BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF043C07

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP02232.1|  unnamed protein product                              99.4    3e-21   Coffea canephora [robusta coffee]
ref|XP_004148695.1|  PREDICTED: transcription factor HB29-like        98.6    5e-21   
ref|XP_004168480.1|  PREDICTED: transcription factor HB29-like        98.2    7e-21   
gb|ABY61030.1|  zinc finger-homeodomain protein 1                     98.2    7e-21   Cucumis sativus [cucumbers]
gb|KJB75739.1|  hypothetical protein B456_012G054300                  97.8    1e-20   Gossypium raimondii
ref|XP_008467057.1|  PREDICTED: zinc-finger homeodomain protein 1...  96.3    3e-20   Cucumis melo [Oriental melon]
ref|XP_002283533.1|  PREDICTED: zinc-finger homeodomain protein 9     96.3    3e-20   Vitis vinifera
ref|XP_010655937.1|  PREDICTED: zinc-finger homeodomain protein 1...  94.7    3e-20   Vitis vinifera
emb|CBI22215.3|  unnamed protein product                              95.5    4e-20   Vitis vinifera
gb|KJB33553.1|  hypothetical protein B456_006G017200                  95.9    5e-20   Gossypium raimondii
ref|XP_009620291.1|  PREDICTED: zinc-finger homeodomain protein 9...  95.5    8e-20   Nicotiana tomentosiformis
ref|XP_003543789.1|  PREDICTED: transcription factor HB29-like        93.6    3e-19   Glycine max [soybeans]
ref|XP_004304301.1|  PREDICTED: zinc-finger homeodomain protein 9     93.6    4e-19   Fragaria vesca subsp. vesca
ref|XP_011085755.1|  PREDICTED: zinc-finger homeodomain protein 9     93.2    5e-19   Sesamum indicum [beniseed]
ref|XP_009787877.1|  PREDICTED: zinc-finger homeodomain protein 9...  93.2    5e-19   Nicotiana sylvestris
ref|XP_008443414.1|  PREDICTED: zinc-finger homeodomain protein 9...  92.4    6e-19   Cucumis melo [Oriental melon]
ref|XP_004147471.1|  PREDICTED: transcription factor HB29-like        92.4    8e-19   Cucumis sativus [cucumbers]
ref|XP_006363398.1|  PREDICTED: transcription factor HB29-like        92.0    1e-18   Solanum tuberosum [potatoes]
emb|CBI29005.3|  unnamed protein product                              94.0    1e-18   Vitis vinifera
ref|XP_004233363.1|  PREDICTED: zinc-finger homeodomain protein 9...  91.7    2e-18   
gb|KHN13618.1|  ZF-HD homeobox protein                                89.4    2e-18   Glycine soja [wild soybean]
ref|XP_009376317.1|  PREDICTED: zinc-finger homeodomain protein 9     91.3    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_008379353.1|  PREDICTED: zinc-finger homeodomain protein 9...  91.3    2e-18   Malus domestica [apple tree]
ref|XP_009621030.1|  PREDICTED: zinc-finger homeodomain protein 9...  91.3    2e-18   Nicotiana tomentosiformis
ref|XP_011098625.1|  PREDICTED: zinc-finger homeodomain protein 9...  91.3    2e-18   Sesamum indicum [beniseed]
ref|XP_008230766.1|  PREDICTED: zinc-finger homeodomain protein 9...  91.3    2e-18   Prunus mume [ume]
ref|XP_007032534.1|  Homeobox protein 34, putative                    90.9    3e-18   
ref|XP_008341574.1|  PREDICTED: zinc-finger homeodomain protein 1...  90.5    3e-18   
ref|XP_002324056.2|  hypothetical protein POPTR_0017s11920g           90.9    3e-18   
ref|XP_006602909.1|  PREDICTED: transcription factor HB29-like        90.5    4e-18   Glycine max [soybeans]
ref|XP_002534012.1|  conserved hypothetical protein                   90.5    4e-18   Ricinus communis
ref|XP_011010066.1|  PREDICTED: zinc-finger homeodomain protein 9...  90.1    5e-18   Populus euphratica
ref|XP_010088163.1|  hypothetical protein L484_013608                 88.6    5e-18   
ref|XP_010552878.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  89.7    6e-18   Tarenaya hassleriana [spider flower]
ref|XP_010693250.1|  PREDICTED: zinc-finger homeodomain protein 9...  90.5    7e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007151228.1|  hypothetical protein PHAVU_004G028600g           89.7    8e-18   Phaseolus vulgaris [French bean]
ref|XP_007139577.1|  hypothetical protein PHAVU_008G041300g           89.4    1e-17   Phaseolus vulgaris [French bean]
ref|XP_006357111.1|  PREDICTED: transcription factor HB29-like        89.4    1e-17   Solanum tuberosum [potatoes]
ref|XP_003621193.1|  ZF-HD homeobox protein                           89.0    1e-17   Medicago truncatula
ref|XP_006357697.1|  PREDICTED: transcription factor HB29-like        88.6    2e-17   Solanum tuberosum [potatoes]
emb|CDX85230.1|  BnaC07g25410D                                        88.2    3e-17   
gb|KDP27147.1|  hypothetical protein JCGZ_19846                       85.5    3e-17   Jatropha curcas
ref|XP_006482594.1|  PREDICTED: myb-like protein I-like               88.2    3e-17   Citrus sinensis [apfelsine]
ref|XP_006395326.1|  hypothetical protein EUTSA_v10004599mg           87.8    3e-17   Eutrema salsugineum [saltwater cress]
ref|XP_009341023.1|  PREDICTED: zinc-finger homeodomain protein 9     87.4    4e-17   
ref|XP_010258352.1|  PREDICTED: zinc-finger homeodomain protein 9...  87.0    4e-17   Nelumbo nucifera [Indian lotus]
ref|XP_006431147.1|  hypothetical protein CICLE_v10011968mg           87.8    5e-17   Citrus clementina [clementine]
ref|XP_010257380.1|  PREDICTED: zinc-finger homeodomain protein 9     87.0    5e-17   Nelumbo nucifera [Indian lotus]
gb|EPS58358.1|  hypothetical protein M569_16456                       85.5    8e-17   Genlisea aurea
emb|CDX86403.1|  BnaA06g31200D                                        86.7    8e-17   
gb|KHN11605.1|  ZF-HD homeobox protein                                83.2    9e-17   Glycine soja [wild soybean]
ref|XP_003618493.1|  Zinc finger-homeodomain protein                  85.5    9e-17   
ref|XP_004491795.1|  PREDICTED: transcription factor HB29-like        86.3    1e-16   Cicer arietinum [garbanzo]
ref|XP_008388052.1|  PREDICTED: zinc-finger homeodomain protein 2     86.7    1e-16   
gb|ADK63413.1|  homeobox domain zinc finger protein                   83.2    1e-16   Brassica rapa
dbj|BAE99230.1|  hypothetical protein                                 85.9    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568570.1|  homeobox protein 23                                 85.9    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004489395.1|  PREDICTED: transcription factor HB29-like        85.9    1e-16   Cicer arietinum [garbanzo]
gb|AAP44422.1|  ZF-HD homeobox protein-like protein                   83.2    2e-16   Lactuca sativa [cultivated lettuce]
ref|XP_009797863.1|  PREDICTED: zinc-finger homeodomain protein 9...  85.9    2e-16   Nicotiana sylvestris
gb|AES74711.2|  transcription factor HB29-like protein                85.5    2e-16   Medicago truncatula
ref|XP_010936702.1|  PREDICTED: zinc-finger homeodomain protein 6...  85.5    2e-16   Elaeis guineensis
ref|XP_002870762.1|  hypothetical protein ARALYDRAFT_494014           85.5    2e-16   
gb|AAM64462.1|  unknown                                               85.5    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|EPS70696.1|  hypothetical protein M569_04063                       84.7    2e-16   Genlisea aurea
gb|ABK22835.1|  unknown                                               84.7    2e-16   Picea sitchensis
gb|AAO62943.1|  ZF-HD homeobox protein-like protein                   82.4    2e-16   Lactuca sativa [cultivated lettuce]
ref|XP_003517792.1|  PREDICTED: transcription factor HB29-like        85.1    3e-16   Glycine max [soybeans]
ref|XP_006405598.1|  hypothetical protein EUTSA_v10028098mg           85.1    3e-16   Eutrema salsugineum [saltwater cress]
ref|XP_009151829.1|  PREDICTED: zinc-finger homeodomain protein 9     85.5    3e-16   Brassica rapa
ref|XP_011097503.1|  PREDICTED: zinc-finger homeodomain protein 2...  84.7    3e-16   
ref|XP_008220815.1|  PREDICTED: zinc-finger homeodomain protein 5...  85.5    3e-16   Prunus mume [ume]
ref|XP_008220812.1|  PREDICTED: zinc-finger homeodomain protein 5...  85.5    3e-16   Prunus mume [ume]
ref|XP_004233362.1|  PREDICTED: zinc-finger homeodomain protein 9     85.1    3e-16   Solanum lycopersicum
ref|NP_189534.1|  homeobox protein 34                                 84.7    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111615.1|  PREDICTED: zinc-finger homeodomain protein 9...  84.7    3e-16   Brassica rapa
ref|XP_002877141.1|  hypothetical protein ARALYDRAFT_484662           84.3    4e-16   
gb|KHN05023.1|  ZF-HD homeobox protein                                83.2    4e-16   Glycine soja [wild soybean]
ref|XP_003555538.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  83.2    4e-16   Glycine max [soybeans]
gb|EPS61017.1|  hypothetical protein M569_13783                       84.0    4e-16   Genlisea aurea
emb|CDY20008.1|  BnaA09g02430D                                        84.0    4e-16   Brassica napus [oilseed rape]
gb|KHN01227.1|  ZF-HD homeobox protein                                81.3    4e-16   Glycine soja [wild soybean]
ref|XP_006373320.1|  hypothetical protein POPTR_0017s11920g           84.0    5e-16   
ref|XP_002305381.2|  hypothetical protein POPTR_0004s12500g           84.3    5e-16   
ref|XP_010682105.1|  PREDICTED: zinc-finger homeodomain protein 3...  84.3    6e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003576623.1|  PREDICTED: zinc-finger homeodomain protein 1     84.0    6e-16   Brachypodium distachyon [annual false brome]
ref|XP_010425683.1|  PREDICTED: zinc-finger homeodomain protein 9...  84.0    7e-16   Camelina sativa [gold-of-pleasure]
emb|CDY00104.1|  BnaC09g01970D                                        84.0    7e-16   
ref|XP_011100018.1|  PREDICTED: zinc-finger homeodomain protein 1...  82.8    7e-16   Sesamum indicum [beniseed]
ref|XP_008782488.1|  PREDICTED: zinc-finger homeodomain protein 6...  83.2    7e-16   Phoenix dactylifera
ref|XP_009336904.1|  PREDICTED: zinc-finger homeodomain protein 2...  84.0    8e-16   Pyrus x bretschneideri [bai li]
ref|XP_008795929.1|  PREDICTED: zinc-finger homeodomain protein 6...  83.2    8e-16   
gb|AAP44426.1|  ZF-HD homeobox protein-like protein                   80.9    9e-16   Lactuca saligna
ref|XP_009364948.1|  PREDICTED: zinc-finger homeodomain protein 2...  83.6    1e-15   Pyrus x bretschneideri [bai li]
ref|XP_010502894.1|  PREDICTED: zinc-finger homeodomain protein 9     83.2    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006285795.1|  hypothetical protein CARUB_v10007269mg           83.6    1e-15   Capsella rubella
ref|XP_010514609.1|  PREDICTED: zinc-finger homeodomain protein 9...  83.2    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002460367.1|  hypothetical protein SORBIDRAFT_02g027040        82.8    1e-15   Sorghum bicolor [broomcorn]
ref|XP_007154109.1|  hypothetical protein PHAVU_003G091100g           82.4    1e-15   Phaseolus vulgaris [French bean]
gb|EYU34567.1|  hypothetical protein MIMGU_mgv1a012253mg              82.4    1e-15   Erythranthe guttata [common monkey flower]
emb|CAN60614.1|  hypothetical protein VITISV_003253                   80.9    2e-15   Vitis vinifera
ref|XP_008357201.1|  PREDICTED: zinc-finger homeodomain protein 5...  83.2    2e-15   
gb|ADK63402.1|  homeobox domain zinc finger protein                   80.9    2e-15   Brassica rapa
ref|XP_002273802.1|  PREDICTED: zinc-finger homeodomain protein 11    82.8    2e-15   Vitis vinifera
ref|XP_006470838.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  82.4    2e-15   Citrus sinensis [apfelsine]
gb|KDO42061.1|  hypothetical protein CISIN_1g048741mg                 82.4    2e-15   Citrus sinensis [apfelsine]
sp|A2Z259.1|ZHD1_ORYSI  RecName: Full=Zinc-finger homeodomain pro...  82.0    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_006431432.1|  hypothetical protein CICLE_v10003702mg           82.4    2e-15   Citrus clementina [clementine]
ref|XP_011070997.1|  PREDICTED: zinc-finger homeodomain protein 10    82.4    2e-15   Sesamum indicum [beniseed]
ref|XP_006660717.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  82.0    2e-15   Oryza brachyantha
ref|NP_001063419.1|  Os09g0466400                                     82.0    2e-15   
ref|XP_008788352.1|  PREDICTED: zinc-finger homeodomain protein 4...  82.0    2e-15   
gb|KJB18247.1|  hypothetical protein B456_003G042700                  82.0    2e-15   Gossypium raimondii
