbjct  488  FGILLLELITGQRALEFGKSANQKGAILDW  517



>ref|XP_004491764.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cicer arietinum]
Length=629

 Score =   112 bits (280),  Expect(3) = 7e-47, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 69/84 (82%), Gaps = 4/84 (5%)
 Frame = -3

Query  499  ELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQR---NDTPRFRTHENT-  332
            ELEEMVQVALLCTQ+ PS+RPKMSEV+RMLEGDGLAE+WEA Q+   N   +++ HE++ 
Sbjct  546  ELEEMVQVALLCTQYLPSNRPKMSEVVRMLEGDGLAERWEAYQKTTDNSNAKYKPHESSL  605

Query  331  PQRYSDFIEESSLIVEAMELSGPR  260
              RYSD  ++S L+V+AMELSGPR
Sbjct  606  SDRYSDLTDDSLLLVQAMELSGPR  629


 Score = 69.3 bits (168),  Expect(3) = 7e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 54.3 bits (129),  Expect(3) = 7e-47, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  491  FGILLLELITGQRALEFGKAANQKGAMLDW  520



>ref|XP_002452616.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
 gb|EES05592.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
Length=626

 Score =   114 bits (286),  Expect(3) = 8e-47, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE+WEASQ  ++ +F+  E +  R
Sbjct  545  IELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLAERWEASQHTESHKFKVPEFSFSR  604

Query  322  -YSDFIEESSLIVEAMELSGPR  260
             +SD  ++SSL+V+A+ELSGPR
Sbjct  605  CHSDLTDDSSLLVQAVELSGPR  626


 Score = 69.3 bits (168),  Expect(3) = 8e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 52.0 bits (123),  Expect(3) = 8e-47, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ +NQKG +LDW
Sbjct  491  FGILLLELITGQTALEFGKSSNQKGAMLDW  520



>ref|XP_010558545.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558546.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
Length=637

 Score =   111 bits (277),  Expect(3) = 9e-47, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 67/89 (75%), Gaps = 8/89 (9%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTP--------RFR  347
            +ELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR D+         R  
Sbjct  549  LELEETVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRTDSTAKCSSSSSRRL  608

Query  346  THENTPQRYSDFIEESSLIVEAMELSGPR  260
               ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  609  NELSSSDRYSDLTDDSTLLVQAMELSGPR  637


 Score = 68.9 bits (167),  Expect(3) = 9e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  463  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  495


 Score = 55.5 bits (132),  Expect(3) = 9e-47, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG ILDW
Sbjct  495  FGILLLELITGQRALEFGKSANQKGAILDW  524



>gb|AHF18212.1| brassinosteroid insensitive 1-associated receptor kinase 1 [Saccharum 
hybrid cultivar]
Length=626

 Score =   114 bits (286),  Expect(3) = 9e-47, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE+WEASQ  ++ +F+  E +  R
Sbjct  545  IELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLAERWEASQHTESHKFKVPEFSFSR  604

Query  322  -YSDFIEESSLIVEAMELSGPR  260
             +SD  ++SSL+V+A+ELSGPR
Sbjct  605  CHSDLTDDSSLLVQAVELSGPR  626


 Score = 68.9 bits (167),  Expect(3) = 9e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 52.0 bits (123),  Expect(3) = 9e-47, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ +NQKG +LDW
Sbjct  491  FGILLLELITGQTALEFGKSSNQKGAMLDW  520



>ref|XP_009803320.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Nicotiana 
sylvestris]
Length=625

 Score =   114 bits (286),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 72/83 (87%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRND-TPRFRTHE-NTP  329
            +ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE+WEASQ+ D + +++T E ++ 
Sbjct  543  IELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAERWEASQKFDGSNKYKTKELSSS  602

Query  328  QRYSDFIEESSLIVEAMELSGPR  260
            +R+SD  ++S L+V+AMELSGPR
Sbjct  603  ERFSDLTDDSLLLVQAMELSGPR  625


 Score = 68.2 bits (165),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            +HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  THVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 52.8 bits (125),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQKG +LDW
Sbjct  489  FGILLLELITGMRAIEFGKAANQKGAMLDW  518



>ref|XP_009131513.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Brassica rapa]
Length=636

 Score =   113 bits (283),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 5/86 (6%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTP-----RFRTHE  338
            +ELEEMV+VALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR+D+      R     
Sbjct  551  IELEEMVRVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRSDSGSKYSNRVNELM  610

Query  337  NTPQRYSDFIEESSLIVEAMELSGPR  260
            ++  RYSD  ++S+L+ +AMELSGPR
Sbjct  611  SSSDRYSDLTDDSTLLAQAMELSGPR  636


 Score = 69.7 bits (169),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  463  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  495


 Score = 52.4 bits (124),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLEL+TGQ+A++FG+ ANQKG +L+W
Sbjct  495  FGILLLELVTGQRALEFGKAANQKGAMLEW  524



>ref|XP_009803321.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Nicotiana 
sylvestris]
Length=622

 Score =   114 bits (286),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 72/83 (87%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRND-TPRFRTHE-NTP  329
            +ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDGLAE+WEASQ+ D + +++T E ++ 
Sbjct  540  IELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDGLAERWEASQKFDGSNKYKTKELSSS  599

Query  328  QRYSDFIEESSLIVEAMELSGPR  260
            +R+SD  ++S L+V+AMELSGPR
Sbjct  600  ERFSDLTDDSLLLVQAMELSGPR  622


 Score = 68.2 bits (165),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            +HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  454  THVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  486


 Score = 52.4 bits (124),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQKG +LDW
Sbjct  486  FGILLLELITGMRAIEFGKAANQKGAMLDW  515



