BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF043C18

Length=808
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011101473.1|  PREDICTED: serine decarboxylase-like               358   3e-117   
ref|XP_004237774.1|  PREDICTED: serine decarboxylase                    355   8e-117   Solanum lycopersicum
ref|XP_006362822.1|  PREDICTED: histidine decarboxylase-like isof...    353   9e-116   Solanum tuberosum [potatoes]
ref|XP_009616512.1|  PREDICTED: serine decarboxylase                    353   1e-115   Nicotiana tomentosiformis
ref|XP_009784234.1|  PREDICTED: serine decarboxylase                    352   2e-115   Nicotiana sylvestris
ref|XP_007019463.1|  Pyridoxal phosphate (PLP)-dependent transfer...    349   3e-114   Theobroma cacao [chocolate]
ref|NP_001047064.2|  Os02g0541300                                       339   4e-114   
ref|XP_010108654.1|  Histidine decarboxylase                            347   3e-113   Morus notabilis
ref|XP_010063879.1|  PREDICTED: serine decarboxylase-like               345   7e-113   
gb|EYU17447.1|  hypothetical protein MIMGU_mgv1a005353mg                345   8e-113   Erythranthe guttata [common monkey flower]
gb|KCW71161.1|  hypothetical protein EUGRSUZ_F04257                     346   1e-112   Eucalyptus grandis [rose gum]
ref|XP_010241731.1|  PREDICTED: serine decarboxylase-like               344   3e-112   Nelumbo nucifera [Indian lotus]
emb|CDP11372.1|  unnamed protein product                                340   5e-112   Coffea canephora [robusta coffee]
ref|XP_002452231.1|  hypothetical protein SORBIDRAFT_04g022140          343   1e-111   Sorghum bicolor [broomcorn]
ref|XP_010260914.1|  PREDICTED: serine decarboxylase-like               342   2e-111   Nelumbo nucifera [Indian lotus]
sp|Q6ESZ9.1|SDC1_ORYSJ  RecName: Full=Serine decarboxylase 1            342   2e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008645766.1|  PREDICTED: histidine decarboxylase-like            342   2e-111   
gb|KDO83688.1|  hypothetical protein CISIN_1g011842mg                   341   3e-111   Citrus sinensis [apfelsine]
ref|XP_004952686.1|  PREDICTED: histidine decarboxylase-like            342   3e-111   Setaria italica
ref|XP_006472964.1|  PREDICTED: histidine decarboxylase-like isof...    341   3e-111   Citrus sinensis [apfelsine]
gb|EAY86197.1|  hypothetical protein OsI_07573                          341   4e-111   Oryza sativa Indica Group [Indian rice]
ref|XP_006434436.1|  hypothetical protein CICLE_v10000775mg             340   6e-111   Citrus clementina [clementine]
gb|KDP43008.1|  hypothetical protein JCGZ_25194                         340   1e-110   Jatropha curcas
ref|XP_004290538.1|  PREDICTED: serine decarboxylase                    339   1e-110   Fragaria vesca subsp. vesca
ref|XP_003579728.1|  PREDICTED: serine decarboxylase 1                  339   2e-110   Brachypodium distachyon [annual false brome]
ref|XP_010931002.1|  PREDICTED: serine decarboxylase 1                  339   2e-110   Elaeis guineensis
ref|XP_002306690.1|  serine decarboxylase family protein                339   2e-110   Populus trichocarpa [western balsam poplar]
ref|XP_002533017.1|  group II plp decarboxylase, putative               338   3e-110   Ricinus communis
ref|XP_011044197.1|  PREDICTED: serine decarboxylase-like               338   5e-110   Populus euphratica
ref|XP_011042836.1|  PREDICTED: serine decarboxylase-like               338   5e-110   Populus euphratica
gb|KJB16469.1|  hypothetical protein B456_002G231300                    338   7e-110   Gossypium raimondii
gb|KJB16470.1|  hypothetical protein B456_002G231300                    338   7e-110   Gossypium raimondii
ref|XP_006434437.1|  hypothetical protein CICLE_v10000775mg             340   7e-110   
gb|KJB16468.1|  hypothetical protein B456_002G231300                    338   8e-110   Gossypium raimondii
gb|KHG24953.1|  Histidine decarboxylase                                 337   8e-110   Gossypium arboreum [tree cotton]
gb|EPS66281.1|  serine decarboxylase                                    335   2e-109   Genlisea aurea
emb|CBI18554.3|  unnamed protein product                                335   2e-109   Vitis vinifera
ref|XP_007201012.1|  hypothetical protein PRUPE_ppa005028mg             337   2e-109   Prunus persica
ref|XP_002302186.1|  serine decarboxylase family protein                336   3e-109   Populus trichocarpa [western balsam poplar]
ref|XP_003575093.1|  PREDICTED: serine decarboxylase 1                  336   3e-109   Brachypodium distachyon [annual false brome]
ref|XP_010519398.1|  PREDICTED: serine decarboxylase-like               337   3e-109   Tarenaya hassleriana [spider flower]
gb|AFK28264.1|  putative serine decarboxylase                           327   3e-109   Helianthus paradoxus
ref|XP_009406072.1|  PREDICTED: serine decarboxylase 1-like             336   4e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004140971.1|  PREDICTED: histidine decarboxylase-like isof...    336   4e-109   
ref|XP_002266398.1|  PREDICTED: serine decarboxylase                    336   4e-109   Vitis vinifera
ref|XP_006393773.1|  hypothetical protein EUTSA_v10011430mg             336   5e-109   Eutrema salsugineum [saltwater cress]
ref|XP_004140972.1|  PREDICTED: histidine decarboxylase-like isof...    336   5e-109   Cucumis sativus [cucumbers]
dbj|BAE07183.1|  putative serine decarboxylase                          336   6e-109   Beta vulgaris [beet]
ref|XP_008243632.1|  PREDICTED: histidine decarboxylase-like            335   7e-109   Prunus mume [ume]
ref|XP_010680495.1|  PREDICTED: serine decarboxylase                    335   7e-109   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB59412.1|  hypothetical protein B456_009G253400                    335   7e-109   Gossypium raimondii
ref|XP_009416900.1|  PREDICTED: serine decarboxylase 1-like             335   8e-109   
gb|KJB59410.1|  hypothetical protein B456_009G253400                    335   1e-108   Gossypium raimondii
gb|KHG04394.1|  Histidine decarboxylase                                 335   1e-108   Gossypium arboreum [tree cotton]
gb|AFK28277.1|  putative serine decarboxylase                           326   1e-108   Helianthus petiolaris
gb|KJB59411.1|  hypothetical protein B456_009G253400                    334   1e-108   Gossypium raimondii
ref|XP_008441525.1|  PREDICTED: histidine decarboxylase isoform X1      334   2e-108   Cucumis melo [Oriental melon]
emb|CAN70523.1|  hypothetical protein VITISV_034634                     333   2e-108   Vitis vinifera
gb|AFK28270.1|  putative serine decarboxylase                           325   3e-108   Helianthus deserticola
gb|AFK28279.1|  putative serine decarboxylase                           325   3e-108   Helianthus petiolaris
gb|AFK28253.1|  putative serine decarboxylase                           325   3e-108   Helianthus argophyllus
ref|XP_006648711.1|  PREDICTED: histidine decarboxylase-like            333   3e-108   
ref|XP_008441526.1|  PREDICTED: histidine decarboxylase isoform X2      333   3e-108   
gb|AFK28256.1|  putative serine decarboxylase                           325   3e-108   Helianthus annuus
gb|AFK28281.1|  putative serine decarboxylase                           325   5e-108   Helianthus debilis [cucumberleaf sunflower]
gb|AFK28271.1|  putative serine decarboxylase                           324   8e-108   Helianthus anomalus
ref|NP_175036.1|  serine decarboxylase 1                                332   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008781392.1|  PREDICTED: serine decarboxylase 1                  332   1e-107   Phoenix dactylifera
gb|AFK28273.1|  putative serine decarboxylase                           324   1e-107   Helianthus anomalus
gb|AFK28257.1|  putative serine decarboxylase                           323   1e-107   Helianthus annuus
gb|AFK28262.1|  putative serine decarboxylase                           323   1e-107   Helianthus annuus
gb|AFK28260.1|  putative serine decarboxylase                           323   1e-107   Helianthus annuus
gb|AFK28261.1|  putative serine decarboxylase                           323   1e-107   Helianthus annuus
gb|AFK28287.1|  putative serine decarboxylase                           323   2e-107   Helianthus bolanderi
gb|AFK28254.1|  putative serine decarboxylase                           323   2e-107   Helianthus argophyllus
emb|CDY41717.1|  BnaA09g15450D                                          331   2e-107   Brassica napus [oilseed rape]
gb|AFK28267.1|  putative serine decarboxylase                           323   2e-107   Helianthus deserticola
ref|XP_009113392.1|  PREDICTED: serine decarboxylase-like               331   2e-107   Brassica rapa
ref|XP_009107655.1|  PREDICTED: serine decarboxylase-like               332   3e-107   Brassica rapa
ref|XP_010500117.1|  PREDICTED: serine decarboxylase-like               331   4e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010461415.1|  PREDICTED: serine decarboxylase-like               331   4e-107   Camelina sativa [gold-of-pleasure]
gb|AFK28272.1|  putative serine decarboxylase                           322   5e-107   Helianthus anomalus
gb|AFW62562.1|  hypothetical protein ZEAMMB73_033583                    328   6e-107   
gb|AFK28291.1|  putative serine decarboxylase                           322   7e-107   Helianthus niveus
ref|XP_002893962.1|  EMB1075                                            329   8e-107   
ref|XP_010530241.1|  PREDICTED: serine decarboxylase                    330   8e-107   Tarenaya hassleriana [spider flower]
gb|AFK28269.1|  putative serine decarboxylase                           321   9e-107   Helianthus deserticola
ref|XP_006307198.1|  hypothetical protein CARUB_v10008789mg             332   1e-106   
dbj|BAA78331.1|  serine decarboxylase                                   330   1e-106   Brassica napus [oilseed rape]
emb|CDX80723.1|  BnaC08g05570D                                          330   1e-106   
ref|XP_009368241.1|  PREDICTED: serine decarboxylase-like               330   1e-106   
ref|XP_009343619.1|  PREDICTED: serine decarboxylase-like               330   1e-106   Pyrus x bretschneideri [bai li]
ref|XP_010479021.1|  PREDICTED: serine decarboxylase                    330   1e-106   Camelina sativa [gold-of-pleasure]
ref|XP_008678685.1|  PREDICTED: histidine decarboxylase-like            329   2e-106   Zea mays [maize]
emb|CDY48944.1|  BnaA08g04700D                                          329   2e-106   Brassica napus [oilseed rape]
emb|CDY59264.1|  BnaC09g51700D                                          328   2e-106   Brassica napus [oilseed rape]
ref|XP_006854520.1|  hypothetical protein AMTR_s00030p00012550          328   4e-106   Amborella trichopoda
gb|AFK39410.1|  unknown                                                 322   6e-106   Medicago truncatula
ref|XP_008381807.1|  PREDICTED: histidine decarboxylase                 327   9e-106   Malus domestica [apple tree]
ref|XP_008339120.1|  PREDICTED: histidine decarboxylase-like            327   1e-105   Malus domestica [apple tree]
ref|XP_003593129.1|  Histidine decarboxylase                            327   1e-105   Medicago truncatula
ref|XP_009368490.1|  PREDICTED: serine decarboxylase-like               327   1e-105   Pyrus x bretschneideri [bai li]
ref|XP_007227607.1|  hypothetical protein PRUPE_ppa020363mg             325   3e-105   Prunus persica
ref|XP_009145064.1|  PREDICTED: serine decarboxylase                    326   3e-105   Brassica rapa
gb|KFK24263.1|  hypothetical protein AALP_AAs40498U000700               326   4e-105   Arabis alpina [alpine rockcress]
ref|XP_007148444.1|  hypothetical protein PHAVU_006G209300g             325   5e-105   Phaseolus vulgaris [French bean]
ref|XP_004485538.1|  PREDICTED: histidine decarboxylase-like isof...    325   5e-105   Cicer arietinum [garbanzo]
emb|CDY30753.1|  BnaC05g51500D                                          325   6e-105   Brassica napus [oilseed rape]
ref|XP_008218831.1|  PREDICTED: histidine decarboxylase-like            324   6e-105   Prunus mume [ume]
ref|XP_009420591.1|  PREDICTED: serine decarboxylase 1-like             324   1e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010241734.1|  PREDICTED: serine decarboxylase 1-like             325   1e-104   Nelumbo nucifera [Indian lotus]
ref|XP_006584565.1|  PREDICTED: uncharacterized protein LOC100792...    322   4e-104   Glycine max [soybeans]
ref|XP_006584563.1|  PREDICTED: uncharacterized protein LOC100792...    322   5e-104   Glycine max [soybeans]
gb|KHN39188.1|  Histidine decarboxylase                                 323   6e-104   Glycine soja [wild soybean]
ref|XP_006584560.1|  PREDICTED: uncharacterized protein LOC100792...    323   6e-104   
gb|ACJ85197.1|  unknown                                                 322   8e-104   Medicago truncatula
ref|NP_001241244.1|  uncharacterized protein LOC100795577               318   4e-102   Glycine max [soybeans]
gb|KHN26720.1|  Histidine decarboxylase                                 318   6e-102   Glycine soja [wild soybean]
ref|XP_003547587.1|  PREDICTED: histidine decarboxylase                 317   7e-102   Glycine max [soybeans]
gb|AFK28252.1|  putative serine decarboxylase                           304   3e-100   Helianthus agrestis
gb|AFA36595.1|  putative serine decarboxylase                           302   4e-99    Lolium perenne [perennial ryegrass]
ref|XP_001761266.1|  predicted protein                                  308   8e-99    
ref|XP_001754291.1|  predicted protein                                  299   2e-95    
ref|XP_002976233.1|  hypothetical protein SELMODRAFT_175502             299   5e-95    
ref|XP_002987141.1|  hypothetical protein SELMODRAFT_158539             298   2e-94    
ref|XP_010676037.1|  PREDICTED: serine decarboxylase-like               293   5e-93    
ref|XP_010675834.1|  PREDICTED: serine decarboxylase-like               293   5e-93    Beta vulgaris subsp. vulgaris [field beet]
gb|EMT14427.1|  Histidine decarboxylase                                 293   1e-92    
ref|XP_003566804.1|  PREDICTED: serine decarboxylase 1-like             289   6e-91    Brachypodium distachyon [annual false brome]
gb|KEH26769.1|  serine decarboxylase                                    270   4e-87    Medicago truncatula
gb|AES76141.2|  serine decarboxylase                                    270   2e-86    Medicago truncatula
ref|NP_001233845.1|  aromatic amino acid decarboxylase 1A               274   3e-85    Solanum lycopersicum
ref|XP_006365167.1|  PREDICTED: histidine decarboxylase-like            274   4e-85    Solanum tuberosum [potatoes]
ref|XP_010325179.1|  PREDICTED: histidine decarboxylase-like isof...    272   2e-84    
ref|XP_004245280.1|  PREDICTED: histidine decarboxylase-like isof...    272   2e-84    
ref|XP_009789723.1|  PREDICTED: histidine decarboxylase-like            272   2e-84    Nicotiana sylvestris
ref|XP_009769413.1|  PREDICTED: histidine decarboxylase-like isof...    271   4e-84    Nicotiana sylvestris
ref|XP_004245427.1|  PREDICTED: histidine decarboxylase-like            271   6e-84    Solanum lycopersicum
ref|XP_009599698.1|  PREDICTED: histidine decarboxylase-like            270   1e-83    Nicotiana tomentosiformis
gb|KHN16991.1|  Histidine decarboxylase                                 268   1e-83    Glycine soja [wild soybean]
ref|XP_009620691.1|  PREDICTED: histidine decarboxylase-like            270   1e-83    Nicotiana tomentosiformis
ref|XP_006365162.1|  PREDICTED: histidine decarboxylase-like isof...    269   2e-83    Solanum tuberosum [potatoes]
ref|XP_006365164.1|  PREDICTED: histidine decarboxylase-like isof...    269   2e-83    
ref|XP_006365163.1|  PREDICTED: histidine decarboxylase-like isof...    269   3e-83    Solanum tuberosum [potatoes]
ref|XP_003535578.1|  PREDICTED: histidine decarboxylase-like            267   4e-83    
ref|XP_006365166.1|  PREDICTED: histidine decarboxylase-like            268   6e-83    Solanum tuberosum [potatoes]
ref|XP_004245281.1|  PREDICTED: histidine decarboxylase-like            268   6e-83    Solanum lycopersicum
ref|XP_006365165.1|  PREDICTED: histidine decarboxylase-like            268   7e-83    
ref|XP_006365087.1|  PREDICTED: histidine decarboxylase-like            268   9e-83    Solanum tuberosum [potatoes]
ref|XP_009600675.1|  PREDICTED: histidine decarboxylase-like            266   2e-82    
gb|EMS49846.1|  Histidine decarboxylase                                 262   3e-82    Triticum urartu
ref|XP_003619923.1|  L-tyrosine decarboxylase                           264   3e-82    
ref|XP_011081981.1|  PREDICTED: histidine decarboxylase-like isof...    266   3e-82    Sesamum indicum [beniseed]
ref|XP_004244519.1|  PREDICTED: histidine decarboxylase                 266   3e-82    Solanum lycopersicum
ref|XP_006365168.1|  PREDICTED: histidine decarboxylase-like            266   4e-82    Solanum tuberosum [potatoes]
ref|NP_001233852.1|  aromatic amino acid decarboxylase 1B               266   5e-82    
ref|XP_006357084.1|  PREDICTED: histidine decarboxylase-like            265   6e-82    Solanum tuberosum [potatoes]
ref|XP_006366216.1|  PREDICTED: histidine decarboxylase-like            264   7e-82    
ref|NP_001233859.1|  aromatic amino acid decarboxylase 2                265   7e-82    Solanum lycopersicum
ref|XP_004245279.1|  PREDICTED: histidine decarboxylase-like            265   8e-82    Solanum lycopersicum
gb|EAY77466.1|  hypothetical protein OsI_32510                          265   1e-81    Oryza sativa Indica Group [Indian rice]
ref|XP_011081982.1|  PREDICTED: histidine decarboxylase-like isof...    265   1e-81    Sesamum indicum [beniseed]
sp|Q8RV06.1|SDC2_ORYSJ  RecName: Full=Serine decarboxylase 2            265   1e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003535572.1|  PREDICTED: histidine decarboxylase-like            264   2e-81    Glycine max [soybeans]
ref|XP_006357083.1|  PREDICTED: histidine decarboxylase-like            263   6e-81    Solanum tuberosum [potatoes]
gb|ACU18860.1|  unknown                                                 252   7e-81    Glycine max [soybeans]
gb|AES89541.2|  serine decarboxylase                                    254   2e-80    Medicago truncatula
ref|XP_006661594.1|  PREDICTED: histidine decarboxylase-like            261   3e-80    Oryza brachyantha
ref|XP_004244809.1|  PREDICTED: histidine decarboxylase-like            260   4e-80    Solanum lycopersicum
ref|XP_006346847.1|  PREDICTED: histidine decarboxylase-like            261   6e-80    
ref|XP_003592126.1|  Histidine decarboxylase                            259   2e-79    
ref|XP_011082255.1|  PREDICTED: serine decarboxylase-like               258   4e-79    Sesamum indicum [beniseed]
ref|XP_006367691.1|  PREDICTED: histidine decarboxylase-like            258   5e-79    Solanum tuberosum [potatoes]
ref|XP_003607344.1|  Serine decarboxylase                               249   9e-79    
ref|XP_003607341.1|  Embryo defective 1075-like protein                 256   2e-78    
ref|NP_001242861.1|  uncharacterized protein LOC100792053               254   1e-77    
gb|AHG12639.1|  histidine decarboxylase                                 251   1e-76    Nicotiana tabacum [American tobacco]
ref|XP_009779195.1|  PREDICTED: histidine decarboxylase-like            251   2e-76    Nicotiana sylvestris
ref|XP_009774334.1|  PREDICTED: histidine decarboxylase-like            249   5e-76    Nicotiana sylvestris
ref|XP_009622262.1|  PREDICTED: LOW QUALITY PROTEIN: histidine de...    249   6e-76    
ref|XP_002953989.1|  serine decarboxylase                               249   1e-75    Volvox carteri f. nagariensis
gb|AIE54278.1|  aromatic amino acid decarboxylase 2                     248   2e-75    Nicotiana tabacum [American tobacco]
gb|EYU29207.1|  hypothetical protein MIMGU_mgv1a026642mg                246   2e-75    Erythranthe guttata [common monkey flower]
ref|XP_011401256.1|  Histidine decarboxylase                            248   4e-75    Auxenochlorella protothecoides
ref|XP_003592128.1|  Embryo defective 1075-like protein                 247   5e-75    
ref|XP_005845371.1|  hypothetical protein CHLNCDRAFT_53969              247   7e-75    Chlorella variabilis
ref|XP_009601849.1|  PREDICTED: histidine decarboxylase-like isof...    245   9e-75    Nicotiana tomentosiformis
ref|XP_004496485.1|  PREDICTED: histidine decarboxylase-like            246   1e-74    Cicer arietinum [garbanzo]
ref|XP_001689659.1|  serine decarboxylase                               244   1e-74    Chlamydomonas reinhardtii
ref|XP_009601848.1|  PREDICTED: histidine decarboxylase-like isof...    245   2e-74    
gb|EMS65243.1|  Histidine decarboxylase                                 241   9e-74    Triticum urartu
ref|XP_011082256.1|  PREDICTED: serine decarboxylase-like               243   2e-73    
ref|XP_009602156.1|  PREDICTED: histidine decarboxylase-like            243   2e-73    Nicotiana tomentosiformis
ref|XP_006364727.1|  PREDICTED: histidine decarboxylase-like            239   2e-72    
gb|EYU40386.1|  hypothetical protein MIMGU_mgv1a026369mg                236   2e-72    Erythranthe guttata [common monkey flower]
gb|KCW44086.1|  hypothetical protein EUGRSUZ_L02502                     233   3e-72    Eucalyptus grandis [rose gum]
ref|XP_006364728.1|  PREDICTED: histidine decarboxylase-like            239   3e-72    
gb|KEH43660.1|  serine decarboxylase                                    242   4e-72    Medicago truncatula
gb|KDD76585.1|  hypothetical protein H632_c172p0                        239   9e-72    Helicosporidium sp. ATCC 50920
gb|EEC76705.1|  hypothetical protein OsI_14710                          237   1e-71    Oryza sativa Indica Group [Indian rice]
gb|EYU19378.1|  hypothetical protein MIMGU_mgv1a006611mg                237   2e-71    Erythranthe guttata [common monkey flower]
gb|KIZ00141.1|  histidine decarboxylase                                 238   3e-71    Monoraphidium neglectum
gb|AES62380.2|  serine decarboxylase                                    236   5e-71    Medicago truncatula
ref|XP_003592129.1|  Serine decarboxylase                               236   6e-71    
gb|EEE60437.1|  hypothetical protein OsJ_13648                          233   9e-71    Oryza sativa Japonica Group [Japonica rice]
gb|EYU30500.1|  hypothetical protein MIMGU_mgv1a023109mg                235   1e-70    Erythranthe guttata [common monkey flower]
ref|XP_005646136.1|  serine decarboxylase                               232   7e-70    Coccomyxa subellipsoidea C-169
sp|Q7X8D4.2|SDC3_ORYSJ  RecName: Full=Serine decarboxylase 3            233   9e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006362640.1|  PREDICTED: histidine decarboxylase-like            230   1e-69    
ref|XP_002456988.1|  hypothetical protein SORBIDRAFT_03g046840          233   2e-69    Sorghum bicolor [broomcorn]
ref|XP_004245146.1|  PREDICTED: histidine decarboxylase-like            230   1e-68    Solanum lycopersicum
ref|XP_006663420.1|  PREDICTED: histidine decarboxylase-like            230   2e-68    Oryza brachyantha
ref|XP_003592132.1|  FAR1-related protein                               240   2e-68    
ref|XP_004245145.1|  PREDICTED: histidine decarboxylase-like            229   3e-68    Solanum lycopersicum
gb|AEW07461.1|  hypothetical protein 0_2106_01                          219   4e-68    Pinus radiata
ref|XP_004245144.1|  PREDICTED: histidine decarboxylase                 228   7e-68    Solanum lycopersicum
gb|AFG54679.1|  hypothetical protein 0_2106_01                          218   2e-67    Pinus taeda
ref|NP_001234136.1|  histidine decarboxylase                            225   7e-67    
ref|XP_007159060.1|  hypothetical protein PHAVU_002G204900g             223   1e-65    Phaseolus vulgaris [French bean]
ref|XP_007159059.1|  hypothetical protein PHAVU_002G204900g             223   3e-65    Phaseolus vulgaris [French bean]
ref|XP_009609584.1|  PREDICTED: histidine decarboxylase-like            212   1e-63    
ref|XP_002292250.1|  histidine decarboxylase                            208   6e-61    Thalassiosira pseudonana CCMP1335
ref|XP_002178784.1|  predicted protein                                  206   2e-60    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002679079.1|  predicted protein                                  199   9e-57    Naegleria gruberi strain NEG-M
ref|XP_004364837.2|  serine decarboxylase                               197   2e-54    Capsaspora owczarzaki ATCC 30864
gb|KJE90702.1|  serine decarboxylase                                    197   2e-54    Capsaspora owczarzaki ATCC 30864
ref|WP_026730962.1|  histidine decarboxylase                            172   3e-47    
ref|XP_003593127.1|  Histidine decarboxylase                            163   2e-46    
gb|ABA93664.1|  retrotransposon protein, putative, unclassified         175   2e-45    Oryza sativa Japonica Group [Japonica rice]
ref|WP_015112001.1|  Histidine decarboxylase                            167   6e-45    Nostoc sp. PCC 7107
ref|WP_017312078.1|  histidine decarboxylase                            166   9e-45    Fischerella sp. PCC 9339
ref|WP_016859640.1|  histidine decarboxylase                            165   3e-44    Fischerella muscicola
ref|WP_016870188.1|  histidine decarboxylase                            162   2e-43    Fischerella muscicola
ref|WP_026721610.1|  histidine decarboxylase                            162   2e-43    Fischerella sp. PCC 9431
ref|NP_001176002.1|  Os10g0105700                                       157   4e-43    
ref|WP_012408195.1|  histidine decarboxylase                            162   5e-43    Nostoc punctiforme
ref|WP_009455225.1|  histidine decarboxylase                            161   5e-43    Fischerella thermalis
ref|WP_040468965.1|  histidine decarboxylase                            154   3e-42    
ref|XP_005840580.1|  hypothetical protein GUITHDRAFT_156940             153   3e-40    Guillardia theta CCMP2712
ref|WP_026731780.1|  histidine decarboxylase                            154   3e-40    
gb|EYU24758.1|  hypothetical protein MIMGU_mgv1a026373mg                148   6e-39    Erythranthe guttata [common monkey flower]
ref|WP_025665600.1|  histidine decarboxylase                            149   2e-38    Aquimarina megaterium
ref|WP_034238501.1|  histidine decarboxylase                            149   2e-38    Aquimarina atlantica
gb|EZH75803.1|  histidine decarboxylase                                 149   3e-38    Aquimarina atlantica
ref|WP_008878268.1|  Pyridoxal-dependent decarboxylase                  146   2e-37    
ref|WP_035090976.1|  histidine decarboxylase                            146   2e-37    Aquimarina macrocephali
ref|WP_003516909.1|  histidine decarboxylase                            146   4e-37    Hungateiclostridium thermocellum
ref|WP_023062889.1|  histidine decarboxylase                            146   4e-37    Hungateiclostridium thermocellum
ref|WP_020457998.1|  histidine decarboxylase                            146   4e-37    Hungateiclostridium thermocellum
ref|WP_003514849.1|  histidine decarboxylase                            146   4e-37    Hungateiclostridium thermocellum
dbj|BAH97114.1|  amino acid decarboxylase                               142   1e-36    Naegleria fowleri [brain-eating amoeba]
gb|EAZ18332.1|  hypothetical protein OsJ_33863                          144   3e-36    Oryza sativa Japonica Group [Japonica rice]
gb|AGT16577.1|  histidine decarboxylase-like protein                    142   7e-36    Saccharum hybrid cultivar R570
gb|KHN17002.1|  Histidine decarboxylase                                 143   1e-35    Glycine soja [wild soybean]
gb|KCW71157.1|  hypothetical protein EUGRSUZ_F04254                     133   2e-35    Eucalyptus grandis [rose gum]
ref|WP_027411177.1|  histidine decarboxylase                            140   3e-35    Aquimarina muelleri
ref|WP_014680621.1|  histidine decarboxylase                            139   9e-35    Solitalea canadensis
ref|WP_004156018.1|  histidine decarboxylase                            139   1e-34    Microscilla marina
ref|WP_017497877.1|  histidine decarboxylase                            137   4e-34    Flavobacterium sp. WG21
ref|WP_011142216.1|  histidine decarboxylase                            137   5e-34    Gloeobacter violaceus
ref|WP_034760693.1|  histidine decarboxylase                            137   6e-34    Chryseobacterium sp. OV259
gb|AFY36874.1|  Histidine decarboxylase                                 139   8e-34    Leptolyngbya sp. PCC 7376
ref|WP_013621330.1|  histidine decarboxylase                            136   1e-33    Cellulophaga lytica
ref|WP_040295065.1|  hypothetical protein                               136   1e-33    
ref|WP_034646581.1|  histidine decarboxylase                            136   1e-33    Cellulophaga
ref|WP_038505799.1|  histidine decarboxylase                            136   1e-33    Cellulophaga lytica
gb|KFF73912.1|  histidine decarboxylase                                 136   1e-33    Chryseobacterium sp. P1-3
gb|EIJ41099.1|  PLP-dependent enzyme, glutamate decarboxylase           136   1e-33    Beggiatoa alba B18LD
ref|WP_041764715.1|  hypothetical protein                               136   1e-33    
ref|WP_015192440.1|  Histidine decarboxylase                            137   3e-33    Stanieria cyanosphaera
ref|WP_024740708.1|  histidine decarboxylase                            135   4e-33    Tenacibaculum maritimum
ref|WP_042506313.1|  histidine decarboxylase                            134   7e-33    Algibacter lectus
gb|EMT14424.1|  Histidine decarboxylase                                 135   8e-33    
ref|WP_036288070.1|  histidine decarboxylase                            134   8e-33    
ref|WP_028889574.1|  histidine decarboxylase                            133   1e-32    Tenacibaculum ovolyticum
ref|WP_008032061.1|  Pyridoxal-dependent decarboxylase                  134   2e-32    Rhodobacter sp. SW2
ref|WP_043706361.1|  histidine decarboxylase                            132   3e-32    
ref|XP_009600053.1|  PREDICTED: histidine decarboxylase-like            129   3e-32    
ref|WP_026815498.1|  histidine decarboxylase                            132   4e-32    
ref|WP_014680343.1|  histidine decarboxylase                            131   8e-32    
ref|WP_026632650.1|  histidine decarboxylase                            131   1e-31    
ref|WP_037437993.1|  histidine decarboxylase                            130   1e-31    
ref|WP_025146293.1|  histidine decarboxylase                            130   1e-31    
ref|WP_007138876.1|  histidine decarboxylase                            130   1e-31    
ref|WP_029274788.1|  histidine decarboxylase                            130   1e-31    
ref|WP_013663956.1|  histidine decarboxylase                            130   3e-31    
gb|KGR35339.1|  histidine decarboxylase                                 130   3e-31    
ref|WP_019504461.1|  hypothetical protein                               131   3e-31    
ref|WP_005427952.1|  histidine decarboxylase                            130   3e-31    
ref|WP_038006112.1|  histidine decarboxylase                            129   4e-31    
gb|EIJ36795.1|  Pyridoxal-dependent decarboxylase                       129   4e-31    
ref|WP_010473064.1|  histidine decarboxylase                            130   5e-31    
ref|WP_012127831.1|  histidine decarboxylase                            129   5e-31    
ref|WP_040574889.1|  hypothetical protein                               129   6e-31    
ref|WP_042499973.1|  histidine decarboxylase                            129   6e-31    
ref|WP_014201338.1|  histidine decarboxylase                            129   6e-31    
ref|WP_038890337.1|  histidine decarboxylase                            129   8e-31    
ref|WP_005533429.1|  histidine decarboxylase                            128   8e-31    
ref|WP_039472909.1|  histidine decarboxylase                            128   8e-31    
ref|WP_012166190.1|  histidine decarboxylase                            129   1e-30    
gb|KIX22111.1|  histidine decarboxylase                                 128   1e-30    
ref|WP_041885112.1|  histidine decarboxylase                            128   1e-30    
ref|XP_008620940.1|  histidine decarboxylase                            128   1e-30    
ref|WP_010647516.1|  histidine decarboxylase                            128   1e-30    
ref|WP_038528108.1|  histidine decarboxylase                            127   2e-30    
ref|WP_039116802.1|  histidine decarboxylase                            126   4e-30    
ref|WP_026362388.1|  histidine decarboxylase                            126   4e-30    
gb|KDO21825.1|  hypothetical protein SPRG_12642                         126   7e-30    
ref|WP_034885662.1|  pyridoxal-dependent decarboxylase                  125   1e-29    
ref|WP_041881750.1|  histidine decarboxylase                            125   1e-29    
ref|WP_040841268.1|  hypothetical protein                               124   2e-29    
ref|WP_028892147.1|  histidine decarboxylase                            124   2e-29    
ref|WP_009841733.1|  histidine decarboxylase                            124   3e-29    
ref|WP_038863593.1|  histidine decarboxylase                            124   3e-29    
ref|WP_038267770.1|  histidine decarboxylase                            124   3e-29    
ref|WP_009963501.1|  histidine decarboxylase                            124   4e-29    
ref|WP_038239506.1|  histidine decarboxylase                            123   5e-29    
ref|WP_017055794.1|  histidine decarboxylase                            123   5e-29    
ref|WP_036146264.1|  histidine decarboxylase                            123   6e-29    
ref|WP_010913856.1|  histidine decarboxylase                            122   1e-28    
ref|WP_033002296.1|  histidine decarboxylase                            122   2e-28    
ref|WP_018151708.1|  hypothetical protein                               121   3e-28    
ref|WP_016529303.1|  histidine decarboxylase                            120   5e-28    
ref|WP_020977926.1|  histidine decarboxylase                            120   8e-28    
ref|WP_038170807.1|  histidine decarboxylase                            120   9e-28    
ref|WP_011154645.1|  histidine decarboxylase                            120   9e-28    
ref|WP_013995757.1|  histidine decarboxylase                            119   2e-27    
ref|WP_013661870.1|  histidine decarboxylase                            119   3e-27    
ref|WP_004737502.1|  histidine decarboxylase                            118   4e-27    
gb|KDW84254.1|  hypothetical protein AC70_4802                          113   6e-27    
dbj|GAJ47127.1|  histidine decarboxylase                                116   1e-26    
ref|WP_022551512.1|  Histidine decarboxylase                            117   1e-26    
ref|WP_010181748.1|  histidine decarboxylase                            116   1e-26    
ref|WP_031316740.1|  histidine decarboxylase                            116   1e-26    
ref|WP_043639836.1|  histidine decarboxylase                            116   2e-26    
ref|WP_043592636.1|  histidine decarboxylase                            116   2e-26    
ref|WP_042585292.1|  histidine decarboxylase                            116   2e-26    
gb|KIP17071.1|  histidine decarboxylase                                 116   2e-26    
gb|EQC02399.1|  histidine decarboxylase                                 116   2e-26    
gb|ABO92295.1|  histidine decarboxylase                                 116   2e-26    
ref|WP_043144304.1|  histidine decarboxylase                            116   2e-26    
ref|WP_034281999.1|  histidine decarboxylase                            116   2e-26    
ref|WP_042467211.1|  histidine decarboxylase                            115   2e-26    
ref|WP_034524496.1|  histidine decarboxylase                            115   2e-26    
ref|WP_004863422.1|  histidine decarboxylase                            115   2e-26    
gb|EHI50832.1|  histidine decarboxylase                                 115   3e-26    
ref|WP_042556656.1|  histidine decarboxylase                            115   3e-26    
ref|WP_036985757.1|  histidine decarboxylase                            115   5e-26    
emb|CAN84646.1|  histidine decarboxylase                                115   5e-26    
gb|EYU30499.1|  hypothetical protein MIMGU_mgv1a018143mg                112   9e-26    
ref|WP_022610851.1|  Histidine decarboxylase                            114   1e-25    
ref|WP_022589616.1|  Histidine decarboxylase                            114   1e-25    
ref|WP_004401828.1|  histidine decarboxylase                            114   1e-25    
gb|ABR25820.1|  histidine decarboxylase                                 107   2e-25    
ref|WP_012069347.1|  histidine decarboxylase                            113   2e-25    
ref|WP_034119545.1|  histidine decarboxylase                            113   2e-25    
ref|WP_005788362.1|  histidine decarboxylase                            113   2e-25    
ref|WP_026037108.1|  histidine decarboxylase                            112   3e-25    
ref|WP_010521317.1|  histidine decarboxylase                            112   3e-25    
ref|WP_010864579.1|  histidine decarboxylase                            112   4e-25    
ref|WP_039045861.1|  histidine decarboxylase                            112   4e-25    
emb|CCJ09762.1|  putative histidine decarboxylase-like                  105   4e-25    
gb|EFA28401.1|  histidine decarboxylase                                 108   5e-25    
ref|WP_005692801.1|  histidine decarboxylase                            112   5e-25    
ref|WP_006995234.1|  MULTISPECIES: histidine decarboxylase              112   5e-25    
ref|WP_033003777.1|  histidine decarboxylase                            112   5e-25    
dbj|GAD76103.1|  hypothetical protein VAZ01S_036_00470                  112   6e-25    
gb|EMU06553.1|  histidine decarboxylase                                 109   7e-25    
ref|WP_025468757.1|  histidine decarboxylase                            109   7e-25    
ref|WP_005301029.1|  histidine decarboxylase                            111   1e-24    
dbj|BAE94285.1|  histidine decarboxylase                                111   1e-24    
ref|WP_005138337.1|  histidine decarboxylase                            110   1e-24    
gb|ERB65931.1|  hypothetical protein N779_07570                         108   2e-24    
gb|KJF87341.1|  histidine decarboxylase                                 107   2e-24    
ref|WP_029661164.1|  hypothetical protein                               109   3e-24    
gb|EJK75470.1|  hypothetical protein THAOC_02802                        110   3e-24    
ref|WP_002058887.1|  histidine decarboxylase                            110   3e-24    
ref|WP_026948110.1|  hypothetical protein                               109   4e-24    
ref|WP_040121251.1|  histidine decarboxylase                            109   5e-24    
ref|WP_032037888.1|  histidine decarboxylase                            109   6e-24    
ref|WP_005196164.1|  histidine decarboxylase                            108   6e-24    
ref|WP_000603877.1|  histidine decarboxylase                            108   6e-24    
ref|WP_030424673.1|  histidine decarboxylase                            108   8e-24    
ref|WP_011859800.1|  histidine decarboxylase                            108   8e-24    
ref|WP_031965236.1|  histidine decarboxylase                            108   9e-24    
ref|WP_031955420.1|  histidine decarboxylase                            108   9e-24    
ref|WP_031995260.1|  histidine decarboxylase                            108   9e-24    
ref|WP_000603876.1|  histidine decarboxylase                            108   9e-24    
ref|WP_021511013.1|  histidine decarboxylase                            108   9e-24    
ref|WP_020302734.1|  histidine decarboxylase                            108   9e-24    
ref|WP_000603880.1|  histidine decarboxylase                            108   9e-24    
ref|WP_019817102.1|  histidine decarboxylase                            108   9e-24    
ref|WP_044101067.1|  histidine decarboxylase                            108   9e-24    
ref|WP_017480701.1|  MULTISPECIES: histidine decarboxylase              108   9e-24    
ref|WP_000603861.1|  histidine decarboxylase                            108   9e-24    
ref|WP_039759067.1|  histidine decarboxylase                            108   9e-24    
ref|WP_023896388.1|  Histidine decarboxylase                            108   9e-24    
ref|WP_014718553.1|  MULTISPECIES: histidine decarboxylase              108   9e-24    
ref|WP_032058746.1|  histidine decarboxylase                            108   1e-23    
ref|WP_018788874.1|  histidine decarboxylase                            108   1e-23    
gb|KGY51676.1|  histidine decarboxylase                                 108   1e-23    
ref|WP_031993225.1|  histidine decarboxylase                            108   1e-23    
ref|WP_019275400.1|  histidine decarboxylase                            108   1e-23    
ref|WP_043010788.1|  histidine decarboxylase                            108   1e-23    
ref|WP_038349211.1|  histidine decarboxylase                            108   1e-23    
sp|P95477.1|DCHS_PSEFL  RecName: Full=Histidine decarboxylase; Sh...    108   1e-23    
ref|WP_032009129.1|  histidine decarboxylase                            108   1e-23    
ref|WP_006960325.1|  MULTISPECIES: histidine decarboxylase              108   1e-23    
ref|WP_005084750.1|  MULTISPECIES: histidine decarboxylase              108   1e-23    
ref|WP_005131724.1|  histidine decarboxylase                            108   1e-23    
ref|WP_042005730.1|  histidine decarboxylase                            108   1e-23    
ref|WP_043188769.1|  histidine decarboxylase                            108   1e-23    
ref|WP_031948968.1|  histidine decarboxylase                            108   1e-23    
ref|WP_000603864.1|  histidine decarboxylase                            108   1e-23    
ref|WP_002046800.1|  histidine decarboxylase                            108   1e-23    
ref|WP_000603881.1|  histidine decarboxylase                            108   1e-23    
ref|WP_005073362.1|  histidine decarboxylase                            108   1e-23    
ref|WP_032063040.1|  histidine decarboxylase                            108   1e-23    
ref|WP_032017576.1|  histidine decarboxylase                            108   1e-23    
ref|WP_005128217.1|  histidine decarboxylase                            108   1e-23    
ref|WP_039098800.1|  histidine decarboxylase                            107   1e-23    
ref|WP_032035746.1|  histidine decarboxylase                            107   2e-23    
ref|WP_002118388.1|  MULTISPECIES: histidine decarboxylase              107   2e-23    
ref|WP_000603871.1|  histidine decarboxylase                            107   2e-23    
ref|WP_000603875.1|  histidine decarboxylase                            107   2e-23    
ref|WP_000603882.1|  histidine decarboxylase                            107   2e-23    
ref|WP_024436628.1|  histidine decarboxylase                            107   2e-23    
ref|WP_005109677.1|  histidine decarboxylase                            107   2e-23    
ref|WP_005068053.1|  MULTISPECIES: histidine decarboxylase              107   2e-23    
ref|WP_000603862.1|  histidine decarboxylase                            107   2e-23    
ref|WP_000927250.1|  histidine decarboxylase                            107   2e-23    
ref|WP_000603867.1|  histidine decarboxylase                            107   2e-23    
ref|WP_011533709.1|  histidine decarboxylase                            107   2e-23    
ref|WP_005306879.1|  MULTISPECIES: histidine decarboxylase              107   2e-23    
ref|WP_004840538.1|  histidine decarboxylase                            107   2e-23    
ref|WP_000603872.1|  histidine decarboxylase                            107   2e-23    
ref|WP_004746555.1|  histidine decarboxylase                            107   2e-23    
ref|WP_032045777.1|  histidine decarboxylase                            107   2e-23    
ref|WP_000603873.1|  histidine decarboxylase                            107   2e-23    
ref|WP_000603869.1|  histidine decarboxylase                            107   2e-23    
ref|WP_017815795.1|  histidine decarboxylase                            107   2e-23    
ref|WP_032060642.1|  histidine decarboxylase                            107   2e-23    
ref|WP_004639823.1|  histidine decarboxylase                            107   2e-23    
ref|WP_031978061.1|  histidine decarboxylase                            107   2e-23    
ref|WP_000603865.1|  histidine decarboxylase                            107   2e-23    
ref|WP_032027924.1|  histidine decarboxylase                            107   2e-23    
ref|WP_036558522.1|  histidine decarboxylase                            107   2e-23    
ref|WP_032001354.1|  histidine decarboxylase                            107   2e-23    
ref|WP_016653750.1|  histidine decarboxylase                            107   2e-23    
ref|WP_002126558.1|  histidine decarboxylase                            107   2e-23    
ref|WP_032874071.1|  histidine decarboxylase                            107   2e-23    
ref|WP_030334778.1|  histidine decarboxylase                            107   2e-23    
ref|WP_018788565.1|  histidine decarboxylase                            107   2e-23    
ref|WP_000603884.1|  histidine decarboxylase                            107   2e-23    
ref|WP_032866759.1|  histidine decarboxylase                            107   2e-23    
ref|WP_000603863.1|  histidine decarboxylase                            107   2e-23    
ref|WP_024439211.1|  histidine decarboxylase                            107   2e-23    
dbj|BAC87908.1|  probable acinetobactin biosynthesis protein            107   2e-23    
ref|WP_002132193.1|  histidine decarboxylase                            107   2e-23    
ref|WP_009507303.1|  histidine decarboxylase                            107   2e-23    
ref|WP_017386577.1|  MULTISPECIES: histidine decarboxylase              107   2e-23    
ref|WP_033847713.1|  histidine decarboxylase                            107   2e-23    
ref|WP_032068226.1|  histidine decarboxylase                            107   2e-23    
ref|WP_043170531.1|  MULTISPECIES: histidine decarboxylase              107   2e-23    
ref|WP_031961008.1|  histidine decarboxylase                            107   3e-23    
ref|WP_010635694.1|  MULTISPECIES: histidine decarboxylase              107   3e-23    
ref|WP_024433575.1|  histidine decarboxylase                            107   3e-23    
ref|WP_000603878.1|  histidine decarboxylase                            107   3e-23    
gb|AII01327.1|  histidine decarboxylase                                 107   3e-23    
ref|WP_000603885.1|  histidine decarboxylase                            107   3e-23    
ref|WP_031976591.1|  histidine decarboxylase                            107   3e-23    
ref|WP_000603866.1|  histidine decarboxylase                            107   3e-23    
gb|AAA25071.1|  histidine decarboxylase                                 107   3e-23    
ref|WP_004869084.1|  MULTISPECIES: histidine decarboxylase              107   3e-23    
ref|WP_032058148.1|  histidine decarboxylase                            107   3e-23    
ref|WP_032004531.1|  histidine decarboxylase                            107   3e-23    
ref|WP_017725496.1|  histidine decarboxylase                            107   3e-23    
gb|AHV37347.1|  histidine decarboxylase                                 107   3e-23    
ref|WP_000603868.1|  MULTISPECIES: histidine decarboxylase              107   3e-23    
ref|WP_019840896.1|  histidine decarboxylase                            107   3e-23    
gb|KGF60681.1|  histidine decarboxylase                                 106   4e-23    
ref|WP_033851982.1|  histidine decarboxylase                            106   4e-23    
ref|WP_004234859.1|  MULTISPECIES: histidine decarboxylase              106   5e-23    
ref|WP_031380129.1|  histidine decarboxylase                            106   5e-23    
gb|KJG27749.1|  histidine decarboxylase                                 106   5e-23    
gb|KJG35078.1|  histidine decarboxylase                                 106   5e-23    
ref|WP_024474395.1|  histidine decarboxylase                            106   5e-23    
ref|WP_025152530.1|  histidine decarboxylase                            106   5e-23    
ref|WP_031964057.1|  histidine decarboxylase                            106   5e-23    
ref|WP_000603883.1|  histidine decarboxylase                            106   5e-23    
ref|WP_032000503.1|  histidine decarboxylase                            106   5e-23    
ref|WP_032055342.1|  histidine decarboxylase                            106   6e-23    
ref|WP_017787016.1|  histidine decarboxylase                            106   7e-23    
sp|P05034.2|DCHS_MORMO  RecName: Full=Histidine decarboxylase; Sh...    105   7e-23    
ref|WP_041204738.1|  histidine decarboxylase                            105   7e-23    
ref|WP_017764935.1|  histidine decarboxylase                            105   7e-23    
ref|WP_017781294.1|  histidine decarboxylase                            105   8e-23    
emb|CBV42710.1|  histidine decarboxylase                                105   8e-23    
ref|WP_017784253.1|  histidine decarboxylase                            105   9e-23    
ref|WP_000603874.1|  histidine decarboxylase                            105   9e-23    