ref|XP_004156724.1|  PREDICTED: LOW QUALITY PROTEIN: ZF-HD homeob...  82.0    2e-15   
ref|XP_004142854.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  82.0    2e-15   Cucumis sativus [cucumbers]
ref|XP_004230410.1|  PREDICTED: zinc-finger homeodomain protein 4     82.0    2e-15   Solanum lycopersicum
ref|XP_006878601.1|  hypothetical protein AMTR_s00011p00255340        81.6    2e-15   
emb|CAC34413.1|  ZF-HD homeobox protein                               81.6    2e-15   Flaveria trinervia
ref|XP_009800645.1|  PREDICTED: putative F-box/LRR-repeat protein...  83.6    3e-15   Nicotiana sylvestris
ref|XP_006859182.1|  hypothetical protein AMTR_s00070p00154800        81.3    3e-15   Amborella trichopoda
ref|XP_009613099.1|  PREDICTED: zinc-finger homeodomain protein 4     81.6    3e-15   Nicotiana tomentosiformis
ref|XP_010940074.1|  PREDICTED: zinc-finger homeodomain protein 6...  81.6    3e-15   Elaeis guineensis
ref|XP_010554331.1|  PREDICTED: zinc-finger homeodomain protein 4     82.0    3e-15   
ref|XP_004957068.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  81.6    3e-15   Setaria italica
gb|EYU22417.1|  hypothetical protein MIMGU_mgv1a026791mg              79.0    3e-15   Erythranthe guttata [common monkey flower]
ref|XP_009139922.1|  PREDICTED: zinc-finger homeodomain protein 10    81.6    3e-15   Brassica rapa
ref|XP_004165400.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  82.0    3e-15   
ref|XP_008444722.1|  PREDICTED: zinc-finger homeodomain protein 2     81.6    3e-15   Cucumis melo [Oriental melon]
ref|XP_010450775.1|  PREDICTED: zinc-finger homeodomain protein 1...  82.0    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_004152776.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  81.3    4e-15   
ref|XP_006291497.1|  hypothetical protein CARUB_v10017644mg           81.6    4e-15   Capsella rubella
ref|XP_010441087.1|  PREDICTED: zinc-finger homeodomain protein 10    82.0    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_007157626.1|  hypothetical protein PHAVU_002G085400g           81.3    4e-15   Phaseolus vulgaris [French bean]
ref|XP_003551238.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  80.9    4e-15   Glycine max [soybeans]
gb|EEE69868.1|  hypothetical protein OsJ_29679                        80.9    5e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009396485.1|  PREDICTED: zinc-finger homeodomain protein 6...  82.4    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT05330.1|  ZF-HD homeobox protein                                77.8    5e-15   
emb|CBI27705.3|  unnamed protein product                              79.0    5e-15   Vitis vinifera
emb|CAC34408.1|  ZF-HD homeobox protein                               80.5    5e-15   Flaveria bidentis
ref|XP_004293203.2|  PREDICTED: zinc-finger homeodomain protein 6     81.6    5e-15   Fragaria vesca subsp. vesca
gb|EPS61775.1|  hypothetical protein M569_13018                       80.9    6e-15   Genlisea aurea
ref|XP_011010943.1|  PREDICTED: zinc-finger homeodomain protein 9...  81.3    6e-15   Populus euphratica
ref|XP_003633412.1|  PREDICTED: zinc-finger homeodomain protein 4     80.9    6e-15   Vitis vinifera
ref|XP_008219382.1|  PREDICTED: zinc-finger homeodomain protein 2     80.9    6e-15   Prunus mume [ume]
ref|XP_011012906.1|  PREDICTED: zinc-finger homeodomain protein 4...  80.9    6e-15   Populus euphratica
ref|XP_007222197.1|  hypothetical protein PRUPE_ppa009679mg           80.9    6e-15   Prunus persica
ref|XP_003520078.1|  PREDICTED: transcription factor HB29-like        80.9    7e-15   Glycine max [soybeans]
ref|XP_009365549.1|  PREDICTED: zinc-finger homeodomain protein 2...  81.3    7e-15   Pyrus x bretschneideri [bai li]
ref|XP_008460585.1|  PREDICTED: zinc-finger homeodomain protein 4     80.9    7e-15   Cucumis melo [Oriental melon]
ref|XP_007215708.1|  hypothetical protein PRUPE_ppa008908mg           80.9    7e-15   
ref|XP_007156483.1|  hypothetical protein PHAVU_003G289700g           80.1    8e-15   Phaseolus vulgaris [French bean]
gb|KDO82923.1|  hypothetical protein CISIN_1g046396mg                 80.9    8e-15   Citrus sinensis [apfelsine]
ref|XP_006438687.1|  hypothetical protein CICLE_v10032160mg           80.9    8e-15   Citrus clementina [clementine]
ref|XP_004238801.1|  PREDICTED: zinc-finger homeodomain protein 1...  80.5    8e-15   Solanum lycopersicum
gb|KHN07994.1|  ZF-HD homeobox protein                                79.7    9e-15   Glycine soja [wild soybean]
ref|XP_003550152.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  80.5    9e-15   Glycine max [soybeans]
ref|XP_002525870.1|  transcription factor, putative                   80.5    9e-15   
emb|CDO97666.1|  unnamed protein product                              80.5    9e-15   Coffea canephora [robusta coffee]
gb|KHN07993.1|  ZF-HD homeobox protein                                79.7    9e-15   Glycine soja [wild soybean]
gb|ABY61020.1|  zinc finger-homeodomain protein 1                     80.1    1e-14   Eschscholzia californica
ref|XP_010527865.1|  PREDICTED: zinc-finger homeodomain protein 4     80.5    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_009762783.1|  PREDICTED: zinc-finger homeodomain protein 4...  80.5    1e-14   Nicotiana sylvestris
ref|XP_004495441.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  79.3    1e-14   Cicer arietinum [garbanzo]
ref|XP_011028421.1|  PREDICTED: zinc-finger homeodomain protein 4     80.1    1e-14   Populus euphratica
gb|KHN07995.1|  ZF-HD homeobox protein                                79.7    1e-14   Glycine soja [wild soybean]
ref|XP_004499360.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  80.5    1e-14   Cicer arietinum [garbanzo]
ref|XP_003529692.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  80.1    1e-14   
gb|KHN07843.1|  ZF-HD homeobox protein                                78.6    1e-14   Glycine soja [wild soybean]
ref|XP_010527155.1|  PREDICTED: zinc-finger homeodomain protein 1     79.0    1e-14   Tarenaya hassleriana [spider flower]
ref|NP_001062055.1|  Os08g0479400                                     80.1    1e-14   
gb|KHN03576.1|  ZF-HD homeobox protein                                80.1    1e-14   Glycine soja [wild soybean]
ref|XP_003530620.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  79.7    1e-14   
ref|XP_006385095.1|  hypothetical protein POPTR_0004s23860g           80.1    1e-14   
gb|KHN40205.1|  ZF-HD homeobox protein                                79.0    1e-14   Glycine soja [wild soybean]
ref|XP_010681042.1|  PREDICTED: zinc-finger homeodomain protein 1...  79.7    1e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB64195.1|  hypothetical protein B456_010G036300                  79.3    1e-14   Gossypium raimondii
ref|XP_010939727.1|  PREDICTED: zinc-finger homeodomain protein 2     79.7    2e-14   Elaeis guineensis
ref|XP_008378554.1|  PREDICTED: zinc-finger homeodomain protein 2...  79.7    2e-14   
gb|AAT39967.1|  Putative ZF-HD homeobox protein, identical            79.7    2e-14   Solanum demissum
ref|XP_007048627.1|  Homeobox protein 21, putative                    79.3    2e-14   
gb|EEE68874.1|  hypothetical protein OsJ_27685                        79.3    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006349273.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  79.7    2e-14   Solanum tuberosum [potatoes]
emb|CAC34410.1|  ZF-HD homeobox protein                               79.3    2e-14   Flaveria bidentis
ref|XP_006366102.1|  PREDICTED: transcription factor HB29-like        79.3    2e-14   Solanum tuberosum [potatoes]
ref|XP_011003997.1|  PREDICTED: zinc-finger homeodomain protein 2...  79.3    2e-14   Populus euphratica
ref|XP_006660219.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  79.3    2e-14   
emb|CDP01539.1|  unnamed protein product                              79.3    2e-14   Coffea canephora [robusta coffee]
gb|KJB30399.1|  hypothetical protein B456_005G141400                  79.3    2e-14   Gossypium raimondii
ref|XP_008810728.1|  PREDICTED: zinc-finger homeodomain protein 6...  80.1    2e-14   Phoenix dactylifera
ref|NP_001149424.1|  LOC100283050                                     79.7    2e-14   
ref|XP_010099792.1|  hypothetical protein L484_010980                 80.1    2e-14   Morus notabilis
ref|XP_007046103.1|  Homeobox protein 34, putative                    79.7    2e-14   
ref|XP_010060081.1|  PREDICTED: zinc-finger homeodomain protein 2...  79.7    2e-14   Eucalyptus grandis [rose gum]
gb|KJB80187.1|  hypothetical protein B456_013G085500                  79.3    2e-14   Gossypium raimondii
gb|KJB58948.1|  hypothetical protein B456_009G231800                  79.0    2e-14   Gossypium raimondii
gb|ABO92969.1|  ZF-HD homeobox domain-containing protein              79.0    2e-14   Solanum tuberosum [potatoes]
ref|XP_011087615.1|  PREDICTED: zinc-finger homeodomain protein 4     79.0    2e-14   Sesamum indicum [beniseed]
gb|KJB70777.1|  hypothetical protein B456_011G090900                  79.3    2e-14   Gossypium raimondii
ref|XP_001777987.1|  predicted protein                                77.8    2e-14   
ref|XP_008789175.1|  PREDICTED: zinc-finger homeodomain protein 4...  79.0    2e-14   Phoenix dactylifera
ref|XP_009609489.1|  PREDICTED: putative FBD-associated F-box pro...  79.0    3e-14   
tpg|DAA48505.1|  TPA: putative homeobox DNA-binding domain superf...  79.3    3e-14   
emb|CDP11470.1|  unnamed protein product                              79.0    3e-14   Coffea canephora [robusta coffee]
ref|XP_002267747.1|  PREDICTED: zinc-finger homeodomain protein 3     78.6    3e-14   Vitis vinifera
gb|ABY61023.1|  zinc finger homeodomain protein 1                     78.6    3e-14   Saruma henryi
gb|KJB48886.1|  hypothetical protein B456_008G092000                  78.6    3e-14   Gossypium raimondii
ref|XP_009395689.1|  PREDICTED: zinc-finger homeodomain protein 5...  79.7    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004973708.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  79.0    3e-14   Setaria italica
ref|XP_006827241.1|  hypothetical protein AMTR_s00010p00261450        78.2    3e-14   Amborella trichopoda
ref|XP_004489767.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  78.6    3e-14   Cicer arietinum [garbanzo]
ref|XP_006394037.1|  hypothetical protein EUTSA_v10005568mg           78.6    3e-14   Eutrema salsugineum [saltwater cress]
emb|CDY34299.1|  BnaA01g14020D                                        78.2    3e-14   Brassica napus [oilseed rape]
ref|NP_001151888.1|  ZF-HD protein dimerisation region containing...  78.6    3e-14   Zea mays [maize]
gb|ABY61018.1|  zinc finger-homeodomain protein 1                     79.0    3e-14   Welwitschia mirabilis
ref|XP_009607017.1|  PREDICTED: zinc-finger homeodomain protein 4...  78.6    3e-14   Nicotiana tomentosiformis
emb|CDY33960.1|  BnaC02g43770D                                        78.6    3e-14   Brassica napus [oilseed rape]
ref|XP_009381483.1|  PREDICTED: zinc-finger homeodomain protein 2...  78.6    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADE77597.1|  unknown                                               78.2    4e-14   Picea sitchensis
ref|XP_004288462.1|  PREDICTED: zinc-finger homeodomain protein 1...  78.6    4e-14   Fragaria vesca subsp. vesca
ref|XP_009138327.1|  PREDICTED: zinc-finger homeodomain protein 2     78.2    4e-14   Brassica rapa
ref|XP_010086552.1|  hypothetical protein L484_001444                 79.7    4e-14   
ref|XP_006433874.1|  hypothetical protein CICLE_v10002355mg           78.2    4e-14   Citrus clementina [clementine]
ref|XP_009602563.1|  PREDICTED: zinc-finger homeodomain protein 2...  78.2    4e-14   Nicotiana tomentosiformis
ref|XP_010254805.1|  PREDICTED: zinc-finger homeodomain protein 5...  79.3    4e-14   Nelumbo nucifera [Indian lotus]
ref|XP_009130511.1|  PREDICTED: zinc-finger homeodomain protein 1...  78.2    4e-14   Brassica rapa
ref|XP_009788413.1|  PREDICTED: zinc-finger homeodomain protein 9...  77.8    4e-14   Nicotiana sylvestris
gb|ABY61024.1|  zinc finger-homeodomain protein 2                     78.2    4e-14   Saruma henryi
ref|XP_010252306.1|  PREDICTED: zinc-finger homeodomain protein 4     78.2    4e-14   Nelumbo nucifera [Indian lotus]