>ref|XP_009396215.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396224.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score =   121 bits (303),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR +  +FR  E + +R
Sbjct  542  IELEEMVQVALLCTQYVPGHRPKMSEVVRMLEGDGLAERWEASQRTEVHKFRVPEFSSER  601

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD  ++ SL+VEAMELSGPR
Sbjct  602  YSDLTDD-SLLVEAMELSGPR  621


 Score = 67.0 bits (162),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            +HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  457  THVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  489


 Score = 47.0 bits (110),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A+++G+ A QKG +LDW
Sbjct  489  FGILLLELITGLRALEYGKAAKQKGAMLDW  518



>ref|XP_008783060.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score =   114 bits (285),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMVQVALLCT + P  RPKMSEV+RMLEGDGLAE+WEASQR +  +F+  E ++ +
Sbjct  543  IELEEMVQVALLCTLYLPGQRPKMSEVVRMLEGDGLAERWEASQRVEAHKFKMPEFSSSE  602

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  603  RYSDLTDDSSLLVQAMELSGPR  624


 Score = 69.7 bits (169),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 50.8 bits (120),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQKG +LDW
Sbjct  489  FGILLLELITGLRAMEFGKAANQKGAMLDW  518



>ref|XP_010549936.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Tarenaya hassleriana]
 gb|ABD96874.1| hypothetical protein [Cleome spinosa]
Length=634

 Score =   114 bits (286),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 4/86 (5%)
 Frame = -3

Query  505  GVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRND-TPRFRTHEN--  335
            G+ELEEMV+VALLCTQ+ P HRPKMSEV+RMLEGDGLAE+WEASQR + T +  +  N  
Sbjct  549  GIELEEMVKVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWEASQRTESTSKCSSRPNEL  608

Query  334  -TPQRYSDFIEESSLIVEAMELSGPR  260
             +  RYSD  ++S+L+V+AMELSGPR
Sbjct  609  SSSDRYSDLTDDSTLLVQAMELSGPR  634


 Score = 69.3 bits (168),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  464  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  496


 Score = 50.4 bits (119),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++F + ANQKG +L+W
Sbjct  496  FGILLLELITGQRALEFSKAANQKGAMLEW  525



>ref|XP_009803965.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Nicotiana 
sylvestris]
Length=620

 Score =   111 bits (278),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 4/85 (5%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRN--DTPRFRTHE-NT  332
            +ELEEMVQVALLCTQ++PS RPKMSEV+RMLEGDGLAEKWEASQR   +T   R +E ++
Sbjct  536  IELEEMVQVALLCTQYHPSQRPKMSEVVRMLEGDGLAEKWEASQRAEPNTRCSRANEFSS  595

Query  331  PQRYSDFIE-ESSLIVEAMELSGPR  260
             +RYSD  + +SSL+V+AMELSGPR
Sbjct  596  SERYSDLTDNDSSLLVQAMELSGPR  620


 Score = 68.2 bits (165),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  450  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  482


 Score = 54.3 bits (129),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  482  FGILLLELITGQRALEFGKAANQKGAMLDW  511



>ref|XP_009803966.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Nicotiana 
sylvestris]
Length=602

 Score =   111 bits (278),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 4/85 (5%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRN--DTPRFRTHE-NT  332
            +ELEEMVQVALLCTQ++PS RPKMSEV+RMLEGDGLAEKWEASQR   +T   R +E ++
Sbjct  518  IELEEMVQVALLCTQYHPSQRPKMSEVVRMLEGDGLAEKWEASQRAEPNTRCSRANEFSS  577

Query  331  PQRYSDFIE-ESSLIVEAMELSGPR  260
             +RYSD  + +SSL+V+AMELSGPR
Sbjct  578  SERYSDLTDNDSSLLVQAMELSGPR  602


 Score = 68.2 bits (165),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  432  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  464


 Score = 54.3 bits (129),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  464  FGILLLELITGQRALEFGKAANQKGAMLDW  493



>ref|XP_009596696.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=621

 Score =   111 bits (278),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 4/85 (5%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRN--DTPRFRTHE-NT  332
            +ELEEMVQVALLCTQ++PS RP+MSEV+RMLEGDGLAEKWEASQR   +T   R +E ++
Sbjct  537  IELEEMVQVALLCTQYHPSQRPRMSEVVRMLEGDGLAEKWEASQRAEPNTRCSRANEFSS  596

Query  331  PQRYSDFIE-ESSLIVEAMELSGPR  260
             +RYSD  E +SSL+V+AMELSGPR
Sbjct  597  SERYSDLTENDSSLLVQAMELSGPR  621


 Score = 68.2 bits (165),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  451  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  483


 Score = 54.7 bits (130),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  483  FGILLLELITGQRALEFGKAANQKGAMLDW  512



>ref|XP_009596697.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=603

 Score =   111 bits (278),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 4/85 (5%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRN--DTPRFRTHE-NT  332
            +ELEEMVQVALLCTQ++PS RP+MSEV+RMLEGDGLAEKWEASQR   +T   R +E ++
Sbjct  519  IELEEMVQVALLCTQYHPSQRPRMSEVVRMLEGDGLAEKWEASQRAEPNTRCSRANEFSS  578

Query  331  PQRYSDFIE-ESSLIVEAMELSGPR  260
             +RYSD  E +SSL+V+AMELSGPR
Sbjct  579  SERYSDLTENDSSLLVQAMELSGPR  603


 Score = 68.2 bits (165),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  433  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  465