>ref|XP_011101473.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
 ref|XP_011101480.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=517

 Score =   358 bits (918),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRL HINALSSNVEYLASRDATIMGSRN
Sbjct  299  KAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLQHINALSSNVEYLASRDATIMGSRN  358

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+D
Sbjct  359  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPRD  418

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE NM+HVVVMPSVTVEKLD FL+E+IQ RS+WY+ GN  PPCLA D+G 
Sbjct  419  EEFVRRWQLACEGNMAHVVVMPSVTVEKLDFFLNEIIQGRSIWYKDGNVHPPCLAADIGS  478

Query  225  SNCCCVLHK  199
            +NC C LHK
Sbjct  479  NNCSCALHK  487



>ref|XP_004237774.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
 ref|XP_010320069.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
Length=482

 Score =   355 bits (912),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HINALSSNVEYLASRDATIMGSRN
Sbjct  295  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRN  354

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L GAGISAMLNELSSTVVFERPKD
Sbjct  355  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAGISAMLNELSSTVVFERPKD  414

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVR+WQLACERNM+HVVVMPSVTV+KLD FLDEL++ARS+WY+  + KPPCLA D+G 
Sbjct  415  EEFVRKWQLACERNMAHVVVMPSVTVDKLDNFLDELVEARSIWYKDEDVKPPCLASDIGS  474

Query  225  SNCCCVLH  202
             NCCC  H
Sbjct  475  KNCCCPQH  482



>ref|XP_006362822.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362823.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=487

 Score =   353 bits (906),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            + PKV+F KPIGSVSVSGHKFVGCPMPCGVQLTRL+HINALSSNVEYLASRDATIMGSRN
Sbjct  296  RTPKVTFNKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRN  355

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L GAGISAMLNELSSTVVFERPKD
Sbjct  356  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAGISAMLNELSSTVVFERPKD  415

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVR+WQLACERNM+HVVVMPSVTV+KLD FLDEL++ARS+WY+  + KPPCLA D+G 
Sbjct  416  EEFVRKWQLACERNMAHVVVMPSVTVDKLDNFLDELVEARSIWYKDEDVKPPCLASDIGS  475

Query  225  SNCCCVLHK  199
             NCCC  H+
Sbjct  476  KNCCCPHHR  484



>ref|XP_009616512.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
 ref|XP_009616514.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
Length=487

 Score =   353 bits (905),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +AP+V+FKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HINALS NVEYLASRDATIMGSRN
Sbjct  295  RAPQVTFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSRNVEYLASRDATIMGSRN  354

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLW TLNRKGYKGFQKEVQKCLRNAHYLKD+L GAGISAMLNELSSTVVFERPKD
Sbjct  355  GHAPLFLWCTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAGISAMLNELSSTVVFERPKD  414

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVR+WQLACERNMSHVVVMPSVTVEKLD FLDEL++ARS+WY+  N KPPCLA D+G 
Sbjct  415  EEFVRKWQLACERNMSHVVVMPSVTVEKLDDFLDELVKARSIWYKDENVKPPCLAADIGS  474

Query  225  SNCCCVLHK  199
             NCCC  H+
Sbjct  475  QNCCCPQHR  483



>ref|XP_009784234.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
 ref|XP_009784235.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
Length=487

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +AP+V+FKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HINALS NVEYLASRDATIMGSRN
Sbjct  295  RAPQVTFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSRNVEYLASRDATIMGSRN  354

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLW TLNRKGYKGFQKEVQKCLRNAHYLKD+L GAGIS MLNELSSTVVFERPKD
Sbjct  355  GHAPLFLWCTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAGISGMLNELSSTVVFERPKD  414

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVR+WQLACERNMSHVVVMPSVTVEKLD FLDEL++ARS+WY+  N  PPCLA D+G 
Sbjct  415  EEFVRKWQLACERNMSHVVVMPSVTVEKLDDFLDELVKARSIWYKDENVNPPCLAADIGS  474

Query  225  SNCCCVLHK*CNN  187
             NCCC  H+ CN+
Sbjct  475  RNCCCPQHRGCNS  487



>ref|XP_007019463.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
 gb|EOY16688.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
Length=491

 Score =   349 bits (896),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRN
Sbjct  303  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRN  362

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LRGAGISAMLNELSSTVVFERP+D
Sbjct  363  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRGAGISAMLNELSSTVVFERPRD  422

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++HVVVMP+VT+EKLD FLDEL++ RS WY+  + +PPC+A DVG 
Sbjct  423  EEFVRRWQLACEGNIAHVVVMPNVTIEKLDLFLDELVEKRSTWYQEEHDQPPCIAADVGK  482

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  483  ENCACALHK  491



>ref|NP_001047064.2| Os02g0541300 [Oryza sativa Japonica Group]
 dbj|BAF08978.2| Os02g0541300, partial [Oryza sativa Japonica Group]
Length=207

 Score =   339 bits (869),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HIN LSSNVEYLASRDATIMGSRN
Sbjct  18   KAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINRLSSNVEYLASRDATIMGSRN  77

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKD
Sbjct  78   GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKD  137

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++HVVVMPSVT++KLD FL+EL + R+ WY+ G+ +PPCLA+DVG 
Sbjct  138  EEFVRRWQLACEGNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGE  197

Query  225  SNCCCVLHK  199
             NC C +HK
Sbjct  198  ENCLCSIHK  206



>ref|XP_010108654.1| Histidine decarboxylase [Morus notabilis]
 gb|EXC19910.1| Histidine decarboxylase [Morus notabilis]
Length=483

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  297  APKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  356

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LRGAGISAMLNELSSTVVFERP DE
Sbjct  357  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRGAGISAMLNELSSTVVFERPLDE  416

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF+RRWQLAC+ NM+HVVVMP+VT+EKLD FL+ELI+ RS WY+  N +PPCLA ++G  
Sbjct  417  EFIRRWQLACQGNMAHVVVMPNVTIEKLDVFLNELIEERSAWYQDENVQPPCLAAEIGAE  476

Query  222  NCCCVLH  202
            NC C LH
Sbjct  477  NCACKLH  483



>ref|XP_010063879.1| PREDICTED: serine decarboxylase-like [Eucalyptus grandis]
Length=477

 Score =   345 bits (886),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR+DHINALS NVEYLASRDATIMGSRN
Sbjct  289  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMDHINALSRNVEYLASRDATIMGSRN  348

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERP +
Sbjct  349  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKGRLREAGISAMLNELSSTVVFERPSE  408

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++HVVVMPSV++EKLD F++ELI+ RS WY  G  +PPCLA D+G 
Sbjct  409  EEFVRRWQLACEGNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCLAVDIGA  468

Query  225  SNCCCVLHK  199
             NCCC LHK
Sbjct  469  ENCCCALHK  477



>gb|EYU17447.1| hypothetical protein MIMGU_mgv1a005353mg [Erythranthe guttata]
Length=487

 Score =   345 bits (886),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCG+Q+TRL HINALS NVEYLASRDATIMGSRN
Sbjct  299  KAPKVSFKKPIGSVSVSGHKFVGCPMPCGIQITRLRHINALSRNVEYLASRDATIMGSRN  358

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+D
Sbjct  359  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPRD  418

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVR WQLACE NM+H+VVMP+VTVEKLD FL+EL + R++WY+ G  +PPCLA DVG+
Sbjct  419  EEFVRMWQLACEGNMAHIVVMPNVTVEKLDYFLNELAKGRAIWYKDGKEQPPCLAVDVGI  478

Query  225  SNCCCVLHK  199
             NC C +HK
Sbjct  479  ENCSCAVHK  487



>gb|KCW71161.1| hypothetical protein EUGRSUZ_F04257 [Eucalyptus grandis]
Length=517

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR+DHINALS NVEYLASRDATIMGSRN
Sbjct  329  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMDHINALSRNVEYLASRDATIMGSRN  388

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERP +
Sbjct  389  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKGRLREAGISAMLNELSSTVVFERPSE  448

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++HVVVMPSV++EKLD F++ELI+ RS WY  G  +PPCLA D+G 
Sbjct  449  EEFVRRWQLACEGNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCLAVDIGA  508

Query  225  SNCCCVLHK  199
             NCCC LHK
Sbjct  509  ENCCCALHK  517



>ref|XP_010241731.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
 ref|XP_010241733.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   344 bits (882),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HIN LS NVEYLASRDATIMGSRN
Sbjct  295  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINTLSRNVEYLASRDATIMGSRN  354

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+D
Sbjct  355  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLRAAGIGAMLNELSSTVVFERPQD  414

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMP++T+EKLD FL+ELIQ R  W++ G S+PPC+A DVG 
Sbjct  415  EEFVRRWQLACQGNIAHVVVMPNITIEKLDNFLNELIQKRLTWFQDGKSQPPCIAADVGK  474

Query  225  SNCCCVLHK  199
             NC CVLHK
Sbjct  475  ENCACVLHK  483



>emb|CDP11372.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   340 bits (873),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+H+NALS NVEYLASRDATIMGSRN
Sbjct  208  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRN  267

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+D
Sbjct  268  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRQAGISAMLNELSSTVVFERPRD  327

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVR+WQLAC+ NM+HVVVMP+VT+EKL+ FLD LI+ RS+WY+    KPPCLA ++G 
Sbjct  328  EEFVRQWQLACQGNMAHVVVMPNVTIEKLEGFLDALIEGRSIWYKDDKGKPPCLAAEIGS  387

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  388  GNCSCPLHK  396



>ref|XP_002452231.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
 gb|EES05207.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
Length=494

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +AP+V+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALSSNVEYLASRDATIMGSRN
Sbjct  306  KAPQVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRN  365

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG+ AMLNELSSTVVFERPKD
Sbjct  366  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGVGAMLNELSSTVVFERPKD  425

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++HVVVMPSV ++KLD FL+EL++ R+ WY+ G S+PPC+A DVGV
Sbjct  426  EEFVRRWQLACEGNIAHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARDVGV  485

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  486  ENCLCGLHK  494



>ref|XP_010260914.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRN
Sbjct  295  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRN  354

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+D
Sbjct  355  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLRSAGIGAMLNELSSTVVFERPQD  414

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMP++TVEKLD FL+ELI  RS W++ G S+PPC+A DVG 
Sbjct  415  EEFVRRWQLACQGSIAHVVVMPNITVEKLDDFLNELIGKRSTWFQDGKSQPPCIAADVGK  474

Query  225  SNCCCVLHK  199
             NC CV+HK
Sbjct  475  ENCACVMHK  483



>sp|Q6ESZ9.1|SDC1_ORYSJ RecName: Full=Serine decarboxylase 1 [Oryza sativa Japonica Group]
 dbj|BAD28070.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 dbj|BAD28221.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 gb|EAZ23358.1| hypothetical protein OsJ_07054 [Oryza sativa Japonica Group]
Length=482

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HIN LSSNVEYLASRDATIMGSRN
Sbjct  293  KAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINRLSSNVEYLASRDATIMGSRN  352

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKD
Sbjct  353  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKD  412

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++HVVVMPSVT++KLD FL+EL + R+ WY+ G+ +PPCLA+DVG 
Sbjct  413  EEFVRRWQLACEGNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGE  472

Query  225  SNCCCVLHK  199
             NC C +HK
Sbjct  473  ENCLCSIHK  481



>ref|XP_008645766.1| PREDICTED: histidine decarboxylase-like [Zea mays]
 gb|AFW71722.1| hypothetical protein ZEAMMB73_965103 [Zea mays]
Length=494

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +AP+V+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALSSNVEYLASRDATIMGSRN
Sbjct  306  KAPQVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRN  365

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKD
Sbjct  366  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKD  425

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++HVVVMPSV ++KLD FL+EL++ R+ WY+ G S+PPC+A DVGV
Sbjct  426  EEFVRRWQLACEGNIAHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARDVGV  485

Query  225  SNCCCVLHK  199
             +C C LHK
Sbjct  486  ESCLCGLHK  494



>gb|KDO83688.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
 gb|KDO83689.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
Length=476