ref|XP_009406459.1|  PREDICTED: zinc-finger homeodomain protein 4...  78.2    4e-14   
gb|KDP29745.1|  hypothetical protein JCGZ_18680                       78.2    4e-14   Jatropha curcas
ref|XP_009758154.1|  PREDICTED: zinc-finger homeodomain protein 2...  78.2    4e-14   Nicotiana sylvestris
ref|XP_007023152.1|  Homeobox protein 31                              78.6    4e-14   
ref|XP_010065227.1|  PREDICTED: zinc-finger homeodomain protein 4...  79.0    4e-14   Eucalyptus grandis [rose gum]
ref|XP_010246039.1|  PREDICTED: zinc-finger homeodomain protein 1...  78.6    5e-14   
ref|XP_006376247.1|  hypothetical protein POPTR_0013s11330g           78.2    5e-14   
ref|XP_009403385.1|  PREDICTED: zinc-finger homeodomain protein 4...  78.2    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY03431.1|  BnaC01g16510D                                        77.8    5e-14   
ref|XP_003518249.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  78.2    5e-14   Glycine max [soybeans]
ref|XP_006836924.1|  hypothetical protein AMTR_s00099p00145100        78.2    5e-14   
ref|XP_010927875.1|  PREDICTED: zinc-finger homeodomain protein 4...  77.8    5e-14   Elaeis guineensis
ref|XP_004299701.1|  PREDICTED: zinc-finger homeodomain protein 2...  77.8    5e-14   Fragaria vesca subsp. vesca
ref|XP_010104483.1|  hypothetical protein L484_025452                 78.2    5e-14   Morus notabilis
gb|KEH32742.1|  homeobox domain, ZF-HD class protein                  79.0    5e-14   Medicago truncatula
ref|XP_006426297.1|  hypothetical protein CICLE_v10027024mg           77.8    5e-14   Citrus clementina [clementine]
ref|XP_009416998.1|  PREDICTED: zinc-finger homeodomain protein 4...  77.8    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002514009.1|  transcription factor, putative                   77.8    6e-14   Ricinus communis
ref|XP_010908151.1|  PREDICTED: zinc-finger homeodomain protein 4...  77.8    6e-14   Elaeis guineensis
ref|XP_002325543.2|  hypothetical protein POPTR_0019s11070g           77.8    6e-14   
gb|KJB75536.1|  hypothetical protein B456_012G046200                  77.0    6e-14   Gossypium raimondii
ref|XP_006376248.1|  hypothetical protein POPTR_0013s11330g           77.8    6e-14   Populus trichocarpa [western balsam poplar]
ref|XP_008670258.1|  PREDICTED: zinc-finger homeodomain protein 1...  77.8    6e-14   
ref|XP_011001095.1|  PREDICTED: zinc-finger homeodomain protein 2...  77.8    6e-14   Populus euphratica
ref|XP_006663328.1|  PREDICTED: uncharacterized protein LOC102703731  79.0    6e-14   
ref|XP_003519839.2|  PREDICTED: ZF-HD homeobox protein At4g24660-...  77.8    6e-14   Glycine max [soybeans]
gb|AES96050.2|  homeobox domain, ZF-HD class protein                  77.8    6e-14   Medicago truncatula
ref|XP_006473167.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  77.0    7e-14   Citrus sinensis [apfelsine]
ref|XP_001785616.1|  predicted protein                                78.2    7e-14   
ref|XP_008338536.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  77.8    7e-14   
gb|KDO36261.1|  hypothetical protein CISIN_1g048824mg                 77.0    7e-14   Citrus sinensis [apfelsine]
ref|XP_006434579.1|  hypothetical protein CICLE_v10004050mg           77.0    7e-14   Citrus clementina [clementine]
ref|XP_002867654.1|  ATHB22/MEE68                                     77.0    7e-14   
ref|XP_007224511.1|  hypothetical protein PRUPE_ppa023369mg           77.8    8e-14   
ref|XP_002445649.1|  hypothetical protein SORBIDRAFT_07g023360        77.8    8e-14   Sorghum bicolor [broomcorn]
ref|XP_010925945.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  78.2    8e-14   Elaeis guineensis
ref|XP_009410127.1|  PREDICTED: zinc-finger homeodomain protein 2...  77.4    8e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002965557.1|  hypothetical protein SELMODRAFT_68508            76.6    8e-14   
gb|KHG22175.1|  hypothetical protein F383_07505                       77.4    8e-14   Gossypium arboreum [tree cotton]
gb|KDP40895.1|  hypothetical protein JCGZ_24894                       77.4    8e-14   Jatropha curcas
ref|XP_009593275.1|  PREDICTED: zinc-finger homeodomain protein 1...  77.0    8e-14   Nicotiana tomentosiformis
gb|EYU35040.1|  hypothetical protein MIMGU_mgv1a014453mg              76.6    9e-14   Erythranthe guttata [common monkey flower]
gb|KJB18248.1|  hypothetical protein B456_003G042700                  77.0    9e-14   Gossypium raimondii
ref|XP_007143929.1|  hypothetical protein PHAVU_007G114300g           76.6    9e-14   Phaseolus vulgaris [French bean]
ref|XP_009407034.1|  PREDICTED: zinc-finger homeodomain protein 2...  77.4    9e-14   
ref|XP_007158386.1|  hypothetical protein PHAVU_002G148900g           77.0    9e-14   Phaseolus vulgaris [French bean]
ref|XP_009403170.1|  PREDICTED: zinc-finger homeodomain protein 9...  77.8    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEW07466.1|  hypothetical protein 0_2239_01                        73.2    1e-13   Pinus radiata
ref|XP_003622365.1|  Zinc finger-homeodomain protein                  76.3    1e-13   
ref|XP_010484369.1|  PREDICTED: zinc-finger homeodomain protein 1...  77.4    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_009788342.1|  PREDICTED: zinc-finger homeodomain protein 9...  77.0    1e-13   Nicotiana sylvestris
ref|XP_003574645.1|  PREDICTED: zinc-finger homeodomain protein 1...  77.4    1e-13   
ref|XP_004237971.1|  PREDICTED: zinc-finger homeodomain protein 2     77.0    1e-13   
gb|EPS73952.1|  hypothetical protein M569_00810                       76.3    1e-13   
gb|ABY61029.1|  zinc finger-homeodomain protein 1                     77.0    1e-13   
ref|XP_010930367.1|  PREDICTED: zinc-finger homeodomain protein 4...  77.0    1e-13   
ref|XP_010444532.1|  PREDICTED: zinc-finger homeodomain protein 1     77.0    1e-13   
gb|EEC67940.1|  hypothetical protein OsI_35664                        78.2    1e-13   
ref|XP_008808961.1|  PREDICTED: zinc-finger homeodomain protein 4...  77.0    1e-13   
ref|NP_201344.1|  homeobox protein 25                                 77.0    1e-13   
ref|XP_010463122.1|  PREDICTED: zinc-finger homeodomain protein 1...  77.0    1e-13   
ref|XP_009393647.1|  PREDICTED: zinc-finger homeodomain protein 2...  77.0    1e-13   
ref|XP_002302329.1|  hypothetical protein POPTR_0002s10330g           77.0    1e-13   
ref|XP_010675490.1|  PREDICTED: zinc-finger homeodomain protein 1...  77.4    1e-13   
ref|XP_006280898.1|  hypothetical protein CARUB_v10026891mg           77.0    1e-13   
ref|XP_002994344.1|  hypothetical protein SELMODRAFT_236945           75.5    1e-13   
ref|XP_009385760.1|  PREDICTED: zinc-finger homeodomain protein 2...  77.0    1e-13   
ref|XP_007226172.1|  hypothetical protein PRUPE_ppa015411mg           77.8    1e-13   
ref|XP_010098663.1|  hypothetical protein L484_026038                 76.6    1e-13   
ref|NP_194197.1|  ZF-HD homeobox protein                              76.3    1e-13   
ref|XP_010448536.1|  PREDICTED: zinc-finger homeodomain protein 2     76.3    1e-13   
ref|XP_007018165.1|  Transcription factor, putative                   76.6    1e-13   
ref|XP_008218634.1|  PREDICTED: zinc-finger homeodomain protein 4...  77.8    1e-13   
ref|XP_010433740.1|  PREDICTED: zinc-finger homeodomain protein 2...  76.3    1e-13   
ref|XP_004301574.1|  PREDICTED: zinc-finger homeodomain protein 4...  78.2    1e-13   
gb|KJB43477.1|  hypothetical protein B456_007G202500                  77.4    1e-13   
ref|NP_178358.1|  homeobox protein 21                                 77.0    1e-13   
ref|XP_006286279.1|  hypothetical protein CARUB_v10007856mg           76.3    1e-13   
ref|XP_010438998.1|  PREDICTED: zinc-finger homeodomain protein 2...  76.3    1e-13   
ref|XP_009373614.1|  PREDICTED: zinc-finger homeodomain protein 3...  78.2    1e-13   
gb|ABY61028.1|  zinc finger-homeodomain protein 1                     76.3    2e-13   
ref|XP_002966118.1|  hypothetical protein SELMODRAFT_85536            75.5    2e-13   
gb|ABK25080.1|  unknown                                               76.6    2e-13   
ref|XP_004152612.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  76.3    2e-13   
gb|AAM10791.1|  hypothetical protein At2g02540/T822.16                77.0    2e-13   
ref|XP_008444884.1|  PREDICTED: zinc-finger homeodomain protein 2     76.3    2e-13   
ref|XP_006338094.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  76.3    2e-13   
ref|XP_003544235.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  76.3    2e-13   
ref|XP_004232414.1|  PREDICTED: zinc-finger homeodomain protein 5     76.6    2e-13   
gb|ABK25143.1|  unknown                                               76.6    2e-13   
ref|XP_008385681.1|  PREDICTED: zinc-finger homeodomain protein 1...  76.6    2e-13   
ref|XP_009399684.1|  PREDICTED: zinc-finger homeodomain protein 1...  76.6    2e-13   
gb|KDP41452.1|  hypothetical protein JCGZ_15859                       77.0    2e-13   
sp|Q53N87.2|ZHD4_ORYSJ  RecName: Full=Zinc-finger homeodomain pro...  78.2    2e-13   
ref|XP_006383190.1|  hypothetical protein POPTR_0005s12420g           77.0    2e-13   
ref|XP_009620302.1|  PREDICTED: zinc-finger homeodomain protein 9...  76.3    2e-13   
ref|XP_008806398.1|  PREDICTED: zinc-finger homeodomain protein 1...  75.1    2e-13   
ref|XP_008389477.1|  PREDICTED: zinc-finger homeodomain protein 1...  77.0    2e-13   
ref|XP_006413402.1|  hypothetical protein EUTSA_v10026163mg           75.9    2e-13   
ref|XP_010102085.1|  hypothetical protein L484_009028                 77.4    2e-13   
ref|XP_010272957.1|  PREDICTED: zinc-finger homeodomain protein 1...  75.9    2e-13   
ref|XP_002864955.1|  hypothetical protein ARALYDRAFT_919872           76.3    2e-13   
gb|AEW07467.1|  hypothetical protein 0_2239_01                        72.0    2e-13   
ref|XP_006581501.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  75.9    2e-13   
gb|EAZ19969.1|  hypothetical protein OsJ_35560                        73.9    2e-13   
gb|KHN08326.1|  ZF-HD homeobox protein                                75.9    3e-13   
ref|XP_008235400.1|  PREDICTED: zinc-finger homeodomain protein 1...  74.7    3e-13   
emb|CAC34409.1|  ZF-HD homeobox protein                               76.6    3e-13   
ref|XP_001778248.1|  predicted protein                                75.9    3e-13   
ref|XP_010263641.1|  PREDICTED: zinc-finger homeodomain protein 5     77.0    3e-13   
gb|AAZ07989.1|  zinc finger homeodomain protein 1                     76.6    3e-13   
ref|XP_008812231.1|  PREDICTED: zinc-finger homeodomain protein 2...  75.9    3e-13   
ref|XP_009373696.1|  PREDICTED: zinc-finger homeodomain protein 2...  75.9    3e-13   
ref|XP_009104712.1|  PREDICTED: zinc-finger homeodomain protein 5...  75.9    3e-13   
ref|XP_010438997.1|  PREDICTED: zinc-finger homeodomain protein 2...  75.5    3e-13   
ref|XP_003635057.1|  PREDICTED: zinc-finger homeodomain protein 2...  75.5    3e-13   
ref|XP_001772697.1|  predicted protein                                75.1    3e-13   
emb|CDX81638.1|  BnaC08g39630D                                        76.3    3e-13   
gb|KJB44095.1|  hypothetical protein B456_007G233800                  75.5    3e-13   
gb|ABY61025.1|  zinc finger-homeodomain protein 3                     75.1    3e-13   
emb|CDX81284.1|  BnaC09g06950D                                        75.5    3e-13   
ref|XP_006305389.1|  hypothetical protein CARUB_v10009782mg           76.3    3e-13   
emb|CDX85059.1|  BnaC05g19960D                                        75.1    4e-13   
ref|XP_009619186.1|  PREDICTED: zinc-finger homeodomain protein 2...  75.5    4e-13   
gb|KHN00406.1|  ZF-HD homeobox protein                                71.6    4e-13   
ref|XP_006426395.1|  hypothetical protein CICLE_v10027184mg           75.1    4e-13   
ref|XP_007224765.1|  hypothetical protein PRUPE_ppa024080mg           76.6    4e-13   
ref|XP_001761178.1|  predicted protein                                72.0    4e-13   
ref|XP_008378952.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  76.6    4e-13   
emb|CDY14559.1|  BnaC03g49000D                                        75.9    4e-13   
ref|XP_009341386.1|  PREDICTED: zinc-finger homeodomain protein 3...  76.6    4e-13   