 Score = 54.3 bits (129),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+A++FG+ ANQKG +LDW
Sbjct  465  FGILLLELITGQRALEFGKAANQKGAMLDW  494



>ref|XP_010533910.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Tarenaya hassleriana]
Length=640

 Score =   110 bits (274),  Expect(3) = 4e-46, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 71/95 (75%), Gaps = 14/95 (15%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQ-----RND---TPRFR  347
            VELEE+VQVALLCTQFNP HRPKMSEVL+MLEGDGLAE+WEASQ     RN      R R
Sbjct  546  VELEEIVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAERWEASQSQSQNRNAEQMLMRLR  605

Query  346  TH------ENTPQRYSDFIEESSLIVEAMELSGPR  260
            +        + P  YS++I++SSL+VEA+ELSGPR
Sbjct  606  SRSWCEPSSSPPVMYSEYIQDSSLVVEAIELSGPR  640


 Score = 67.0 bits (162),  Expect(3) = 4e-46, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+T VRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTVVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 56.2 bits (134),  Expect(3) = 4e-46, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQKA+DFGR ++QKGV+LDW
Sbjct  492  FGILLLELITGQKALDFGRSSHQKGVMLDW  521



>ref|XP_006380012.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
 gb|ERP57809.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
Length=622

 Score =   152 bits (385),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR+ EN PQ+
Sbjct  542  IELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRSCENPPQK  601

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL+VEAMELSGPR
Sbjct  602  YSDFIEESSLVVEAMELSGPR  622


 Score = 60.1 bits (144),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -2

Query  650  LHPSICRQANHPKRLMYLVFGILLLELITGQKAVDFGRGANQKGVILDW  504
            + P         ++     FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  469  ISPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDW  517


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHI+PEYLSTGQSSEKTDVFGF
Sbjct  456  SHVTTAVRGTVGHISPEYLSTGQSSEKTDVFGF  488



>ref|NP_001146634.1| uncharacterized LOC100280233 precursor [Zea mays]
 ref|XP_008643516.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 ref|XP_008643517.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 ref|XP_008643518.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 gb|ACL54438.1| unknown [Zea mays]
 gb|AFW73243.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 1 [Zea mays]
 gb|AFW73244.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 2 [Zea mays]
 gb|AFW73245.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 3 [Zea mays]
 gb|AFW73246.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 4 [Zea mays]
Length=626

 Score =   112 bits (280),  Expect(3) = 4e-46, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGLAE+WEA Q  ++ +F+  E +  R
Sbjct  545  IELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLAERWEALQHTESHKFKVPEFSFSR  604

Query  322  -YSDFIEESSLIVEAMELSGPR  260
             +SD  ++SSL+V+A+ELSGPR
Sbjct  605  CHSDLTDDSSLLVQAVELSGPR  626


 Score = 68.9 bits (167),  Expect(3) = 4e-46, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  491


 Score = 52.0 bits (123),  Expect(3) = 4e-46, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ A++FG+ +NQKG +LDW
Sbjct  491  FGILLLELITGQTALEFGKSSNQKGAMLDW  520



>ref|XP_002312685.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE90052.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=625

 Score =   152 bits (384),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR+ EN PQ+
Sbjct  545  IELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRSCENPPQK  604

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL+VEAMELSGPR
Sbjct  605  YSDFIEESSLVVEAMELSGPR  625


 Score = 60.1 bits (144),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -2

Query  650  LHPSICRQANHPKRLMYLVFGILLLELITGQKAVDFGRGANQKGVILDW  504
            + P         ++     FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  472  ISPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDW  520


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHI+PEYLSTGQSSEKTDVFGF
Sbjct  459  SHVTTAVRGTVGHISPEYLSTGQSSEKTDVFGF  491



>ref|XP_006290715.1| hypothetical protein CARUB_v10016813mg [Capsella rubella]
 gb|EOA23613.1| hypothetical protein CARUB_v10016813mg [Capsella rubella]
Length=651

 Score =   112 bits (280),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 4/85 (5%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQRNDTPRFRTHEN---  335
            +E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL EKWEA SQR +T R  +  N   
Sbjct  567  IEVEEMVQVALLCTQYLPVHRPKMSEVVRMLEGDGLVEKWEASSQRAETNRSYSKPNEFS  626

Query  334  TPQRYSDFIEESSLIVEAMELSGPR  260
            + +RYSD  ++SS++V+AMELSGPR
Sbjct  627  SSERYSDLTDDSSVLVQAMELSGPR  651


 Score = 69.3 bits (168),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  481  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  513


 Score = 51.2 bits (121),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQ+G ILDW
Sbjct  513  FGILLLELITGLRALEFGKAANQRGAILDW  542



>gb|EPS73511.1| hypothetical protein M569_01245, partial [Genlisea aurea]
Length=636

 Score =   105 bits (261),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 67/84 (80%), Gaps = 4/84 (5%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDT-PRFRTHENTPQ  326
            +EL EM +VALLCT FNP+ RPKMSEVLRMLEGDGLAEKWE S   ++ PR R+    P+
Sbjct  554  MELVEMARVALLCTHFNPAIRPKMSEVLRMLEGDGLAEKWEQSLDIESPPRQRSFGFPPE  613

Query  325  --RYSDFIEESSLIVEAMELSGPR  260
              RYSDFIEESSL V+AMELSGPR
Sbjct  614  IRRYSDFIEESSL-VDAMELSGPR  636


 Score = 68.9 bits (167),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  468  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  500


 Score = 58.9 bits (141),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITGQ+AVDFGRG N+KG+ILDW
Sbjct  500  FGILLLELITGQRAVDFGRGVNEKGLILDW  529