 Score =   341 bits (875),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRN
Sbjct  288  KAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRN  347

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+D
Sbjct  348  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQD  407

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMP+VT++KLD FL+ELI+ RS WYE G  +PPC+A D+G 
Sbjct  408  EEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGS  467

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  468  ENCVCAAHK  476



>ref|XP_004952686.1| PREDICTED: histidine decarboxylase-like [Setaria italica]
Length=489

 Score =   342 bits (876),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HIN LSSNVEYLASRDATIMGSRN
Sbjct  301  KAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINVLSSNVEYLASRDATIMGSRN  360

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKD
Sbjct  361  GHAPIFLWYTLNRKGYVGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKD  420

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++HVVVMPSV ++KLD FL EL++ R+ WY+ G SKPPCLA D+GV
Sbjct  421  EEFVRRWQLACEGNIAHVVVMPSVNIDKLDYFLTELVEKRATWYQDGISKPPCLARDLGV  480

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  481  ENCLCGLHK  489



>ref|XP_006472964.1| PREDICTED: histidine decarboxylase-like isoform X1 [Citrus sinensis]
 ref|XP_006472965.1| PREDICTED: histidine decarboxylase-like isoform X2 [Citrus sinensis]
Length=476

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRN
Sbjct  288  KAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRN  347

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+D
Sbjct  348  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQD  407

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMP+VT++KLD FL+ELI+ RS WYE G  +PPC+A D+G 
Sbjct  408  EEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGS  467

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  468  ENCVCAAHK  476



>gb|EAY86197.1| hypothetical protein OsI_07573 [Oryza sativa Indica Group]
Length=484

 Score =   341 bits (875),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HIN LSSNVEYLASRDATIMGSRN
Sbjct  295  KAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINRLSSNVEYLASRDATIMGSRN  354

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKD
Sbjct  355  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKD  414

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++HVVVMPSVT++KLD FL+EL + R+ WY+ G+ +PPCLA+DVG 
Sbjct  415  EEFVRRWQLACEGNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGE  474

Query  225  SNCCCVLHK  199
             NC C +HK
Sbjct  475  ENCLCSIHK  483



>ref|XP_006434436.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47676.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=476

 Score =   340 bits (873),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRN
Sbjct  288  KAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRN  347

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+D
Sbjct  348  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQD  407

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMP+VT++KLD FL+ELI  RS WYE G  +PPC+A D+G 
Sbjct  408  EEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIDNRSTWYEDGKRQPPCIAADIGS  467

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  468  ENCVCAAHK  476



>gb|KDP43008.1| hypothetical protein JCGZ_25194 [Jatropha curcas]
Length=484

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HIN LS NVEYLASRDATIMGSRN
Sbjct  296  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINVLSRNVEYLASRDATIMGSRN  355

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+D
Sbjct  356  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPRD  415

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMP+VT+EKLD FL+ELI+ RS WY+ G  + PC+A DVG 
Sbjct  416  EEFVRRWQLACQGSIAHVVVMPNVTIEKLDNFLNELIEKRSTWYQDGQLQSPCIATDVGS  475

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  476  ENCACALHK  484



>ref|XP_004290538.1| PREDICTED: serine decarboxylase [Fragaria vesca subsp. vesca]
Length=476

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HIN LS+NVEYLASRDATIMGSRNG
Sbjct  289  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINVLSNNVEYLASRDATIMGSRNG  348

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+DE
Sbjct  349  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPQDE  408

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EFVRRWQLAC+ N++HVVVMPSV+V+KLD FL+EL++ RS WY+ G  +PPC+A DVG  
Sbjct  409  EFVRRWQLACQGNIAHVVVMPSVSVDKLDDFLNELVEKRSTWYKDGKVQPPCIAADVGSE  468

Query  222  NCCCVLHK  199
            NC C  HK
Sbjct  469  NCVCGRHK  476



>ref|XP_003579728.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=469

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL HINAL+SNVEYLASRDATIMGSRNG
Sbjct  281  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLKHINALASNVEYLASRDATIMGSRNG  340

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDE
Sbjct  341  HAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLRNAGISAMLNELSSTVVFERPKDE  400

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EFVRRWQLACE N+SHVVVMPSVT+ KLD FL+EL++ R  WY+ G  + PC+A DVG  
Sbjct  401  EFVRRWQLACEGNISHVVVMPSVTINKLDSFLNELVEKRVTWYQEGICQSPCIAGDVGQH  460

Query  222  NCCCVLHK  199
            NC C +HK
Sbjct  461  NCLCTMHK  468



>ref|XP_010931002.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
 ref|XP_010931003.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
Length=475

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HI  LSSNVEYLASRD+TIMGSRN
Sbjct  286  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHIKVLSSNVEYLASRDSTIMGSRN  345

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG+ AMLNELSSTVVFERPKD
Sbjct  346  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKAAGVGAMLNELSSTVVFERPKD  405

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++H+VVMP+VT+EKLD FL+ELIQ RS WYEGG    PCLA D+G 
Sbjct  406  EEFVRRWQLACEGNIAHIVVMPNVTIEKLDTFLNELIQKRSSWYEGGKIPSPCLAADIGD  465

Query  225  SNCCCVLHK  199
             NC C LH+
Sbjct  466  ENCLCSLHQ  474



>ref|XP_002306690.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE93686.1| serine decarboxylase family protein [Populus trichocarpa]
Length=478

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HI+ LS NVEYLASRDATIMGSRN
Sbjct  285  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHIDVLSRNVEYLASRDATIMGSRN  344

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP D
Sbjct  345  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLHDAGISAMLNELSSTVVFERPLD  404

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMPSVT+EKLD FL+EL++ RS+WY  G  +PPC+A DVG 
Sbjct  405  EEFVRRWQLACQGNIAHVVVMPSVTIEKLDDFLNELVEKRSIWYRDGGVQPPCIAADVGC  464

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  465  ENCACALHK  473



>ref|XP_002533017.1| group II plp decarboxylase, putative [Ricinus communis]
 gb|EEF29371.1| group II plp decarboxylase, putative [Ricinus communis]
Length=471

 Score =   338 bits (867),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN LS NVEYLASRDATIMGSRN
Sbjct  283  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSKNVEYLASRDATIMGSRN  342

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQK+VQKCLRNAHYLK +LR AGISAMLNELSSTVV ERPKD
Sbjct  343  GHAPIFLWYTLNRKGYKGFQKDVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVLERPKD  402

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMPSVT+EKLD FLDEL++ RS WY+ G  + PC+A DVG 
Sbjct  403  EEFVRRWQLACQGNIAHVVVMPSVTIEKLDNFLDELVKKRSTWYQDGQVQSPCIAADVGS  462

Query  225  SNCCCVLH  202
             NC C LH
Sbjct  463  ENCACALH  470



>ref|XP_011044197.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=478

 Score =   338 bits (867),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HI+ LS NVEYLASRDATIMGSRN
Sbjct  285  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHIDVLSRNVEYLASRDATIMGSRN  344

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP D
Sbjct  345  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLHDAGISAMLNELSSTVVFERPLD  404

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMPSVT+EKLD FL+EL++ RS WY  G  +PPC+A DVG 
Sbjct  405  EEFVRRWQLACQGNIAHVVVMPSVTIEKLDDFLNELVEKRSTWYRDGGVQPPCIAADVGC  464

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  465  ENCACALHK  473



>ref|XP_011042836.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
 ref|XP_011042837.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=463

 Score =   338 bits (866),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRN
Sbjct  275  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRN  334

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNA+YLKD+LR AGISAMLNELSSTVVFERP D
Sbjct  335  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAYYLKDRLRDAGISAMLNELSSTVVFERPID  394

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E+FVRRWQLAC+ N++HVVVMPSVT+EKLD F++EL++ RS WY+   ++PPC+A DVG 
Sbjct  395  EDFVRRWQLACQGNIAHVVVMPSVTIEKLDDFVNELVEKRSTWYQDEKARPPCIAADVGS  454

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  455  QNCSCDLHK  463



>gb|KJB16469.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=477

 Score =   338 bits (866),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRN
Sbjct  290  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRN  349

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQK+VQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+D
Sbjct  350  GHAPLFLWYTLNRKGYKGFQKDVQKCLRNAHYLKDRLHEAGISAMLNELSSTVVFERPRD  409

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++HVVVMP+VT+EKLD FL+EL++ RS WY+ GN +PPC+A ++G 
Sbjct  410  EEFVRRWQLACEGNIAHVVVMPNVTIEKLDFFLNELVEKRSTWYQ-GNVQPPCIAAEIGK  468

Query  225  SNCCCVLHK  199
            +NC C LHK
Sbjct  469  ANCVCALHK  477



>gb|KJB16470.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=479

 Score =   338 bits (866),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRN
Sbjct  292  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRN  351

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQK+VQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+D
Sbjct  352  GHAPLFLWYTLNRKGYKGFQKDVQKCLRNAHYLKDRLHEAGISAMLNELSSTVVFERPRD  411

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++HVVVMP+VT+EKLD FL+EL++ RS WY+ GN +PPC+A ++G 
Sbjct  412  EEFVRRWQLACEGNIAHVVVMPNVTIEKLDFFLNELVEKRSTWYQ-GNVQPPCIAAEIGK  470

Query  225  SNCCCVLHK  199
            +NC C LHK
Sbjct  471  ANCVCALHK  479



>ref|XP_006434437.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47677.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=544

 Score =   340 bits (871),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRN
Sbjct  356  KAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRN  415

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+D
Sbjct  416  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQD  475

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMP+VT++KLD FL+ELI  RS WYE G  +PPC+A D+G 
Sbjct  476  EEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIDNRSTWYEDGKRQPPCIAADIGS  535

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  536  ENCVCAAHK  544



>gb|KJB16468.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=478

 Score =   338 bits (866),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRN
Sbjct  291  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRN  350

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQK+VQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+D
Sbjct  351  GHAPLFLWYTLNRKGYKGFQKDVQKCLRNAHYLKDRLHEAGISAMLNELSSTVVFERPRD  410

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++HVVVMP+VT+EKLD FL+EL++ RS WY+ GN +PPC+A ++G 
Sbjct  411  EEFVRRWQLACEGNIAHVVVMPNVTIEKLDFFLNELVEKRSTWYQ-GNVQPPCIAAEIGK  469

Query  225  SNCCCVLHK  199
            +NC C LHK
Sbjct  470  ANCVCALHK  478



>gb|KHG24953.1| Histidine decarboxylase [Gossypium arboreum]
Length=478

 Score =   337 bits (865),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRN
Sbjct  291  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRN  350

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQK+VQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+D
Sbjct  351  GHAPLFLWYTLNRKGYKGFQKDVQKCLRNAHYLKDRLHEAGISAMLNELSSTVVFERPRD  410

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++HVVVMP+VT+EKLD FL+EL++ RS WY+ GN +PPC+A ++G 
Sbjct  411  EEFVRRWQLACEGNIAHVVVMPNVTIEKLDFFLNELVEKRSTWYQ-GNVQPPCIAAEIGK  469

Query  225  SNCCCVLHK  199
            +NC C LHK
Sbjct  470  ANCVCALHK  478



>gb|EPS66281.1| serine decarboxylase, partial [Genlisea aurea]
Length=426

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL HINALS +VEYLASRDATIMGSRN
Sbjct  239  KAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLRHINALSRDVEYLASRDATIMGSRN  298

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGF+KEVQKCLRNAHYL  +LR AGISAMLNELSSTVVFERP+D
Sbjct  299  GHAPIFLWYTLNRKGYKGFRKEVQKCLRNAHYLNHRLREAGISAMLNELSSTVVFERPRD  358

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE +M+HVVVMP+VTV KLD FLDELI++RSVWYE G  +PPCLA D+G 
Sbjct  359  EEFVRRWQLACEGSMAHVVVMPNVTVGKLDQFLDELIESRSVWYEDG-VEPPCLAADIGT  417

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  418  ENCSCPLHK  426



>emb|CBI18554.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HINALS NVEYLASRDATIMGSRN
Sbjct  250  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINALSRNVEYLASRDATIMGSRN  309

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP D
Sbjct  310  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPVD  369

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            +EFVRRWQLAC+ N++HVVVMP+VT+EKLD FLDELI+ R+ W+     +PPC+A D+G 
Sbjct  370  DEFVRRWQLACQGNIAHVVVMPNVTIEKLDYFLDELIEKRNTWFLDKKVQPPCVAADIGS  429

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  430  ENCLCDLHK  438



>ref|XP_007201012.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
 gb|EMJ02211.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
Length=480

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRN
Sbjct  292  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRN  351

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLN+KGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKD
Sbjct  352  GHAPIFLWYTLNKKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPKD  411

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMPSV ++KLD FL+EL++ RS WY     +PPC+A DVG 
Sbjct  412  EEFVRRWQLACQGNIAHVVVMPSVNIDKLDDFLNELVEKRSTWYNDEKVQPPCIAADVGT  471

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  472  ENCACGQHK  480



>ref|XP_002302186.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE81459.1| serine decarboxylase family protein [Populus trichocarpa]
Length=463

 Score =   336 bits (861),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRN
Sbjct  275  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRN  334

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNA+YLKD+LR AGISAMLNELSSTVVFERP D
Sbjct  335  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAYYLKDRLRDAGISAMLNELSSTVVFERPID  394

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E+FVRRWQLAC+ N++HVVVMPSVT+EKLD F++EL++ RS WY+    +PPC+A D+G 
Sbjct  395  EDFVRRWQLACQGNIAHVVVMPSVTIEKLDDFVNELVEKRSTWYQDEKVRPPCIAADIGS  454

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  455  QNCSCDLHK  463



>ref|XP_003575093.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=470

 Score =   336 bits (861),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +A KV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALSSNVEYLASRDATIMGSRN
Sbjct  281  KAAKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRN  340

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L  AGI AMLNELSSTVVFERPKD
Sbjct  341  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLNAAGIGAMLNELSSTVVFERPKD  400

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE N++HVVVMPSVT++KLD FL EL++ R+VWY+ G  +PPC+A DVG 
Sbjct  401  EEFVRRWQLACEGNIAHVVVMPSVTIDKLDYFLRELVEKRAVWYKDGICQPPCIARDVGE  460

Query  225  SNCCCVLHK  199
             +C C LHK
Sbjct  461  KSCFCSLHK  469



>ref|XP_010519398.1| PREDICTED: serine decarboxylase-like [Tarenaya hassleriana]
Length=489

 Score =   337 bits (863),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 174/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HI ALS NVEYLASRDATIMGSRN
Sbjct  302  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKALSRNVEYLASRDATIMGSRN  361

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKD
Sbjct  362  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRKAGISAMLNELSSTVVFERPKD  421

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMPSVT+EKLD FLDEL++ RSVWY+ G S+  C+A DVGV
Sbjct  422  EEFVRRWQLACQGNIAHVVVMPSVTIEKLDYFLDELVEQRSVWYKDG-SQALCIASDVGV  480

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  481  ENCICPAHK  489



>gb|AFK28264.1| putative serine decarboxylase, partial [Helianthus paradoxus]
 gb|AFK28265.1| putative serine decarboxylase, partial [Helianthus paradoxus]
 gb|AFK28266.1| putative serine decarboxylase, partial [Helianthus paradoxus]
Length=239

 Score =   327 bits (839),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L GAGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTGAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>ref|XP_009406072.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   336 bits (861),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL HIN LSSNVEYLASRDATIMGSRN
Sbjct  290  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLKHINVLSSNVEYLASRDATIMGSRN  349

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKC+RNAHYLKD+L+ AGI AMLNELSSTVVFERPKD
Sbjct  350  GHAPIFLWYTLNRKGYRGFQKEVQKCVRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKD  409

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            +EFVRRWQLACE N++HVVVMP+V ++KLD FL+EL Q RS WY+ G   PPC+A D+G 
Sbjct  410  DEFVRRWQLACEGNIAHVVVMPNVNIDKLDSFLEELFQKRSCWYQDGKMPPPCIAADIGQ  469

Query  225  SNCCCVLHK  199
             NC CVLHK
Sbjct  470  DNCFCVLHK  478



>ref|XP_004140971.1| PREDICTED: histidine decarboxylase-like isoform 1 [Cucumis sativus]
 ref|XP_004170442.1| PREDICTED: histidine decarboxylase-like isoform 1 [Cucumis sativus]
Length=486

 Score =   336 bits (861),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HINALSSNVEYLASRDATIMGSRN
Sbjct  297  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRN  356

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L   GISAMLNELSSTVVFERP+D
Sbjct  357  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDVGISAMLNELSSTVVFERPRD  416

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+RRWQLACE N++HVVVMPSV+ EKLD FL +L++ RS WY+G N +PPC+A ++G 
Sbjct  417  EEFIRRWQLACEGNIAHVVVMPSVSQEKLDDFLSDLVEKRSTWYDGENVQPPCVAAELGN  476

Query  225  SNCCCVLHK  199
             +C C LH+
Sbjct  477  ESCACKLHR  485



>ref|XP_002266398.1| PREDICTED: serine decarboxylase [Vitis vinifera]
Length=482

 Score =   336 bits (861),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HINALS NVEYLASRDATIMGSRN
Sbjct  294  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINALSRNVEYLASRDATIMGSRN  353

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP D
Sbjct  354  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPVD  413

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            +EFVRRWQLAC+ N++HVVVMP+VT+EKLD FLDELI+ R+ W+     +PPC+A D+G 
Sbjct  414  DEFVRRWQLACQGNIAHVVVMPNVTIEKLDYFLDELIEKRNTWFLDKKVQPPCVAADIGS  473

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  474  ENCLCDLHK  482



>ref|XP_006393773.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
 gb|ESQ31059.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
Length=489

 Score =   336 bits (861),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  LS+NVEYLASRDATIMGSRN
Sbjct  302  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRN  361

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKD
Sbjct  362  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKD  421

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ RSVWYE G S+PPCLA+DVG 
Sbjct  422  EEFVRRWQLACQGDIAHVVVMPSVTIEKLDHFLKDLVEHRSVWYEDG-SQPPCLAKDVGT  480

Query  225  SNCCCVLHK  199
            +NC C  HK
Sbjct  481  NNCICPTHK  489



>ref|XP_004140972.1| PREDICTED: histidine decarboxylase-like isoform 2 [Cucumis sativus]
 ref|XP_004170443.1| PREDICTED: histidine decarboxylase-like isoform 2 [Cucumis sativus]
 gb|KGN46150.1| hypothetical protein Csa_6G057160 [Cucumis sativus]
Length=481

 Score =   336 bits (861),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HINALSSNVEYLASRDATIMGSRN
Sbjct  292  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRN  351

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L   GISAMLNELSSTVVFERP+D
Sbjct  352  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDVGISAMLNELSSTVVFERPRD  411

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+RRWQLACE N++HVVVMPSV+ EKLD FL +L++ RS WY+G N +PPC+A ++G 
Sbjct  412  EEFIRRWQLACEGNIAHVVVMPSVSQEKLDDFLSDLVEKRSTWYDGENVQPPCVAAELGN  471

Query  225  SNCCCVLHK  199
             +C C LH+
Sbjct  472  ESCACKLHR  480



>dbj|BAE07183.1| putative serine decarboxylase [Beta vulgaris]
Length=487

 Score =   336 bits (861),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +AP+V+FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRN
Sbjct  299  KAPQVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINTLSSNVEYLASRDATIMGSRN  358

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+LR  GISAMLNELSSTVVFERP D
Sbjct  359  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLREVGISAMLNELSSTVVFERPLD  418

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+RRWQLAC+ N++HVVVMP++T++KL+ FLDEL++ RS W++ G +KPPC+A D+G 
Sbjct  419  EEFIRRWQLACQGNIAHVVVMPNITIDKLESFLDELVEKRSTWFKDGTNKPPCVASDIGQ  478

Query  225  SNCCCVLHK  199
             NC C +HK
Sbjct  479  ENCVCPMHK  487



>ref|XP_008243632.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=480

 Score =   335 bits (859),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRN
Sbjct  292  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRN  351

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLN+KGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKD
Sbjct  352  GHAPIFLWYTLNKKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPKD  411

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMPSV ++KLD FL+EL++ RS WY+    +PPC+A DVG 
Sbjct  412  EEFVRRWQLACQGNIAHVVVMPSVNIDKLDDFLNELVEKRSTWYKDEKVQPPCIAVDVGT  471

Query  225  SNCCCVLHK  199
             NC C  H+
Sbjct  472  ENCACGQHQ  480



>ref|XP_010680495.1| PREDICTED: serine decarboxylase [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   335 bits (860),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +AP+V+FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRN
Sbjct  299  KAPQVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINTLSSNVEYLASRDATIMGSRN  358

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+LR  GISAMLNELSSTVVFERP D
Sbjct  359  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLREVGISAMLNELSSTVVFERPLD  418

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+RRWQLAC+ N++HVVVMP++T++KL+ FLDEL++ RS W+  G +KPPC+A D+G 
Sbjct  419  EEFIRRWQLACQGNIAHVVVMPNITIDKLESFLDELVEKRSTWFRDGTNKPPCVASDIGQ  478

Query  225  SNCCCVLHK  199
             NC C +HK
Sbjct  479  ENCVCPMHK  487



>gb|KJB59412.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=463

 Score =   335 bits (858),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++H+NALSSNVEYLASRDATIMGSRN
Sbjct  277  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHVNALSSNVEYLASRDATIMGSRN  336

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY GF KEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+D
Sbjct  337  GHAPIFLWYTLNRKGYNGFAKEVQKCLRNAHYLKDQLRAAGIGAMLNELSSTVVFERPRD  396

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E+FVRRWQLACE N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPC+A D+G 
Sbjct  397  EDFVRRWQLACEGNIAHVVVMPSVSIEKLDVFLNELVKNRSTWYQ--EKQPPCIAADIGK  454

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  455  ENCACPLHK  463



>ref|XP_009416900.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   335 bits (859),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR  HIN LSSNVEYLASRDATIMGSRN
Sbjct  290  RAPKVTFTKPIGSVSVSGHKFVGCPMPCGVQITRSKHINVLSSNVEYLASRDATIMGSRN  349

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGIS MLNELSSTVVFERPKD
Sbjct  350  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGISVMLNELSSTVVFERPKD  409

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVR+WQLACE N++HVVVMP+VT++KLD FL+EL++ RS WY+ GN  PPC+A D+G 
Sbjct  410  EEFVRQWQLACEGNIAHVVVMPNVTIDKLDSFLNELLRHRSCWYQEGNISPPCIAADIGE  469

Query  225  SNCCCVLHK  199
             NCCC LH+
Sbjct  470  ENCCCALHR  478



>gb|KJB59410.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=476

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++H+NALSSNVEYLASRDATIMGSRN
Sbjct  290  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHVNALSSNVEYLASRDATIMGSRN  349

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY GF KEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+D
Sbjct  350  GHAPIFLWYTLNRKGYNGFAKEVQKCLRNAHYLKDQLRAAGIGAMLNELSSTVVFERPRD  409

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E+FVRRWQLACE N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPC+A D+G 
Sbjct  410  EDFVRRWQLACEGNIAHVVVMPSVSIEKLDVFLNELVKNRSTWYQ--EKQPPCIAADIGK  467

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  468  ENCACPLHK  476



>gb|KHG04394.1| Histidine decarboxylase [Gossypium arboreum]
Length=476

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++H+NALSSNVEYLASRDATIMGSRN
Sbjct  290  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHVNALSSNVEYLASRDATIMGSRN  349

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY GF KEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+D
Sbjct  350  GHAPIFLWYTLNRKGYNGFAKEVQKCLRNAHYLKDQLRAAGIGAMLNELSSTVVFERPRD  409

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E+FVRRWQLACE N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPC+A D+G 
Sbjct  410  EDFVRRWQLACEGNIAHVVVMPSVSIEKLDVFLNELVKNRSTWYQ--EQQPPCIAADIGK  467

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  468  ENCACPLHK  476



>gb|AFK28277.1| putative serine decarboxylase, partial [Helianthus petiolaris]
Length=239

 Score =   326 bits (836),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ RSVWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRSVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>gb|KJB59411.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=475

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++H+NALSSNVEYLASRDATIMGSRN
Sbjct  289  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHVNALSSNVEYLASRDATIMGSRN  348

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY GF KEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+D
Sbjct  349  GHAPIFLWYTLNRKGYNGFAKEVQKCLRNAHYLKDQLRAAGIGAMLNELSSTVVFERPRD  408

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E+FVRRWQLACE N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPC+A D+G 
Sbjct  409  EDFVRRWQLACEGNIAHVVVMPSVSIEKLDVFLNELVKNRSTWYQ--EKQPPCIAADIGK  466

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  467  ENCACPLHK  475



>ref|XP_008441525.1| PREDICTED: histidine decarboxylase isoform X1 [Cucumis melo]
Length=486

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HINALSSNVEYLASRDATIMGSRN
Sbjct  297  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRN  356

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+D
Sbjct  357  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPRD  416

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+RRWQLACE +++HVVVMPSV+ EKLD FL EL++ RS WY+  N +PPC+A ++G 
Sbjct  417  EEFIRRWQLACEGSIAHVVVMPSVSQEKLDDFLAELVEKRSTWYDDENVQPPCVAAELGN  476

Query  225  SNCCCVLHK  199
             +C C LH+
Sbjct  477  ESCACKLHR  485



>emb|CAN70523.1| hypothetical protein VITISV_034634 [Vitis vinifera]
Length=473

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HINALS NVEYLASRDATIMGSRN
Sbjct  285  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINALSRNVEYLASRDATIMGSRN  344

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP D
Sbjct  345  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPXD  404

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            +EFVRRWQLAC+ N++HVVVMP+VT+EKLD FLD LI+ R+ W+     +PPC+A D+G 
Sbjct  405  DEFVRRWQLACQGNIAHVVVMPNVTIEKLDYFLDXLIEKRNTWFLDKKVQPPCVAADIGS  464

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  465  ENCLCDLHK  473



>gb|AFK28270.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   325 bits (833),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>gb|AFK28279.1| putative serine decarboxylase, partial [Helianthus petiolaris]
Length=239

 Score =   325 bits (833),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>gb|AFK28253.1| putative serine decarboxylase, partial [Helianthus argophyllus]
 gb|AFK28255.1| putative serine decarboxylase, partial [Helianthus argophyllus]
 gb|AFK28258.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28259.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28263.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28268.1| putative serine decarboxylase, partial [Helianthus deserticola]
 gb|AFK28274.1| putative serine decarboxylase, partial [Helianthus anomalus]
 gb|AFK28275.1| putative serine decarboxylase, partial [Helianthus anomalus]
 gb|AFK28276.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28278.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28280.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28284.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28285.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28286.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28288.1| putative serine decarboxylase, partial [Helianthus exilis]
 gb|AFK28289.1| putative serine decarboxylase, partial [Helianthus exilis]
 gb|AFK28290.1| putative serine decarboxylase, partial [Helianthus neglectus]
Length=239

 Score =   325 bits (833),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>ref|XP_006648711.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=467

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALSSNVEYLASRDATIMGSRN
Sbjct  277  KAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRN  336

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERPKD
Sbjct  337  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLREAGIGAMLNELSSTVVFERPKD  396

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWY-EGGNSKPPCLAEDVG  229
            EEFVRRWQLACE +++HVVVMP+VT++KLD FL+EL + R+ WY +GG  + PC+A DVG
Sbjct  397  EEFVRRWQLACEGSIAHVVVMPNVTIDKLDYFLNELREKRATWYQDGGMCQAPCIARDVG  456

Query  228  VSNCCCVLHK  199
              +C C LHK
Sbjct  457  QDSCLCSLHK  466



>ref|XP_008441526.1| PREDICTED: histidine decarboxylase isoform X2 [Cucumis melo]
Length=481

 Score =   333 bits (855),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HINALSSNVEYLASRDATIMGSRN
Sbjct  292  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRN  351

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+D
Sbjct  352  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPRD  411

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+RRWQLACE +++HVVVMPSV+ EKLD FL EL++ RS WY+  N +PPC+A ++G 
Sbjct  412  EEFIRRWQLACEGSIAHVVVMPSVSQEKLDDFLAELVEKRSTWYDDENVQPPCVAAELGN  471

Query  225  SNCCCVLHK  199
             +C C LH+
Sbjct  472  ESCACKLHR  480



>gb|AFK28256.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   325 bits (833),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>gb|AFK28281.1| putative serine decarboxylase, partial [Helianthus debilis]
 gb|AFK28282.1| putative serine decarboxylase, partial [Helianthus debilis]
 gb|AFK28283.1| putative serine decarboxylase, partial [Helianthus debilis]
Length=239

 Score =   325 bits (832),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRGVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>gb|AFK28271.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   324 bits (830),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRVVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>ref|NP_175036.1| serine decarboxylase 1 [Arabidopsis thaliana]
 sp|Q9MA74.1|SDC1_ARATH RecName: Full=Serine decarboxylase; Short=AtSDC; AltName: Full=Protein 
EMBRYO DEFECTIVE 1075; AltName: Full=Serine decarboxylase 
1; Short=AtSDC1 [Arabidopsis thaliana]
 gb|AAF63121.1|AC009526_6 Putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK25943.1|AF360233_1 putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK77493.1|AF389349_1 serine decarboxylase [Arabidopsis thaliana]
 gb|AAK64091.1| putative histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79456.1| histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79457.1| histidine decarboxylase [Arabidopsis thaliana]
 gb|AEE31989.1| serine decarboxylase 1 [Arabidopsis thaliana]
Length=482

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  LSSNVEYLASRDATIMGSRN
Sbjct  295  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRN  354

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKD
Sbjct  355  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKD  414

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ R +WYE G S+PPCLA +VG 
Sbjct  415  EEFVRRWQLACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRLIWYEDG-SQPPCLASEVGT  473

Query  225  SNCCCVLHK  199
            +NC C  HK
Sbjct  474  NNCICPAHK  482



>ref|XP_008781392.1| PREDICTED: serine decarboxylase 1 [Phoenix dactylifera]
Length=475

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HI  LSSNVEYLASRDATIMGSRN
Sbjct  286  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHIKVLSSNVEYLASRDATIMGSRN  345