ref|XP_009355386.1|  PREDICTED: zinc-finger homeodomain protein 3     76.6    4e-13   
ref|NP_565106.1|  homeobox protein 33                                 75.9    4e-13   
emb|CDX85886.1|  BnaC06g22480D                                        75.5    4e-13   
emb|CAC34447.1|  ZF-HD homeobox protein                               75.1    4e-13   
ref|XP_006291509.1|  hypothetical protein CARUB_v10017657mg           75.9    4e-13   
ref|XP_008339432.1|  PREDICTED: zinc-finger homeodomain protein 3...  76.6    4e-13   
ref|XP_002285709.1|  PREDICTED: zinc-finger homeodomain protein 1     75.1    4e-13   
ref|XP_002892806.1|  ATHB31                                           75.9    4e-13   
ref|XP_009112180.1|  PREDICTED: zinc-finger homeodomain protein 1...  75.1    4e-13   
ref|XP_009150629.1|  PREDICTED: zinc-finger homeodomain protein 1...  75.5    4e-13   
ref|XP_003613092.1|  Zinc finger-homeodomain protein                  76.3    5e-13   
ref|XP_007205692.1|  hypothetical protein PRUPE_ppa009712mg           75.5    5e-13   
emb|CDY54719.1|  BnaA09g52500D                                        75.1    5e-13   
gb|EAY87240.1|  hypothetical protein OsI_08642                        73.2    5e-13   
gb|KJB44094.1|  hypothetical protein B456_007G233800                  75.1    5e-13   
ref|XP_010530124.1|  PREDICTED: zinc-finger homeodomain protein 2     74.7    5e-13   
ref|XP_010414224.1|  PREDICTED: zinc-finger homeodomain protein 6...  75.1    5e-13   
ref|XP_002534484.1|  transcription factor, putative                   75.1    5e-13   
ref|XP_010912718.1|  PREDICTED: zinc-finger homeodomain protein 4...  75.1    5e-13   
emb|CDX69541.1|  BnaA10g18900D                                        75.1    5e-13   
ref|XP_011075633.1|  PREDICTED: zinc-finger homeodomain protein 1...  73.9    5e-13   
gb|EYU30955.1|  hypothetical protein MIMGU_mgv1a026983mg              75.1    5e-13   
gb|KFK40227.1|  hypothetical protein AALP_AA3G347100                  74.7    5e-13   
ref|XP_006466561.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  74.7    5e-13   
ref|XP_006841247.1|  hypothetical protein AMTR_s00135p00085840        74.7    6e-13   
gb|KFK28242.1|  hypothetical protein AALP_AA8G490700                  75.1    6e-13   
ref|XP_009405659.1|  PREDICTED: zinc-finger homeodomain protein 6...  76.3    6e-13   
emb|CDY08945.1|  BnaC08g11750D                                        74.3    6e-13   
ref|XP_004512050.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  75.1    6e-13   
ref|XP_003612025.1|  Zinc finger-homeodomain protein                  75.1    6e-13   
ref|NP_172896.1|  homeobox protein 31                                 75.5    6e-13   
ref|XP_009769508.1|  PREDICTED: zinc-finger homeodomain protein 2...  74.7    6e-13   
ref|XP_009769511.1|  PREDICTED: zinc-finger homeodomain protein 2...  74.7    6e-13   
ref|XP_010502266.1|  PREDICTED: zinc-finger homeodomain protein 3...  75.5    6e-13   
emb|CDX88950.1|  BnaA04g02360D                                        74.3    6e-13   
ref|XP_011016887.1|  PREDICTED: zinc-finger homeodomain protein 2     74.7    6e-13   
ref|XP_003530618.2|  PREDICTED: ZF-HD homeobox protein At4g24660-...  74.7    6e-13   
ref|XP_008338913.1|  PREDICTED: zinc-finger homeodomain protein 2...  74.7    6e-13   
gb|AES94983.2|  homeobox domain, ZF-HD class protein                  75.1    7e-13   
ref|XP_007141241.1|  hypothetical protein PHAVU_008G179200g           74.7    7e-13   
ref|XP_010266504.1|  PREDICTED: zinc-finger homeodomain protein 1...  74.3    7e-13   
ref|XP_007046919.1|  Homeobox protein 24, putative                    76.3    7e-13   
ref|XP_002310240.2|  zinc finger family protein                       75.1    7e-13   
ref|XP_009121598.1|  PREDICTED: zinc-finger homeodomain protein 8     74.7    7e-13   
gb|ABR16776.1|  unknown                                               75.1    7e-13   
emb|CBI19232.3|  unnamed protein product                              74.3    7e-13   
ref|XP_006380765.1|  hypothetical protein POPTR_0007s12970g           75.5    7e-13   
ref|XP_006340630.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  75.1    8e-13   
ref|XP_006395776.1|  hypothetical protein EUTSA_v10004643mg           75.1    8e-13   
ref|XP_003530619.2|  PREDICTED: ZF-HD homeobox protein At4g24660-...  74.3    8e-13   
ref|XP_010539898.1|  PREDICTED: zinc-finger homeodomain protein 5...  74.3    8e-13   
gb|KFK26902.1|  hypothetical protein AALP_AA8G308300                  74.7    9e-13   
ref|XP_006425664.1|  hypothetical protein CICLE_v10025926mg           75.5    9e-13   
emb|CAN75153.1|  hypothetical protein VITISV_035994                   74.7    9e-13   
ref|XP_008338912.1|  PREDICTED: zinc-finger homeodomain protein 2...  74.7    9e-13   
ref|XP_002510399.1|  transcription factor, putative                   74.7    9e-13   
ref|XP_004501619.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  74.3    9e-13   
ref|XP_006853040.1|  hypothetical protein AMTR_s00038p00027320        73.9    9e-13   
dbj|BAJ92783.1|  predicted protein                                    75.9    9e-13   
ref|XP_002443023.1|  hypothetical protein SORBIDRAFT_08g006490        75.1    1e-12   
gb|ABY61021.1|  zinc finger-homeodomain protein 2                     74.3    1e-12   
ref|XP_004978993.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  75.5    1e-12   
gb|KDP34399.1|  hypothetical protein JCGZ_12803                       75.1    1e-12   
ref|XP_010551857.1|  PREDICTED: zinc-finger homeodomain protein 8...  74.3    1e-12   
ref|XP_009421143.1|  PREDICTED: zinc-finger homeodomain protein 4...  74.3    1e-12   
sp|Q2QW44.3|ZHD3_ORYSJ  RecName: Full=Zinc-finger homeodomain pro...  75.1    1e-12   
ref|XP_008339904.1|  PREDICTED: zinc-finger homeodomain protein 1...  74.7    1e-12   
ref|XP_007017558.1|  Homeobox protein 33 isoform 1                    74.3    1e-12   
gb|ABY61027.1|  zinc finger-homeodomain protein 1                     73.9    1e-12   
ref|XP_010489538.1|  PREDICTED: zinc-finger homeodomain protein 6...  73.9    1e-12   
ref|NP_001144285.1|  uncharacterized protein LOC100277167             74.7    1e-12   
emb|CDP02013.1|  unnamed protein product                              75.1    1e-12   
gb|ACG39295.1|  hypothetical protein                                  74.7    1e-12   
ref|XP_008678040.1|  PREDICTED: zinc-finger homeodomain protein 4...  75.1    1e-12   
ref|XP_003602944.1|  Zinc finger-homeodomain protein                  73.9    1e-12   
ref|XP_008221618.1|  PREDICTED: zinc-finger homeodomain protein 1...  74.7    1e-12   
ref|XP_004490406.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  73.6    1e-12   
ref|XP_006299733.1|  hypothetical protein CARUB_v10015926mg           73.6    1e-12   
ref|XP_009117900.1|  PREDICTED: zinc-finger homeodomain protein 4...  74.3    1e-12   
gb|EYU28753.1|  hypothetical protein MIMGU_mgv1a025639mg              73.9    2e-12   
ref|XP_008678039.1|  PREDICTED: zinc-finger homeodomain protein 4...  75.5    2e-12   
ref|XP_010467646.1|  PREDICTED: zinc-finger homeodomain protein 6     73.6    2e-12   
ref|XP_010425030.1|  PREDICTED: zinc-finger homeodomain protein 3...  74.3    2e-12   
ref|XP_008800713.1|  PREDICTED: zinc-finger homeodomain protein 6...  74.3    2e-12   
ref|XP_010926548.1|  PREDICTED: zinc-finger homeodomain protein 9...  73.6    2e-12   
gb|KFK33764.1|  hypothetical protein AALP_AA5G057200                  73.9    2e-12   
ref|XP_002876052.1|  ATHB28                                           73.6    2e-12   
emb|CDY41692.1|  BnaC02g34620D                                        73.9    2e-12   
ref|XP_004143449.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  73.2    2e-12   
gb|KJB37131.1|  hypothetical protein B456_006G190600                  72.4    2e-12   
pdb|1WH7|A  Chain A, Solution Structure Of Homeobox Domain Of Ara...  70.5    2e-12   
emb|CDY09363.1|  BnaA02g26470D                                        73.9    2e-12   
ref|XP_010060080.1|  PREDICTED: zinc-finger homeodomain protein 2...  74.7    2e-12   
ref|XP_001752347.1|  predicted protein                                73.9    2e-12   
ref|XP_009411228.1|  PREDICTED: zinc-finger homeodomain protein 5...  74.7    2e-12   
ref|XP_004961117.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  73.6    2e-12   
ref|XP_008440565.1|  PREDICTED: zinc-finger homeodomain protein 1...  73.2    2e-12   
ref|XP_011010389.1|  PREDICTED: zinc-finger homeodomain protein 2...  73.2    2e-12   
ref|XP_010674293.1|  PREDICTED: zinc-finger homeodomain protein 1...  72.8    2e-12   
ref|XP_002449277.1|  hypothetical protein SORBIDRAFT_05g007050        75.1    2e-12   
ref|XP_009596948.1|  PREDICTED: zinc-finger homeodomain protein 2...  73.2    2e-12   
ref|XP_001773676.1|  predicted protein                                69.7    2e-12   
ref|XP_009410002.1|  PREDICTED: zinc-finger homeodomain protein 9     73.9    2e-12   
ref|XP_009129138.1|  PREDICTED: zinc-finger homeodomain protein 3     73.9    2e-12   
emb|CDP20040.1|  unnamed protein product                              72.4    2e-12   
ref|XP_002281371.1|  PREDICTED: zinc-finger homeodomain protein 6     73.9    2e-12   
ref|XP_007158652.1|  hypothetical protein PHAVU_002G171000g           74.7    2e-12   
emb|CBI18514.3|  unnamed protein product                              73.2    2e-12   
ref|XP_011003723.1|  PREDICTED: zinc-finger homeodomain protein 6     74.3    2e-12   
emb|CDM83487.1|  unnamed protein product                              72.8    2e-12   
emb|CAN64849.1|  hypothetical protein VITISV_004128                   73.2    2e-12   
ref|XP_008353097.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  73.9    2e-12   
emb|CDM83476.1|  unnamed protein product                              72.8    2e-12   
ref|XP_009360340.1|  PREDICTED: zinc-finger homeodomain protein 8     74.7    2e-12   
gb|KDP38514.1|  hypothetical protein JCGZ_04439                       73.6    2e-12   
ref|XP_009380358.1|  PREDICTED: zinc-finger homeodomain protein 6...  73.6    3e-12   
ref|XP_009596949.1|  PREDICTED: zinc-finger homeodomain protein 2...  72.8    3e-12   
ref|XP_006655627.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  71.2    3e-12   
gb|AFW79306.1|  ZF-HD homeobox protein                                72.8    3e-12   
gb|ADE76551.1|  unknown                                               73.2    3e-12   
ref|NP_001152263.1|  ZF-HD homeobox protein                           72.8    3e-12   
ref|XP_009392577.1|  PREDICTED: zinc-finger homeodomain protein 4...  72.8    3e-12   
ref|XP_010665240.1|  PREDICTED: zinc-finger homeodomain protein 2...  73.2    3e-12   
emb|CDX90679.1|  BnaA03g41020D                                        72.8    3e-12   
ref|XP_006290001.1|  hypothetical protein CARUB_v10003631mg           72.8    3e-12   
ref|XP_009136568.1|  PREDICTED: zinc-finger homeodomain protein 7...  72.8    3e-12   
ref|XP_003528585.2|  PREDICTED: transcription factor HB29-like        73.9    3e-12   
pdb|1WH5|A  Chain A, Solution Structure Of Homeobox Domain Of Ara...  69.7    3e-12   
ref|XP_002306552.2|  hypothetical protein POPTR_0005s17620g           72.8    3e-12   
ref|XP_002886165.1|  ATHB24                                           72.8    3e-12   
ref|XP_003615230.1|  Zinc finger-homeodomain protein                  72.8    3e-12   
ref|XP_010937133.1|  PREDICTED: zinc-finger homeodomain protein 9...  73.2    3e-12   
ref|XP_009415270.1|  PREDICTED: zinc-finger homeodomain protein 6...  73.9    3e-12   
ref|XP_003576116.2|  PREDICTED: zinc-finger homeodomain protein 4...  73.9    3e-12   
ref|XP_006573021.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  72.4    3e-12   
gb|KJB40199.1|  hypothetical protein B456_007G050500                  73.2    4e-12   
ref|XP_009404830.1|  PREDICTED: zinc-finger homeodomain protein 4...  72.4    4e-12   
emb|CDY24844.1|  BnaA08g14660D                                        72.0    4e-12   
ref|XP_009802157.1|  PREDICTED: zinc-finger homeodomain protein 2...  72.4    4e-12   
ref|XP_011004015.1|  PREDICTED: zinc-finger homeodomain protein 5...  72.8    4e-12   
ref|XP_009109241.1|  PREDICTED: zinc-finger homeodomain protein 2...  72.0    4e-12   