>ref|XP_010502426.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Camelina sativa]
Length=645

 Score =   112 bits (280),  Expect(3) = 6e-46, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 4/86 (5%)
 Frame = -3

Query  505  GVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQRNDTPRFRTHEN--  335
            G+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL EKWEA S R +T R  +  N  
Sbjct  560  GIEVEEMVQVALLCTQYLPVHRPKMSEVVRMLEGDGLVEKWEASSHRAETNRSYSKPNEF  619

Query  334  -TPQRYSDFIEESSLIVEAMELSGPR  260
             + +RYSD  ++SS++V+AMELSGPR
Sbjct  620  SSSERYSDLTDDSSVLVQAMELSGPR  645


 Score = 69.3 bits (168),  Expect(3) = 6e-46, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  475  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  507


 Score = 51.2 bits (121),  Expect(3) = 6e-46, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQ+G ILDW
Sbjct  507  FGILLLELITGLRALEFGKAANQRGAILDW  536



>ref|XP_006395648.1| hypothetical protein EUTSA_v10003811mg [Eutrema salsugineum]
 gb|ESQ32934.1| hypothetical protein EUTSA_v10003811mg [Eutrema salsugineum]
Length=643

 Score =   112 bits (280),  Expect(3) = 6e-46, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 4/85 (5%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQRNDTPRFRTHEN---  335
            +E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL EKWEA SQR +T R  +  N   
Sbjct  559  IEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVEKWEASSQRTETNRSYSKPNEFS  618

Query  334  TPQRYSDFIEESSLIVEAMELSGPR  260
            + +RYSD  ++SS++V+AMELSGPR
Sbjct  619  SSERYSDLTDDSSVLVQAMELSGPR  643


 Score = 69.3 bits (168),  Expect(3) = 6e-46, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  473  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  505


 Score = 51.2 bits (121),  Expect(3) = 6e-46, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQ+G ILDW
Sbjct  505  FGILLLELITGLRALEFGKAANQRGAILDW  534



>dbj|BAB01326.1| receptor-like kinase [Arabidopsis thaliana]
Length=630

 Score =   112 bits (279),  Expect(3) = 7e-46, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 4/85 (5%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQRNDTPRFRTHEN---  335
            +E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL EKWEA SQR +T R  +  N   
Sbjct  546  IEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVEKWEASSQRAETNRSYSKPNEFS  605

Query  334  TPQRYSDFIEESSLIVEAMELSGPR  260
            + +RYSD  ++SS++V+AMELSGPR
Sbjct  606  SSERYSDLTDDSSVLVQAMELSGPR  630


 Score = 69.7 bits (169),  Expect(3) = 7e-46, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492


 Score = 51.2 bits (121),  Expect(3) = 7e-46, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQ+G ILDW
Sbjct  492  FGILLLELITGLRALEFGKAANQRGAILDW  521



>ref|XP_002525400.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF37038.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=618

 Score =   152 bits (383),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ+ +TPRFR+ E+ PQR
Sbjct  538  VELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQKIETPRFRSCESHPQR  597

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL+VEAMELSGPR
Sbjct  598  YSDFIEESSLVVEAMELSGPR  618


 Score = 59.7 bits (143),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  644  PSICRQANHPKRLMYLVFGILLLELITGQKAVDFGRGANQKGVILDW  504
            P         ++     FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  467  PEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDW  513


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  452  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  484



>ref|XP_009407942.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=623

 Score =   109 bits (272),  Expect(3) = 9e-46, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            VE+EE++QV +LCTQ+ P HRPKMSEV+RMLEGDGLAE+WEAS+R +  + +  E   ++
Sbjct  543  VEVEEIIQVVILCTQYLPGHRPKMSEVVRMLEGDGLAERWEASRRIEAHKLKVPEIFSEQ  602

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSD  ++SSL+++A+ELSGPR
Sbjct  603  YSDITDDSSLLIDAIELSGPR  623


 Score = 69.3 bits (168),  Expect(3) = 9e-46, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 53.5 bits (127),  Expect(3) = 9e-46, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +AV+FG+ ANQKG ILDW
Sbjct  489  FGILLLELITGLRAVEFGKAANQKGAILDW  518



>ref|XP_002876917.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53176.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
Length=636

 Score =   111 bits (278),  Expect(3) = 9e-46, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 4/85 (5%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQRNDTPRFRTHEN---  335
            +E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL EKWEA SQR +T R  +  N   
Sbjct  552  IEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVEKWEASSQRAETNRSYSKPNEFS  611

Query  334  TPQRYSDFIEESSLIVEAMELSGPR  260
            + +RYSD  ++SS++V+AMELSGPR
Sbjct  612  SSERYSDLTDDSSVLVQAMELSGPR  636


 Score = 69.3 bits (168),  Expect(3) = 9e-46, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  466  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  498


 Score = 51.2 bits (121),  Expect(3) = 9e-46, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQ+G ILDW
Sbjct  498  FGILLLELITGLRALEFGKAANQRGAILDW  527



>gb|KFK39862.1| hypothetical protein AALP_AA3G298400 [Arabis alpina]
Length=631

 Score =   113 bits (282),  Expect(3) = 9e-46, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 4/85 (5%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQRNDTPRFRTHEN---  335
            +E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGL E+WEA SQR +T R  +  N   
Sbjct  547  IEIEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDGLVERWEASSQRTETNRSYSKPNEFS  606

Query  334  TPQRYSDFIEESSLIVEAMELSGPR  260
            T +RYSD  ++SS++V+AMELSGPR
Sbjct  607  TSERYSDLTDDSSVLVQAMELSGPR  631