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG+SAMLNELSSTVVFERPKD
Sbjct  346  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKAAGVSAMLNELSSTVVFERPKD  405

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
             EFVRRWQLACE N++HVVVMP+VTVEKLD FL+ELIQ RS  YE GN   PC+A D+G 
Sbjct  406  GEFVRRWQLACEGNIAHVVVMPNVTVEKLDTFLNELIQNRSSCYEDGNIPFPCIAADIGD  465

Query  225  SNCCCVLHK  199
             NC C LH+
Sbjct  466  ENCLCSLHQ  474



>gb|AFK28273.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   324 bits (830),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI  R+VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIGKRAVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>gb|AFK28257.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   323 bits (829),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++E I+ R+VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNEFIEKRAVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>gb|AFK28262.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   323 bits (829),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRD TIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDTTIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>gb|AFK28260.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   323 bits (829),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            AP+VSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APRVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY  G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYRDGKRKPPCVASDIGRA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>gb|AFK28261.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   323 bits (829),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HV VMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVAVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>gb|AFK28287.1| putative serine decarboxylase, partial [Helianthus bolanderi]
Length=239

 Score =   323 bits (828),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVV+P++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVVPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>gb|AFK28254.1| putative serine decarboxylase, partial [Helianthus argophyllus]
Length=239

 Score =   323 bits (828),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS N EYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNXEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>emb|CDY41717.1| BnaA09g15450D [Brassica napus]
Length=467

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRN
Sbjct  280  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRN  339

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTL+RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKD
Sbjct  340  GHAPLFLWYTLSRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKD  399

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ RSVWYE G S+PPCL +DVG+
Sbjct  400  EEFVRRWQLACQGDIAHVVVMPSVTIEKLDHFLKDLVENRSVWYEDG-SQPPCLVKDVGI  458

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  459  KNCICPAHK  467



>gb|AFK28267.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   323 bits (827),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++K D F++ELI+ R+VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKSDDFVNELIEKRAVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>ref|XP_009113392.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=477

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRN
Sbjct  290  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRN  349

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTL+RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKD
Sbjct  350  GHAPLFLWYTLSRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKD  409

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ RSVWYE G S+PPCL +DVG+
Sbjct  410  EEFVRRWQLACQGDIAHVVVMPSVTIEKLDHFLKDLVENRSVWYEDG-SQPPCLVKDVGI  468

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  469  KNCICPAHK  477



>ref|XP_009107655.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=490

 Score =   332 bits (850),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRN
Sbjct  303  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRN  362

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPK+
Sbjct  363  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKE  422

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVTVEKLD FL +L++ R VWYE G SKPPCL +DVG+
Sbjct  423  EEFVRRWQLACQGDIAHVVVMPSVTVEKLDHFLKDLVEHRLVWYEDG-SKPPCLVKDVGI  481

Query  225  SNCCCVLHK  199
            +NC C  HK
Sbjct  482  NNCICPAHK  490



>ref|XP_010500117.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=481

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  LSSNVEYLASRDATIMGSRN
Sbjct  294  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRN  353

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKD
Sbjct  354  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKD  413

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVT+EKLD F+ +L++ RSVWYE G ++PPCL  +VG 
Sbjct  414  EEFVRRWQLACQGDIAHVVVMPSVTIEKLDNFVKDLVKHRSVWYEDG-TQPPCLVSEVGT  472

Query  225  SNCCCVLHK  199
            +NC C  HK
Sbjct  473  NNCLCPAHK  481



>ref|XP_010461415.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=485

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  LSSNVEYLASRDATIMGSRN
Sbjct  298  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRN  357

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKD
Sbjct  358  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKD  417

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVT+EKLD F+ +L++ RSVWYE G ++PPCL  +VG 
Sbjct  418  EEFVRRWQLACQGDIAHVVVMPSVTIEKLDNFVKDLVKHRSVWYEDG-TQPPCLVSEVGT  476

Query  225  SNCCCVLHK  199
            +NC C  HK
Sbjct  477  NNCICPAHK  485



>gb|AFK28272.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   322 bits (825),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQTTRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI A LNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGATLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNITHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>gb|AFW62562.1| hypothetical protein ZEAMMB73_033583 [Zea mays]
Length=406

 Score =   328 bits (840),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +AP+V+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL++INALSSNVEYLASRDATIMGSRN
Sbjct  218  KAPQVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEYINALSSNVEYLASRDATIMGSRN  277

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKD
Sbjct  278  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKD  337

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E FVRRWQLACE N+ HVVVMPSV ++KLD FL+EL++ R+ WY+ G S+PPC+A  VG 
Sbjct  338  EVFVRRWQLACEGNICHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARVVGF  397

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  398  ENCLCGRHK  406



>gb|AFK28291.1| putative serine decarboxylase, partial [Helianthus niveus]
Length=239

 Score =   322 bits (824),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI A LNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGATLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T+++LD F++ELI+ R+VWY+ G  KPPC+A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDRLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>ref|XP_002893962.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70221.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score =   329 bits (844),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  LS+NVEYLASRDATIMGSRN
Sbjct  275  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRN  334

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERPKD
Sbjct  335  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLCEAGISAMLNELSSTVVFERPKD  394

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ RSVWYE G S+PPCLA +VG 
Sbjct  395  EEFVRRWQLACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRSVWYEDG-SQPPCLASEVGT  453

Query  225  SNCCCVLHK  199
            +NC C  HK
Sbjct  454  NNCICPTHK  462



>ref|XP_010530241.1| PREDICTED: serine decarboxylase [Tarenaya hassleriana]
Length=498

 Score =   330 bits (847),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  LS NVEYLASRDATIMGSRN
Sbjct  311  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSRNVEYLASRDATIMGSRN  370

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTL++KGYKGFQKEVQKCLRNAHYLKD+LRGAGISAMLNELSSTVVFERPKD
Sbjct  371  GHAPLFLWYTLSQKGYKGFQKEVQKCLRNAHYLKDRLRGAGISAMLNELSSTVVFERPKD  430

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMPSV++ KLD FL+EL++ RS+WY+   S+PPC+A DVG 
Sbjct  431  EEFVRRWQLACQGNIAHVVVMPSVSIGKLDSFLNELVEQRSLWYK-DESQPPCVASDVGT  489

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  490  ENCICPTHK  498



>gb|AFK28269.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   321 bits (823),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPP +A D+G +
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPRVASDIGQA  233

Query  222  NCCCVL  205
            NC C L
Sbjct  234  NCLCEL  239



>ref|XP_006307198.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
 gb|EOA40096.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
Length=542

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  LS+NVEYLASRDATIMGSRN
Sbjct  355  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRN  414

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLR AGISAMLNELSSTVVFERPKD
Sbjct  415  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLREAGISAMLNELSSTVVFERPKD  474

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ R VWYE G ++PPCLA +VG 
Sbjct  475  EEFVRRWQLACQGDIAHVVVMPSVTIEKLDDFLKDLVKHRLVWYEDG-TQPPCLASEVGT  533

Query  225  SNCCCVLHK  199
            +NC C  HK
Sbjct  534  NNCICPAHK  542



>dbj|BAA78331.1| serine decarboxylase [Brassica napus]
Length=490

 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRN
Sbjct  303  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRN  362

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPK+
Sbjct  363  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKE  422

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVTVEKLD FL +L++ R VWYE G S+PPCL +DVG+
Sbjct  423  EEFVRRWQLACQGDIAHVVVMPSVTVEKLDHFLKDLVEHRLVWYEDG-SQPPCLVKDVGI  481

Query  225  SNCCCVLHK  199
            +NC C  HK
Sbjct  482  NNCICPAHK  490



>emb|CDX80723.1| BnaC08g05570D [Brassica napus]
Length=489

 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRN
Sbjct  302  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRN  361

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPK+
Sbjct  362  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKE  421

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVTVEKLD FL +L++ R VWYE G S+PPCL +DVG+
Sbjct  422  EEFVRRWQLACQGDIAHVVVMPSVTVEKLDHFLKDLVEHRLVWYEDG-SQPPCLVKDVGI  480

Query  225  SNCCCVLHK  199
            +NC C  HK
Sbjct  481  NNCICPAHK  489



>ref|XP_009368241.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 169/189 (89%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRN
Sbjct  292  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRN  351

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLN+KGY GFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERPKD
Sbjct  352  GHAPIFLWYTLNKKGYSGFQKEVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVFERPKD  411

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMPSV +EKLD FL EL++ RS WY+    +PPC+A DVG 
Sbjct  412  EEFVRRWQLACQGNIAHVVVMPSVNIEKLDDFLSELVEKRSTWYD-EKVQPPCIAADVGT  470

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  471  ENCSCGQHK  479



>ref|XP_009343619.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 169/189 (89%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRN
Sbjct  292  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRN  351

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLN+KGY GFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERPKD
Sbjct  352  GHAPIFLWYTLNKKGYSGFQKEVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVFERPKD  411

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMPSV +EKLD FL EL++ RS WY+    +PPC+A DVG 
Sbjct  412  EEFVRRWQLACQGNIAHVVVMPSVNIEKLDDFLSELVEKRSTWYD-EKVQPPCIAADVGT  470

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  471  ENCSCGQHK  479



>ref|XP_010479021.1| PREDICTED: serine decarboxylase [Camelina sativa]
Length=490

 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  LSSNVEYLASRDATIMGSRN
Sbjct  303  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRN  362

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKD
Sbjct  363  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKD  422

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ R VWYE G ++PPCL  +VG 
Sbjct  423  EEFVRRWQLACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRLVWYEDG-TQPPCLVSEVGT  481

Query  225  SNCCCVLHK  199
            +NC C  HK
Sbjct  482  NNCICPAHK  490



>ref|XP_008678685.1| PREDICTED: histidine decarboxylase-like [Zea mays]
Length=489

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +AP+V+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL++INALSSNVEYLASRDATIMGSRN
Sbjct  301  KAPQVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEYINALSSNVEYLASRDATIMGSRN  360

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKD
Sbjct  361  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKD  420

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E FVRRWQLACE N+ HVVVMPSV ++KLD FL+EL++ R+ WY+ G S+PPC+A  VG 
Sbjct  421  EVFVRRWQLACEGNICHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARVVGF  480

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  481  ENCLCGRHK  489



>emb|CDY48944.1| BnaA08g04700D [Brassica napus]
Length=490

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 172/189 (91%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRN
Sbjct  303  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRN  362

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPK+
Sbjct  363  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPKE  422

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVTVEKLD FL +L++ R VWYE G  KPPCL +DVG+
Sbjct  423  EEFVRRWQLACQGDIAHVVVMPSVTVEKLDHFLKDLVEHRLVWYEDG-CKPPCLVKDVGI  481

Query  225  SNCCCVLHK  199
            +NC C  HK
Sbjct  482  NNCICPAHK  490



>emb|CDY59264.1| BnaC09g51700D [Brassica napus]
Length=470

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = -2

Query  792  LFISFHCHVQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASR  613
            L + F     APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  LS+NVEYLASR
Sbjct  273  LMMPFVKRASAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASR  332

Query  612  DATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSS  433
            DATIMGSRNGHAP+FLWYTL+RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSS
Sbjct  333  DATIMGSRNGHAPLFLWYTLSRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSS  392

Query  432  TVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
            TVVFERP+DEEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ RSVWYE   S+ 
Sbjct  393  TVVFERPRDEEFVRRWQLACQGDIAHVVVMPSVTIEKLDHFLKDLVENRSVWYEEYGSQL  452

Query  252  PCLAEDVGVSNCCCVLHK  199
            PCL +DVG+ NC C  HK
Sbjct  453  PCLVKDVGIKNCICPAHK  470



>ref|XP_006854520.1| hypothetical protein AMTR_s00030p00012550 [Amborella trichopoda]
 gb|ERN15987.1| hypothetical protein AMTR_s00030p00012550 [Amborella trichopoda]
Length=488

 Score =   328 bits (842),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRLDHINALS NVEYLASRDATIMGSRN
Sbjct  300  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLDHINALSRNVEYLASRDATIMGSRN  359

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD LR  GISAMLNELSSTVVFERP+D
Sbjct  360  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDCLRSEGISAMLNELSSTVVFERPQD  419

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++H VVMP++T+EKLD F+ EL   RS W++ G ++ PC+A+++G 
Sbjct  420  EEFVRRWQLACQGNIAHAVVMPNITIEKLDDFVKELTAKRSTWFKDGKAQAPCIADEIGA  479

Query  225  SNCCCVLH  202
             NC C  H
Sbjct  480  ENCACARH  487



>gb|AFK39410.1| unknown [Medicago truncatula]
Length=320

 Score =   322 bits (826),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVE LASRDATIMGSRN
Sbjct  132  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVECLASRDATIMGSRN  191

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP D
Sbjct  192  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHD  251

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+R+WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG 
Sbjct  252  EEFIRKWQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGE  311

Query  225  SNCCCVLHK  199
            ++C C  HK
Sbjct  312  NSCLCAQHK  320



>ref|XP_008381807.1| PREDICTED: histidine decarboxylase [Malus domestica]
Length=479

 Score =   327 bits (839),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 169/189 (89%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRN
Sbjct  292  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRN  351

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLN+KGY GFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERPKD
Sbjct  352  GHAPIFLWYTLNKKGYSGFQKEVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVFERPKD  411

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ N++HVVVMPSV +EKLD FL+EL++ RS WY+    + PC+A DVG 
Sbjct  412  EEFVRRWQLACQGNIAHVVVMPSVNIEKLDDFLNELVEKRSTWYD-EKVQAPCIAADVGT  470

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  471  ENCSCGQHK  479



>ref|XP_008339120.1| PREDICTED: histidine decarboxylase-like [Malus domestica]
Length=479

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHK VGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  293  APKVSFKKPIGSVSVSGHKLVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  352

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAPIFLWYTLN+KGY GFQKEVQKCLRNAHYLK +LR A ISAMLNELSSTVVFERPKDE
Sbjct  353  HAPIFLWYTLNKKGYTGFQKEVQKCLRNAHYLKGRLRDARISAMLNELSSTVVFERPKDE  412

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EFVR+WQLAC+ N++HVVVMPSV++EKLD FL+EL++ RS WY+  N +PPCLA DVG  
Sbjct  413  EFVRKWQLACQGNIAHVVVMPSVSIEKLDNFLNELVEKRSTWYD-ENVQPPCLAADVGTE  471

Query  222  NCCCVLHK  199
            NC C  HK
Sbjct  472  NCSCRQHK  479



>ref|XP_003593129.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES63380.1| serine decarboxylase [Medicago truncatula]
Length=486

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRN
Sbjct  298  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRN  357

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP D
Sbjct  358  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHD  417

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+R+WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG 
Sbjct  418  EEFIRKWQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGE  477

Query  225  SNCCCVLHK  199
            ++C C  HK
Sbjct  478  NSCLCAQHK  486



>ref|XP_009368490.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 168/188 (89%), Gaps = 1/188 (1%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHK VGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  293  APKVSFKKPIGSVSVSGHKLVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  352

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAPIFLWYTLN+KGY GFQKEVQKCLRNAHYLK  LR AGISAMLNELSSTVVFERPKDE
Sbjct  353  HAPIFLWYTLNKKGYTGFQKEVQKCLRNAHYLKGHLRDAGISAMLNELSSTVVFERPKDE  412

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EFVR+WQLAC+ N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPCLA DVG  
Sbjct  413  EFVRKWQLACQGNIAHVVVMPSVSIEKLDNFLNELVEKRSTWYD-EKVQPPCLAADVGTE  471

Query  222  NCCCVLHK  199
            NC C  HK
Sbjct  472  NCSCRQHK  479



>ref|XP_007227607.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
 gb|EMJ28806.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
Length=457

 Score =   325 bits (834),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL HIN LSSNVEYLASRDATIMGSRN
Sbjct  269  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLKHINCLSSNVEYLASRDATIMGSRN  328

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY GFQKEVQKCL+NAHYLKD+LR AGI AMLNELSSTVVFERP++
Sbjct  329  GHAPIFLWYTLNRKGYGGFQKEVQKCLKNAHYLKDRLREAGIGAMLNELSSTVVFERPQE  388

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVR+WQLAC+ N++HV+VMP++T+EKLD FL EL+Q R+ W++ G  + PC+A DVG 
Sbjct  389  EEFVRKWQLACQGNIAHVIVMPNITIEKLDDFLSELLQHRAKWFQDGKLQAPCIASDVGT  448

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  449  ENCLCASHK  457



>ref|XP_009145064.1| PREDICTED: serine decarboxylase [Brassica rapa]
 emb|CDY40942.1| BnaAnng06510D [Brassica napus]
Length=472

 Score =   326 bits (835),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 171/189 (90%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  LSSNVEYLASRDATIMGSRN
Sbjct  285  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSSNVEYLASRDATIMGSRN  344

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKD
Sbjct  345  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKD  404

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+  ++HVVVMPSVT+EKLD FL +L++ RS+W + G S+ PCLA+DVG 
Sbjct  405  EEFVRRWQLACQGEIAHVVVMPSVTIEKLDHFLKDLVEHRSIWCKDG-SQTPCLAKDVGT  463

Query  225  SNCCCVLHK  199
            +NC C  HK
Sbjct  464  NNCVCPAHK  472



>gb|KFK24263.1| hypothetical protein AALP_AAs40498U000700 [Arabis alpina]
Length=489

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  LS+NVEYLASRDATIMGSRN
Sbjct  302  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRN  361

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  +GISAMLNELSSTVVFERPKD
Sbjct  362  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLCESGISAMLNELSSTVVFERPKD  421

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L+Q RSVWY  G S+PPCL  +VG 
Sbjct  422  EEFVRRWQLACQGDIAHVVVMPSVTIEKLDSFLKDLVQHRSVWYADG-SQPPCLVSEVGT  480

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  481  HNCICPAHK  489



>ref|XP_007148444.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
 gb|ESW20438.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
Length=483

 Score =   325 bits (834),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRLD++NALS +VEYLASRDATIMGSRN
Sbjct  295  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLDYVNALSRDVEYLASRDATIMGSRN  354

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP D
Sbjct  355  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLVEAGIGAMLNELSSTVVFERPHD  414

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+RRWQLAC+ N++HVVVMP++T+EKLD FL+EL++ R+ W++ G  +P C++ DVG 
Sbjct  415  EEFIRRWQLACKGNIAHVVVMPNITIEKLDDFLNELLEKRTTWFQDGKDQPYCISADVGE  474

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  475  KNCLCALHK  483



>ref|XP_004485538.1| PREDICTED: histidine decarboxylase-like isoform X1 [Cicer arietinum]
 ref|XP_004485539.1| PREDICTED: histidine decarboxylase-like isoform X2 [Cicer arietinum]
 ref|XP_004485540.1| PREDICTED: histidine decarboxylase-like isoform X3 [Cicer arietinum]
Length=485

 Score =   325 bits (834),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRN
Sbjct  297  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSQNVEYLASRDATIMGSRN  356

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP D
Sbjct  357  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLVEAGIGAMLNELSSTVVFERPHD  416

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+RRWQLAC+ N++HVVVMP+VT++KLD FL+EL + R+ W+E G  +P C+A DVG 
Sbjct  417  EEFIRRWQLACKGNIAHVVVMPNVTIQKLDDFLNELKEKRAAWFEDGKYQPYCIASDVGE  476

Query  225  SNCCCVLHK  199
            ++C C LHK
Sbjct  477  NHCLCALHK  485



>emb|CDY30753.1| BnaC05g51500D [Brassica napus]
Length=472

 Score =   325 bits (833),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 172/189 (91%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  LSSNVEYLASRDATIMGSRN
Sbjct  285  RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSSNVEYLASRDATIMGSRN  344

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKD
Sbjct  345  GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKD  404

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLAC+ +++HVVVMPSVT++KLD FL +L++ RS+W + G S+ PCLA+DVG 
Sbjct  405  EEFVRRWQLACQGDIAHVVVMPSVTIKKLDHFLKDLVEHRSIWCKDG-SQTPCLAKDVGT  463

Query  225  SNCCCVLHK  199
            +NC C  HK
Sbjct  464  NNCVCPAHK  472



>ref|XP_008218831.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=457

 Score =   324 bits (831),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL HIN LSSNVEYLASRDATIMGSRN
Sbjct  269  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLKHINCLSSNVEYLASRDATIMGSRN  328

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY GFQKEVQKCL NAHYLKD+LR AGI AMLNELSSTVVFERP++
Sbjct  329  GHAPIFLWYTLNRKGYGGFQKEVQKCLENAHYLKDRLREAGIGAMLNELSSTVVFERPQE  388

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVR+WQLAC+ N++HV+VMP++T+EKLD FL EL+Q R+ W++ G  + PC+A DVG 
Sbjct  389  EEFVRKWQLACQGNIAHVIVMPNITIEKLDDFLSELLQHRAKWFQDGKLQAPCIASDVGT  448

Query  225  SNCCCVLHK  199
             NC C  HK
Sbjct  449  ENCLCASHK  457



>ref|XP_009420591.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=473

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  VQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSR  589
             +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL HINAL+SNVEYLASRDATIMGSR
Sbjct  283  TRAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLKHINALASNVEYLASRDATIMGSR  342

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
            NGHAP+FLWYTLNRKGY+GF+KEVQKCLRNAHYL+D+L  AG+ AMLN LSSTVVFERPK
Sbjct  343  NGHAPLFLWYTLNRKGYRGFRKEVQKCLRNAHYLRDRLMAAGVGAMLNPLSSTVVFERPK  402

Query  408  DEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVG  229
            DE FVRRWQLACE N++HVVVMPSVT+EKLD FLDEL+  RS WY   +   PC+A ++G
Sbjct  403  DEGFVRRWQLACEGNIAHVVVMPSVTIEKLDDFLDELVAGRSAWYRDRSRPSPCIAAEIG  462

Query  228  VSNCCCVLHK  199
              NC C +HK
Sbjct  463  QENCHCSMHK  472



>ref|XP_010241734.1| PREDICTED: serine decarboxylase 1-like [Nelumbo nucifera]
Length=486

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGS SVSGHKFVGCPMPCGV++TRL+HINALS NVEYLASRDATIMGSRN
Sbjct  297  RAPKVSFKKPIGSASVSGHKFVGCPMPCGVEITRLEHINALSRNVEYLASRDATIMGSRN  356

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GH PIFLWYTLN+KGYKGFQKEVQKCL NA YLKD+LR AG+ AMLNE SSTVVFERP+D
Sbjct  357  GHTPIFLWYTLNQKGYKGFQKEVQKCLSNAFYLKDRLRAAGVGAMLNEFSSTVVFERPQD  416

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNS-KPPCLAEDVG  229
            EEFVRRW LAC+ +++HVVVMP+VT+EKLD F+DEL+Q RS W+  G   +PPC+A DVG
Sbjct  417  EEFVRRWHLACQGDIAHVVVMPNVTIEKLDVFVDELMQKRSAWFRNGRILQPPCIAADVG  476

Query  228  VSNCCCVLHK  199
              NC C+LHK
Sbjct  477  NENCACILHK  486



>ref|XP_006584565.1| PREDICTED: uncharacterized protein LOC100792053 isoform X6 [Glycine 
max]
Length=458

 Score =   322 bits (826),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APK+SFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+H+NALS NVEYLASRDATIMGSRN
Sbjct  270  RAPKISFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRN  329

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWY+LN KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP D
Sbjct  330  GHAPIFLWYSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHD  389

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E FV +WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+VW+  GN +P C+A DVG 
Sbjct  390  EGFVHKWQLACQGNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQ  449

Query  225  SNCCCVLHK  199
             NC C LH+
Sbjct  450  ENCLCALHR  458



>ref|XP_006584563.1| PREDICTED: uncharacterized protein LOC100792053 isoform X4 [Glycine 
max]
 ref|XP_006584564.1| PREDICTED: uncharacterized protein LOC100792053 isoform X5 [Glycine 
max]
Length=468

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APK+SFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+H+NALS NVEYLASRDATIMGSRN
Sbjct  280  RAPKISFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRN  339

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWY+LN KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP D
Sbjct  340  GHAPIFLWYSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHD  399

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E FV +WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+VW+  GN +P C+A DVG 
Sbjct  400  EGFVHKWQLACQGNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQ  459

Query  225  SNCCCVLHK  199
             NC C LH+
Sbjct  460  ENCLCALHR  468



>gb|KHN39188.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   323 bits (827),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APK+SFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+H+NALS NVEYLASRDATIMGSRN
Sbjct  297  RAPKISFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRN  356

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWY+LN KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP D
Sbjct  357  GHAPIFLWYSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHD  416

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E FV +WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+VW+  GN +P C+A DVG 
Sbjct  417  EGFVHKWQLACQGNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQ  476

Query  225  SNCCCVLHK  199
             NC C LH+
Sbjct  477  ENCLCALHR  485



>ref|XP_006584560.1| PREDICTED: uncharacterized protein LOC100792053 isoform X1 [Glycine 
max]
 ref|XP_006584561.1| PREDICTED: uncharacterized protein LOC100792053 isoform X2 [Glycine 
max]
 ref|XP_006584562.1| PREDICTED: uncharacterized protein LOC100792053 isoform X3 [Glycine 
max]
Length=485

 Score =   323 bits (827),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APK+SFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+H+NALS NVEYLASRDATIMGSRN
Sbjct  297  RAPKISFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRN  356

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWY+LN KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP D
Sbjct  357  GHAPIFLWYSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHD  416

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E FV +WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+VW+  GN +P C+A DVG 
Sbjct  417  EGFVHKWQLACQGNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQ  476

Query  225  SNCCCVLHK  199
             NC C LH+
Sbjct  477  ENCLCALHR  485



>gb|ACJ85197.1| unknown [Medicago truncatula]
Length=486

 Score =   322 bits (826),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVE LASRDATIMGSRN
Sbjct  298  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVECLASRDATIMGSRN  357

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP D
Sbjct  358  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHD  417

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+R+WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG 
Sbjct  418  EEFIRKWQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGE  477

Query  225  SNCCCVLHK  199
            ++C C  HK
Sbjct  478  NSCLCAQHK  486



>ref|NP_001241244.1| uncharacterized protein LOC100795577 [Glycine max]
 gb|ACU18100.1| unknown [Glycine max]
Length=483

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKP+GSVSVSGHKFVGCPMPCGVQ+TRL+++NAL+ +VEYLASRDATIMGSRN
Sbjct  295  RAPKVTFKKPVGSVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRN  354

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY K +L  AGI AMLNELSSTVVFERP D
Sbjct  355  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHD  414

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+R+WQLAC+ N++HVVVMP++T+EKLD FL+EL++ R+ W++ G  +P C++ DVG 
Sbjct  415  EEFIRKWQLACKGNIAHVVVMPNITIEKLDDFLNELLEKRATWFQDGKDQPYCISSDVGE  474

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  475  KNCLCALHK  483



>gb|KHN26720.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   318 bits (814),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKP+GSVSVSGHKFVGCPMPCGVQ+TRL+++NAL+ +VEYLASRDATIMGSRN
Sbjct  297  RAPKVTFKKPVGSVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRN  356

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY K +L  AGI AMLNELSSTVVFERP D
Sbjct  357  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHD  416

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+R+WQLAC+ N++HVVVMP++T+EKLD FL+EL++ R+ W++ G  +P C++ DVG 
Sbjct  417  EEFIRKWQLACKGNIAHVVVMPNITIEKLDDFLNELLEKRATWFQDGKDQPYCISSDVGE  476

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  477  KNCLCALHK  485



>ref|XP_003547587.1| PREDICTED: histidine decarboxylase [Glycine max]
 gb|KHN33495.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   317 bits (813),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+++NAL+ +VEYLASRDATIMGSRNG
Sbjct  298  APKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRNG  357

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY K +L  AGI AMLNELSSTVVFERP DE
Sbjct  358  HAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHDE  417

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVS  223
            EF+R+WQLAC+ N++HVVVMP++T+EKLD FL+EL+  R+ W++ G  +P C++ DVG  
Sbjct  418  EFIRKWQLACKGNIAHVVVMPNITIEKLDDFLNELLDKRATWFQDGKDQPYCISSDVGEK  477

Query  222  NCCCVLHK  199
            NC C LHK
Sbjct  478  NCLCALHK  485



>gb|AFK28252.1| putative serine decarboxylase, partial [Helianthus agrestis]
Length=223

 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNG
Sbjct  54   APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNG  113

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DE
Sbjct  114  HAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDE  173

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
            EF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KP
Sbjct  174  EFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKHKP  223



>gb|AFA36595.1| putative serine decarboxylase, partial [Lolium perenne]
Length=245

 Score =   302 bits (773),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +A KV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL HINALSSNVEYLASRDATIMGSRN
Sbjct  83   KAAKVTFKKPIGSVSVSGHKFVGCPMPCGVQVTRLKHINALSSNVEYLASRDATIMGSRN  142

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLN+KGY+GFQKEVQKCLRNAHYLKD+L  AGI AMLNELSSTVVFERPKD
Sbjct  143  GHAPIFLWYTLNQKGYRGFQKEVQKCLRNAHYLKDRLNAAGIGAMLNELSSTVVFERPKD  202

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVW  277
            EEFVRRWQLACE N++HVVVMPSV ++KLD FL EL++ R+VW
Sbjct  203  EEFVRRWQLACEGNIAHVVVMPSVNIDKLDYFLRELVEKRAVW  245



>ref|XP_001761266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73988.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   308 bits (790),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 164/195 (84%), Gaps = 0/195 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKF+GCPMPCGVQ TR+ HIN+LS NVEYLASRDATIMGSRN
Sbjct  232  KAPKVTFKKPIGSVSVSGHKFIGCPMPCGVQFTRMKHINSLSRNVEYLASRDATIMGSRN  291

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQK+VQ+CLRNAHYLK++LR A I  MLNELSSTVVFERP D
Sbjct  292  GHAPIFLWYTLNRKGYRGFQKDVQRCLRNAHYLKERLREAKIGVMLNELSSTVVFERPLD  351

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E F+ +WQLAC+  ++H VVMPSVTVEKLD F++ELI+ R   +  GN K PC+ E+VGV
Sbjct  352  EAFILKWQLACQGKIAHAVVMPSVTVEKLDNFVEELIEVRKRSFPEGNVKIPCIVEEVGV  411