>emb|CDP02232.1| unnamed protein product [Coffea canephora]
Length=362

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KMLDFAE+IGWKIQKRDE+LI +FC EIGV++GVLKVWMHNNKNT GKRD
Sbjct  238  KEKMLDFAEKIGWKIQKRDEDLIAEFCNEIGVDKGVLKVWMHNNKNTFGKRD  289



>ref|XP_004148695.1| PREDICTED: transcription factor HB29-like [Cucumis sativus]
Length=304

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KMLDFAER+GWK+QKRDE+L+ DFC ++GVERGVLKVWMHNNKNT+GK+ +
Sbjct  208  KEKMLDFAERVGWKMQKRDEDLVRDFCNQVGVERGVLKVWMHNNKNTMGKKPD  260



>ref|XP_004168480.1| PREDICTED: transcription factor HB29-like [Cucumis sativus]
 gb|KGN52458.1| hypothetical protein Csa_5G636510 [Cucumis sativus]
Length=307

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KMLDFAER+GWK+QKRDE+L+ DFC ++GVERGVLKVWMHNNKNT+GK+ +
Sbjct  211  KEKMLDFAERVGWKMQKRDEDLVRDFCNQVGVERGVLKVWMHNNKNTMGKKPD  263



>gb|ABY61030.1| zinc finger-homeodomain protein 1, partial [Cucumis sativus]
Length=302

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KMLDFAER+GWK+QKRDE+L+ DFC ++GVERGVLKVWMHNNKNT+GK+ +
Sbjct  206  KEKMLDFAERVGWKMQKRDEDLVRDFCNQVGVERGVLKVWMHNNKNTMGKKPD  258



>gb|KJB75739.1| hypothetical protein B456_012G054300 [Gossypium raimondii]
Length=337

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KML+FAE+IGWKIQKRDEE I +FCRE+GV+RGVLKVWMHNNKNT GK+D 
Sbjct  210  KDKMLEFAEKIGWKIQKRDEEDIQEFCREVGVDRGVLKVWMHNNKNTFGKKDQ  262



>ref|XP_008467057.1| PREDICTED: zinc-finger homeodomain protein 10-like [Cucumis melo]
Length=315

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KMLDFAER+GWK+QKRD++L+ DFC ++GVERGVLKVWMHNNKNT+GK+
Sbjct  219  KEKMLDFAERVGWKMQKRDDDLVRDFCNQVGVERGVLKVWMHNNKNTMGKK  269



>ref|XP_002283533.1| PREDICTED: zinc-finger homeodomain protein 9 [Vitis vinifera]
Length=341

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAER+GWK+QKRDEEL+ +FC E+GV++GVLKVWMHNNKNT GKRD
Sbjct  215  KEKMFEFAERVGWKMQKRDEELVAEFCNEVGVDKGVLKVWMHNNKNTFGKRD  266



>ref|XP_010655937.1| PREDICTED: zinc-finger homeodomain protein 10-like [Vitis vinifera]
Length=195

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAER+GWK+QKRDEEL+ +FC E+GV++GVLKVWMHNNKNT GKRD
Sbjct  108  KKKMFEFAERVGWKMQKRDEELVAEFCNEVGVDKGVLKVWMHNNKNTFGKRD  159



>emb|CBI22215.3| unnamed protein product [Vitis vinifera]
Length=238

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAER+GWK+QKRDEEL+ +FC E+GV++GVLKVWMHNNKNT GKRD
Sbjct  144  KEKMFEFAERVGWKMQKRDEELVAEFCNEVGVDKGVLKVWMHNNKNTFGKRD  195



>gb|KJB33553.1| hypothetical protein B456_006G017200 [Gossypium raimondii]
Length=326

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KML+FAE++GWKIQKRDEE I +FC E+GV+RGVLKVWMHNNKNT GK+D 
Sbjct  221  KDKMLEFAEKVGWKIQKRDEEAIQEFCSEVGVDRGVLKVWMHNNKNTFGKKDQ  273



>ref|XP_009620291.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
tomentosiformis]
Length=361

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 72/122 (59%), Gaps = 10/122 (8%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNK-----NTVGKRDNIT  467
            K +ML+FAE++ WKIQKRDEELINDFC +IGVE+GVLKVWMHNNK      T     N  
Sbjct  235  KERMLEFAEKVEWKIQKRDEELINDFCSKIGVEKGVLKVWMHNNKCKKDQATAAAAINTV  294

Query  466  TTPaaaaaADNGNAHSLGFDIGRVNSAPLTSDFNLRPESNNNGSHSQNHYALHSGDVLAA  287
             TP      +          I R N+  + S+F+L  ES+ +     +H  LH+ D ++A
Sbjct  295  ATPNLLNGNNGNGF----GLISRNNTDTIASEFHLHHESSKDNDKDHSHQ-LHNNDSVSA  349

Query  286  NG  281
            +G
Sbjct  350  HG  351



>ref|XP_003543789.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=331

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 71/116 (61%), Gaps = 7/116 (6%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTTPaa  452
            K KM +FA+++GWK+Q+RDEE++ +FC EIGV+RGVLKVWMHNNKNT  K+DN+      
Sbjct  197  KEKMHEFADKVGWKMQRRDEEMVMEFCNEIGVDRGVLKVWMHNNKNTFAKKDNLNGNSIG  256

Query  451  aaaADNGNAHSLGFDIGRVNSAPLTSDFNLRPES----NNNGSHSQNHYALHSGDV  296
              A  + N  +    IG V SA + S  ++        N NGS   NH  L S DV
Sbjct  257  NVAIVSANGVA---PIGAVGSATVRSSVHVHEHEHGGINGNGSGDNNHNPLGSRDV  309



>ref|XP_004304301.1| PREDICTED: zinc-finger homeodomain protein 9 [Fragaria vesca 
subsp. vesca]
Length=360

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITT  464
            K KM  FAER+GWK+QKRDE+++++FC EIGV++GVLKVWMHNNKNT  KRD + +
Sbjct  213  KDKMFQFAERVGWKMQKRDEDIVHEFCNEIGVDKGVLKVWMHNNKNTFAKRDGVVS  268



>ref|XP_011085755.1| PREDICTED: zinc-finger homeodomain protein 9 [Sesamum indicum]
Length=345

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAER+GWK+QKRDE++I++FC EIGV++GV KVWMHNNKNT GK+D
Sbjct  213  KEKMFEFAERVGWKMQKRDEDVISEFCSEIGVDKGVFKVWMHNNKNTFGKKD  264



>ref|XP_009787877.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
sylvestris]
Length=358

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML+FAER+GWK+QKRDE+L+  FC EIGVE+GVLKVWMHNNKNT GK+
Sbjct  227  KVKMLEFAERVGWKMQKRDEDLVRSFCNEIGVEKGVLKVWMHNNKNTFGKK  277



>ref|XP_008443414.1| PREDICTED: zinc-finger homeodomain protein 9-like [Cucumis melo]
Length=298

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K +M +FAE++GWKIQKRDE++I +FC ++GV+RGVLKVWMHNNKNT+GK+D
Sbjct  212  KERMYEFAEKVGWKIQKRDEDMIQEFCSDVGVDRGVLKVWMHNNKNTLGKKD  263



>ref|XP_004147471.1| PREDICTED: transcription factor HB29-like [Cucumis sativus]
 ref|XP_004163533.1| PREDICTED: transcription factor HB29-like [Cucumis sativus]
 gb|KGN59574.1| hypothetical protein Csa_3G826680 [Cucumis sativus]
Length=298

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K +M +FAE++GWKIQKRDE++I +FC ++GV+RGVLKVWMHNNKNT+GK+D
Sbjct  212  KERMYEFAEKVGWKIQKRDEDMIQEFCSDVGVDRGVLKVWMHNNKNTLGKKD  263



>ref|XP_006363398.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=346

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KML+ AERIGWK+QKRDE+L+++FC EIGVE+GVLKVWMHNNKNT GK+ +
Sbjct  211  KVKMLELAERIGWKMQKRDEDLVSNFCNEIGVEKGVLKVWMHNNKNTFGKKSD  263



>emb|CBI29005.3| unnamed protein product [Vitis vinifera]
Length=587

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KM +FAER+GWK+QKRDEEL+ +FC E+GV++GVLKVWMHNNKNT GKRD+
Sbjct  114  KKKMFEFAERVGWKMQKRDEELVAEFCNEVGVDKGVLKVWMHNNKNTFGKRDD  166



>ref|XP_004233363.1| PREDICTED: zinc-finger homeodomain protein 9-like [Solanum lycopersicum]
Length=354

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KM +FAER+GWK+QKRDE+L+++FC EIGVE+GVLKVWMHNNKNT GK+ +
Sbjct  216  KVKMQEFAERVGWKMQKRDEDLVSNFCNEIGVEKGVLKVWMHNNKNTFGKKSD  268



>gb|KHN13618.1| ZF-HD homeobox protein [Glycine soja]
Length=163

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KM  FAE++GWKIQKRDE+LI++FC E+GV+R VLKVWMHNNKNT  K+DN
Sbjct  37   KEKMHKFAEKVGWKIQKRDEDLIHEFCNEVGVDRSVLKVWMHNNKNTFAKKDN  89



>ref|XP_009376317.1| PREDICTED: zinc-finger homeodomain protein 9 [Pyrus x bretschneideri]
Length=323

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  FAER+GWK+QKRDEE++ +FC E G+E+GVLKVWMHNNKNT  KRD
Sbjct  195  KEKMYQFAERVGWKMQKRDEEIVQEFCNEAGIEKGVLKVWMHNNKNTFSKRD  246



>ref|XP_008379353.1| PREDICTED: zinc-finger homeodomain protein 9-like [Malus domestica]
Length=353

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  FAER+GWK+QKRDEE++ +FC E GVE+GVLKVWMHNNKNT  KRD
Sbjct  221  KEKMYQFAERVGWKMQKRDEEIVREFCNEAGVEKGVLKVWMHNNKNTFSKRD  272



>ref|XP_009621030.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
tomentosiformis]
Length=356

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML+FAER+GWK+QKRDE+L+  FC +IG+E+GVLKVWMHNNKNT GK+
Sbjct  224  KVKMLEFAERVGWKMQKRDEDLVRSFCNQIGIEKGVLKVWMHNNKNTFGKK  274



>ref|XP_011098625.1| PREDICTED: zinc-finger homeodomain protein 9-like [Sesamum indicum]
Length=325

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAE++GWK+QKRDE++I++FCREIGV++GV KVWMHNNKNT  K+D
Sbjct  189  KEKMHEFAEKVGWKMQKRDEDVISEFCREIGVDKGVFKVWMHNNKNTFAKKD  240



>ref|XP_008230766.1| PREDICTED: zinc-finger homeodomain protein 9-like [Prunus mume]
Length=357

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K KM  FAER+GWK+QKRDEE++ +FC EI V++GVLKVWMHNNKNT  KRD I
Sbjct  222  KDKMYQFAERVGWKMQKRDEEIVQEFCNEINVDKGVLKVWMHNNKNTFAKRDVI  275



>ref|XP_007032534.1| Homeobox protein 34, putative [Theobroma cacao]
 gb|EOY03460.1| Homeobox protein 34, putative [Theobroma cacao]
Length=309

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  613  FAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            FAER+GWK+QKRDEEL+ +FC E+GV+RGVLKVWMHNNKNT GK+D 
Sbjct  197  FAERVGWKMQKRDEELVQEFCSEVGVDRGVLKVWMHNNKNTFGKKDQ  243



>ref|XP_008341574.1| PREDICTED: zinc-finger homeodomain protein 10-like [Malus domestica]
Length=309

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  FAER+GWK+QKR+EE++ +FC E+GVE+GVLKVWMHNNKNT  KRD
Sbjct  219  KDKMHQFAERVGWKMQKREEEIVQEFCNEVGVEKGVLKVWMHNNKNTFTKRD  270



>ref|XP_002324056.2| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 ref|XP_006373321.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 gb|EEF04189.2| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 gb|ERP51118.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
Length=340

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K +M  FAER+GWK+QKRDE+L+ +FC E+GV+RGVLKVWMHNNKN++GK++++
Sbjct  221  KERMYQFAERVGWKMQKRDEDLVQEFCNEVGVDRGVLKVWMHNNKNSLGKKEHL  274



>ref|XP_006602909.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=338

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KM  FAE++GWKIQKRDE+LI++FC E+GV+R VLKVWMHNNKNT  K+DN
Sbjct  212  KEKMHKFAEKVGWKIQKRDEDLIHEFCNEVGVDRSVLKVWMHNNKNTFAKKDN  264



>ref|XP_002534012.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28370.1| conserved hypothetical protein [Ricinus communis]
Length=335

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K +M +FAER+GWK+QKRDEEL+ +FC E+GV++GVLKVWMHNNKNT  +RD
Sbjct  229  KERMHEFAERVGWKMQKRDEELVQEFCNEVGVDKGVLKVWMHNNKNTFARRD  280



>ref|XP_011010066.1| PREDICTED: zinc-finger homeodomain protein 9-like [Populus euphratica]
Length=335

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K +M  FAER+GWK+QKRDE+L+ +FC E+GV++GVLKVWMHNNKN++GK++++
Sbjct  214  KERMFQFAERVGWKMQKRDEDLVQEFCNEVGVDKGVLKVWMHNNKNSLGKKEHL  267



>ref|XP_010088163.1| hypothetical protein L484_013608 [Morus notabilis]
 gb|EXB31975.1| hypothetical protein L484_013608 [Morus notabilis]
Length=195