 Score = 69.3 bits (168),  Expect(3) = 9e-46, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  461  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  493


 Score = 49.7 bits (117),  Expect(3) = 9e-46, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQ+G IL+W
Sbjct  493  FGILLLELITGLRALEFGKAANQRGAILEW  522



>gb|KDP26621.1| hypothetical protein JCGZ_17779 [Jatropha curcas]
Length=626

 Score =   151 bits (381),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDGLAEKWEASQ+ +TPR R+ EN PQR
Sbjct  546  IELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDGLAEKWEASQKIETPRLRSCENHPQR  605

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL+VEAMELSGPR
Sbjct  606  YSDFIEESSLVVEAMELSGPR  626


 Score = 59.3 bits (142),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  644  PSICRQANHPKRLMYLVFGILLLELITGQKAVDFGRGANQKGVILDW  504
            P         ++     FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  475  PEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDW  521


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  492



>ref|XP_007044709.1| Nsp-interacting kinase 3 isoform 2 [Theobroma cacao]
 gb|EOY00541.1| Nsp-interacting kinase 3 isoform 2 [Theobroma cacao]
Length=451

 Score =   151 bits (382),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEEMVQVALLCTQFNPSHRP+MSEVLRMLEGDGLAEKWEASQ+ +TPRFR+ +N PQR
Sbjct  371  IELEEMVQVALLCTQFNPSHRPRMSEVLRMLEGDGLAEKWEASQKVETPRFRSCDNPPQR  430

Query  322  YSDFIEESSLIVEAMELSGPR  260
            YSDFIEESSL++EAMELSGPR
Sbjct  431  YSDFIEESSLVIEAMELSGPR  451


 Score = 58.9 bits (141),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  644  PSICRQANHPKRLMYLVFGILLLELITGQKAVDFGRGANQKGVILDW  504
            P         ++     FGILLLELITGQKA+DFGR ANQKGV+LDW
Sbjct  297  PEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLDW  343


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  282  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  314



>ref|XP_008658828.1| PREDICTED: uncharacterized LOC100382590 isoform X1 [Zea mays]
Length=642

 Score =   115 bits (288),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 2/84 (2%)
 Frame = -3

Query  505  GVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPR-FRTHENTP  329
            G+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+W+ASQR D+ + F+  + T 
Sbjct  559  GIEMEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWQASQRADSHKSFKVPDFTF  618

Query  328  QR-YSDFIEESSLIVEAMELSGPR  260
             R YSD  ++SSL+V+A+ELSGPR
Sbjct  619  SRCYSDLTDDSSLLVQAVELSGPR  642


 Score = 67.8 bits (164),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  463  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  495


 Score = 47.8 bits (112),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 1/31 (3%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQ-KGVILDW  504
            FGILLLEL+TGQ A++FG+ ANQ KG +LDW
Sbjct  495  FGILLLELVTGQTALEFGKAANQKKGAMLDW  525



>gb|AFW86330.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=523

 Score =   115 bits (289),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 2/84 (2%)
 Frame = -3

Query  505  GVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPR-FRTHENTP  329
            G+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+W+ASQR D+ + F+  + T 
Sbjct  440  GIEMEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWQASQRADSHKSFKVPDFTF  499

Query  328  QR-YSDFIEESSLIVEAMELSGPR  260
             R YSD  ++SSL+V+A+ELSGPR
Sbjct  500  SRCYSDLTDDSSLLVQAVELSGPR  523


 Score = 67.4 bits (163),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  354  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  386


 Score = 47.8 bits (112),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 1/31 (3%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQ-KGVILDW  504
            FGILLLEL+TGQ A++FG+ ANQ KG +LDW
Sbjct  386  FGILLLELVTGQTALEFGKAANQKKGAMLDW  416



>ref|NP_001168791.1| uncharacterized LOC100382590 [Zea mays]
 gb|ACN30713.1| unknown [Zea mays]
 gb|AFW86331.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=485

 Score =   115 bits (289),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 2/84 (2%)
 Frame = -3

Query  505  GVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPR-FRTHENTP  329
            G+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+W+ASQR D+ + F+  + T 
Sbjct  402  GIEMEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWQASQRADSHKSFKVPDFTF  461

Query  328  QR-YSDFIEESSLIVEAMELSGPR  260
             R YSD  ++SSL+V+A+ELSGPR
Sbjct  462  SRCYSDLTDDSSLLVQAVELSGPR  485


 Score = 67.4 bits (163),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  316  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  348


 Score = 47.8 bits (112),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 1/31 (3%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQ-KGVILDW  504
            FGILLLEL+TGQ A++FG+ ANQ KG +LDW
Sbjct  348  FGILLLELVTGQTALEFGKAANQKKGAMLDW  378



>gb|ACN30679.1| unknown [Zea mays]
Length=632

 Score =   115 bits (288),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 2/84 (2%)
 Frame = -3

Query  505  GVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPR-FRTHENTP  329
            G+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+W+ASQR D+ + F+  + T 
Sbjct  549  GIEMEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWQASQRADSHKSFKVPDFTF  608

Query  328  QR-YSDFIEESSLIVEAMELSGPR  260
             R YSD  ++SSL+V+A+ELSGPR
Sbjct  609  SRCYSDLTDDSSLLVQAVELSGPR  632


 Score = 67.4 bits (163),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  463  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  495


 Score = 47.8 bits (112),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 1/31 (3%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQ-KGVILDW  504
            FGILLLEL+TGQ A++FG+ ANQ KG +LDW
Sbjct  495  FGILLLELVTGQTALEFGKAANQKKGAMLDW  525