Query  225  SNCCCVLHK*CNNNP  181
             NC C LH+     P
Sbjct  412  QNCACSLHRGAGTIP  426



>ref|XP_001754291.1| predicted protein [Physcomitrella patens]
 gb|EDQ80741.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TR+ HIN LS NVEYLASRDATIMGSRN
Sbjct  220  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMKHINVLSRNVEYLASRDATIMGSRN  279

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQ+CLRNA+YLK++LR A +  +LNELSSTVVFERP D
Sbjct  280  GHAPIFLWYTLNRKGYRGFQKEVQRCLRNAYYLKERLREANVGVLLNELSSTVVFERPLD  339

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E F+ +WQLAC+  ++H VVMPSVTVEKLD F++ELI+ R+  +  G+   PC+ E+VG 
Sbjct  340  EAFILKWQLACQGKIAHAVVMPSVTVEKLDDFVEELIEVRNRAFPDGDVVVPCIVEEVGP  399

Query  225  SNCCCVLHK  199
             NC C +H+
Sbjct  400  ENCACSVHR  408



>ref|XP_002976233.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
 gb|EFJ22493.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
Length=472

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCG+Q+TR++HIN LS NVEYLASRDATIMGSRN
Sbjct  281  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGIQITRIEHINTLSRNVEYLASRDATIMGSRN  340

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGY+GF+KEV+KCL NAHYL   LR +G  AMLNELSSTVVFERP+D
Sbjct  341  GHAPLFLWYTLNRKGYRGFKKEVEKCLANAHYLAGCLRESGFGAMLNELSSTVVFERPQD  400

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E FVR+WQLAC+  ++H VVMPSVTV+KL  FL ELI++RS  +  G    PC+AE++G 
Sbjct  401  EAFVRKWQLACQGKIAHAVVMPSVTVDKLKVFLKELIESRSRLFPDGKIVAPCVAEELGA  460

Query  225  SNCCCVLHK*CN  190
             NC CV H  C+
Sbjct  461  KNCACVKHSSCS  472



>ref|XP_002987141.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
 gb|EFJ11717.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
Length=472

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCG+Q+TR++HIN LS NVEYLASRDATIMGSRN
Sbjct  281  RAPKVSFKKPIGSVSVSGHKFVGCPMPCGIQITRIEHINTLSRNVEYLASRDATIMGSRN  340

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLNRKGY+GF+KEV+KCL NAHYL   LR +G  AMLNELSSTVVFERP+D
Sbjct  341  GHAPLFLWYTLNRKGYRGFKKEVEKCLANAHYLAGCLRESGFGAMLNELSSTVVFERPQD  400

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E FVR+WQLAC+  ++H VVMPSVTV+KL  FL ELI++RS  +  G    PC+A+++G 
Sbjct  401  EAFVRKWQLACQGKIAHAVVMPSVTVDKLKVFLKELIESRSRLFPDGKIVAPCVADELGA  460

Query  225  SNCCCVLHK*CN  190
             NC CV H  C+
Sbjct  461  KNCACVKHSSCS  472



>ref|XP_010676037.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   293 bits (751),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +A +V+FKKPIGSVSVSGHKF+GCPMPCGVQ+ R  HINALS N+EY+AS+DATI GSRN
Sbjct  260  KATQVTFKKPIGSVSVSGHKFLGCPMPCGVQIVRKKHINALSRNIEYIASKDATITGSRN  319

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GH PIFLWY LNRKGY G QK+VQ C+RNA YLK +L+  G+S MLN+LS+TVVFERP+D
Sbjct  320  GHTPIFLWYALNRKGYHGLQKDVQMCMRNADYLKGRLKEFGVSVMLNKLSNTVVFERPQD  379

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+RRWQLACE N++HV+VMP VT+EKLD FL+EL++ R  W++ G ++PPC+A ++G 
Sbjct  380  EEFIRRWQLACEGNIAHVIVMPHVTIEKLDTFLNELVEKRLTWFKDGGNQPPCVASELGK  439

Query  225  SNCCCVLH  202
             NC C LH
Sbjct  440  ENCACPLH  447



>ref|XP_010675834.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   293 bits (751),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +A +V+FKKPIGSVSVSGHKF+GCPMPCGVQ+ R  HINALS N+EY+AS+DATI GSRN
Sbjct  260  KATQVTFKKPIGSVSVSGHKFLGCPMPCGVQIVRKKHINALSRNIEYIASKDATITGSRN  319

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GH PIFLWY LNRKGY G QK+VQ C+RNA YLK +L+  G+S MLN+LS+TVVFERP+D
Sbjct  320  GHTPIFLWYALNRKGYHGLQKDVQMCMRNADYLKGRLKEFGVSVMLNKLSNTVVFERPQD  379

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+RRWQLACE N++HV+VMP VT+EKLD FL+EL++ R  W++ G ++PPC+A ++G 
Sbjct  380  EEFIRRWQLACEGNIAHVIVMPHVTIEKLDTFLNELVEKRLTWFKDGGNQPPCVASELGK  439

Query  225  SNCCCVLH  202
             NC C LH
Sbjct  440  ENCACPLH  447



>gb|EMT14427.1| Histidine decarboxylase [Aegilops tauschii]
Length=488

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QAPKV+FKKPIGSVSVSGHKF+GCP+PCGV +TRL+H+  LS+++EYL+SRDATIMGSRN
Sbjct  294  QAPKVTFKKPIGSVSVSGHKFMGCPVPCGVVITRLEHVKVLSTDIEYLSSRDATIMGSRN  353

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWYTLN+KGY+G +KEVQKCLRNAH+L ++LR AG+SA LNELSSTVVFERP D
Sbjct  354  GHAPMFLWYTLNKKGYRGIRKEVQKCLRNAHHLANRLREAGVSAYLNELSSTVVFERPHD  413

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E FV +WQLACE +++HVVVMP+V+VEKL+ F++ELI  R  W+EGG  + PC+A+D+G 
Sbjct  414  EAFVHKWQLACEGSIAHVVVMPNVSVEKLNNFVEELIGERPRWHEGGGFRVPCVAKDIGQ  473

Query  225  SNCCCVLH  202
             NC C +H
Sbjct  474  ENCLCGVH  481



>ref|XP_003566804.1| PREDICTED: serine decarboxylase 1-like [Brachypodium distachyon]
Length=484

 Score =   289 bits (740),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QAPKV+F+KPIGSVS+SGHKF+GCP+PCGV +TRL H+  LS+++EYL+SRD TIMGSRN
Sbjct  287  QAPKVTFEKPIGSVSISGHKFMGCPVPCGVVITRLAHVKVLSTDIEYLSSRDTTIMGSRN  346

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLN+KGY+GF+KEV+KCLRNAHYL ++LR  G+SA LN LSSTVVFERP+D
Sbjct  347  GHAPIFLWYTLNKKGYRGFRKEVRKCLRNAHYLANRLREEGVSASLNMLSSTVVFERPRD  406

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
              FV +WQLACE +++HVVVMP+V+VEKLD F++EL+  RS WY+G     PC+A+D+G 
Sbjct  407  VAFVHKWQLACEGSIAHVVVMPNVSVEKLDGFVEELVANRSCWYDGKGHDIPCVAKDIGQ  466

Query  225  SNCCCVLHK*CNNNPE  178
             NC C LH   + N E
Sbjct  467  DNCLCSLHNTKHKNVE  482



>gb|KEH26769.1| serine decarboxylase [Medicago truncatula]
Length=192

 Score =   270 bits (689),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 154/198 (78%), Gaps = 13/198 (7%)
 Frame = -2

Query  792  LFISFHCHVQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASR  613
            L + +     APKV+FKKPIGSVSVSGHKFVGCPMPCG+  T L            L  R
Sbjct  8    LLMEWKEDEMAPKVTFKKPIGSVSVSGHKFVGCPMPCGMWNTLL------------LGMR  55

Query  612  DATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSS  433
              +IMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNA+Y KD+L  AGI AMLNELSS
Sbjct  56   -LSIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAYYFKDRLIEAGIGAMLNELSS  114

Query  432  TVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
            TVVFERP DEEF+R+WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P
Sbjct  115  TVVFERPHDEEFIRKWQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQP  174

Query  252  PCLAEDVGVSNCCCVLHK  199
             C+A DVG ++C C  HK
Sbjct  175  YCIASDVGENSCLCAQHK  192



>gb|AES76141.2| serine decarboxylase [Medicago truncatula]
Length=261

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 152/189 (80%), Gaps = 13/189 (7%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCG+  T L            L  R  +IMGSRN
Sbjct  86   RAPKVTFKKPIGSVSVSGHKFVGCPMPCGMWNTLL------------LGMR-LSIMGSRN  132

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNA+Y KD+L  AGI AMLNELSSTVVFERP D
Sbjct  133  GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAYYFKDRLIEAGIGAMLNELSSTVVFERPHD  192

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+R+WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG 
Sbjct  193  EEFIRKWQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGE  252

Query  225  SNCCCVLHK  199
            ++C C  HK
Sbjct  253  NSCLCAQHK  261



>ref|NP_001233845.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
 gb|ABE77149.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
Length=471

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  P
Sbjct  281  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTP  340

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  341  IFLWYSLSAKGQVGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  400

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC 
Sbjct  401  RRWQLSCVKDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTDPPCVGEDIGAQNCA  460

Query  213  CVLHK  199
            C  HK
Sbjct  461  CSYHK  465



>ref|XP_006365167.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score =   274 bits (700),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  P
Sbjct  280  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTP  339

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  340  IFLWYSLSAKGQIGLQKDVERCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  399

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC 
Sbjct  400  RRWQLSCVKDMAHVIVMPGITREMLDNFISELMQQRKVWYQNGKTNPPCVGEDIGAQNCA  459

Query  213  CVLHK  199
            C  HK
Sbjct  460  CSYHK  464



>ref|XP_010325179.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum lycopersicum]
Length=469

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  P
Sbjct  274  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTP  333

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLKD+L+  GIS MLNELS  VV ERP+D EFV
Sbjct  334  IFLWYSLSAKGQLGLQKDVKRCLDNAKYLKDRLQKEGISVMLNELSIIVVLERPRDHEFV  393

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC 
Sbjct  394  RRWQLSCVKDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTYPPCVGEDIGAQNCA  453

Query  213  CVLHK  199
            C  HK
Sbjct  454  CSYHK  458



>ref|XP_004245280.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum lycopersicum]
Length=476

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  P
Sbjct  281  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTP  340

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLKD+L+  GIS MLNELS  VV ERP+D EFV
Sbjct  341  IFLWYSLSAKGQLGLQKDVKRCLDNAKYLKDRLQKEGISVMLNELSIIVVLERPRDHEFV  400

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC 
Sbjct  401  RRWQLSCVKDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTYPPCVGEDIGAQNCA  460

Query  213  CVLHK  199
            C  HK
Sbjct  461  CSYHK  465



>ref|XP_009789723.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=465

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCG+Q+TR  +IN LS  VEY+AS DATI GSRNG AP
Sbjct  275  ISFKKPIGSVTISGHKFLGCPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAP  334

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  335  IFLWYSLSAKGQVGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  394

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C R+M+HV+VMP +T E LD F+++L+Q R  WY+ GN  PPC+AED+G  NC 
Sbjct  395  RRWQLSCVRDMAHVIVMPGITREILDSFINDLLQQRKKWYKDGNVTPPCVAEDIGAQNCA  454

Query  213  CVLHK  199
            C  HK
Sbjct  455  CSYHK  459



>ref|XP_009769413.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769414.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
sylvestris]
Length=465

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCG+Q+TR  +IN LS  VEY+AS DATI GSRNG AP
Sbjct  275  ISFKKPIGSVTISGHKFLGCPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAP  334

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AG+S MLNELS  VV ERP+D EFV
Sbjct  335  IFLWYSLSSKGQIGLQKDVKRCLDNAKYLKDRLQQAGVSVMLNELSIIVVLERPRDHEFV  394

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C R+M+HV+VMP +T E LD F+++L+Q R  WY+ GN  PPC+AED+G  NC 
Sbjct  395  RRWQLSCVRDMAHVIVMPGITREILDSFINDLLQQRKKWYKDGNVTPPCVAEDIGAQNCA  454

Query  213  CVLHK  199
            C  HK
Sbjct  455  CSYHK  459



>ref|XP_004245427.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score =   271 bits (692),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG   
Sbjct  281  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTL  340

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  341  IFLWYSLSAKGQVGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  400

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC 
Sbjct  401  RRWQLSCVKDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTNPPCVGEDIGAQNCA  460

Query  213  CVLHK  199
            C  HK
Sbjct  461  CSYHK  465



>ref|XP_009599698.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCG+Q+TR  +IN LS  VEY+AS DATI GSRNG AP
Sbjct  270  ISFKKPIGSVTISGHKFLGCPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAP  329

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  330  IFLWYSLSAKGQIGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  389

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C R+M+HV+VMP +T + LD F+++L+Q R  WY+ GN  PPC+A+D+G  NC 
Sbjct  390  RRWQLSCVRDMAHVIVMPGITRDILDSFINDLLQQRKKWYKDGNVTPPCVAQDIGAQNCA  449

Query  213  CVLHK  199
            C  HK
Sbjct  450  CSYHK  454



>gb|KHN16991.1| Histidine decarboxylase [Glycine soja]
Length=413

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 152/191 (80%), Gaps = 1/191 (1%)
 Frame = -2

Query  768  VQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSR  589
            +QAPKV+FKKPIGS+++SGHKF+GCP PCGV +TRL++IN L+ NVEY+ASRD TI GSR
Sbjct  223  IQAPKVTFKKPIGSITISGHKFLGCPFPCGVLITRLEYINTLAKNVEYIASRDVTITGSR  282

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
            +GHAPIFLWY L  +G  G Q EVQKC+ +A YL+ +LR A I AMLNE S+TVVFERP+
Sbjct  283  SGHAPIFLWYALKERGSVGLQNEVQKCIISARYLQHRLREAKIGAMLNEFSNTVVFERPQ  342

Query  408  DEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWY-EGGNSKPPCLAEDV  232
            D++F R+W LAC++N++H VVM  VTVE LD F++E IQ R +W+ + G   P CLA D+
Sbjct  343  DDDFARKWSLACKKNIAHGVVMQHVTVEMLDSFVNEFIQERQIWFQDDGKRNPLCLANDI  402

Query  231  GVSNCCCVLHK  199
            GV NC C+LH+
Sbjct  403  GVGNCACILHE  413



>ref|XP_009620691.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCG+Q+TR  +IN LS  VEY+AS DATI GSRNG AP
Sbjct  270  ISFKKPIGSVTISGHKFLGCPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAP  329

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  330  IFLWYSLSAKGQIGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  389

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C R+M+HV+VMP +T + LD F+++L+Q R  WY+ GN  PPC+A+D+G  NC 
Sbjct  390  RRWQLSCVRDMAHVIVMPGITRDILDSFINDLLQQRKKWYKDGNVTPPCVAQDIGAQNCA  449

Query  213  CVLHK  199
            C  HK
Sbjct  450  CSYHK  454



>ref|XP_006365162.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
Length=470

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  P
Sbjct  280  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTP  339

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V+KCL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  340  IFLWYSLSAKGQIGLQKDVKKCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  399

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC 
Sbjct  400  RRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCA  459

Query  213  CVLHK  199
            C  HK
Sbjct  460  CSYHK  464



>ref|XP_006365164.1| PREDICTED: histidine decarboxylase-like isoform X3 [Solanum tuberosum]
Length=470

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  P
Sbjct  280  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTP  339

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V+KCL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  340  IFLWYSLSAKGQIGLQKDVKKCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  399

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC 
Sbjct  400  RRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCA  459

Query  213  CVLHK  199
            C  HK
Sbjct  460  CSYHK  464



>ref|XP_006365163.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=470

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  P
Sbjct  280  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTP  339

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V+KCL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  340  IFLWYSLSAKGQIGLQKDVKKCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  399

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC 
Sbjct  400  RRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCA  459

Query  213  CVLHK  199
            C  HK
Sbjct  460  CSYHK  464



>ref|XP_003535578.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=423

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 151/191 (79%), Gaps = 1/191 (1%)
 Frame = -2

Query  768  VQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSR  589
            +QAPKV+FKKPIGS+++SGHKF+GCP PCGV +TRL++IN L+ NVEY+ASRD TI GSR
Sbjct  233  IQAPKVTFKKPIGSITISGHKFLGCPFPCGVLITRLEYINTLAKNVEYIASRDVTITGSR  292

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
             GHAPIFLWY L  +G  G Q EVQKC+ +A YL+ +LR A I AMLNE S+TVVFERP+
Sbjct  293  RGHAPIFLWYALKERGSVGLQNEVQKCIISARYLQHRLREAKIGAMLNEFSNTVVFERPQ  352

Query  408  DEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWY-EGGNSKPPCLAEDV  232
            D++F R+W LAC++N++H VVM  VTVE LD F++E IQ R +W+ + G   P CLA D+
Sbjct  353  DDDFARKWSLACKKNIAHGVVMQHVTVEMLDSFVNEFIQERQIWFQDDGKRNPLCLANDI  412

Query  231  GVSNCCCVLHK  199
            GV NC C+LH+
Sbjct  413  GVGNCACILHE  423



>ref|XP_006365166.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=469

 Score =   268 bits (685),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  P
Sbjct  280  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTP  339

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V+KCL NA YLKD+L  AGIS MLNELS  VV ERP+D EFV
Sbjct  340  IFLWYSLSAKGQIGLQKDVKKCLDNAKYLKDRLLQAGISVMLNELSIIVVLERPRDHEFV  399

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+A+D+G  NC 
Sbjct  400  RRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVADDIGAQNCA  459

Query  213  CVLHK  199
            C  HK
Sbjct  460  CSYHK  464



>ref|XP_004245281.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=455

 Score =   268 bits (684),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  P
Sbjct  270  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTP  329

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLKD L+ AGIS MLNE+S  VV ERP D EFV
Sbjct  330  IFLWYSLSTKGQIGLQKDVKRCLDNAKYLKDGLQQAGISVMLNEISIIVVLERPHDHEFV  389

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HVVVMP +T E LD F+ EL+Q R  WY+GG ++ PC+A+D+G  NC 
Sbjct  390  RRWQLSCVKDMAHVVVMPGITREMLDNFISELVQQRKHWYQGGKAEAPCVADDIGTQNCA  449

Query  213  CVLHK  199
            C  HK
Sbjct  450  CSYHK  454



>ref|XP_006365165.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=482

 Score =   268 bits (686),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  P
Sbjct  293  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTP  352

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V+KCL NA YLKD+L+  GIS MLNELS  VV ERP+D EFV
Sbjct  353  IFLWYSLSAKGQIGLQKDVKKCLDNAKYLKDRLQQEGISVMLNELSIIVVLERPRDHEFV  412

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+A+D+G  NC 
Sbjct  413  RRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVADDIGAQNCA  472

Query  213  CVLHK  199
            C  HK
Sbjct  473  CSYHK  477



>ref|XP_006365087.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=467

 Score =   268 bits (684),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  P
Sbjct  277  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTP  336

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  337  IFLWYSLSAKGQIGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  396

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC 
Sbjct  397  RRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCA  456

Query  213  CVLHK  199
            C  HK
Sbjct  457  CSYHK  461



>ref|XP_009600675.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=456

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS NVEY+AS DATI GSRNG  P
Sbjct  266  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSRNVEYIASVDATISGSRNGLTP  325

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  326  IFLWYSLSAKGQIGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  385

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+++L+Q R +WY+ G    PC+A+D+G  NC 
Sbjct  386  RRWQLSCMKDMAHVIVMPGITRETLDNFVNDLVQQRKLWYQHGRVTTPCIADDIGAQNCS  445

Query  213  CVLHK  199
            C  HK
Sbjct  446  CSYHK  450



>gb|EMS49846.1| Histidine decarboxylase [Triticum urartu]
Length=341

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 153/177 (86%), Gaps = 1/177 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QAPKV+F KPIGSVSVSGHKF+GCP+PCGV +TRL+H+  LS+++EYL+SRDATIMGSRN
Sbjct  166  QAPKVTFTKPIGSVSVSGHKFMGCPVPCGVVITRLEHVKVLSTDIEYLSSRDATIMGSRN  225

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP++LWYTLN+KGYKG +KEVQKCLRNAH+L ++L+  G+SA LNELSSTVVFERP+D
Sbjct  226  GHAPMYLWYTLNKKGYKGIRKEVQKCLRNAHHLANRLKEMGVSASLNELSSTVVFERPQD  285

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAED  235
            E FV +WQLACE +++HVVVMP++ VEKLD F++EL+ AR  W+E       C+A++
Sbjct  286  ETFVHKWQLACESSIAHVVVMPNIDVEKLDDFVEELV-ARRAWHERKVFDILCVAKE  341



>ref|XP_003619923.1| L-tyrosine decarboxylase [Medicago truncatula]
Length=384

 Score =   264 bits (674),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 148/189 (78%), Gaps = 19/189 (10%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HIN LS NVEYLASRDATI     
Sbjct  215  RAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINGLSRNVEYLASRDATI-----  269

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
                           + GFQKEVQKCLRNA+Y KD+L  AGI AMLNELSSTVVFERP D
Sbjct  270  --------------DHGGFQKEVQKCLRNAYYFKDRLIEAGIGAMLNELSSTVVFERPHD  315

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF+R+WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG 
Sbjct  316  EEFIRKWQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGE  375

Query  225  SNCCCVLHK  199
            ++C C  HK
Sbjct  376  NSCLCAQHK  384



>ref|XP_011081981.1| PREDICTED: histidine decarboxylase-like isoform X1 [Sesamum indicum]
Length=465

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            Q  K +FKKPIGSVS+SGHKF+GCPMPCGV +TR  +I+ +S N+EY+AS D TI GSRN
Sbjct  274  QVQKFTFKKPIGSVSISGHKFLGCPMPCGVLITRRRYIDLISRNIEYIASFDTTIAGSRN  333

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GH+P+F+WY LN KG++G +++VQKCLRNA YL+ +L+ AGIS+MLNE+S TVVFERP D
Sbjct  334  GHSPVFMWYVLNLKGWRGLEQDVQKCLRNARYLRHRLKKAGISSMLNEMSITVVFERPPD  393

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
             EFVR WQL C  NM+HVVVMP VTVE L+ FL +LI+ R+ WY  G  +PPCLAED+G+
Sbjct  394  NEFVRHWQLQCLENMAHVVVMPHVTVEMLERFLSDLIRKRNTWY--GKVQPPCLAEDIGI  451

Query  225  SNCCCVLH  202
             NC C +H
Sbjct  452  CNCACPVH  459



>ref|XP_004244519.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=465

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            ++FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS  VEY+AS DATI GSRNG  P
Sbjct  275  ITFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTP  334

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  GFQK+V++C  NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  335  IFLWYSLSAKGQIGFQKDVKRCFDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  394

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C R+M+HV+VMP +T E LD F+++L+Q R  WY+ G   PPC+A D+G  NC 
Sbjct  395  RRWQLSCVRDMAHVIVMPGITRETLDGFINDLLQQRKKWYQDGRISPPCVASDIGAQNCT  454

Query  213  CVLHK  199
            C  HK
Sbjct  455  CSYHK  459



>ref|XP_006365168.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  P
Sbjct  280  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTP  339

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLKD+L+  GIS MLNELS  VV ERP+D EFV
Sbjct  340  IFLWYSLSAKGQIGLQKDVKRCLDNAKYLKDRLQKEGISVMLNELSIIVVLERPRDHEFV  399

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC 
Sbjct  400  RRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCA  459

Query  213  CVLHK  199
            C  HK
Sbjct  460  CSYHK  464



>ref|NP_001233852.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
 gb|ABE77150.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
Length=471

 Score =   266 bits (679),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  P
Sbjct  281  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTP  340

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLK++L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  341  IFLWYSLSAKGQVGLQKDVKRCLDNAKYLKNRLQQAGISVMLNELSIIVVLERPRDHEFV  400

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R  WY  G ++ PC+ ED+G  NC 
Sbjct  401  RRWQLSCVKDMAHVIVMPGITREMLDNFVSELVQQRKQWYRDGKAEAPCVGEDIGAQNCA  460

Query  213  CVLHK  199
            C  HK
Sbjct  461  CSYHK  465



>ref|XP_006357084.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score =   265 bits (678),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            ++FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS  VEY+AS DATI GSRNG  P
Sbjct  275  ITFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTP  334

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  GFQK+V++C  NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  335  IFLWYSLSAKGQIGFQKDVKRCFDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  394

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C R+M+HV+VMP +T E LD F+ +L+Q R  WY+ G   PPC+A D+G  NC 
Sbjct  395  RRWQLSCVRDMAHVIVMPGITRETLDGFITDLLQQRKKWYQDGRISPPCVASDIGAQNCT  454

Query  213  CVLHK  199
            C  HK
Sbjct  455  CSYHK  459



>ref|XP_006366216.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=418

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
             APK++FKKPIGSVSVSGHKF+GCPMPCG+Q+ R  H++ LS N+EY+AS DATI GSR 
Sbjct  228  NAPKITFKKPIGSVSVSGHKFLGCPMPCGIQIARKKHVDILSRNIEYIASIDATISGSRG  287

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWY+L++K +   Q + ++C++NA YLKD LR +GISAMLNE S TVVFERP +
Sbjct  288  GHAPIFLWYSLSKKCHTTLQDDAKRCIQNARYLKDSLRNSGISAMLNEHSITVVFERPLE  347

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNS-KPPCLAEDVG  229
            +EF+ +WQL+CER+M+HVVVMP VT + LD F+ E  + R +WY+ GN  +PPCLA D+G
Sbjct  348  QEFIHKWQLSCERDMTHVVVMPGVTTQMLDNFVSEFAKKRLIWYQDGNKVQPPCLANDIG  407

Query  228  VSNCCCVLHK  199
            + NC C  HK
Sbjct  408  MHNCVCPHHK  417



>ref|NP_001233859.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
 gb|ABE77151.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
Length=465

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            ++FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS  VEY+AS DATI GSRNG  P
Sbjct  275  ITFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTP  334

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+++ KG  GFQK+V++C  NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  335  IFLWYSISAKGQIGFQKDVKRCFDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  394

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C R+M+HV+VMP +T E LD F+++L+Q R  WY+ G   PPC+A D+G  NC 
Sbjct  395  RRWQLSCVRDMAHVIVMPGITRETLDGFINDLLQQRKKWYQDGRISPPCVANDIGAQNCA  454

Query  213  CVLHK  199
            C  HK
Sbjct  455  CSYHK  459



>ref|XP_004245279.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score =   265 bits (678),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  P
Sbjct  281  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTP  340

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLK++L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  341  IFLWYSLSAKGQVGLQKDVKRCLDNAKYLKNRLQQAGISVMLNELSIIVVLERPRDHEFV  400

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R  WY  G ++ PC+ ED+G  NC 
Sbjct  401  RRWQLSCVKDMAHVIVMPGITREMLDNFVSELVQQRKQWYRDGKAEAPCVGEDIGAQNCA  460

Query  213  CVLHK  199
            C  HK
Sbjct  461  CSYHK  465



>gb|EAY77466.1| hypothetical protein OsI_32510 [Oryza sativa Indica Group]
Length=467

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QAPKVSFKKPIGS+SVSGHKF+GCPMPCGV +TRL+H   LS+++EY+ASRD+TI GSRN
Sbjct  271  QAPKVSFKKPIGSISVSGHKFLGCPMPCGVVITRLEHAEVLSTDIEYIASRDSTITGSRN  330

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTL++KGYKG  KEV  C+ NA YL+  L+  GISA  N LS+ VVFERPKD
Sbjct  331  GHAPIFLWYTLSKKGYKGLLKEVHICMGNARYLEVLLKQVGISASCNTLSNIVVFERPKD  390

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E  V RWQLACE N++H+VVMP+VT EKL  F++EL + R+ WY+      PCLA D+G 
Sbjct  391  ERIVCRWQLACEGNLAHIVVMPNVTFEKLTVFVEELAEKRNDWYQDKGFDIPCLAVDIGK  450

Query  225  SNCCCVLH  202
             NC C LH
Sbjct  451  ENCYCNLH  458



>ref|XP_011081982.1| PREDICTED: histidine decarboxylase-like isoform X2 [Sesamum indicum]
Length=463

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 150/185 (81%), Gaps = 2/185 (1%)
 Frame = -2

Query  756  KVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHA  577
            K +FKKPIGSVS+SGHKF+GCPMPCGV +TR  +I+ +S N+EY+AS D TI GSRNGH+
Sbjct  275  KFTFKKPIGSVSISGHKFLGCPMPCGVLITRRRYIDLISRNIEYIASFDTTIAGSRNGHS  334

Query  576  PIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEF  397
            P+F+WY LN KG++G +++VQKCLRNA YL+ +L+ AGIS+MLNE+S TVVFERP D EF
Sbjct  335  PVFMWYVLNLKGWRGLEQDVQKCLRNARYLRHRLKKAGISSMLNEMSITVVFERPPDNEF  394

Query  396  VRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNC  217
            VR WQL C  NM+HVVVMP VTVE L+ FL +LI+ R+ WY  G  +PPCLAED+G+ NC
Sbjct  395  VRHWQLQCLENMAHVVVMPHVTVEMLERFLSDLIRKRNTWY--GKVQPPCLAEDIGICNC  452

Query  216  CCVLH  202
             C +H
Sbjct  453  ACPVH  457



>sp|Q8RV06.1|SDC2_ORYSJ RecName: Full=Serine decarboxylase 2 [Oryza sativa Japonica Group]
 gb|AAG12476.2|AC037197_1 Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAL75763.1| Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAP51789.1| Histidine decarboxylase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ15061.1| hypothetical protein OsJ_30471 [Oryza sativa Japonica Group]
Length=467

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 147/188 (78%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QAPKVSFKKPIGS+SVSGHKF+GCPMPCGV +TRL+H   LS+++EY+ASRD+TI GSRN
Sbjct  271  QAPKVSFKKPIGSISVSGHKFLGCPMPCGVVITRLEHAEVLSTDIEYIASRDSTITGSRN  330