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KM  FAE++GWK+QKRDEEL+ +FC EIGV++GVLKVWMHNNKNT  K+D+
Sbjct  60   KEKMCQFAEKVGWKMQKRDEELVREFCGEIGVDKGVLKVWMHNNKNTFAKKDH  112



>ref|XP_010552878.1| PREDICTED: LOW QUALITY PROTEIN: zinc-finger homeodomain protein 
10-like [Tarenaya hassleriana]
Length=344

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAER+GWK+QKRDEE I DFCREIGV++GVLKVWMHNNKN   +RD
Sbjct  213  KDKMHEFAERMGWKMQKRDEEEIRDFCREIGVDKGVLKVWMHNNKNASHRRD  264



>ref|XP_010693250.1| PREDICTED: zinc-finger homeodomain protein 9-like [Beta vulgaris 
subsp. vulgaris]
Length=400

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGK-RDNITTT  461
            K KM DFAE++GWK+QK +E+++N FC EIGVERGV KVWMHNNKNT GK R N T T
Sbjct  254  KDKMHDFAEKVGWKMQKTNEDMVNGFCNEIGVERGVFKVWMHNNKNTFGKIRSNTTIT  311



>ref|XP_007151228.1| hypothetical protein PHAVU_004G028600g [Phaseolus vulgaris]
 gb|ESW23222.1| hypothetical protein PHAVU_004G028600g [Phaseolus vulgaris]
Length=343

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K KM +FA+++GWK+QKRDE ++ +FC EIGV+RGVLKVWMHNNKNT+ K+DN+
Sbjct  209  KEKMHEFADKVGWKMQKRDENMVMEFCNEIGVDRGVLKVWMHNNKNTLAKKDNL  262



>ref|XP_007139577.1| hypothetical protein PHAVU_008G041300g [Phaseolus vulgaris]
 gb|ESW11571.1| hypothetical protein PHAVU_008G041300g [Phaseolus vulgaris]
Length=326

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KM  FA+++GWK+QKRDE+L+++FC EIGV+R VLKVWMHNNKNT+ K+DN
Sbjct  210  KEKMHKFADKVGWKMQKRDEDLVHEFCNEIGVDRSVLKVWMHNNKNTLAKKDN  262



>ref|XP_006357111.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=329

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 73/125 (58%), Gaps = 8/125 (6%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTTPaa  452
            K KML FAE++ WK+QKRDE+L+N+FC EIGVE+GVLKVWMHNNK T      +      
Sbjct  200  KMKMLKFAEKVEWKMQKRDEDLVNNFCNEIGVEKGVLKVWMHNNKTTSVSGKKLDQPITG  259

Query  451  aaaADNGNAHSL--GFDIGRVNSAP------LTSDFNLRPESNNNGSHSQNHYALHSGDV  296
                 NGN +++  GF I   N+          S+F++  ES+ N  + + H +  + +V
Sbjct  260  NGDHQNGNTNNIVNGFCIVSRNNTTHPDQNNTDSEFHIHHESSMNDDNKKEHLSFDANNV  319

Query  295  LAANG  281
            +  NG
Sbjct  320  VVTNG  324



>ref|XP_003621193.1| ZF-HD homeobox protein [Medicago truncatula]
 gb|ABN05735.1| Homeobox domain, ZF-HD class; ZF-HD homeobox protein Cys/His-rich 
dimerisation region; Homeodomain-like [Medicago truncatula]
 gb|ABN08930.1| Homeobox domain, ZF-HD class; ZF-HD homeobox protein Cys/His-rich 
dimerisation region; Homeodomain-like [Medicago truncatula]
 gb|AES77411.1| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=341

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML FAE++GWK+QK+D+E +++FC EIGV+R VLKVWMHNNKNT+ KR+
Sbjct  232  KDKMLKFAEKVGWKMQKKDDEFVHEFCNEIGVDRSVLKVWMHNNKNTLAKRE  283



>ref|XP_006357697.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=307

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML+F+ER+GW++QK+DEE+IN  C EI VE+GVLKVWMHNNKN  G++D
Sbjct  209  KEKMLEFSERVGWRMQKQDEEIINKLCHEISVEKGVLKVWMHNNKNNFGRKD  260



>emb|CDX85230.1| BnaC07g25410D [Brassica napus]
Length=339

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVG-KRDNITTTPa  455
            K KM +FA+RIGWKIQKRDE+ + DFCRE+GV++GVLKVWMHNNKNT   +RD   +   
Sbjct  214  KDKMHEFADRIGWKIQKRDEDEVRDFCREVGVDKGVLKVWMHNNKNTFNTRRDQPFSGDT  273

Query  454  aaaaADNGNAHSLG  413
                 DNG A S G
Sbjct  274  TVQKIDNGVAVSGG  287



>gb|KDP27147.1| hypothetical protein JCGZ_19846 [Jatropha curcas]
Length=148

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  622  MLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            M   AER+GWK+QKRDEELI +FC E+G ++GVLKVWMHNNKNT GKRD
Sbjct  43   MYQVAERVGWKMQKRDEELIQEFCNEVGGDKGVLKVWMHNNKNTFGKRD  91



>ref|XP_006482594.1| PREDICTED: myb-like protein I-like [Citrus sinensis]
 gb|KDO72568.1| hypothetical protein CISIN_1g016972mg [Citrus sinensis]
Length=379

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAER+GWK+QKRD++L+++FC E+GV+R VLKVWMHNNK+T  KRD
Sbjct  245  KEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKSTFAKRD  296



>ref|XP_006395326.1| hypothetical protein EUTSA_v10004599mg [Eutrema salsugineum]
 gb|ESQ32612.1| hypothetical protein EUTSA_v10004599mg [Eutrema salsugineum]
Length=323

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KM +FA+RIGWKIQKRDEE + DFCREIGV++GVLKVWMHNNKNT   R
Sbjct  204  KEKMHEFADRIGWKIQKRDEEEVRDFCREIGVDKGVLKVWMHNNKNTFNNR  254



>ref|XP_009341023.1| PREDICTED: zinc-finger homeodomain protein 9 [Pyrus x bretschneideri]
Length=344

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  622  MLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            M  FAER+GWK+QKRDEE++ +FC E GVE+GVLKVWMHNNKNT  KRD
Sbjct  217  MHQFAERVGWKMQKRDEEIVQEFCNEAGVEKGVLKVWMHNNKNTFTKRD  265



>ref|XP_010258352.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nelumbo nucifera]
Length=296

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  F+ER+GWK+QK DEE++++FC EIGV +GVLKVWMHNNK+T GKRD
Sbjct  209  KEKMYAFSERLGWKMQKSDEEVVDEFCNEIGVGKGVLKVWMHNNKHTFGKRD  260



>ref|XP_006431147.1| hypothetical protein CICLE_v10011968mg [Citrus clementina]
 gb|ESR44387.1| hypothetical protein CICLE_v10011968mg [Citrus clementina]
Length=379

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAER+GWK+QKRD++L++ FC E+GV+R VLKVWMHNNK+T  KRD
Sbjct  244  KEKMFEFAERVGWKMQKRDDDLVHQFCNEVGVDRTVLKVWMHNNKSTFAKRD  295



>ref|XP_010257380.1| PREDICTED: zinc-finger homeodomain protein 9 [Nelumbo nucifera]
Length=300

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  F+ER+GWK+QK DEE++ +FC EIGV +GVLKVWMHNNK+T GKRD
Sbjct  216  KEKMHAFSERLGWKMQKTDEEVVEEFCNEIGVGKGVLKVWMHNNKHTFGKRD  267



>gb|EPS58358.1| hypothetical protein M569_16456, partial [Genlisea aurea]
Length=195

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML+ AE++GWK+QKRD++LIN+ C +IGV++GV KVWMHNNKNT GK+D
Sbjct  137  KVKMLELAEKVGWKMQKRDDDLINESCSDIGVDKGVFKVWMHNNKNTFGKKD  188



>emb|CDX86403.1| BnaA06g31200D [Brassica napus]
Length=344

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVG-KRDNITTTPa  455
            K KM +FA+RIGWKIQKRDE+ + DFCR++GV++GVLKVWMHNNKNT   +RD   +   
Sbjct  217  KDKMHEFADRIGWKIQKRDEDEVRDFCRDVGVDKGVLKVWMHNNKNTFNTRRDQPFSGDT  276

Query  454  aaaaADNGNAHSLG  413
                 DNG A S G
Sbjct  277  TVQKIDNGVAVSGG  290



>gb|KHN11605.1| ZF-HD homeobox protein [Glycine soja]
Length=115

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -1

Query  622  MLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            M  FAE++GWKIQKRDE+LI++ C E+GV+R VLKVWMHNNKNT  K+DN
Sbjct  1    MHKFAEKVGWKIQKRDEDLIHEICNEVGVDRSVLKVWMHNNKNTFAKKDN  50



>ref|XP_003618493.1| Zinc finger-homeodomain protein [Medicago truncatula]
Length=223

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KM +FA+++GWK+QKRDEE++N FC E+GV+R VLKVWMHNNKNT+G++
Sbjct  121  KEKMHEFADKVGWKMQKRDEEMVNGFCNEVGVDRSVLKVWMHNNKNTLGRK  171



>ref|XP_004491795.1| PREDICTED: transcription factor HB29-like [Cicer arietinum]
Length=328

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML FAE++GWKIQKRD++LI++ C EIGV+R VLKVWMHNNKN   KRD
Sbjct  217  KDKMLKFAEKVGWKIQKRDDDLIHEVCNEIGVDRTVLKVWMHNNKNNFTKRD  268



>ref|XP_008388052.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
 ref|XP_008388053.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
 ref|XP_008388054.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
Length=350

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 7/75 (9%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTTPaa  452
            K +M++FAER+GW+IQK+DEE +  FC E+GV+R VL+VWMHNNKNT+ K+ ++T T   
Sbjct  268  KERMMEFAERVGWRIQKQDEEEVERFCAEVGVKRQVLRVWMHNNKNTIKKQGDVTAT---  324

Query  451  aaaADNGNAHSLGFD  407
                 N  A  L FD
Sbjct  325  ----TNAIATGLSFD  335



>gb|ADK63413.1| homeobox domain zinc finger protein [Brassica rapa]
Length=124

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = -1

Query  622  MLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVG-KRDNITTTPaaaa  446
            M +FA+RIGWKIQKRDE+ + DFCR++GV++GVLKVWMHNNKNT   +RD   +      
Sbjct  1    MHEFADRIGWKIQKRDEDEVRDFCRDVGVDKGVLKVWMHNNKNTFNTRRDQPFSGDTTVQ  60

Query  445  aADNGNAHSLG  413
              DNG A S G
Sbjct  61   KIDNGVAVSGG  71



>dbj|BAE99230.1| hypothetical protein [Arabidopsis thaliana]
Length=334

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAER+GWK+QKRDE+ + DFCR+IGV++ VLKVWMHNNKNT  +RD
Sbjct  212  KEKMHEFAERVGWKMQKRDEDDVRDFCRQIGVDKSVLKVWMHNNKNTFNRRD  263



>ref|NP_568570.1| homeobox protein 23 [Arabidopsis thaliana]
 sp|Q9FIW9.1|ZHD10_ARATH RecName: Full=Zinc-finger homeodomain protein 10; Short=AtZHD10; 
AltName: Full=Homeobox protein 23; Short=AtHB-23 [Arabidopsis 
thaliana]
 dbj|BAB11382.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13855.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51422.1| unknown protein [Arabidopsis thaliana]
 gb|AED94472.1| homeobox protein 23 [Arabidopsis thaliana]
Length=334

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAER+GWK+QKRDE+ + DFCR+IGV++ VLKVWMHNNKNT  +RD
Sbjct  212  KEKMHEFAERVGWKMQKRDEDDVRDFCRQIGVDKSVLKVWMHNNKNTFNRRD  263



>ref|XP_004489395.1| PREDICTED: transcription factor HB29-like [Cicer arietinum]
Length=322

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KM +FAE +GWK+QKRDEE +N FC E+GV+R VLKVWMHNNKNT+G++
Sbjct  224  KEKMHEFAESVGWKMQKRDEETVNGFCNEVGVDRSVLKVWMHNNKNTLGRK  274



>gb|AAP44422.1| ZF-HD homeobox protein-like protein, partial [Lactuca sativa]
 gb|AAP44423.1| ZF-HD homeobox protein-like protein, partial [Lactuca sativa]
 gb|AAP44424.1| ZF-HD homeobox protein-like protein, partial [Lactuca sativa]
 gb|AAP44425.1| ZF-HD homeobox protein-like protein, partial [Lactuca serriola]
Length=132

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD-NITTTP  458
            K KM  FAE++GWK+Q+ D++LI DFC EIG+ RG+ KVWMHNNKN  GKR+ +ITTT 
Sbjct  39   KEKMTIFAEKLGWKMQRCDDKLIADFCNEIGIRRGIFKVWMHNNKNNFGKREKDITTTA  97



>ref|XP_009797863.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
sylvestris]
Length=358

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNK  497
            K +ML+FAE++ WKIQKRDEELI+DFC +IGVE+GVLKVWMHNNK
Sbjct  232  KERMLEFAEKVEWKIQKRDEELISDFCSKIGVEKGVLKVWMHNNK  276



>gb|AES74711.2| transcription factor HB29-like protein [Medicago truncatula]
Length=333

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KM +FA+++GWK+QKRDEE++N FC E+GV+R VLKVWMHNNKNT+G++
Sbjct  234  KEKMHEFADKVGWKMQKRDEEMVNGFCNEVGVDRSVLKVWMHNNKNTLGRK  284



>ref|XP_010936702.1| PREDICTED: zinc-finger homeodomain protein 6-like [Elaeis guineensis]
Length=293