>ref|XP_008658830.1| PREDICTED: uncharacterized LOC100382590 isoform X2 [Zea mays]
Length=632

 Score =   115 bits (288),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 2/84 (2%)
 Frame = -3

Query  505  GVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPR-FRTHENTP  329
            G+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDGLAE+W+ASQR D+ + F+  + T 
Sbjct  549  GIEMEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDGLAERWQASQRADSHKSFKVPDFTF  608

Query  328  QR-YSDFIEESSLIVEAMELSGPR  260
             R YSD  ++SSL+V+A+ELSGPR
Sbjct  609  SRCYSDLTDDSSLLVQAVELSGPR  632


 Score = 67.4 bits (163),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGF
Sbjct  463  SHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGF  495


 Score = 47.8 bits (112),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 1/31 (3%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQ-KGVILDW  504
            FGILLLEL+TGQ A++FG+ ANQ KG +LDW
Sbjct  495  FGILLLELVTGQTALEFGKAANQKKGAMLDW  525



>ref|XP_009417562.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=638

 Score =   113 bits (282),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE--NTP  329
            +ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDGL E+WEASQR D+  F+  E   + 
Sbjct  556  IELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDGLVERWEASQRVDSQNFKVPEFAFSE  615

Query  328  QRYSDFIEESSLIVEAMELSGPR  260
            + YS+  ++SSL+V+A+ELSGPR
Sbjct  616  RCYSNLTDDSSLLVQAVELSGPR  638


 Score = 68.9 bits (167),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  470  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  502


 Score = 48.5 bits (114),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG+ A++FG+  N+KG +LDW
Sbjct  502  FGILLLELITGRTALEFGKSVNEKGTMLDW  531



>ref|XP_009152132.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
2-like [Brassica rapa]
Length=652

 Score =   109 bits (272),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 4/85 (5%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQRNDTPRFRTHEN---  335
            +E+EE+V+VALLCTQ+ P HRPKMSEV+RMLEGDGL EKWEA SQR +T R  +  N   
Sbjct  568  IEVEEIVKVALLCTQYLPIHRPKMSEVVRMLEGDGLVEKWEASSQRTETNRSYSKPNEFS  627

Query  334  TPQRYSDFIEESSLIVEAMELSGPR  260
            + +RYSD  ++SS++V+AMELSGPR
Sbjct  628  SSERYSDLTDDSSVLVQAMELSGPR  652


 Score = 69.3 bits (168),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  482  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  514


 Score = 51.2 bits (121),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQ+G ILDW
Sbjct  514  FGILLLELITGLRALEFGKAANQRGAILDW  543



>emb|CDX83534.1| BnaC07g22740D [Brassica napus]
Length=640

 Score =   109 bits (272),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 4/85 (5%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQRNDTPRFRTHEN---  335
            +E+EE+V+VALLCTQ+ P HRPKMSEV+RMLEGDGL EKWEA SQR +T R  +  N   
Sbjct  556  IEVEEIVKVALLCTQYLPIHRPKMSEVVRMLEGDGLVEKWEASSQRTETNRSYSKPNEFS  615

Query  334  TPQRYSDFIEESSLIVEAMELSGPR  260
            + +RYSD  ++SS++V+AMELSGPR
Sbjct  616  SSERYSDLTDDSSVLVQAMELSGPR  640


 Score = 69.3 bits (168),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  470  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  502


 Score = 51.2 bits (121),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQ+G ILDW
Sbjct  502  FGILLLELITGLRALEFGKAANQRGAILDW  531



>emb|CDY48073.1| BnaA06g33550D [Brassica napus]
Length=640

 Score =   109 bits (272),  Expect(3) = 4e-45, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 4/85 (5%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEA-SQRNDTPRFRTHEN---  335
            +E+EE+V+VALLCTQ+ P HRPKMSEV+RMLEGDGL EKWEA SQR +T R  +  N   
Sbjct  556  IEVEEIVKVALLCTQYLPIHRPKMSEVVRMLEGDGLVEKWEASSQRTETNRSYSKPNEFS  615

Query  334  TPQRYSDFIEESSLIVEAMELSGPR  260
            + +RYSD  ++SS++V+AMELSGPR
Sbjct  616  SSERYSDLTDDSSVLVQAMELSGPR  640


 Score = 69.3 bits (168),  Expect(3) = 4e-45, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  470  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  502


 Score = 51.2 bits (121),  Expect(3) = 4e-45, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQ+G ILDW
Sbjct  502  FGILLLELITGLRALEFGKAANQRGAILDW  531



>ref|XP_009391273.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score =   110 bits (275),  Expect(3) = 5e-45, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 69/83 (83%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE--NTP  329
            +ELEEMV+VALLCTQF+P HRPKMSEV+RMLEGDGL E+WEASQR D+  F+  E   + 
Sbjct  560  IELEEMVKVALLCTQFHPRHRPKMSEVVRMLEGDGLVERWEASQRVDSQGFKMPELAFSD  619

Query  328  QRYSDFIEESSLIVEAMELSGPR  260
            + YS+  ++SS++++A+ELSGPR
Sbjct  620  RCYSNLTDDSSILIQAVELSGPR  642


 Score = 69.3 bits (168),  Expect(3) = 5e-45, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  474  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  506


 Score = 49.7 bits (117),  Expect(3) = 5e-45, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG+ A++FG+  NQKG +LDW
Sbjct  506  FGILLLELITGRTALEFGKSVNQKGTMLDW  535