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTL++KGYKG  KEV  C+ NA YL+  L+  GISA  N LS+ VVFERPKD
Sbjct  331  GHAPIFLWYTLSKKGYKGLLKEVHICMGNARYLEVLLKQVGISASCNTLSNIVVFERPKD  390

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E  V RWQLACE N++H+VVMP+VT EKL  F++EL + R  WY+      PCLA D+G 
Sbjct  391  ERIVCRWQLACEGNLAHIVVMPNVTFEKLTVFVEELAEKRKDWYQDKGFDIPCLAVDIGK  450

Query  225  SNCCCVLH  202
             NC C LH
Sbjct  451  ENCYCNLH  458



>ref|XP_003535572.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=462

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QAP+++F+KPIGSV++SGHKF+GCP+PCG+ +TRL +INALS +VEY+ SRD TI GSR 
Sbjct  269  QAPRITFEKPIGSVAISGHKFLGCPIPCGIVITRLRYINALSRDVEYIGSRDVTITGSRC  328

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWY + RKG  G Q EV+KC+ NAHYL+ +LR AGI AMLN  SSTVVF+RP D
Sbjct  329  GHAPIFLWYAIKRKGLIGLQNEVRKCIMNAHYLQSRLRNAGIGAMLNRFSSTVVFKRPLD  388

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEF RRW LAC+ N++HVVVM  VT+E LD F+ E +Q RS+W+E    +  C+A+D+G 
Sbjct  389  EEFTRRWNLACKGNIAHVVVMQHVTIEMLDSFVAEFLQKRSIWFEDEQFQHVCIAKDIGS  448

Query  225  SNCCCVLH  202
             NC C +H
Sbjct  449  GNCGCSMH  456



>ref|XP_006357083.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score =   263 bits (672),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            ++FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS  VEY+AS DATI GSRNG  P
Sbjct  275  ITFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTP  334

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  GFQK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  335  IFLWYSLSAKGQIGFQKDVKRCLDNAIYLKDRLQKAGISVMLNELSIIVVLERPRDHEFV  394

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            RRWQL+C R+M+HV+VMP +T E LD F+ +L+Q R  WY+ G    PC+A D+G  NC 
Sbjct  395  RRWQLSCVRDMAHVIVMPGITRETLDGFITDLLQQRKKWYQDGRISAPCVASDIGAQNCA  454

Query  213  CVLHK  199
            C  HK
Sbjct  455  CSYHK  459



>gb|ACU18860.1| unknown [Glycine max]
Length=152

 Score =   252 bits (644),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+++NAL+ +VEYLASRDATIMGSRNG
Sbjct  8    APKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRNG  67

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            HAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY K +L  AGI AMLNELSSTVVFERP DE
Sbjct  68   HAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHDE  127

Query  402  EFVRRWQLACERNMSHV  352
            EF+R+WQLAC+ N++HV
Sbjct  128  EFIRKWQLACKGNIAHV  144



>gb|AES89541.2| serine decarboxylase [Medicago truncatula]
Length=228

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 145/193 (75%), Gaps = 0/193 (0%)
 Frame = -2

Query  780  FHCHVQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATI  601
            F   VQA ++SFKKPI SV++SGHKF+GCP PCGV +TRL +INALS +VEY+ASRDATI
Sbjct  30   FRISVQALRISFKKPIDSVTISGHKFLGCPFPCGVLITRLKYINALSRDVEYIASRDATI  89

Query  600  MGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVF  421
             GSR+GHAPIFLWY L ++G  G + EV +C+ NA YL ++LR AGI AMLNE S+ VVF
Sbjct  90   TGSRSGHAPIFLWYALKKRGLIGLENEVHECITNARYLLNQLRDAGIGAMLNEFSNIVVF  149

Query  420  ERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLA  241
            ERP D+ F RRW LA   N++HVVV+  +T+E LD F+ E IQ RS+W + G  + PC+A
Sbjct  150  ERPFDDHFTRRWNLASNGNIAHVVVLKHITIEMLDTFVCEFIQKRSIWSKDGQFQLPCIA  209

Query  240  EDVGVSNCCCVLH  202
             DVG  NC C +H
Sbjct  210  SDVGSRNCACSIH  222



>ref|XP_006661594.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=461

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 146/188 (78%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QAPKVSFKK IGS+SVSGHKF+GCPMPCGV +TRL+H   LS++VEY+ASRD+TI GSRN
Sbjct  265  QAPKVSFKKTIGSISVSGHKFMGCPMPCGVVITRLEHAKVLSTDVEYIASRDSTITGSRN  324

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWYTLN+KGYKG  KEVQ CL NA YL+  L+  GISA     S+ VVFERPKD
Sbjct  325  GHAPIFLWYTLNKKGYKGILKEVQMCLGNARYLEVLLKQVGISASCATTSNIVVFERPKD  384

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            E+FV RWQLACE N++H+VVMP+VT EK+  F++E  + R  WY+      PCLA D+G 
Sbjct  385  EKFVCRWQLACEGNLAHIVVMPNVTFEKIIVFVEEFAKKRRDWYQDKGFNIPCLAVDIGK  444

Query  225  SNCCCVLH  202
             NC C LH
Sbjct  445  ENCYCNLH  452



>ref|XP_004244809.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=457

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCP+PCGVQ+TR  HI  LS NVEY+AS DATI GSRNG  P
Sbjct  267  ISFKKPIGSVTISGHKFIGCPIPCGVQITRKSHIGYLSRNVEYIASMDATISGSRNGLTP  326

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            I LWY+L+ KG  G Q++V++CL NA YL+D+L+ A IS MLNELS+ VV ERP D EF 
Sbjct  327  ILLWYSLSSKGQIGIQQDVKRCLNNARYLRDRLKQANISVMLNELSTIVVLERPHDHEFT  386

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            R WQL+C ++++HV+VMPS+T E LD F  +L+Q R +WY+ G+ KPPC+A+D+G  NC 
Sbjct  387  RHWQLSCVKDIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKPPCVADDIGAQNCA  446

Query  213  CVLH  202
            C LH
Sbjct  447  CALH  450



>ref|XP_006346847.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=498

 Score =   261 bits (667),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 151/204 (74%), Gaps = 0/204 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCP+PCGVQ+TR  HI  LS NVEY+AS DATI GSRNG  P
Sbjct  267  ISFKKPIGSVTISGHKFLGCPIPCGVQITRKSHIAYLSRNVEYIASMDATISGSRNGLTP  326

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            I LWY+L+ KG  G QK+V++CL NA YLKD+L+ A IS MLNELS+ VV ERP D EF 
Sbjct  327  ILLWYSLSSKGQIGIQKDVKRCLNNARYLKDRLQQANISVMLNELSTIVVLERPHDHEFT  386

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            R WQL+C R+++HV+VMPS+T E LD F  +L+Q R +WY+ G+ KPPC+A+D+G  NC 
Sbjct  387  RHWQLSCVRHIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKPPCVADDIGAQNCS  446

Query  213  CVLHK*CNNNPEGRSFILGLCLPV  142
            C  H   ++     + ++ +  P 
Sbjct  447  CAFHNDSDSEMANDNVMVDVAAPT  470



>ref|XP_003592126.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES62377.1| serine decarboxylase [Medicago truncatula]
Length=453

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 145/188 (77%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QAP ++FKKPIGS+++SGHKF+GCP+PCGV LTRL+HIN L  +VE + SRD TI GSR+
Sbjct  265  QAPSITFKKPIGSITISGHKFLGCPIPCGVLLTRLEHINTLCKDVEVIGSRDTTISGSRS  324

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWY L ++G  G Q EV KC+ NA YL+ KLR AGI  MLNE S+TVVFE+P D
Sbjct  325  GHAPIFLWYALQKRGIIGLQNEVHKCMMNARYLQRKLRDAGIGTMLNEFSNTVVFEKPLD  384

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
             EF+R+W LA + N++HVVVM  VT+E LD F+DE  + R++W++ G  KP CLA+++G 
Sbjct  385  IEFIRKWSLAYQGNIAHVVVMQHVTIEMLDSFVDEFTKKRAIWFQYGLRKPICLADEIGA  444

Query  225  SNCCCVLH  202
             NC C LH
Sbjct  445  ENCICSLH  452



>ref|XP_011082255.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=461

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 150/188 (80%), Gaps = 2/188 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            Q  K +FKKPIGSVS+SGHKF+GCPMPCGV LTR  +I  +S N+EY+A+ D+TI GSRN
Sbjct  270  QVTKFTFKKPIGSVSISGHKFLGCPMPCGVLLTRRKYIKLISRNIEYIATCDSTIAGSRN  329

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GH+PIF+WY LN KG+KG +++V+KCL+NA YL+  L+ AGIS+MLNE S TVVFERP+D
Sbjct  330  GHSPIFMWYVLNIKGWKGLKQDVEKCLKNARYLRHHLKKAGISSMLNETSVTVVFERPQD  389

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
             EF+R WQL C  +M+HVVVMP VT+E LD FL +LI+ R++W+  G   PPCLAED+G+
Sbjct  390  SEFIRHWQLQCLGSMAHVVVMPHVTIEMLDRFLYDLIRKRNIWH--GTLHPPCLAEDMGI  447

Query  225  SNCCCVLH  202
             NC C +H
Sbjct  448  CNCACPVH  455



>ref|XP_006367691.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=457

 Score =   258 bits (658),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCP+PCGVQ+TR  HI  LS NVEY+AS DATI GSRNG  P
Sbjct  267  ISFKKPIGSVTISGHKFLGCPIPCGVQITRKSHIAYLSRNVEYIASMDATISGSRNGLTP  326

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            I LWY+L+ K   G Q++V++CL NA YLKD+L+ A IS MLNELS+ VV ERP D EF 
Sbjct  327  ILLWYSLSSKNQIGIQQDVKRCLYNARYLKDRLQQANISVMLNELSTIVVLERPLDHEFT  386

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            R WQL+C R+++HV+VMPS+T E LD F  +L+Q R +WY+ G+ KPPC+A+D+G  NC 
Sbjct  387  RHWQLSCVRDIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKPPCVADDIGAQNCA  446

Query  213  CVLH  202
            C LH
Sbjct  447  CALH  450



>ref|XP_003607344.1| Serine decarboxylase [Medicago truncatula]
Length=207

 Score =   249 bits (635),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  768  VQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSR  589
            ++A ++SFKKPI SV++SGHKF+GCP PCGV +TRL +INALS +VEY+ASRDATI GSR
Sbjct  13   LRALRISFKKPIDSVTISGHKFLGCPFPCGVLITRLKYINALSRDVEYIASRDATITGSR  72

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
            +GHAPIFLWY L ++G  G + EV +C+ NA YL ++LR AGI AMLNE S+ VVFERP 
Sbjct  73   SGHAPIFLWYALKKRGLIGLENEVHECITNARYLLNQLRDAGIGAMLNEFSNIVVFERPF  132

Query  408  DEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVG  229
            D+ F RRW LA   N++HVVV+  +T+E LD F+ E IQ RS+W + G  + PC+A DVG
Sbjct  133  DDHFTRRWNLASNGNIAHVVVLKHITIEMLDTFVCEFIQKRSIWSKDGQFQLPCIASDVG  192

Query  228  VSNCCCVLH  202
              NC C +H
Sbjct  193  SRNCACSIH  201



>ref|XP_003607341.1| Embryo defective 1075-like protein [Medicago truncatula]
 gb|AES89538.1| serine decarboxylase [Medicago truncatula]
Length=452

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QA ++SFKKPI SV++SGHKF+GCP PCGV +TRL +INALS +VEY+ASRDATI GSR+
Sbjct  259  QALRISFKKPIDSVTISGHKFLGCPSPCGVLITRLKYINALSRDVEYIASRDATITGSRS  318

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPI LWY L ++G  G + EV +C+ NA YL ++LR AGI AMLNE S+ VVFERP D
Sbjct  319  GHAPILLWYALKKRGLIGLENEVHECITNARYLLNQLRDAGIGAMLNEFSNIVVFERPFD  378

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            + F RRW LA   N++HVVV+  +T+E LD F+ E IQ RS+W + G+ +PPC+A DVG 
Sbjct  379  DHFTRRWNLASNENIAHVVVLKHITIEMLDTFVHEFIQKRSIWSKDGHFQPPCIASDVGS  438

Query  225  SNCCCVLH  202
             NC C +H
Sbjct  439  KNCACSIH  446



>ref|NP_001242861.1| uncharacterized protein LOC100792053 [Glycine max]
 gb|ACU18387.1| unknown [Glycine max]
Length=438

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APK+SFKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+H+NALS NVEYLASRDATIMGSRN
Sbjct  297  RAPKISFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRN  356

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWY+LN KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP D
Sbjct  357  GHAPIFLWYSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHD  416

Query  405  EEFVRRWQLACERNMSHV  352
            E FV +WQLAC+ N++HV
Sbjct  417  EGFVHKWQLACQGNVAHV  434



>gb|AHG12639.1| histidine decarboxylase [Nicotiana tabacum]
Length=446

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 146/198 (74%), Gaps = 2/198 (1%)
 Frame = -2

Query  792  LFISFHCHVQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASR  613
            L I F  H  A  ++FKKPIGSVS+SGHKF+GCPMPCG+Q+TR  +I+ LS+ +EY+AS 
Sbjct  248  LIIPFIQH--AKTITFKKPIGSVSISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASV  305

Query  612  DATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSS  433
            DATI GSRNG APIFLWY+L  KG  G Q++ + C  NA YLK +L  AGISAMLNE S 
Sbjct  306  DATISGSRNGLAPIFLWYSLCMKGRAGLQQDAKICNENARYLKGRLHKAGISAMLNESSI  365

Query  432  TVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
             VVFERP D +F+R WQL+C R+M+HVVVMP +T E +D F ++L+Q R  WY+ G + P
Sbjct  366  IVVFERPNDPKFIRHWQLSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTTLP  425

Query  252  PCLAEDVGVSNCCCVLHK  199
            PCLA+D+G  NC C   K
Sbjct  426  PCLADDIGSQNCLCSYQK  443



>ref|XP_009779195.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 146/198 (74%), Gaps = 2/198 (1%)
 Frame = -2

Query  792  LFISFHCHVQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASR  613
            L I F  H  A  ++FKKPIGSVS+SGHKF+GCPMPCG+Q+TR  +I+ LS+ +EY+AS 
Sbjct  248  LIIPFIQH--AKTITFKKPIGSVSISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASV  305

Query  612  DATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSS  433
            DATI GSRNG APIFLWY+L  KG  G Q++ + C  NA YLK +L  AGISAMLNE S 
Sbjct  306  DATISGSRNGLAPIFLWYSLCMKGRAGLQQDAKICNENARYLKGRLHKAGISAMLNESSI  365

Query  432  TVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
             VVFERP D +F+R WQL+C R+M+HVVVMP +T E +D F ++L+Q R  WY+ G + P
Sbjct  366  IVVFERPNDPKFIRHWQLSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTTLP  425

Query  252  PCLAEDVGVSNCCCVLHK  199
            PCLA+D+G  NC C   K
Sbjct  426  PCLADDIGSQNCLCSYQK  443



>ref|XP_009774334.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score =   249 bits (637),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 146/198 (74%), Gaps = 2/198 (1%)
 Frame = -2

Query  792  LFISFHCHVQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASR  613
            L + F  HV+   ++FKKPIGSVS+SGHKF+GCPMPCG+Q+TR  +I+ LS+ +EY+AS 
Sbjct  248  LIVPFIQHVKT--ITFKKPIGSVSISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASV  305

Query  612  DATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSS  433
            DATI GSRNG APIFLWY+L  KG  G Q++ + C  NA YLK +L  AGISAMLNE S 
Sbjct  306  DATISGSRNGLAPIFLWYSLCMKGRAGLQQDAKMCNENARYLKGRLHKAGISAMLNESSI  365

Query  432  TVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
             VVFERP D +F+R WQL+C R+M+HVVVMP +T E +D F ++L+Q R  WY+ G   P
Sbjct  366  IVVFERPNDPKFIRHWQLSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTIVP  425

Query  252  PCLAEDVGVSNCCCVLHK  199
            PCLA+D+G  NC C   K
Sbjct  426  PCLADDIGSQNCLCSKQK  443



>ref|XP_009622262.1| PREDICTED: LOW QUALITY PROTEIN: histidine decarboxylase-like 
[Nicotiana tomentosiformis]
Length=444

 Score =   249 bits (636),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 146/198 (74%), Gaps = 2/198 (1%)
 Frame = -2

Query  792  LFISFHCHVQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASR  613
            L + F  HV+   ++FKKPIGSVS+SGHKF+GCPMPCG+Q+TR  +I +LS+ +EY+AS 
Sbjct  246  LIVPFIQHVKT--ITFKKPIGSVSISGHKFLGCPMPCGIQITRKGYITSLSTKIEYIASV  303

Query  612  DATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSS  433
            DATI GSRNG APIFLWY+L  KG  G Q++ + C  NA YLK +L  AGI+AMLNE S 
Sbjct  304  DATISGSRNGLAPIFLWYSLCMKGRAGLQQDAKMCNENARYLKGRLHKAGINAMLNECSI  363

Query  432  TVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
             VVFERP D +F+R WQL+C R+M+HVV+MP +T E +D F  +L+Q R  WY+ G + P
Sbjct  364  IVVFERPNDPKFIRHWQLSCTRDMAHVVIMPGITRETIDSFFKDLMQERXKWYQVGTTVP  423

Query  252  PCLAEDVGVSNCCCVLHK  199
            PCLA+D+G  NC C   K
Sbjct  424  PCLADDIGSQNCICSKQK  441



>ref|XP_002953989.1| serine decarboxylase [Volvox carteri f. nagariensis]
 gb|EFJ45018.1| serine decarboxylase [Volvox carteri f. nagariensis]
Length=473

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
             AP V+F+KPIGSVSVSGHKFVG P+PCGV +TR  H+ ALSS+VEYL SRDATIMGSRN
Sbjct  290  DAPMVTFRKPIGSVSVSGHKFVGAPVPCGVVITRFKHVMALSSDVEYLNSRDATIMGSRN  349

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPI+LWYTL RKGY+G +++V++C+RNAH LK  L  AGI  MLNELS+TVVFERPK+
Sbjct  350  GHAPIYLWYTLTRKGYEGMRRDVERCMRNAHVLKQMLESAGIRTMLNELSNTVVFERPKE  409

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  283
            E FVR+WQLACE +++HVVVMP++TVEKL+ F+ + +Q+R+
Sbjct  410  EAFVRKWQLACEGDIAHVVVMPNITVEKLEEFVADYVQSRA  450



>gb|AIE54278.1| aromatic amino acid decarboxylase 2 [Nicotiana tabacum]
Length=457

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCG+Q+TR  +I+ LS+ +EY+AS DATI GSRNG AP
Sbjct  270  ISFKKPIGSVTISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASVDATISGSRNGLAP  329

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L  KG  G Q++ + C  NA YLK +L  AGISAMLNE S  VVFERP D +F+
Sbjct  330  IFLWYSLCMKGRAGLQQDAKICNENARYLKGRLHKAGISAMLNESSIIVVFERPNDPKFI  389

Query  393  RRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCC  214
            R WQL+C R+M+HVVVMP +T E +D F ++L+Q R  WY+ G + PPCLA+D+G  NC 
Sbjct  390  RHWQLSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTTLPPCLADDIGSQNCL  449

Query  213  CVLHK  199
            C   K
Sbjct  450  CSYQK  454



>gb|EYU29207.1| hypothetical protein MIMGU_mgv1a026642mg, partial [Erythranthe 
guttata]
Length=377

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 139/188 (74%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
              P  SFKKPIGSVSVS HK +G  +PCGV ++R  H+   S+N+EY+A++D TI GSRN
Sbjct  188  NGPLFSFKKPIGSVSVSAHKLLGSSIPCGVFISRKMHMTDFSTNIEYIATQDTTISGSRN  247

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GH PIF+WY LN KG  GFQKEV+ CL NA YL+D L+ AGISAMLNE S  VVFERP D
Sbjct  248  GHTPIFIWYGLNMKGRIGFQKEVKSCLTNARYLRDGLKEAGISAMLNESSIVVVFERPLD  307

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
             EFV  WQL+   NM+HVV+MP VTV+ LD FL +L+Q R +WY  G  +P CLAE++GV
Sbjct  308  REFVDFWQLSFLDNMAHVVLMPHVTVKMLDDFLSDLVQKREIWYGSGEVRPVCLAEEIGV  367

Query  225  SNCCCVLH  202
            SNC C +H
Sbjct  368  SNCACSIH  375



>ref|XP_011401256.1| Histidine decarboxylase [Auxenochlorella protothecoides]
 gb|KFM28243.1| Histidine decarboxylase [Auxenochlorella protothecoides]
Length=479

 Score =   248 bits (633),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +AP V+FKKPIGSVSVSGHKFVG P+PCGV +TRL HI ALS++VEYL SRDATIMGSRN
Sbjct  297  RAPMVTFKKPIGSVSVSGHKFVGAPVPCGVVMTRLKHIQALSTDVEYLNSRDATIMGSRN  356

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPI++WYT  RKGY+G +K+V++CLRNAH L+  L  AG+   LNELSSTVVFERP D
Sbjct  357  GHAPIYMWYTFTRKGYEGLRKDVERCLRNAHLLRSMLERAGVVTSLNELSSTVVFERPAD  416

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  283
            E+FVRRWQLAC+ +++HVVVMP++TV KL+ F+ ELI  R+
Sbjct  417  EDFVRRWQLACQGDIAHVVVMPNITVAKLERFVTELIAVRA  457



>ref|XP_003592128.1| Embryo defective 1075-like protein [Medicago truncatula]
 gb|AES62379.1| serine decarboxylase [Medicago truncatula]
Length=451

 Score =   247 bits (631),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 141/188 (75%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QAP++SFKKPI SV++SGHKF+GCP PCGV +TRL ++NALS +V+ +ASRDATI GSR 
Sbjct  258  QAPRISFKKPIDSVTISGHKFLGCPSPCGVLITRLKYMNALSRDVDIIASRDATITGSRC  317

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWY L ++G  G + EV +C+  AHYL + LR AGI AMLN+ S+ VVFERP D
Sbjct  318  GHAPIFLWYALKKRGLIGLENEVHECIMKAHYLLNLLRDAGIGAMLNKFSNIVVFERPLD  377

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            + F RRW LA  +N +HVVV+  VTVE LD F+ E  + +S+WY+    +PPC+A DVG 
Sbjct  378  DHFTRRWNLASNKNTAHVVVLKHVTVEMLDSFVREFTEKQSIWYKDEQFQPPCIANDVGS  437

Query  225  SNCCCVLH  202
             NC C +H
Sbjct  438  RNCACSIH  445



>ref|XP_005845371.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
 gb|EFN53269.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
Length=468

 Score =   247 bits (631),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +AP V+FKKPIGS+SVSGHKFVG P+PCGV +TRL +I  +SS+VEYL SRDATIMGSRN
Sbjct  286  RAPMVTFKKPIGSISVSGHKFVGSPVPCGVVMTRLRYIKGVSSDVEYLNSRDATIMGSRN  345

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPI++WYT  RKGY+G +K+V+KCLRNAH LK  L  AG+  MLNELSSTVVFERP++
Sbjct  346  GHAPIYMWYTFTRKGYEGLRKDVEKCLRNAHLLKSMLDTAGVRTMLNELSSTVVFERPRE  405

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  283
            E FVR+WQLACE +++HVVVMP++T+ KL+ F+ EL+++R+
Sbjct  406  ESFVRKWQLACEGDIAHVVVMPNITIRKLETFVQELVESRA  446



>ref|XP_009601849.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=408

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 145/201 (72%), Gaps = 2/201 (1%)
 Frame = -2

Query  792  LFISFHCHVQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASR  613
            L I F  H  A  ++FKK +GSVS+SGHKF+GCPMPCG+Q+TR  +I++LS+ +EY+AS 
Sbjct  210  LIIPFIQH--AKTITFKKSVGSVSISGHKFLGCPMPCGIQMTRKSYISSLSTKIEYIAST  267

Query  612  DATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSS  433
            DATI GSRNG API LWY+L  KG  G Q++ + C+ NA YLK +L  AGISAMLNE S 
Sbjct  268  DATISGSRNGLAPILLWYSLCMKGRTGLQQDAKMCIENARYLKGQLHKAGISAMLNEFSI  327

Query  432  TVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
             VVFERP D +F+R+WQL+C R+M+H VVMP +T E +D F  +L+  R  WY  G + P
Sbjct  328  IVVFERPNDHKFIRQWQLSCTRDMTHAVVMPCITRETIDNFFKDLMHEREKWYRVGTTVP  387

Query  252  PCLAEDVGVSNCCCVLHK*CN  190
            PCLA+D+   NC C  HK C+
Sbjct  388  PCLADDIASQNCLCCCHKMCH  408



>ref|XP_004496485.1| PREDICTED: histidine decarboxylase-like [Cicer arietinum]
Length=446

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QA ++SFKKPI SV++SGHKF+GCP PCGV +TRL +IN LS +VE +ASRDATI GSR 
Sbjct  256  QAQRISFKKPIDSVTISGHKFLGCPSPCGVVITRLKYINELSRDVEIIASRDATITGSRC  315

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPI LWY L +KG  G + EV +C+ NA YL D+LR AGI AMLNE S+ VVFE+P D
Sbjct  316  GHAPILLWYALKKKGLIGLKNEVHECIINARYLLDQLRDAGIGAMLNEFSNIVVFEKPLD  375

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            + F RRW LA + N++HVVV+  VT E LD F+ E IQ RS+WY+ G+ +P C+A  VG 
Sbjct  376  DNFTRRWNLATKGNIAHVVVLMHVTKEMLDTFVREFIQKRSIWYKHGHFQPLCIANHVGS  435

Query  225  SNCCCVLHK  199
            +NC C +HK
Sbjct  436  TNCVCSIHK  444



>ref|XP_001689659.1| serine decarboxylase [Chlamydomonas reinhardtii]
 gb|EDP09397.1| serine decarboxylase, partial [Chlamydomonas reinhardtii]
Length=375

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
             AP V+F+KPIGSVSVSGHKFVG P+PCGV +TR  ++ ALSS+VEYL SRDATIMGSRN
Sbjct  216  DAPMVTFRKPIGSVSVSGHKFVGAPVPCGVIITRFKYVMALSSDVEYLNSRDATIMGSRN  275

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP++LWYTL RKGY G +++V+KC+RNAH L+  L  AGI  MLNELS+TVVFERPK+
Sbjct  276  GHAPVYLWYTLTRKGYDGMRRDVEKCMRNAHVLQQMLESAGIRTMLNELSNTVVFERPKE  335

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  286
            E FVR+WQLACE  ++HVVVMP++TVEKL+ F+ + +Q+R
Sbjct  336  EAFVRKWQLACEGEIAHVVVMPNITVEKLEEFVADYVQSR  375



>ref|XP_009601848.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=448

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 145/201 (72%), Gaps = 2/201 (1%)
 Frame = -2

Query  792  LFISFHCHVQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASR  613
            L I F  H  A  ++FKK +GSVS+SGHKF+GCPMPCG+Q+TR  +I++LS+ +EY+AS 
Sbjct  250  LIIPFIQH--AKTITFKKSVGSVSISGHKFLGCPMPCGIQMTRKSYISSLSTKIEYIAST  307

Query  612  DATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSS  433
            DATI GSRNG API LWY+L  KG  G Q++ + C+ NA YLK +L  AGISAMLNE S 
Sbjct  308  DATISGSRNGLAPILLWYSLCMKGRTGLQQDAKMCIENARYLKGQLHKAGISAMLNEFSI  367

Query  432  TVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
             VVFERP D +F+R+WQL+C R+M+H VVMP +T E +D F  +L+  R  WY  G + P
Sbjct  368  IVVFERPNDHKFIRQWQLSCTRDMTHAVVMPCITRETIDNFFKDLMHEREKWYRVGTTVP  427

Query  252  PCLAEDVGVSNCCCVLHK*CN  190
            PCLA+D+   NC C  HK C+
Sbjct  428  PCLADDIASQNCLCCCHKMCH  448



>gb|EMS65243.1| Histidine decarboxylase [Triticum urartu]
Length=357

 Score =   241 bits (615),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 133/189 (70%), Gaps = 39/189 (21%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QAP+VSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR                          
Sbjct  207  QAPRVSFKKPIGSVSVSGHKFVGCPMPCGVQITR--------------------------  240

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
                         KGY+GFQKEVQKCLRNAHYLKD+L+ AGISAMLNELSSTVVFERPKD
Sbjct  241  -------------KGYRGFQKEVQKCLRNAHYLKDRLKDAGISAMLNELSSTVVFERPKD  287

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFVRRWQLACE  +SHVVVMPSV V+KLD FL+EL++ R  WY+ G  + PC+A DVG 
Sbjct  288  EEFVRRWQLACEGGISHVVVMPSVNVDKLDTFLNELVEKRVTWYQEGKCQSPCIAADVGQ  347

Query  225  SNCCCVLHK  199
             NC C LHK
Sbjct  348  ENCLCTLHK  356



>ref|XP_011082256.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=437

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QAPK +FKKPIGSVS+SGHKF+GCPMPCGV LTR  +I+ LS+++EY+A+ D TI GSRN
Sbjct  264  QAPKFTFKKPIGSVSISGHKFLGCPMPCGVLLTRKRYIDILSTSIEYIATVDTTIAGSRN  323

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GH+PIFLWY LN KG KG +++V+KCL N+ YL+D+L+ AGI++MLNE+S TVVFERP D
Sbjct  324  GHSPIFLWYVLNIKGQKGLEEDVEKCLINSRYLRDRLKKAGINSMLNEMSITVVFERPPD  383

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWY  274
             EF+R WQL C  NM+HVV+MP VTVE LD FL +L+Q R++WY
Sbjct  384  SEFIRHWQLQCLGNMAHVVIMPHVTVEMLDHFLYDLLQKRNIWY  427



>ref|XP_009602156.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=446

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 143/198 (72%), Gaps = 2/198 (1%)
 Frame = -2