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K +MLDFAER+GW+IQK+DE L+ DFC E+GV R VLKVWMHNNK+T+ K+
Sbjct  233  KERMLDFAERMGWRIQKQDEALVEDFCAEVGVSRQVLKVWMHNNKHTIRKQ  283



>ref|XP_002870762.1| hypothetical protein ARALYDRAFT_494014 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47021.1| hypothetical protein ARALYDRAFT_494014 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAER+GWK+QKRDE+ + DFCR+IGV++ VLKVWMHNNKNT  +RD
Sbjct  207  KEKMHEFAERLGWKMQKRDEDDVRDFCRQIGVDKSVLKVWMHNNKNTFNRRD  258



>gb|AAM64462.1| unknown [Arabidopsis thaliana]
Length=333

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAER+GWK+QKRD++ + DFCR+IGV++ VLKVWMHNNKNT  +RD
Sbjct  211  KEKMHEFAERVGWKMQKRDZDDVRDFCRQIGVDKSVLKVWMHNNKNTFNRRD  262



>gb|EPS70696.1| hypothetical protein M569_04063, partial [Genlisea aurea]
Length=242

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML+ AE++GWK+QKRDE+LI  FC +IGV++ V +VWMHNNKNT GK+D
Sbjct  191  KDKMLELAEKVGWKMQKRDEDLIAQFCCDIGVDKAVFRVWMHNNKNTFGKKD  242



>gb|ABK22835.1| unknown [Picea sitchensis]
Length=249

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K +MLDFAE++GW+IQK DE+ +  FC++IGV+R VLKVWMHNNKNT+GK+ +
Sbjct  197  KDRMLDFAEKVGWRIQKHDEQAVQQFCQDIGVKRRVLKVWMHNNKNTLGKKSD  249



>gb|AAO62943.1| ZF-HD homeobox protein-like protein [Lactuca sativa]
 gb|AAO62944.1| ZF-HD homeobox protein-like protein, partial [Lactuca sativa]
Length=128

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD-NITTTP  458
            K KM  FAE++GWK+Q+ D++LI DFC EIG+ RG+ KVWMHNNKN  GKR+ +ITTT 
Sbjct  33   KEKMTIFAEKLGWKMQRCDDKLIADFCNEIGIRRGIFKVWMHNNKNNFGKREKDITTTA  91



>ref|XP_003517792.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=296

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K KM +FAE++GW++QK DE L+ DFC+EIGV RGV KVWMHNNKNT G++ ++
Sbjct  211  KEKMHNFAEKLGWRMQKGDEGLVQDFCKEIGVSRGVFKVWMHNNKNTSGRKKSL  264



>ref|XP_006405598.1| hypothetical protein EUTSA_v10028098mg [Eutrema salsugineum]
 dbj|BAJ34518.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47051.1| hypothetical protein EUTSA_v10028098mg [Eutrema salsugineum]
Length=320

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 64/101 (63%), Gaps = 14/101 (14%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD-NITTTPa  455
            K KM +FA+R+GWK+QKRDE+ + DFCR+IGV++ VLKVWMHNNKNT  +RD   +   A
Sbjct  199  KEKMHEFADRVGWKMQKRDEDDVRDFCRQIGVDKSVLKVWMHNNKNTFNRRDLPFSVAGA  258

Query  454  aaaaADNGNAHSLGFDIGRVNSAPLTSDFNLRPESNNNGSH  332
            A A  DNG         G  N AP+ +      E+NNN  H
Sbjct  259  AVAKIDNGG--------GGGNHAPIPAG-----ETNNNEFH  286



>ref|XP_009151829.1| PREDICTED: zinc-finger homeodomain protein 9 [Brassica rapa]
Length=344

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVG-KRDNITTTPa  455
            K KM +FA+RIGWKIQKRDE  + DFCR++GV++GVLKVWMHNNKNT   +RD   +   
Sbjct  217  KDKMHEFADRIGWKIQKRDEGEVRDFCRDVGVDKGVLKVWMHNNKNTFNTRRDQPFSGDT  276

Query  454  aaaaADNGNAHSLG  413
                 DNG A S G
Sbjct  277  TVQKIDNGVAVSGG  290



>ref|XP_011097503.1| PREDICTED: zinc-finger homeodomain protein 2-like [Sesamum indicum]
Length=249

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVG  485
            K KML+FAER+GWKIQK+DEE++  FC E+G++R VLKVWMHNNK+T+G
Sbjct  196  KDKMLNFAERLGWKIQKQDEEMVQQFCSELGIKRHVLKVWMHNNKHTLG  244



>ref|XP_008220815.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X2 [Prunus 
mume]
 ref|XP_008220816.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X2 [Prunus 
mume]
Length=350

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTTP  458
            K +M +FAE++GW+IQK+DEE +  FC E+GV+R VL+VWMHNNKN+  K+ +I TTP
Sbjct  268  KERMTEFAEKVGWRIQKQDEEEVERFCSEVGVKRQVLRVWMHNNKNSAKKQSDILTTP  325



>ref|XP_008220812.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X1 [Prunus 
mume]
Length=356

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTTP  458
            K +M +FAE++GW+IQK+DEE +  FC E+GV+R VL+VWMHNNKN+  K+ +I TTP
Sbjct  274  KERMTEFAEKVGWRIQKQDEEEVERFCSEVGVKRQVLRVWMHNNKNSAKKQSDILTTP  331



>ref|XP_004233362.1| PREDICTED: zinc-finger homeodomain protein 9 [Solanum lycopersicum]
Length=331

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 74/130 (57%), Gaps = 18/130 (14%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTTPaa  452
            K KML+FAE++ WK+QKRDE+L+N+FC EIGVE+GVLKVWMHNNK T     +I+     
Sbjct  202  KIKMLEFAEKVEWKMQKRDEDLVNNFCNEIGVEKGVLKVWMHNNKTT-----SISGKKLD  256

Query  451  aaaADNGNAHSLGFDIGRVNSAPLT-------------SDFNLRPESNNNGSHSQNHYAL  311
                DNG+ H  G     VN   +              S+F++  ES+ N  + + + + 
Sbjct  257  QPNTDNGHNHQNGNSNYTVNGFCIVDRNNTTHHHDNTDSEFHIHHESSMNDDNKKENSSF  316

Query  310  HSGDVLAANG  281
             + +V+  NG
Sbjct  317  GANNVVVTNG  326



>ref|NP_189534.1| homeobox protein 34 [Arabidopsis thaliana]
 sp|Q9LHF0.1|ZHD9_ARATH RecName: Full=Zinc-finger homeodomain protein 9; Short=AtZHD9; 
AltName: Full=Homeobox protein 34; Short=AtHB-34 [Arabidopsis 
thaliana]
 dbj|BAB02255.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13170.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91220.1| unknown protein [Arabidopsis thaliana]
 gb|AEE77508.1| homeobox protein 34 [Arabidopsis thaliana]
Length=312

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  491
            K KM +FA+RIGWKIQKRDE+ + DFCREIGV++GVLKVWMHNNKN+
Sbjct  204  KEKMHEFADRIGWKIQKRDEDEVRDFCREIGVDKGVLKVWMHNNKNS  250



>ref|XP_009111615.1| PREDICTED: zinc-finger homeodomain protein 9-like [Brassica rapa]
Length=309

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV-GKRDNITTTPa  455
            K KM +FA+RIGWK QKRDE+ + DFCRE+GV++GVLKVWMHNNKNT   +RD       
Sbjct  197  KEKMHEFADRIGWKFQKRDEDDVRDFCREVGVDKGVLKVWMHNNKNTFNNRRDQPVAGGT  256

Query  454  aaaaADNGNA  425
                 DNG A
Sbjct  257  TVHCVDNGVA  266



>ref|XP_002877141.1| hypothetical protein ARALYDRAFT_484662 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53400.1| hypothetical protein ARALYDRAFT_484662 [Arabidopsis lyrata subsp. 
lyrata]
Length=299

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  491
            K KM +FA RIGWKIQKRDE+ + DFCREIGV++GVLKVWMHNNKN+
Sbjct  196  KEKMHEFAARIGWKIQKRDEDEVRDFCREIGVDKGVLKVWMHNNKNS  242



>gb|KHN05023.1| ZF-HD homeobox protein [Glycine soja]
Length=190

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITT  464
            K KML FAER GW+IQK DE L+  FC+EIG++R VLKVWMHNNKNT  KR+  T+
Sbjct  135  KEKMLAFAERAGWRIQKLDESLVQKFCQEIGIKRRVLKVWMHNNKNTFAKRNPSTS  190



>ref|XP_003555538.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=200

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITT  464
            K KML FAER GW+IQK DE L+  FC+EIG++R VLKVWMHNNKNT  KR+  T+
Sbjct  145  KEKMLAFAERAGWRIQKLDESLVQKFCQEIGIKRRVLKVWMHNNKNTFAKRNPSTS  200



>gb|EPS61017.1| hypothetical protein M569_13783, partial [Genlisea aurea]
Length=244

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML+F+ER+GW+IQK+DEEL+  FC E+G++R VLKVWMHNNK+T+G++
Sbjct  194  KDKMLNFSERLGWRIQKQDEELVQQFCHEVGIKRHVLKVWMHNNKHTLGEK  244



>emb|CDY20008.1| BnaA09g02430D [Brassica napus]
Length=281

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KM +FA+RIGWK QKRDE+ + DFCRE+GV++GVLKVWMHNNKNT   R
Sbjct  169  KEKMHEFADRIGWKFQKRDEDDVRDFCREVGVDKGVLKVWMHNNKNTFNNR  219



>gb|KHN01227.1| ZF-HD homeobox protein [Glycine soja]
Length=116

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K KM +FAE++GW++QK DE L+ DFC+EIGV RGV KVWMHNNKNT G++ ++
Sbjct  31   KEKMHNFAEKLGWRMQKGDEGLVQDFCKEIGVSRGVFKVWMHNNKNTSGRKKSL  84



>ref|XP_006373320.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 gb|ERP51117.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
Length=286

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  488
            K +M  FAER+GWK+QKRDE+L+ +FC E+GV+RGVLKVWMHNNKN++
Sbjct  221  KERMYQFAERVGWKMQKRDEDLVQEFCNEVGVDRGVLKVWMHNNKNSL  268



>ref|XP_002305381.2| hypothetical protein POPTR_0004s12500g [Populus trichocarpa]
 gb|EEE85892.2| hypothetical protein POPTR_0004s12500g [Populus trichocarpa]
Length=334

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K +M  FAE++GWK+QKRDE+L+ +FC E+GV+R  LKVWMHNNKN+ GK++++
Sbjct  225  KERMHQFAEKVGWKMQKRDEDLVQEFCNEVGVDRSALKVWMHNNKNSFGKKEHL  278



>ref|XP_010682105.1| PREDICTED: zinc-finger homeodomain protein 3-like [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K KM++FAE++GWKIQK++EE++  FC+EIGV+R VLKVWMHNNK+ +GK+ +I
Sbjct  280  KEKMMEFAEKVGWKIQKQEEEVVQQFCQEIGVKRRVLKVWMHNNKHNLGKKSDI  333



>ref|XP_003576623.1| PREDICTED: zinc-finger homeodomain protein 1 [Brachypodium distachyon]
Length=290

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K +ML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+GK+ +I
Sbjct  237  KDRMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKPSI  290



>ref|XP_010425683.1| PREDICTED: zinc-finger homeodomain protein 9-like [Camelina sativa]
Length=323

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  491
            K KM +FA+RIGWKIQKRDE+ + +FCREIGV++GVLKVWMHNNKNT
Sbjct  208  KEKMHEFADRIGWKIQKRDEDDVREFCREIGVDKGVLKVWMHNNKNT  254



>emb|CDY00104.1| BnaC09g01970D [Brassica napus]
Length=312

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KM +FA+RIGWK QKRDE+ + DFCRE+GV++GVLKVWMHNNKNT   R
Sbjct  200  KEKMHEFADRIGWKFQKRDEDDVRDFCREVGVDKGVLKVWMHNNKNTFNNR  250



>ref|XP_011100018.1| PREDICTED: zinc-finger homeodomain protein 1-like [Sesamum indicum]
Length=215

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML+ AER+ WKIQK+DEEL+  FC E+GV+R VLKVWMHNNK+T+GK+
Sbjct  164  KDKMLNLAERLDWKIQKQDEELVQQFCSEVGVKRHVLKVWMHNNKHTLGKK  214



>ref|XP_008782488.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=259

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K +MLDFAER+GW+IQK+DE L+ +FC E+GV R VLKVWMHNNK+++ K+  
Sbjct  199  KERMLDFAERVGWRIQKQDEALVEEFCAEVGVSRQVLKVWMHNNKHSIRKQQQ  251



>ref|XP_009336904.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=351

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 7/75 (9%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTTPaa  452
            K +M++FAER+ W+IQK+DEE +  FC E+GV+R VL+VWMHNNKNT+ K+ ++T T   
Sbjct  269  KERMMEFAERVEWRIQKQDEEEVERFCAEVGVKRQVLRVWMHNNKNTIKKQGDVTAT---  325

Query  451  aaaADNGNAHSLGFD  407
                 N  A  L FD
Sbjct  326  ----TNAIATGLSFD  336



>ref|XP_008795929.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=267

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  491
            K +MLDFAER+GW+IQK+DE L+ DFC E+GV R VLKVWMHNNK++
Sbjct  208  KERMLDFAERVGWRIQKQDEALVQDFCAEVGVSRPVLKVWMHNNKHS  254