>ref|XP_009391272.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=646

 Score =   110 bits (275),  Expect(3) = 5e-45, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 69/83 (83%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE--NTP  329
            +ELEEMV+VALLCTQF+P HRPKMSEV+RMLEGDGL E+WEASQR D+  F+  E   + 
Sbjct  564  IELEEMVKVALLCTQFHPRHRPKMSEVVRMLEGDGLVERWEASQRVDSQGFKMPELAFSD  623

Query  328  QRYSDFIEESSLIVEAMELSGPR  260
            + YS+  ++SS++++A+ELSGPR
Sbjct  624  RCYSNLTDDSSILIQAVELSGPR  646


 Score = 69.3 bits (168),  Expect(3) = 5e-45, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  478  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  510


 Score = 49.7 bits (117),  Expect(3) = 5e-45, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG+ A++FG+  NQKG +LDW
Sbjct  510  FGILLLELITGRTALEFGKSVNQKGTMLDW  539



>ref|XP_009418102.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=623

 Score =   110 bits (276),  Expect(3) = 6e-45, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELEE+VQVALLCTQ+ P HRPKMSEV+ MLEGDGLAE+WEASQR +  + +  +    R
Sbjct  542  IELEEVVQVALLCTQYLPGHRPKMSEVVHMLEGDGLAERWEASQRTEALKLKVPDFHSDR  601

Query  322  YSDF-IEESSLIVEAMELSGPR  260
            YSD  + + SL+VEAMELSGPR
Sbjct  602  YSDITVTDDSLLVEAMELSGPR  623


 Score = 68.2 bits (165),  Expect(3) = 6e-45, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            +HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  457  THVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  489


 Score = 50.4 bits (119),  Expect(3) = 6e-45, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQKG +LDW
Sbjct  489  FGILLLELITGLRALEFGKAANQKGAMLDW  518



>gb|KDP31451.1| hypothetical protein JCGZ_11827 [Jatropha curcas]
Length=621

 Score =   119 bits (297),  Expect(3) = 9e-45, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE-NTPQ  326
            +ELEEMV+VALLCTQ+ P+HRPKMSEV+RMLEGDGLAEKWEASQR +    R  E ++ +
Sbjct  540  IELEEMVRVALLCTQYYPTHRPKMSEVVRMLEGDGLAEKWEASQRAEATGSRVAEFSSSE  599

Query  325  RYSDFIEESSLIVEAMELSGPR  260
            RYSD  ++SSL+V+AMELSGPR
Sbjct  600  RYSDLTDDSSLLVQAMELSGPR  621


 Score = 65.5 bits (158),  Expect(3) = 9e-45, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SH++T V+GTVGHIAPEYLSTGQSSEKTDVFGF
Sbjct  454  SHITTTVKGTVGHIAPEYLSTGQSSEKTDVFGF  486


 Score = 44.3 bits (103),  Expect(3) = 9e-45, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FG+LL+ELI+G +A++FG+ + QKG +LDW
Sbjct  486  FGMLLVELISGLRALEFGKSSKQKGAMLDW  515



>ref|XP_010044332.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Eucalyptus grandis]
 gb|KCW86416.1| hypothetical protein EUGRSUZ_B03087 [Eucalyptus grandis]
Length=623

 Score =   113 bits (282),  Expect(3) = 3e-44, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHE--NTP  329
            +ELEE++QV+LLCTQ+ P++RPKMSEV+RMLEGDGL EKWEASQR ++ R R     ++ 
Sbjct  541  IELEEIIQVSLLCTQYLPTNRPKMSEVVRMLEGDGLVEKWEASQRAESTRCRAANEFSSS  600

Query  328  QRYSDFIEESSLIVEAMELSGPR  260
            +RYSD  ++SSL+++AMELSGPR
Sbjct  601  ERYSDLTDDSSLLIQAMELSGPR  623


 Score = 63.9 bits (154),  Expect(3) = 3e-44, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGT GHIAPEYL +GQSSEKTDVFGF
Sbjct  455  SHVTTAVRGTAGHIAPEYLLSGQSSEKTDVFGF  487


 Score = 50.1 bits (118),  Expect(3) = 3e-44, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            FGILLLELITG +A++FG+ ANQ+G +LDW
Sbjct  487  FGILLLELITGLRALEFGKAANQRGAMLDW  516



>gb|KCW86687.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
 gb|KCW86688.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=622

 Score =   104 bits (260),  Expect(3) = 4e-44, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELE MV+VALLCT+ NP  RPKMSEVL+M E DGLA+  +A+QR +TPR  +  + P+R
Sbjct  543  LELEVMVKVALLCTKVNPLQRPKMSEVLKMFEDDGLADNQDAAQRAETPRLLSGSSPPRR  602

Query  322  YSDFIEESSLIVEAMELSGPR  260
            Y+D+IEE SL VEAMELSGPR
Sbjct  603  YADYIEEYSL-VEAMELSGPR  622


 Score = 67.4 bits (163),  Expect(3) = 4e-44, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+
Sbjct  457  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGY  489


 Score = 54.3 bits (129),  Expect(3) = 4e-44, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            +GILLLELITGQ+A+DFGR  NQKGV+LDW
Sbjct  489  YGILLLELITGQRALDFGRIPNQKGVMLDW  518



>ref|XP_010044599.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X6 [Eucalyptus 
grandis]
Length=578

 Score =   103 bits (258),  Expect(3) = 6e-44, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELE MV+VALLCT+ NP  RPKMSEVL+M E DGLA+  +A+QR +TPR  +  + P+R
Sbjct  499  LELEVMVKVALLCTKVNPLQRPKMSEVLKMFEDDGLADNQDAAQRAETPRCLSGSSPPRR  558