Query  792  LFISFHCHVQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASR  613
            L + F  HV+   ++FKKPIGSVS+SGHKF+GCPMPCG+Q+TR  +I +LS+ +EY+AS 
Sbjct  248  LIVPFTQHVKT--ITFKKPIGSVSISGHKFLGCPMPCGIQITRKSYITSLSTKIEYIASV  305

Query  612  DATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSS  433
            DATI GSRNG APIFLWY+L  KG  G Q++ + C  NA YLK +L  AGIS MLNE S 
Sbjct  306  DATISGSRNGLAPIFLWYSLCMKGRAGLQQDAKMCNENARYLKGQLHKAGISTMLNESSI  365

Query  432  TVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
             VVFERP   +F+R WQL+C R+M+HVVVMP +T E +D F  +L+Q R  WY+ G   P
Sbjct  366  IVVFERPNVPKFIRHWQLSCTRDMAHVVVMPGITRETIDNFFKDLMQERKKWYQVGIIVP  425

Query  252  PCLAEDVGVSNCCCVLHK  199
            PCLA+D+G  NC C   K
Sbjct  426  PCLADDIGSQNCLCSKQK  443



>ref|XP_006364727.1| PREDICTED: histidine decarboxylase-like, partial [Solanum tuberosum]
Length=422

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 147/198 (74%), Gaps = 2/198 (1%)
 Frame = -2

Query  792  LFISFHCHVQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASR  613
            L + F  HV + K++FKKPIGS+S+SGHKF+GCPMPCG+Q+TR  ++++LS  +EY+ S 
Sbjct  224  LILPFIRHV-SKKITFKKPIGSISISGHKFLGCPMPCGIQITRKSYVSSLSK-IEYINST  281

Query  612  DATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSS  433
            DATI GSRNG  PIFLWY L+ KG+   Q++ + C+ NA YLKD+L  AGISAMLNE S 
Sbjct  282  DATISGSRNGLTPIFLWYCLSTKGHVRLQQDSKICIENARYLKDRLLEAGISAMLNEFSI  341

Query  432  TVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
            TVVFERP D +F+RRW L   R M+HVVVMP +T E +D F ++L+Q R  W++ G ++P
Sbjct  342  TVVFERPCDHKFIRRWNLCYLRGMAHVVVMPGITREIIDSFFNDLMQERKRWFQDGKTRP  401

Query  252  PCLAEDVGVSNCCCVLHK  199
            PCLA+D G  NC C  +K
Sbjct  402  PCLADDFGTQNCMCSNNK  419



>gb|EYU40386.1| hypothetical protein MIMGU_mgv1a026369mg, partial [Erythranthe 
guttata]
Length=300

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 134/188 (71%), Gaps = 1/188 (1%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHI-NALSSNVEYLASRDATIMGSRN  586
             PK+SFKKPI S+SVS HK +G  +PCGV +TR   I N LS NVEY+ + D TI GSRN
Sbjct  111  GPKLSFKKPIRSISVSAHKLLGSSIPCGVLMTRKGRITNNLSENVEYIDTLDTTISGSRN  170

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIF+WY L  KG  G   EV KCL NA YL+D  + AGISAMLNE S  VVFERP  
Sbjct  171  GHAPIFIWYGLKMKGRSGLHTEVNKCLTNAKYLRDGFKNAGISAMLNESSIVVVFERPLS  230

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
             EF+  WQL+    M+HVVVMP VTV+ LD FLD+L+Q R +WY  G  +P CLAE++GV
Sbjct  231  REFIDYWQLSLLEKMAHVVVMPHVTVKMLDDFLDDLVQNREIWYGNGKVQPLCLAEEIGV  290

Query  225  SNCCCVLH  202
            SNC C++H
Sbjct  291  SNCACLVH  298



>gb|KCW44086.1| hypothetical protein EUGRSUZ_L02502 [Eucalyptus grandis]
Length=239

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -2

Query  603  IMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVV  424
            I   RNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVV
Sbjct  105  IEAVRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKGRLREAGISAMLNELSSTVV  164

Query  423  FERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCL  244
            FERP +EEFVRRWQLACE N++HVVVMPSV++EKLD F++ELI+ RS WY  G  +PPCL
Sbjct  165  FERPSEEEFVRRWQLACEGNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCL  224

Query  243  AEDVGVSNCCCVLHK  199
            A D+G  NCCC LHK
Sbjct  225  AVDIGAENCCCALHK  239



>ref|XP_006364728.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=447

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 143/194 (74%), Gaps = 3/194 (2%)
 Frame = -2

Query  792  LFISFHCHVQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASR  613
            L + F  H  A K++FKKPIGS+S+SGHKF+GCPMPCG+Q+TR  ++++LS  +EY+AS 
Sbjct  247  LILPFMEH--AKKITFKKPIGSISISGHKFLGCPMPCGIQITRKSYVSSLSK-IEYIASI  303

Query  612  DATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSS  433
            D TI GSRNG  PIFLWY LN KG+   Q++   C+ NA YLKD+L  AGISAMLNELS 
Sbjct  304  DTTISGSRNGLTPIFLWYCLNMKGHARLQQDSITCIENARYLKDRLVKAGISAMLNELSI  363

Query  432  TVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
             VVFERP D EF+RRWQL     M+H+VVMP +T E +D F ++L+Q R  W++ G ++P
Sbjct  364  IVVFERPCDHEFIRRWQLCYLSVMAHIVVMPFITREIIDSFFNDLMQERKRWFQDGKTRP  423

Query  252  PCLAEDVGVSNCCC  211
            PCLA+D G  NC C
Sbjct  424  PCLADDFGTQNCMC  437



>gb|KEH43660.1| serine decarboxylase [Medicago truncatula]
Length=543

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 141/188 (75%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QA KVSFKKPIGSV++SGHKF+GCP PCGV +TRL +++A+S +V  +ASRDATI GSR 
Sbjct  261  QALKVSFKKPIGSVTISGHKFLGCPSPCGVVITRLKYMSAISRDVGIIASRDATITGSRC  320

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWY L ++G  G + EV +C+  AHYL + LR AGI AMLNE S+ VVFERP D
Sbjct  321  GHAPIFLWYALKKRGLIGLENEVHECIMKAHYLLNLLRDAGIGAMLNEFSNIVVFERPLD  380

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            ++F R W LAC  N++HVVV+  V+VE LD F+ E I+ RS+W +    KP C+A DVG 
Sbjct  381  DDFNRSWNLACSGNIAHVVVLQHVSVEMLDTFVHEFIEKRSIWSKDEQFKPLCIANDVGS  440

Query  225  SNCCCVLH  202
             NC C++H
Sbjct  441  KNCACLMH  448



>gb|KDD76585.1| hypothetical protein H632_c172p0 [Helicosporidium sp. ATCC 50920]
Length=483

 Score =   239 bits (611),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -2

Query  759  PKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGH  580
            P V+F+KPIGSVSVSGHKFVG PMPCGV +TRL ++ ALSS VEYL SRDATIMGSRNGH
Sbjct  299  PMVTFRKPIGSVSVSGHKFVGAPMPCGVVMTRLRYVEALSSEVEYLNSRDATIMGSRNGH  358

Query  579  APIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEE  400
            API+LWYTL RKG  G +K+V++CLRNAH LKD L+ AG+ A LN LSSTVVFERP D  
Sbjct  359  APIYLWYTLARKGLVGMRKDVERCLRNAHLLKDMLQRAGVGASLNPLSSTVVFERPADPA  418

Query  399  FVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  283
            FVRRWQLACE +++HV+VMP++TV KL+ F+ EL+  R+
Sbjct  419  FVRRWQLACEGDIAHVIVMPNITVAKLEKFVKELLACRA  457



>gb|EEC76705.1| hypothetical protein OsI_14710 [Oryza sativa Indica Group]
Length=407

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 142/189 (75%), Gaps = 6/189 (3%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN-ALSSNVEYLASRDATIMGSR  589
            QAPK++FKKPIGS+ +SGHKF+GCP+PCGV +TRL  IN  +S+N+EY++S D TI GSR
Sbjct  216  QAPKLTFKKPIGSICISGHKFIGCPIPCGVLITRLMDINHVMSTNIEYISSNDTTIAGSR  275

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
            NGHAPIFLWY L R GY G  K V+ CL+NA YL  +LR  G+S  LN LS TVVFERPK
Sbjct  276  NGHAPIFLWYALKRIGYNGLCKTVENCLKNAQYLALRLREMGVSVFLNALSITVVFERPK  335

Query  408  DEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVG  229
            DE FVR+WQLAC+  ++HVVVMP+V++E+++ FL+E  ++R   ++       C+A DVG
Sbjct  336  DETFVRKWQLACQGKIAHVVVMPNVSLERINMFLEEFTKSRITLHQ-----DKCVAGDVG  390

Query  228  VSNCCCVLH  202
              NC C LH
Sbjct  391  QENCLCSLH  399



>gb|EYU19378.1| hypothetical protein MIMGU_mgv1a006611mg [Erythranthe guttata]
Length=437

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 136/189 (72%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
              PK SFKKPIGSVSVS HK +G  MPCGV +TR  HI   S N+EY+A+ D TI GSRN
Sbjct  241  NGPKFSFKKPIGSVSVSAHKLLGSSMPCGVFMTRKRHIADFSRNIEYIATVDNTISGSRN  300

Query  585  GHAPIFLWYTLNRK-GYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
            GHAPIF+WY+LN K G  G QKEV KCL NA YL+D L+ AGIS MLNE +  VVFERP 
Sbjct  301  GHAPIFIWYSLNMKLGRMGLQKEVNKCLMNARYLRDGLKNAGISVMLNESNILVVFERPL  360

Query  408  DEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVG  229
            D EF+  WQL+ +  M+HV+VMP VTV+ LD FL +L + R +WY  G  +  CLAED+G
Sbjct  361  DLEFIYHWQLSVDGKMAHVIVMPHVTVKMLDDFLSDLTRKREIWYGSGEVRRLCLAEDIG  420

Query  228  VSNCCCVLH  202
            +SNC C +H
Sbjct  421  LSNCACSVH  429



>gb|KIZ00141.1| histidine decarboxylase [Monoraphidium neglectum]
Length=481

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QAP V+F+KPIGSVSVSGHKF+G P+PCGV +TR  H+ ALSS+VEYL SRDATIMGSRN
Sbjct  292  QAPMVTFRKPIGSVSVSGHKFLGAPVPCGVVITRFRHVLALSSDVEYLNSRDATIMGSRN  351

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP++LWYTL RKGY G  ++V++C+RNAH LK  L  AG+  MLNELS+TVVFERP++
Sbjct  352  GHAPLYLWYTLTRKGYAGIARDVERCMRNAHTLKSMLDQAGVKTMLNELSNTVVFERPRE  411

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  283
            E FVR+WQLACE +++HVVVMP++ + KL+ F+ + I +R+
Sbjct  412  EAFVRKWQLACEGDIAHVVVMPNIDIAKLEEFVQDYISSRA  452



>gb|AES62380.2| serine decarboxylase [Medicago truncatula]
Length=432

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 138/188 (73%), Gaps = 7/188 (4%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QAP ++FKK IGS+++SGHKF+GCP+PCGV LTRL+HIN L  +VE + SRD TI GSR+
Sbjct  251  QAPSITFKKSIGSITISGHKFLGCPIPCGVLLTRLEHINTLCKDVEVIGSRDTTISGSRS  310

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHA IF+WY L +KG  G + EV KC+ NA YLK KLR AGI  MLNE S+TVVFE+P D
Sbjct  311  GHASIFIWYALQKKGLLGLENEVHKCIMNACYLKRKLRDAGICTMLNEYSNTVVFEKPLD  370

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
             EF+R+W LA E +++HVVVM  VTVE LD F+DE I+ R         KP CLA+ +G 
Sbjct  371  CEFIRKWNLAYEGDIAHVVVMQHVTVEMLDSFVDEFIKTRL-------RKPLCLADKIGA  423

Query  225  SNCCCVLH  202
             NC C+LH
Sbjct  424  ENCTCILH  431



>ref|XP_003592129.1| Serine decarboxylase [Medicago truncatula]
Length=456

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 138/188 (73%), Gaps = 7/188 (4%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QAP ++FKK IGS+++SGHKF+GCP+PCGV LTRL+HIN L  +VE + SRD TI GSR+
Sbjct  275  QAPSITFKKSIGSITISGHKFLGCPIPCGVLLTRLEHINTLCKDVEVIGSRDTTISGSRS  334

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHA IF+WY L +KG  G + EV KC+ NA YLK KLR AGI  MLNE S+TVVFE+P D
Sbjct  335  GHASIFIWYALQKKGLLGLENEVHKCIMNACYLKRKLRDAGICTMLNEYSNTVVFEKPLD  394

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
             EF+R+W LA E +++HVVVM  VTVE LD F+DE I+ R         KP CLA+ +G 
Sbjct  395  CEFIRKWNLAYEGDIAHVVVMQHVTVEMLDSFVDEFIKTRL-------RKPLCLADKIGA  447

Query  225  SNCCCVLH  202
             NC C+LH
Sbjct  448  ENCTCILH  455



>gb|EEE60437.1| hypothetical protein OsJ_13648 [Oryza sativa Japonica Group]
Length=334

 Score =   233 bits (593),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 140/189 (74%), Gaps = 6/189 (3%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN-ALSSNVEYLASRDATIMGSR  589
            QAPK++FKKPIGS+ +SGHKF+GCP+PCGV +TRL  IN  +S+N+EY++S D TI GSR
Sbjct  143  QAPKLTFKKPIGSICISGHKFIGCPIPCGVLITRLMDINHVMSTNIEYISSNDTTIAGSR  202

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
            NGHAPIFLWY L R GY G  K V+ CL+NA YL  +LR  G+S  LN LS TVVFERP 
Sbjct  203  NGHAPIFLWYALKRIGYNGLCKTVENCLKNAQYLALRLREMGVSVFLNALSITVVFERPN  262

Query  408  DEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVG  229
            DE FVR+WQLAC+  ++HVVVMP+V++E+++ FL+E  ++R   ++       C+A DV 
Sbjct  263  DETFVRKWQLACQGKIAHVVVMPNVSLERINMFLEEFTKSRIALHQ-----DKCVAGDVS  317

Query  228  VSNCCCVLH  202
              NC C LH
Sbjct  318  QENCLCSLH  326



>gb|EYU30500.1| hypothetical protein MIMGU_mgv1a023109mg, partial [Erythranthe 
guttata]
Length=418

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 134/189 (71%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
              P  SFKKPIGSVSVS HK +G  MPCG+ ++R  H+   S+N+EY+A+ D TI GSRN
Sbjct  228  NGPLFSFKKPIGSVSVSAHKLLGSSMPCGILISRKMHMTDFSTNIEYIATLDTTISGSRN  287

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GH PIF+WY LN KG  G QKEV  CL NA YL+D L  AGISAMLNE S  VVFERP D
Sbjct  288  GHTPIFIWYGLNLKGRIGLQKEVNNCLTNAKYLRDGLNKAGISAMLNESSIVVVFERPLD  347

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
             EF+  WQL+    M+HVV+MP VT++ LD FL +L++ R +WY  G  +P CLAE++G 
Sbjct  348  REFIDYWQLSFLGKMAHVVLMPHVTMKMLDDFLSDLVRKREIWYGSGEVRPVCLAEEIGA  407

Query  225  SNCCCVLHK  199
            SNC C +H+
Sbjct  408  SNCACSIHR  416



>ref|XP_005646136.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
 gb|EIE21592.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
Length=377

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +AP+VSF+KPIGSVSVSGHKF+G P+PCGV +TR  ++ ALS++VEYL SRDATIMGSRN
Sbjct  192  KAPRVSFRKPIGSVSVSGHKFIGAPVPCGVVITRQKYVAALSNDVEYLNSRDATIMGSRN  251

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPI++W+TL RKGY+G +K+V++CLRNA  LK  L  AG+  MLNELSSTVVFERP++
Sbjct  252  GHAPIYMWFTLTRKGYEGMRKDVERCLRNALVLKSMLEQAGVKVMLNELSSTVVFERPRE  311

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  283
            E FVR+WQLACE  ++HVVVMP+V +  L+ F+ +LI +R+
Sbjct  312  EAFVRKWQLACEGEVAHVVVMPNVHMAILEEFVADLIASRT  352



>sp|Q7X8D4.2|SDC3_ORYSJ RecName: Full=Serine decarboxylase 3 [Oryza sativa Japonica Group]
 emb|CAE05435.2| OSJNBa0059H15.18 [Oryza sativa Japonica Group]
 emb|CAE04954.2| OSJNBa0070D17.5 [Oryza sativa Japonica Group]
Length=446

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 140/189 (74%), Gaps = 6/189 (3%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN-ALSSNVEYLASRDATIMGSR  589
            QAPK++FKKPIGS+ +SGHKF+GCP+PCGV +TRL  IN  +S+N+EY++S D TI GSR
Sbjct  255  QAPKLTFKKPIGSICISGHKFIGCPIPCGVLITRLMDINHVMSTNIEYISSNDTTIAGSR  314

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
            NGHAPIFLWY L R GY G  K V+ CL+NA YL  +LR  G+S  LN LS TVVFERP 
Sbjct  315  NGHAPIFLWYALKRIGYNGLCKTVENCLKNAQYLALRLREMGVSVFLNALSITVVFERPN  374

Query  408  DEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVG  229
            DE FVR+WQLAC+  ++HVVVMP+V++E+++ FL+E  ++R   ++       C+A DV 
Sbjct  375  DETFVRKWQLACQGKIAHVVVMPNVSLERINMFLEEFTKSRIALHQ-----DKCVAGDVS  429

Query  228  VSNCCCVLH  202
              NC C LH
Sbjct  430  QENCLCSLH  438



>ref|XP_006362640.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=346

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 140/197 (71%), Gaps = 4/197 (2%)
 Frame = -2

Query  792  LFISFHCHVQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASR  613
            L + F  H  A  ++FKK IGS+SVSGHKF+GC M CGVQ+TR  +I  +S  VEY+AS 
Sbjct  150  LIVPFINH--AKIITFKKSIGSISVSGHKFLGCSMLCGVQITRKTYIATISKRVEYIASI  207

Query  612  DATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSS  433
            D TI GSRNG APIFLWY+L+ KG+ G Q+  + C  NA YLKD+L  AGISAMLNELS+
Sbjct  208  DNTISGSRNGLAPIFLWYSLSMKGHVGLQQHAKMCYENARYLKDRLHKAGISAMLNELSN  267

Query  432  TVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
             VVFERP D++F+RRWQL+C R+ +HVVVMP  T E +D F  +L+Q R  W   G +  
Sbjct  268  IVVFERPCDDKFIRRWQLSCTRDTAHVVVMPGTTKEIIDNFFKDLMQEREKWC--GITLA  325

Query  252  PCLAEDVGVSNCCCVLH  202
            PCLA+D+G  NC C  H
Sbjct  326  PCLADDIGSQNCLCSYH  342



>ref|XP_002456988.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
 gb|EES02108.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
Length=480

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 145/189 (77%), Gaps = 4/189 (2%)
 Frame = -2

Query  765  QAPKVSFKKP-IGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSR  589
            QAP+V+F+KP IGSVSVSGHKF+GCP+PCGV +TR +H   LS++V+Y++SRDATI GSR
Sbjct  282  QAPRVTFRKPGIGSVSVSGHKFLGCPVPCGVVITRREHAAVLSTDVDYISSRDATITGSR  341

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAM-LNELSSTVVFERP  412
            NGHAP+FLW  LN KG +G + +V +CLRNA +L  +LR AG+SA  LN LS TVV ERP
Sbjct  342  NGHAPLFLWCALNAKGRRGIRDDVHRCLRNARFLARRLRDAGVSAARLNPLSITVVLERP  401

Query  411  KDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNS--KPPCLAE  238
            +DE FVR+WQL+C+  ++HVVVMP+V V+K+  F+++L   R +WY  G      PC+A+
Sbjct  402  RDEAFVRKWQLSCQGGVAHVVVMPNVGVDKIASFVEDLAAKRRIWYPHGEGLRVGPCVAK  461

Query  237  DVGVSNCCC  211
            D+G  NC C
Sbjct  462  DIGQENCLC  470



>ref|XP_004245146.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=444

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 138/194 (71%), Gaps = 4/194 (2%)
 Frame = -2

Query  792  LFISFHCHVQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASR  613
            L + F  H  A  ++FKK IGS+SVSGHKF+GC MPCGVQ+T+  +I  +S  VEY+AS 
Sbjct  248  LIVPFINH--AKIITFKKSIGSISVSGHKFLGCSMPCGVQITKRTYITTISKQVEYIASI  305

Query  612  DATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSS  433
            D TI GSRNG APIFLWY+L+ KG  G QK+ + C  NA YLKD+L  AGISAMLNE S+
Sbjct  306  DNTISGSRNGLAPIFLWYSLSMKGNAGLQKDAKICYENARYLKDRLHKAGISAMLNEFSN  365

Query  432  TVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
             VVFERP D +F+RRWQL+C R+ +HVVVMP  T E +D F  +L+Q R  W   G +  
Sbjct  366  IVVFERPCDNKFIRRWQLSCARDTAHVVVMPGTTKEIIDNFFKDLVQEREKW--CGITLG  423

Query  252  PCLAEDVGVSNCCC  211
            PCLA+D+G  NC C
Sbjct  424  PCLADDIGSQNCLC  437



>ref|XP_006663420.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=446

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 137/189 (72%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN-ALSSNVEYLASRDATIMGSR  589
            Q PK++FKK IGS+SVSGHK +GCP PCGV + RL  IN  +S+N+EY+ASRDATI GSR
Sbjct  251  QEPKLTFKKSIGSISVSGHKLLGCPTPCGVVVNRLKDINLVMSTNIEYVASRDATITGSR  310

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
            NGHAPI +WYTL   GY G + +V  C+R A YL+  L+  G+S +LN  SSTV+FERPK
Sbjct  311  NGHAPIIMWYTLKCLGYNGIRMKVTTCIRKAEYLEFLLKKKGVSTLLNPGSSTVIFERPK  370

Query  408  DEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVG  229
            DE FVR+WQLACE N++HVVVMP+V++  L  F+DEL + R +         PC+A D+G
Sbjct  371  DEVFVRKWQLACEGNLAHVVVMPNVSIRHLFRFVDELAENRYIMLHDKEISTPCVAADIG  430

Query  228  VSNCCCVLH  202
              NC C LH
Sbjct  431  PGNCMCNLH  439



>ref|XP_003592132.1| FAR1-related protein [Medicago truncatula]
Length=1272

 Score =   240 bits (613),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 141/188 (75%), Gaps = 0/188 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            QA KVSFKKPIGSV++SGHKF+GCP PCGV +TRL +++A+S +V  +ASRDATI GSR 
Sbjct  277  QALKVSFKKPIGSVTISGHKFLGCPSPCGVVITRLKYMSAISRDVGIIASRDATITGSRC  336

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWY L ++G  G + EV +C+  AHYL + LR AGI AMLNE S+ VVFERP D
Sbjct  337  GHAPIFLWYALKKRGLIGLENEVHECIMKAHYLLNLLRDAGIGAMLNEFSNIVVFERPLD  396

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            ++F R W LAC  N++HVVV+  V+VE LD F+ E I+ RS+W +    KP C+A DVG 
Sbjct  397  DDFNRSWNLACSGNIAHVVVLQHVSVEMLDTFVHEFIEKRSIWSKDEQFKPLCIANDVGS  456

Query  225  SNCCCVLH  202
             NC C++H
Sbjct  457  KNCACLMH  464



>ref|XP_004245145.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=443

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 136/189 (72%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
             A K++F KPIGS+SVSGHKF+GCPMPCG+Q+TR  +++ LS  +EY+AS D TI GSR 
Sbjct  253  HAKKITFMKPIGSISVSGHKFLGCPMPCGIQITRKTYVSTLSK-IEYIASIDTTISGSRY  311

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            G  PIFLWY LN KG+ G Q++   C+ NA YLKDKL  AGI AMLNE S  VVFERP D
Sbjct  312  GLTPIFLWYYLNMKGHAGLQQDSITCIENARYLKDKLVKAGIGAMLNEFSIIVVFERPCD  371

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
             +F+ RWQL     ++H+VVMP +T E ++ F +EL+Q R  W++ G +KPPCLA++ G 
Sbjct  372  HKFILRWQLCYLSGLAHIVVMPGITREIINSFFNELMQERKRWFQDGKTKPPCLADEFGS  431

Query  225  SNCCCVLHK  199
             NC C  +K
Sbjct  432  QNCMCSHNK  440



>gb|AEW07461.1| hypothetical protein 0_2106_01, partial [Pinus radiata]
 gb|AFG54678.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54680.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54681.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54683.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54684.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54685.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54688.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54689.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54690.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54691.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54692.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54693.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54694.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
Length=150

 Score =   219 bits (559),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HINALS +VEYLASRDATIMGSRN
Sbjct  38   RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRIEHINALSRDVEYLASRDATIMGSRN  97

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTV  427
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLK + R AGISAMLNELSSTV
Sbjct  98   GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKGRFRSAGISAMLNELSSTV  150



>ref|XP_004245144.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=444

 Score =   228 bits (582),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 136/189 (72%), Gaps = 1/189 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
             A K++FKKPIGS+S+SGHKF+GCPMPCG+Q+TR  +++   S +EY+ S DATI GSRN
Sbjct  254  HAKKITFKKPIGSISISGHKFLGCPMPCGIQITRKTYVST-HSKIEYINSTDATISGSRN  312

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            G  PIFLWY L++KG+   Q++   C+ NA YLKD+L  AGIS MLNE S TV+FER  D
Sbjct  313  GFTPIFLWYCLSKKGHARLQQDSITCIENARYLKDRLLEAGISVMLNEFSITVIFERSCD  372

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
             +F+ RW L   R M+HVVVMP +T E +D F  +L+Q R  W++ G ++PPCLA++ G 
Sbjct  373  HKFIHRWNLCYLRGMAHVVVMPGITRETIDSFFKDLMQERKRWFQDGKTQPPCLADEFGS  432

Query  225  SNCCCVLHK  199
             NC C  +K
Sbjct  433  QNCMCSHNK  441



>gb|AFG54679.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54682.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54686.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54687.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
Length=150

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HINALS +VEYLASRDATIMGSRN
Sbjct  38   RAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRIEHINALSRDVEYLASRDATIMGSRN  97

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTV  427
            GHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLK + R  GISAMLNELSSTV
Sbjct  98   GHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKGRFRSVGISAMLNELSSTV  150



>ref|NP_001234136.1| histidine decarboxylase [Solanum lycopersicum]
 sp|P54772.1|DCHS_SOLLC RecName: Full=Histidine decarboxylase; Short=HDC; AltName: Full=TOM92 
[Solanum lycopersicum]
 emb|CAA50719.1| histidine decarboxylase [Solanum lycopersicum]
Length=413

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 137/186 (74%), Gaps = 3/186 (2%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
             A K++FKKPIGS+S+SGHKF+GCPM CGVQ+TR  +++ LS  +EY+ S DATI GSRN
Sbjct  223  HAKKITFKKPIGSISISGHKFLGCPMSCGVQITRRSYVSTLSK-IEYINSADATISGSRN  281

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            G  PIFLWY L++KG+   Q++   C+ NA YLKD+L  AGIS MLN+ S TVVFERP D
Sbjct  282  GFTPIFLWYCLSKKGHARLQQDSITCIENARYLKDRLLEAGISVMLNDFSITVVFERPCD  341

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSV-WYEGGNSKPPCLAEDVG  229
             +F+RRW L C R M+HVV+MP +T E +D F  +L+Q R+  WY+   + PPCLA+D+ 
Sbjct  342  HKFIRRWNLCCLRGMAHVVIMPGITRETIDSFFKDLMQERNYKWYQDVKALPPCLADDLA  401

Query  228  VSNCCC  211
            + NC C
Sbjct  402  L-NCMC  406



>ref|XP_007159060.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 ref|XP_007159061.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31054.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31055.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=454

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 129/189 (68%), Gaps = 34/189 (18%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVG                                  SRN
Sbjct  300  RAPKVSFKKPIGSVSVSGHKFVG----------------------------------SRN  325

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWY+LN KGY+G QKEVQKCLRNAHY K +L  AGI AM+NELSSTVVFERP D
Sbjct  326  GHAPIFLWYSLNMKGYRGLQKEVQKCLRNAHYFKGQLVEAGIGAMVNELSSTVVFERPHD  385

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFV +WQLAC+ N++HVVVMP+VT+EKL  FL+EL+Q R  W+  G  +P C+A  VG 
Sbjct  386  EEFVHKWQLACQGNIAHVVVMPNVTIEKLHDFLNELLQKRQEWFRDGKCQPRCIASAVGH  445

Query  225  SNCCCVLHK  199
             NC C +H+
Sbjct  446  ENCLCFIHR  454



>ref|XP_007159059.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31053.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=494

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 129/189 (68%), Gaps = 34/189 (18%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +APKVSFKKPIGSVSVSGHKFVG                                  SRN
Sbjct  340  RAPKVSFKKPIGSVSVSGHKFVG----------------------------------SRN  365

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAPIFLWY+LN KGY+G QKEVQKCLRNAHY K +L  AGI AM+NELSSTVVFERP D
Sbjct  366  GHAPIFLWYSLNMKGYRGLQKEVQKCLRNAHYFKGQLVEAGIGAMVNELSSTVVFERPHD  425

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGV  226
            EEFV +WQLAC+ N++HVVVMP+VT+EKL  FL+EL+Q R  W+  G  +P C+A  VG 
Sbjct  426  EEFVHKWQLACQGNIAHVVVMPNVTIEKLHDFLNELLQKRQEWFRDGKCQPRCIASAVGH  485

Query  225  SNCCCVLHK  199
             NC C +H+
Sbjct  486  ENCLCFIHR  494



>ref|XP_009609584.1| PREDICTED: histidine decarboxylase-like, partial [Nicotiana tomentosiformis]
Length=269

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  753  VSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAP  574
            +SFKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN LS NVEY+AS DATI GSRNG  P
Sbjct  133  ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSRNVEYIASVDATISGSRNGLTP  192

Query  573  IFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFV  394
            IFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFV
Sbjct  193  IFLWYSLSAKGQIGLQKDVKRCLDNAIYLKDRLQQAGISVMLNELSIIVVLERPRDHEFV  252

Query  393  RRWQLACERNMSHVVVM  343
            RRWQL+C ++M+HV+VM
Sbjct  253  RRWQLSCMKDMAHVIVM  269



>ref|XP_002292250.1| histidine decarboxylase [Thalassiosira pseudonana CCMP1335]
 gb|EED90225.1| histidine decarboxylase, partial [Thalassiosira pseudonana CCMP1335]
Length=369

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            AP+VSF+KPI S++VSGHK +GCPMPCG+ LTR +H+  +   ++YL S D TIMGSRNG
Sbjct  208  APEVSFQKPIDSIAVSGHKMLGCPMPCGIALTRKEHVKKVEQKIDYLNSVDTTIMGSRNG  267

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
             A ++LWY+L +KG  G +++V  C+  A YL+DK+  AG++  LN+LSSTVV ERP D+
Sbjct  268  QAALYLWYSLRKKGIAGIKRDVVHCMETAQYLRDKITEAGLTCRLNDLSSTVVLERPMDD  327

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVW  277
             F++RWQLACE +++HVVVMP+VT  K+D F++EL++ ++V+
Sbjct  328  AFIKRWQLACEEDIAHVVVMPNVTRFKIDKFVEELVECKNVY  369



>ref|XP_002178784.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49482.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=364

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            AP+VSF+KPI S++VSGHK +GCPMPCGV L+R +H+  L  +++YL S D TIMGSRNG
Sbjct  208  APEVSFRKPIDSIAVSGHKMLGCPMPCGVALSRKEHVKNLEQHIDYLNSVDTTIMGSRNG  267

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
             A ++LWY+L +KG  G +++V  C+  A YLKD L   G++  LN+LSSTVV ERP D+
Sbjct  268  QAALYLWYSLRKKGIGGIKRDVMHCMETARYLKDALTAKGLTCRLNDLSSTVVLERPMDD  327

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQ  292
            + V+RWQLACE +++HVVVMP+VT  K+D F++EL+Q
Sbjct  328  DLVKRWQLACEEDIAHVVVMPNVTRYKIDLFVEELMQ  364



>ref|XP_002679079.1| predicted protein [Naegleria gruberi]
 gb|EFC46335.1| predicted protein [Naegleria gruberi]
Length=441

 Score =   199 bits (506),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 135/187 (72%), Gaps = 9/187 (5%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            +A +V+F KPIGS+SVSGHKF+GCPMPCGV +TR  ++  L S+++YL S D TIMGSRN
Sbjct  253  EALEVNFTKPIGSISVSGHKFMGCPMPCGVTITRKRYVETLKSHIDYLNSVDTTIMGSRN  312

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            G A ++LW TL +KG +GF  + +KCL NA Y+   L+ AG+  +LN+ S+T+V ERP D
Sbjct  313  GQASLYLWLTLRKKGTEGFASDARKCLENAKYMIKLLKEAGVGCLLNDHSNTIVLERPMD  372

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPP--CLAEDV  232
            EEFV++WQLACE  ++H +VMP+V+ +K++ F+++ +++R        S P   C+A+ +
Sbjct  373  EEFVKKWQLACEGTVAHCIVMPNVSKQKIEDFVNDYLESRK-------SHPADLCIAKHI  425

Query  231  GVSNCCC  211
            G  +C C
Sbjct  426  GPVHCLC  432



>ref|XP_004364837.2| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=692

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 126/180 (70%), Gaps = 4/180 (2%)
 Frame = -2

Query  747  FKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIF  568
            F +PI S+SVSGHKF+GCPMP GV + R D++  +  ++ YL S+D TIMGSRNG AP+F
Sbjct  506  FTRPIDSMSVSGHKFMGCPMPAGVVICRKDNVKKVEQHIAYLNSKDTTIMGSRNGQAPLF  565

Query  567  LWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRR  388
            +W T+  KG  GF K+  +CL  A  L  +LR AG+S+MLN +S+TVVFERP +  FV++
Sbjct  566  MWNTIQLKGKSGFAKDTHQCLTRAALLNKRLRDAGVSSMLNPMSNTVVFERPDEHAFVKK  625

Query  387  WQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCV  208
            WQLACE N++H +VMP++T EK+  F+ EL+ +R    +G   K  C+A  +G +NC C 
Sbjct  626  WQLACEGNIAHAIVMPNITEEKIVVFVTELLASRKA--QGTCDK--CVAMHIGRANCLCT  681



>gb|KJE90702.1| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=683

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 126/180 (70%), Gaps = 4/180 (2%)
 Frame = -2

Query  747  FKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIF  568
            F +PI S+SVSGHKF+GCPMP GV + R D++  +  ++ YL S+D TIMGSRNG AP+F
Sbjct  497  FTRPIDSMSVSGHKFMGCPMPAGVVICRKDNVKKVEQHIAYLNSKDTTIMGSRNGQAPLF  556

Query  567  LWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRR  388
            +W T+  KG  GF K+  +CL  A  L  +LR AG+S+MLN +S+TVVFERP +  FV++
Sbjct  557  MWNTIQLKGKSGFAKDTHQCLTRAALLNKRLRDAGVSSMLNPMSNTVVFERPDEHAFVKK  616

Query  387  WQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCV  208
            WQLACE N++H +VMP++T EK+  F+ EL+ +R    +G   K  C+A  +G +NC C 
Sbjct  617  WQLACEGNIAHAIVMPNITEEKIVVFVTELLASRKA--QGTCDK--CVAMHIGRANCLCT  672



>ref|WP_026730962.1| histidine decarboxylase [Fischerella sp. PCC 9605]
Length=363

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
             AP+V+F KPI S+++SGHKF+G P+ CGV LTR + +N + ++++Y+ S+D TI+GSRN
Sbjct  202  NAPQVNFTKPISSIAISGHKFIGSPLVCGVVLTRKEFVNKIETSIDYIGSKDTTILGSRN  261

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            GHAP+FLWY L +K Y+G  KEV+ CL N+ YL + L+      MLN  S+TVVF++P  
Sbjct  262  GHAPLFLWYALKKKDYQGLAKEVEFCLENSQYLFNNLQLLNYPCMLNNFSNTVVFKKPP-  320

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDEL  298
             + V++WQLA + + +H+VVM ++   K+D F+ +L
Sbjct  321  IQLVKKWQLATQGDWAHMVVMQNINRHKIDTFITDL  356



>ref|XP_003593127.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES63378.1| serine decarboxylase [Medicago truncatula]
Length=124

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -2

Query  534  GFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSH  355
             F+KEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQLAC+ N++H
Sbjct  7    SFEKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACKGNIAH  66

Query  354  VVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNC  217
            VVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C
Sbjct  67   VVVMPNVTIEKLDDFLNELVQKRATWFEYGTFQPYCIASDVGENSC  112



>gb|ABA93664.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1040

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 110/161 (68%), Gaps = 18/161 (11%)
 Frame = -2

Query  765  QAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL-SSNVEYLASRDATIMGSR  589
            QAPKV+F KPIGS+SVSGHK +GCP PCGV + RL  I+ L S+N+EY+AS D TI GSR
Sbjct  831  QAPKVTFIKPIGSISVSGHKLLGCPTPCGVVINRLKDIDVLKSTNIEYIASNDVTISGSR  890

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
            NG +PIFLWY L   GY     EV            +LR  GISA +N  S  V+FE+PK
Sbjct  891  NGQSPIFLWYKLKSMGY-----EV------------RLRNVGISAFMNSKSIIVIFEKPK  933

Query  408  DEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  286
            DE F+++WQLAC  N++HVVVMP V+ E L  F++EL + R
Sbjct  934  DEMFMQKWQLACAGNVAHVVVMPHVSFEMLGIFVEELAEKR  974



>ref|WP_015112001.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
 gb|AFY41767.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
Length=383

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 116/164 (71%), Gaps = 2/164 (1%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            AP+++F+KPI SV++SG KF+G P+PCGV LT+   +  + + +EY+ S+D TI+GSRNG
Sbjct  211  APQINFQKPIDSVAISG-KFIGSPIPCGVVLTKKKWVEKVETMIEYIGSKDTTILGSRNG  269

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            H P+ LWY L  KGY+GF +E + C++NA YL  +L+      MLN+ S+TVVF++P ++
Sbjct  270  HTPLILWYALKTKGYEGFAQEAKTCIQNAQYLFQQLQLREYPCMLNKFSNTVVFQKP-NQ  328

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYE  271
              +++WQLA   N +H++VM ++  +K+D F++EL+    +  E
Sbjct  329  VLIKKWQLATLDNFAHLIVMQNIDRQKIDTFVNELVLQEGILPE  372



>ref|WP_017312078.1| histidine decarboxylase [Fischerella sp. PCC 9339]
Length=391

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 119/177 (67%), Gaps = 6/177 (3%)
 Frame = -2

Query  762  APKVSFKK-PIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            APK+SF+  PIGS+SVSGHKF+G P+  G+ LTR  ++N + ++VEY+ S+D TI+GSR+
Sbjct  213  APKISFRDYPIGSISVSGHKFIGSPITYGIVLTRQPYVNKIETSVEYIGSQDTTILGSRS  272

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            G A + LWY +  + +  FQKEV  CL+NA YL+D+L       +LN+ S+TVVF++P  
Sbjct  273  GIAALLLWYAIQTRSHH-FQKEVASCLQNARYLRDRLLEINYHPLLNDFSTTVVFDKPGI  331

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYE---GGNSKPPCL  244
             E  R+WQLA E N +HVVVM  ++ +K+D F+  L+  + +  E    GN K  C+
Sbjct  332  -ELCRKWQLATEENFAHVVVMQHISTQKIDLFIQNLLVNKEIENEKVLTGNRKTMCV  387



>ref|WP_016859640.1| histidine decarboxylase [Fischerella muscicola]
Length=391

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 121/182 (66%), Gaps = 6/182 (3%)
 Frame = -2

Query  765  QAPKVSFKK-PIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSR  589
            +APK+SF+  PIGS+SVSGHKF+G P+  G+ LTR  ++N + ++VEY+ S+D TI+GSR
Sbjct  212  EAPKISFRDYPIGSISVSGHKFIGSPITYGIVLTRQPYVNKIETSVEYIGSQDTTILGSR  271

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
            +G   + LWY +  +  + FQKEV  CL+NA YL+D+L       +LN+ S+TVVF++P 
Sbjct  272  SGITALLLWYAIQTRS-QHFQKEVASCLQNARYLRDRLLERNYHPLLNDFSTTVVFDKP-  329

Query  408  DEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGG---NSKPPCLAE  238
              E  R+WQLA E+N++H+VVM  ++ +K+D F+  L+  + +  E     N K  C+  
Sbjct  330  GIELCRKWQLATEQNLAHIVVMQHISTQKIDLFIQNLLVNKEIGNEKALTENRKTICVIN  389

Query  237  DV  232
             V
Sbjct  390  SV  391



>ref|WP_016870188.1| histidine decarboxylase [Fischerella muscicola]
Length=380

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 113/158 (72%), Gaps = 3/158 (2%)
 Frame = -2

Query  765  QAPKVSFKK-PIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSR  589
            +APK+SF+  PIGS+SVSGHKF+G P+  G+ LTR  ++  + ++VEY+ S+D TI+GSR
Sbjct  212  EAPKISFRDYPIGSISVSGHKFIGSPITYGIVLTRQPYVKKIETSVEYIGSKDMTILGSR  271

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
            +G A + LWY +  +  + F +EV  CL+NA YL+D+L       +LN+ S+TVVF++P 
Sbjct  272  SGLAALLLWYAIQTRN-QQFHREVATCLQNARYLRDRLLEINYHPLLNDFSTTVVFDKP-  329

Query  408  DEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELI  295
            D E  R+WQLA E N++H+VVM  ++ +K+D F+D L+
Sbjct  330  DIELCRKWQLATEGNLAHIVVMQHISTQKIDQFIDNLL  367



>ref|WP_026721610.1| histidine decarboxylase [Fischerella sp. PCC 9431]
Length=391

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 118/171 (69%), Gaps = 7/171 (4%)
 Frame = -2

Query  765  QAPKVSFKK-PIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSR  589
            +APK+SF++ PIGS+SVSGHKF+G P+  G+ LTR  ++N + +++EY+ S+D TI+GSR
Sbjct  212  KAPKISFQEYPIGSISVSGHKFIGSPITYGIVLTRQPYVNKIETSIEYIGSQDTTILGSR  271

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
            +G A + LWY + R   + FQKEV  CL+NA YL+D+L       +LN+ S TVVF++P 
Sbjct  272  SGIAALLLWYAI-RTRSQHFQKEVASCLQNARYLRDRLLEINYHPLLNDFSITVVFDKPG  330

Query  408  DEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSK  256
              E  R+WQLA E N++HVVVM  ++ +K+D F+  L+  + +    GN K
Sbjct  331  I-ELCRKWQLATEENLAHVVVMQHISSQKIDLFIRNLLVNKEI----GNEK  376



>ref|NP_001176002.1| Os10g0105700 [Oryza sativa Japonica Group]
 dbj|BAH94730.1| Os10g0105700 [Oryza sativa Japonica Group]
Length=219

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -2

Query  768  VQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSR  589
             +APKVSFKKPIGS+SVSGHKF+GCPMPCGV +TRL+H   LS+++EY+ASRD+TI GSR
Sbjct  113  AKAPKVSFKKPIGSISVSGHKFLGCPMPCGVVITRLEHAEVLSTDIEYIASRDSTITGSR  172

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLK  484
            NGHAPIFLWYTL++KGYKG  KEV  C+ NA YL+
Sbjct  173  NGHAPIFLWYTLSKKGYKGLLKEVHICMGNARYLE  207



>ref|WP_012408195.1| histidine decarboxylase [Nostoc punctiforme]
 gb|ACC80176.1| Pyridoxal-dependent decarboxylase [Nostoc punctiforme PCC 73102]
Length=384

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 108/156 (69%), Gaps = 2/156 (1%)
 Frame = -2

Query  762  APKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNG  583
            AP+V+F+KPI SV++S  KF+G P+PCGV LT+   +  + + +EY+ S+D TI+GSRNG
Sbjct  211  APQVNFQKPIDSVAISA-KFIGSPLPCGVVLTKKKWVEKVETEIEYIGSKDTTILGSRNG  269

Query  582  HAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDE  403
            H P+ LWY +  +GY G  KE + C+ NA YL  +L+      MLN  S+TVVF++P  +
Sbjct  270  HTPLILWYAVQTRGYDGLAKEAKTCIHNAQYLFQQLQIREYPCMLNNFSNTVVFQKP-SQ  328

Query  402  EFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELI  295
              +++WQLA   N +H++VM ++  EK+D F++EL+
Sbjct  329  RLIKKWQLAVFENWAHMIVMQNIVREKIDIFINELL  364



>ref|WP_009455225.1| histidine decarboxylase [Fischerella sp. JSC-11]
 gb|EHC17883.1| Histidine decarboxylase [Fischerella sp. JSC-11]
Length=380

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 113/158 (72%), Gaps = 3/158 (2%)
 Frame = -2

Query  765  QAPKVSFKK-PIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSR  589
            +APK+SF+  PIGS+SVSGHKF+G P+  G+ LTR  ++  + ++VEY+ S+D TI+GSR
Sbjct  212  EAPKISFRDYPIGSISVSGHKFIGSPVTYGIVLTRQPYVKKIETSVEYIGSKDMTILGSR  271

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
            +G A +FLWY +  +  + F KEV  CL+NA YL+D+L       +LN+ S+TVVF++P 
Sbjct  272  SGLAALFLWYAIQTRS-QHFHKEVANCLQNARYLRDRLLEINYHPLLNDFSTTVVFDKPA  330

Query  408  DEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELI  295
              E  R+WQLA + N++H+VVM  ++ +K+D F+D L+
Sbjct  331  I-ELCRKWQLATQGNIAHIVVMQHISTQKIDQFIDNLL  367



>ref|WP_040468965.1| histidine decarboxylase, partial [Fischerella thermalis]
Length=165

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 109/154 (71%), Gaps = 3/154 (2%)
 Frame = -2

Query  753  VSFKK-PIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHA  577
            +SF+  PIGS+SVSGHKF+G P+  G+ LTR  ++  + ++VEY+ S+D TI+GSR+G A
Sbjct  1    ISFRDYPIGSISVSGHKFIGSPVTYGIVLTRQPYVKKIETSVEYIGSKDMTILGSRSGLA  60

Query  576  PIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEF  397
             +FLWY +  +  + F KEV  CL+NA YL+D+L       +LN+ S+TVVF++P   E 
Sbjct  61   ALFLWYAIQTRS-QHFHKEVANCLQNARYLRDRLLELDYHPLLNDFSTTVVFDKPA-IEL  118

Query  396  VRRWQLACERNMSHVVVMPSVTVEKLDCFLDELI  295
             R+WQLA + N++H+VVM  ++ +K+D F+D L+
Sbjct  119  CRKWQLATQGNIAHIVVMQHISTQKIDQFIDNLL  152



>ref|XP_005840580.1| hypothetical protein GUITHDRAFT_156940 [Guillardia theta CCMP2712]
 gb|EKX53600.1| hypothetical protein GUITHDRAFT_156940 [Guillardia theta CCMP2712]
Length=338

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 107/154 (69%), Gaps = 1/154 (1%)
 Frame = -2

Query  756  KVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHA  577
             +SFK+ I S+++SGHKF+G P PCGV +T     + + + ++Y+ S D TI+GSRNGHA
Sbjct  180  NLSFKRHINSIAISGHKFLGTPFPCGVFVTEKKFRSLIENRIDYIDSVDDTILGSRNGHA  239

Query  576  PIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEF  397
            P+FL + +  K  KGF+++V +CL  A +L ++++  GI A +N+LS TV+F RP  E  
Sbjct  240  PLFLKHIITVKQNKGFKEDVFRCLYLAQWLVNRMQSLGIDAWMNDLSITVIFPRPA-EIV  298

Query  396  VRRWQLACERNMSHVVVMPSVTVEKLDCFLDELI  295
            V+RWQLA   N+SHVVVMP VT E L+ FL E +
Sbjct  299  VKRWQLASNGNLSHVVVMPHVTQEMLEVFLKEYL  332



>ref|WP_026731780.1| histidine decarboxylase [Fischerella sp. PCC 9605]
Length=364

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 111/161 (69%), Gaps = 3/161 (2%)
 Frame = -2

Query  762  APKVSFKK-PIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRN  586
            APK+SF+  PIGS++VSGHKF+G P+  G+ LTR +++  +   +EYL + D TI GSR 
Sbjct  206  APKISFQDYPIGSIAVSGHKFIGSPIHFGIVLTRREYVQKIGKRIEYLGTDDTTITGSRC  265

Query  585  GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            G   +FLWY +  +G K F +EV  CL NA YL+D+L+  G + +LN+ S TV F++P  
Sbjct  266  GLNALFLWYAIATRGQK-FAREVVTCLENAQYLRDRLQQIGYNPLLNDFSITVAFKKPP-  323

Query  405  EEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  283
             +   +WQLA E N++HVVVM  ++ +K++  +D+L+QA++
Sbjct  324  AKVCDKWQLAIEGNLAHVVVMQHISTQKINELIDDLLQAQA  364



>gb|EYU24758.1| hypothetical protein MIMGU_mgv1a026373mg, partial [Erythranthe 
guttata]
Length=282

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = -2

Query  768  VQAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSR  589
            +  P  SFKKPIGSVSV  HK +G  MPCGV ++R  H    S+N+EY+A+ D TI GS+
Sbjct  162  LSGPLFSFKKPIGSVSVLAHKLLGSSMPCGVLISRKMHPTNFSTNIEYIAALDTTISGSQ  221

Query  588  NGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPK  409
            NGH PIF+WY LN KG  G QKEV  CL NA YL+D L  A  SAMLNE S  VVFERP 
Sbjct  222  NGHTPIFIWYGLNMKGRTGLQKEVSNCLTNAKYLRDGLNKATSSAMLNESSIVVVFERPL  281

Query  408  D  406
            D
Sbjct  282  D  282



>ref|WP_025665600.1| histidine decarboxylase [Aquimarina megaterium]
Length=373

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 100/154 (65%), Gaps = 1/154 (1%)
 Frame = -2

Query  759  PKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGH  580
            P+  F+  I S+S+SGHKF+G PMP GV + + D+ + ++  + Y+ S DATI GSRNGH
Sbjct  214  PQFDFEDGIDSISISGHKFIGSPMPSGVVIVKKDNRDRIARRIAYIGSSDATITGSRNGH  273

Query  579  APIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEE  400
             P+FLWY + + G +GF+K  +  L  A Y ++KL+  GI A  N  + T+VF  P   E
Sbjct  274  TPLFLWYAIKKLGVEGFKKRTEHSLGVASYTENKLKDLGIEAWRNPNAITIVFPAPS-TE  332

Query  399  FVRRWQLACERNMSHVVVMPSVTVEKLDCFLDEL  298
             + +WQLA E   SH++ MP+V+ E++D F+ ++
Sbjct  333  IIDKWQLATENGQSHIICMPNVSYEQIDSFIADI  366



>ref|WP_034238501.1| histidine decarboxylase [Aquimarina sp. 22II-S11-z7]
Length=373

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 100/154 (65%), Gaps = 1/154 (1%)
 Frame = -2

Query  759  PKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGH  580
            P+  F+  I S+S+SGHKF+G PMP GV + + D+ + ++  + Y+ S DATI GSRNGH
Sbjct  214  PQFDFEDGIDSISISGHKFIGSPMPSGVVIVKKDNRDRIARRIAYIGSSDATITGSRNGH  273

Query  579  APIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEE  400
             P+FLWY + + G +GF+K  +  L  A Y ++KL+  GI A  N  + T+VF  P   E
Sbjct  274  TPLFLWYAIKKLGVEGFKKRTEHSLGVASYTENKLKNLGIEAWRNPNAITIVFPAPS-TE  332

Query  399  FVRRWQLACERNMSHVVVMPSVTVEKLDCFLDEL  298
             + +WQLA E   SH++ MP+V+ E++D F+ ++
Sbjct  333  IIDKWQLATENGQSHIICMPNVSYEQIDNFIADI  366



>gb|EZH75803.1| histidine decarboxylase [Aquimarina sp. 22II-S11-z7]
Length=377

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 100/154 (65%), Gaps = 1/154 (1%)
 Frame = -2

Query  759  PKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGH  580
            P+  F+  I S+S+SGHKF+G PMP GV + + D+ + ++  + Y+ S DATI GSRNGH
Sbjct  218  PQFDFEDGIDSISISGHKFIGSPMPSGVVIVKKDNRDRIARRIAYIGSSDATITGSRNGH  277

Query  579  APIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEE  400
             P+FLWY + + G +GF+K  +  L  A Y ++KL+  GI A  N  + T+VF  P   E
Sbjct  278  TPLFLWYAIKKLGVEGFKKRTEHSLGVASYTENKLKNLGIEAWRNPNAITIVFPAPS-TE  336

Query  399  FVRRWQLACERNMSHVVVMPSVTVEKLDCFLDEL  298
             + +WQLA E   SH++ MP+V+ E++D F+ ++
Sbjct  337  IIDKWQLATENGQSHIICMPNVSYEQIDNFIADI  370



>ref|WP_008878268.1| Pyridoxal-dependent decarboxylase [Mesorhizobium metallidurans]
 emb|CCV09416.1| Pyridoxal-dependent decarboxylase [Mesorhizobium metallidurans 
STM 2683]
Length=366

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 99/150 (66%), Gaps = 1/150 (1%)
 Frame = -2

Query  750  SFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPI  571
            SFK  I S+S SGHK +G PMPCG+ + R +H+N ++S++ YL S D T+MGSRNGHA I
Sbjct  198  SFKHEIDSISASGHKMIGTPMPCGILVARRNHVNRIASSISYLRSNDTTLMGSRNGHASI  257

Query  570  FLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVR  391
             +W  +   G  GFQ+E Q CL  A  L  +LR  G+  + N+ S T+VF +P D + V+
Sbjct  258  AIWERIVELGEDGFQRETQACLARATRLAQRLRQMGVPVLQNKHSLTLVFPKPND-DIVK  316

Query  390  RWQLACERNMSHVVVMPSVTVEKLDCFLDE  301
             +QLAC+  ++H +VMP+V  E ++ F+ +
Sbjct  317  MYQLACDGELAHAIVMPNVNDELINRFIHD  346



>ref|WP_035090976.1| histidine decarboxylase [Aquimarina macrocephali]
Length=373

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 99/154 (64%), Gaps = 1/154 (1%)
 Frame = -2

Query  759  PKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGH  580
            P+  F+  I S+S+SGHKF+G PMP GV + + D+ + ++  + Y+ S DATI GSRNGH
Sbjct  214  PQFDFEDGIDSISISGHKFIGSPMPSGVVIVKKDNRDRIARRIAYIGSSDATITGSRNGH  273

Query  579  APIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEE  400
             P+FLWY + + G +GF+K  +  L  A Y + KL+  GI A  N  + T++F  P   +
Sbjct  274  TPLFLWYAIKKLGIEGFKKRTEHSLAVASYTESKLKNLGIEAWRNPNAITIIFPAPS-PK  332

Query  399  FVRRWQLACERNMSHVVVMPSVTVEKLDCFLDEL  298
             + +WQLA E   SH++ MP+V+ E++D F+ ++
Sbjct  333  IINKWQLATENGQSHIICMPNVSYEQIDNFIADM  366



>ref|WP_003516909.1| histidine decarboxylase [Ruminiclostridium thermocellum]
 gb|EEU01894.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
DSM 2360]
 gb|ADU73661.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
DSM 1313]
 gb|EIC03488.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
YS]
 gb|EIC11668.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
AD2]
Length=398

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 108/163 (66%), Gaps = 4/163 (2%)
 Frame = -2

Query  765  QAPKVSFKK-PIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL--SSNVEYLASRDATIMG  595
              P+++F+  PI S+++SGHKFVGCPMP G+ LTR  +I  +  +S+V Y+ ++D TI G
Sbjct  233  NGPELNFETLPIDSIAISGHKFVGCPMPAGIFLTRKKYIQKILENSDVSYVGTKDTTISG  292

Query  594  SRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFER  415
             RNG + + LWY +NRKG +GF+++V++C+    Y K +L   G +  +N  S+T+V ++
Sbjct  293  CRNGLSALLLWYQINRKGVEGFKQDVRQCMEVTAYAKARLDSIGWNNFVNPWSNTIVIDK  352

Query  414  PKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  286
            P D      W LACE + +H+++M  VT E +D F++ L+ ++
Sbjct  353  PND-AICNYWSLACEGDKAHIIIMQHVTKEHIDLFIEHLLNSK  394



>ref|WP_023062889.1| histidine decarboxylase [Ruminiclostridium thermocellum]
 emb|CDG37515.1| histidine decarboxylase [Ruminiclostridium thermocellum BC1]
Length=398

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 108/163 (66%), Gaps = 4/163 (2%)
 Frame = -2

Query  765  QAPKVSFKK-PIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL--SSNVEYLASRDATIMG  595
              P+++F+  PI S+++SGHKFVGCPMP G+ LTR  +I  +  +S+V Y+ ++D TI G
Sbjct  233  NGPELNFETLPIDSIAISGHKFVGCPMPAGIFLTRKKYIQKILENSDVSYVGTKDTTISG  292

Query  594  SRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFER  415
             RNG + + LWY +NRKG +GF+++V++C+    Y K +L   G +  +N  S+T+V ++
Sbjct  293  CRNGLSALLLWYQINRKGVEGFKQDVRQCMEVTAYAKARLDSIGWNNFVNPWSNTIVIDK  352

Query  414  PKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  286
            P D      W LACE + +H+++M  VT E +D F++ L+ ++
Sbjct  353  PND-AICNYWSLACEGDKAHIIIMQHVTKEHIDLFIEHLLNSK  394



>ref|WP_020457998.1| histidine decarboxylase [Ruminiclostridium thermocellum]
 gb|ABN54224.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
ATCC 27405]
Length=398

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 108/163 (66%), Gaps = 4/163 (2%)
 Frame = -2

Query  765  QAPKVSFKK-PIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL--SSNVEYLASRDATIMG  595
              P+++F+  PI S+++SGHKFVGCPMP G+ LTR  +I  +  +S+V Y+ ++D TI G
Sbjct  233  NGPELNFETLPIDSIAISGHKFVGCPMPAGIFLTRKKYIQKILENSDVSYVGTKDTTISG  292

Query  594  SRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFER  415
             RNG + + LWY +NRKG +GF+++V++C+    Y K +L   G +  +N  S+T+V ++
Sbjct  293  CRNGLSALLLWYQINRKGVEGFKQDVRQCMEVTAYAKARLDSIGWNNFVNPWSNTIVIDK  352

Query  414  PKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  286
            P D      W LACE + +H+++M  VT E +D F++ L+ ++
Sbjct  353  PND-AICNYWSLACEGDKAHIIIMQHVTKEHIDLFIEHLLNSK  394



>ref|WP_003514849.1| histidine decarboxylase [Ruminiclostridium thermocellum]
 gb|EFB37130.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
JW20]
Length=398

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 108/163 (66%), Gaps = 4/163 (2%)
 Frame = -2

Query  765  QAPKVSFKK-PIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL--SSNVEYLASRDATIMG  595
              P+++F+  PI S+++SGHKFVGCPMP G+ LTR  +I  +  +S+V Y+ ++D TI G
Sbjct  233  NGPELNFETLPIDSIAISGHKFVGCPMPAGIFLTRKKYIQKILENSDVSYVGTKDTTISG  292

Query  594  SRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFER  415
             RNG + + LWY +NRKG +GF+++V++C+    Y K +L   G +  +N  S+T+V ++
Sbjct  293  CRNGLSALLLWYQINRKGVEGFKQDVRQCMEVTAYAKARLDSIGWNNFVNPWSNTIVIDK  352

Query  414  PKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  286
            P D      W LACE + +H+++M  VT E +D F++ L+ ++
Sbjct  353  PND-AICNYWSLACEGDKAHIIIMQHVTKEHIDLFIEHLLNSK  394



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1620118203410