Query  322  YSDFIEESSLIVEAMELSGPR  260
            Y+D+IEE SL VEAMELSGPR
Sbjct  559  YADYIEEYSL-VEAMELSGPR  578


 Score = 67.8 bits (164),  Expect(3) = 6e-44, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+
Sbjct  413  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGY  445


 Score = 54.3 bits (129),  Expect(3) = 6e-44, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            +GILLLELITGQ+A+DFGR  NQKGV+LDW
Sbjct  445  YGILLLELITGQRALDFGRIPNQKGVMLDW  474



>ref|XP_010044598.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X5 [Eucalyptus 
grandis]
Length=624

 Score =   103 bits (258),  Expect(3) = 8e-44, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELE MV+VALLCT+ NP  RPKMSEVL+M E DGLA+  +A+QR +TPR  +  + P+R
Sbjct  545  LELEVMVKVALLCTKVNPLQRPKMSEVLKMFEDDGLADNQDAAQRAETPRCLSGSSPPRR  604

Query  322  YSDFIEESSLIVEAMELSGPR  260
            Y+D+IEE SL VEAMELSGPR
Sbjct  605  YADYIEEYSL-VEAMELSGPR  624


 Score = 67.4 bits (163),  Expect(3) = 8e-44, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+
Sbjct  459  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGY  491


 Score = 54.3 bits (129),  Expect(3) = 8e-44, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            +GILLLELITGQ+A+DFGR  NQKGV+LDW
Sbjct  491  YGILLLELITGQRALDFGRIPNQKGVMLDW  520



>ref|XP_010044597.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X4 [Eucalyptus 
grandis]
Length=625

 Score =   103 bits (257),  Expect(3) = 8e-44, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELE MV+VALLCT+ NP  RPKMSEVL+M E DGLA+  +A+QR +TPR  +  + P+R
Sbjct  546  LELEVMVKVALLCTKVNPLQRPKMSEVLKMFEDDGLADNQDAAQRAETPRCLSGSSPPRR  605

Query  322  YSDFIEESSLIVEAMELSGPR  260
            Y+D+IEE SL VEAMELSGPR
Sbjct  606  YADYIEEYSL-VEAMELSGPR  625


 Score = 67.4 bits (163),  Expect(3) = 8e-44, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+
Sbjct  460  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGY  492


 Score = 54.3 bits (129),  Expect(3) = 8e-44, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            +GILLLELITGQ+A+DFGR  NQKGV+LDW
Sbjct  492  YGILLLELITGQRALDFGRIPNQKGVMLDW  521



>ref|XP_010044594.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Eucalyptus 
grandis]
Length=627

 Score =   103 bits (257),  Expect(3) = 9e-44, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELE MV+VALLCT+ NP  RPKMSEVL+M E DGLA+  +A+QR +TPR  +  + P+R
Sbjct  548  LELEVMVKVALLCTKVNPLQRPKMSEVLKMFEDDGLADNQDAAQRAETPRCLSGSSPPRR  607

Query  322  YSDFIEESSLIVEAMELSGPR  260
            Y+D+IEE SL VEAMELSGPR
Sbjct  608  YADYIEEYSL-VEAMELSGPR  627


 Score = 67.4 bits (163),  Expect(3) = 9e-44, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+
Sbjct  462  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGY  494


 Score = 54.3 bits (129),  Expect(3) = 9e-44, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            +GILLLELITGQ+A+DFGR  NQKGV+LDW
Sbjct  494  YGILLLELITGQRALDFGRIPNQKGVMLDW  523



>ref|XP_010044596.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Eucalyptus 
grandis]
Length=626

 Score =   103 bits (257),  Expect(3) = 9e-44, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELE MV+VALLCT+ NP  RPKMSEVL+M E DGLA+  +A+QR +TPR  +  + P+R
Sbjct  547  LELEVMVKVALLCTKVNPLQRPKMSEVLKMFEDDGLADNQDAAQRAETPRCLSGSSPPRR  606

Query  322  YSDFIEESSLIVEAMELSGPR  260
            Y+D+IEE SL VEAMELSGPR
Sbjct  607  YADYIEEYSL-VEAMELSGPR  626


 Score = 67.8 bits (164),  Expect(3) = 9e-44, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+
Sbjct  461  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGY  493


 Score = 54.3 bits (129),  Expect(3) = 9e-44, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            +GILLLELITGQ+A+DFGR  NQKGV+LDW
Sbjct  493  YGILLLELITGQRALDFGRIPNQKGVMLDW  522



>ref|XP_010044595.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Eucalyptus 
grandis]
Length=626

 Score =   103 bits (257),  Expect(3) = 9e-44, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = -3

Query  502  VELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKWEASQRNDTPRFRTHENTPQR  323
            +ELE MV+VALLCT+ NP  RPKMSEVL+M E DGLA+  +A+QR +TPR  +  + P+R
Sbjct  547  LELEVMVKVALLCTKVNPLQRPKMSEVLKMFEDDGLADNQDAAQRAETPRCLSGSSPPRR  606

Query  322  YSDFIEESSLIVEAMELSGPR  260
            Y+D+IEE SL VEAMELSGPR
Sbjct  607  YADYIEEYSL-VEAMELSGPR  626


 Score = 67.8 bits (164),  Expect(3) = 9e-44, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  690  SHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGF  592
            SHV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+
Sbjct  461  SHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGY  493


 Score = 54.3 bits (129),  Expect(3) = 9e-44, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  593  FGILLLELITGQKAVDFGRGANQKGVILDW  504
            +GILLLELITGQ+A+DFGR  NQKGV+LDW
Sbjct  493  YGILLLELITGQRALDFGRIPNQKGVMLDW  522



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520