>gb|AAP44426.1| ZF-HD homeobox protein-like protein, partial [Lactuca saligna]
 gb|AAP44427.1| ZF-HD homeobox protein-like protein, partial [Lactuca saligna]
 gb|AAP44428.1| ZF-HD homeobox protein-like protein, partial [Lactuca saligna]
Length=132

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  FAER+GWK+Q+ D++LI DFC EIG+ RG+ KVWMHNNKN  GKR+
Sbjct  39   KEKMTIFAERLGWKMQRCDDKLIADFCNEIGIRRGIFKVWMHNNKNNFGKRE  90



>ref|XP_009364948.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=349

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 7/75 (9%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTTPaa  452
            K +M++FAER+ W+IQK+DEE +  FC E+GV+R VL+VWMHNNKNT+ K+ ++T T   
Sbjct  267  KERMMEFAERVEWRIQKQDEEEVERFCAEVGVKRQVLRVWMHNNKNTIKKQGDVTAT---  323

Query  451  aaaADNGNAHSLGFD  407
                 N  A  L FD
Sbjct  324  ----TNAIATGLSFD  334



>ref|XP_010502894.1| PREDICTED: zinc-finger homeodomain protein 9 [Camelina sativa]
Length=321

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  491
            K KM +FA+RIGWKIQKRDE+ + +FCREIGV++GVLKVWMHNNKNT
Sbjct  210  KEKMHEFADRIGWKIQKRDEDDVREFCREIGVDKGVLKVWMHNNKNT  256



>ref|XP_006285795.1| hypothetical protein CARUB_v10007269mg [Capsella rubella]
 gb|EOA18693.1| hypothetical protein CARUB_v10007269mg [Capsella rubella]
Length=341

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAER+GWK+QKRDE+ + +FCR+IGV++ VLKVWMHNNKNT  +RD
Sbjct  216  KEKMHEFAERLGWKMQKRDEDDVREFCRQIGVDKSVLKVWMHNNKNTFNRRD  267



>ref|XP_010514609.1| PREDICTED: zinc-finger homeodomain protein 9-like [Camelina sativa]
Length=323

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  491
            K KM +FA+RIGWKIQKRDE+ + +FCREIGV++GVLKVWMHNNKNT
Sbjct  211  KEKMHEFADRIGWKIQKRDEDDVREFCREIGVDKGVLKVWMHNNKNT  257



>ref|XP_002460367.1| hypothetical protein SORBIDRAFT_02g027040 [Sorghum bicolor]
 gb|EER96888.1| hypothetical protein SORBIDRAFT_02g027040 [Sorghum bicolor]
Length=302

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+GK+
Sbjct  251  KDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKK  301



>ref|XP_007154109.1| hypothetical protein PHAVU_003G091100g [Phaseolus vulgaris]
 gb|ESW26103.1| hypothetical protein PHAVU_003G091100g [Phaseolus vulgaris]
Length=271

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTT  461
            K KML+FAER+GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K++  T  
Sbjct  214  KEKMLNFAERVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKNPPTAA  270



>gb|EYU34567.1| hypothetical protein MIMGU_mgv1a012253mg [Erythranthe guttata]
Length=256

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML+FAER+GW+IQK++EE++  FC E+G++R VLKVWMHNNK+T+GK+
Sbjct  205  KDKMLNFAERLGWRIQKQEEEMVQQFCGEMGIKRHVLKVWMHNNKHTLGKK  255



>emb|CAN60614.1| hypothetical protein VITISV_003253 [Vitis vinifera]
Length=155

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTT  461
            K KML FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K+  + ++
Sbjct  97   KEKMLSFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKTPLPSS  153



>ref|XP_008357201.1| PREDICTED: zinc-finger homeodomain protein 5-like [Malus domestica]
 ref|XP_008357202.1| PREDICTED: zinc-finger homeodomain protein 5-like [Malus domestica]
Length=345

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTT  461
            K +M++F E++GW+IQK+DEE +  FC E+GV+R VL+VWMHNNKNT+ K+ ++T T
Sbjct  265  KERMMEFGEKVGWRIQKQDEEEVERFCAEVGVKRQVLRVWMHNNKNTIKKQGDVTAT  321



>gb|ADK63402.1| homeobox domain zinc finger protein [Brassica rapa]
Length=163

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FA+R+GWK+QKRDE+ + +FCR+IGV++ VLKVWMHNNKN   +RD
Sbjct  40   KEKMHEFADRVGWKMQKRDEDDVREFCRQIGVDKSVLKVWMHNNKNNFNRRD  91



>ref|XP_002273802.1| PREDICTED: zinc-finger homeodomain protein 11 [Vitis vinifera]
Length=326

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  F+E++GWK+QK DE L+ +FC E+GV +GVLKVWMHNNK+T GKRD
Sbjct  214  KEKMFSFSEKLGWKMQKSDEGLVEEFCNEVGVGKGVLKVWMHNNKHTFGKRD  265



>ref|XP_006470838.1| PREDICTED: ZF-HD homeobox protein At5g65410-like [Citrus sinensis]
Length=314

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K KM +FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K++NI
Sbjct  253  KEKMFNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKNNI  306



>gb|KDO42061.1| hypothetical protein CISIN_1g048741mg [Citrus sinensis]
Length=314

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K KM +FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K++NI
Sbjct  253  KEKMFNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKNNI  306



>sp|A2Z259.1|ZHD1_ORYSI RecName: Full=Zinc-finger homeodomain protein 1 [Oryza sativa 
Indica Group]
 gb|EAZ09420.1| hypothetical protein OsI_31693 [Oryza sativa Indica Group]
Length=279

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+GK+
Sbjct  227  KDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKK  277



>ref|XP_006431432.1| hypothetical protein CICLE_v10003702mg [Citrus clementina]
 gb|ESR44672.1| hypothetical protein CICLE_v10003702mg [Citrus clementina]
Length=314

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K KM +FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K++NI
Sbjct  253  KEKMFNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKNNI  306



>ref|XP_011070997.1| PREDICTED: zinc-finger homeodomain protein 10 [Sesamum indicum]
Length=295

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  F+E++GWK+QK DE  + +FC+EIGV +GVLKVWMHNNKNT GK+D
Sbjct  192  KEKMHSFSEKLGWKMQKSDEVAVREFCQEIGVPKGVLKVWMHNNKNTFGKKD  243



>ref|XP_006660717.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Oryza brachyantha]
Length=285

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+GK+
Sbjct  233  KDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKK  283



>ref|NP_001063419.1| Os09g0466400 [Oryza sativa Japonica Group]
 sp|Q6YXH5.1|ZHD1_ORYSJ RecName: Full=Zinc-finger homeodomain protein 1; Short=OsZHD1 
[Oryza sativa Japonica Group]
 dbj|BAD17515.1| putative ZF-HD homeobox protein [Oryza sativa Japonica Group]
 dbj|BAF25333.1| Os09g0466400 [Oryza sativa Japonica Group]
 dbj|BAG98341.1| unnamed protein product [Oryza sativa Japonica Group]
Length=279

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+GK+
Sbjct  227  KDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKK  277



>ref|XP_008788352.1| PREDICTED: zinc-finger homeodomain protein 4-like [Phoenix dactylifera]
Length=249

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML FAERIGW++Q+++E ++ +FC+EIGV+R VLKVWMHNNK+++ K++
Sbjct  194  KEKMLSFAERIGWRLQRQEESVVEEFCQEIGVKRKVLKVWMHNNKHSLAKQE  245



>gb|KJB18247.1| hypothetical protein B456_003G042700 [Gossypium raimondii]
Length=270

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML  AER+GW+IQK DEE++  FC E GV+R VLKVWMHNNK+T+GK+
Sbjct  219  KEKMLSLAERLGWRIQKHDEEIVQQFCNETGVKRHVLKVWMHNNKHTLGKK  269



>ref|XP_004156724.1| PREDICTED: LOW QUALITY PROTEIN: ZF-HD homeobox protein At5g65410-like 
[Cucumis sativus]
Length=301

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTT  461
            K KML FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K+D ++ +
Sbjct  237  KEKMLRFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKDTMSPS  293



>ref|XP_004142854.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 gb|KGN51402.1| hypothetical protein Csa_5G527900 [Cucumis sativus]
Length=301

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTT  461
            K KML FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K+D ++ +
Sbjct  237  KEKMLRFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKDTMSPS  293



>ref|XP_004230410.1| PREDICTED: zinc-finger homeodomain protein 4 [Solanum lycopersicum]
Length=290

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITT  464
            K KML+FAE++GWKIQK++E ++  FC+E+GV+R VLKVWMHNNK+++ K+ NITT
Sbjct  227  KDKMLNFAEKVGWKIQKQEEGVVQQFCQEVGVKRRVLKVWMHNNKHSLAKK-NITT  281



>ref|XP_006878601.1| hypothetical protein AMTR_s00011p00255340 [Amborella trichopoda]
 gb|ERM94746.1| hypothetical protein AMTR_s00011p00255340 [Amborella trichopoda]
Length=242

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K +ML FAER+GW+IQK+DE  +  FC E+GV+R VLKVWMHNNKNT+GK+ +
Sbjct  189  KERMLGFAERVGWRIQKQDEGAVQRFCDEVGVKRHVLKVWMHNNKNTLGKKSS  241



>emb|CAC34413.1| ZF-HD homeobox protein [Flaveria trinervia]
Length=263

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KML FAE++GWK+Q+ D++++ DFC EIG+ R VLKVWMHNNKNT  K++ 
Sbjct  174  KEKMLTFAEKVGWKLQRCDDKMVADFCSEIGIRRRVLKVWMHNNKNTSAKKEQ  226



>ref|XP_009800645.1| PREDICTED: putative F-box/LRR-repeat protein At5g41840 [Nicotiana 
sylvestris]
Length=456

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML+FAER+GWK+QKRD+ELI+DFC +IGV++ +LKVWMH+N+NT    D
Sbjct  24   KKKMLEFAERVGWKLQKRDDELISDFCSKIGVKKRLLKVWMHDNENTFATAD  75



>ref|XP_006859182.1| hypothetical protein AMTR_s00070p00154800 [Amborella trichopoda]
 gb|ERN20649.1| hypothetical protein AMTR_s00070p00154800 [Amborella trichopoda]
Length=218

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTT  461
            K KM  FA+++GW+IQK+D+  +  FC E+GV+R VLKVWMHNNKNT+GK+D++T +
Sbjct  161  KEKMQAFADKLGWRIQKQDDVALQQFCMEVGVKRHVLKVWMHNNKNTLGKKDSLTAS  217



>ref|XP_009613099.1| PREDICTED: zinc-finger homeodomain protein 4 [Nicotiana tomentosiformis]
Length=304

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTTP  458
            K KM +FAE++GWKIQK++E ++  FC+E+G++R VLKVWMHNNK+++ K+++ +T P
Sbjct  243  KEKMFNFAEKVGWKIQKQEETVVQQFCQELGIKRRVLKVWMHNNKHSLAKKNSNSTIP  300



>ref|XP_010940074.1| PREDICTED: zinc-finger homeodomain protein 6-like [Elaeis guineensis]
Length=302

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGK  482
            K +MLDFAER+GW+IQK+DE L+++FC E+GV R VLKVW+HNNK++V K
Sbjct  242  KERMLDFAERLGWRIQKQDEALVDEFCAEVGVSRQVLKVWIHNNKHSVRK  291



>ref|XP_010554331.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554332.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554333.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554334.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554335.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554336.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
Length=322

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNIT  467
            K KM++FAER+GWKIQ+++E ++  FC+EIGV+R VLKVWMHNNK+ + K+ N T
Sbjct  244  KEKMMNFAERVGWKIQRQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKKNST  298



>ref|XP_004957068.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Setaria italica]
Length=281

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K +ML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+GK+
Sbjct  230  KDRMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKK  280



>gb|EYU22417.1| hypothetical protein MIMGU_mgv1a026791mg, partial [Erythranthe 
guttata]
Length=107

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  F+ ++GWK+QK DE  + +FCREIGV RGVLKVWMHNNKNT  K++
Sbjct  8    KEKMRYFSAKMGWKMQKSDEAAVREFCREIGVTRGVLKVWMHNNKNTFAKKE  59



>ref|XP_009139922.1| PREDICTED: zinc-finger homeodomain protein 10 [Brassica rapa]
 emb|CDX74428.1| BnaA04g09610D [Brassica napus]
Length=317

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FA+R+GWK+QKRDE+ + +FCR+IGV++ VLKVWMHNNKN   +RD
Sbjct  194  KEKMHEFADRVGWKMQKRDEDDVREFCRQIGVDKSVLKVWMHNNKNNFNRRD  245



>ref|XP_004165400.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 gb|KGN62606.1| hypothetical protein Csa_2G361700 [Cucumis sativus]
Length=320

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K +ML+FAE++GW+IQK+DEE +  FC E+GV+R VLKVWMHNNKNTV K++
Sbjct  249  KDRMLEFAEKVGWRIQKQDEEEVERFCTEVGVKRQVLKVWMHNNKNTVKKQN  300



>ref|XP_008444722.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
Length=314

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K +ML+FAE++GW+IQK+DEE +  FC E+GV+R VLKVWMHNNKNTV K++
Sbjct  242  KDRMLEFAEKVGWRIQKQDEEEVERFCTEVGVKRQVLKVWMHNNKNTVKKQN  293



>ref|XP_010450775.1| PREDICTED: zinc-finger homeodomain protein 10-like [Camelina 
sativa]
Length=334

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAER+GWK+QKRD++ + +FCR+IGV++ VLKVWMHNNKNT  +RD
Sbjct  211  KEKMHEFAERLGWKMQKRDDDDVREFCRQIGVDKSVLKVWMHNNKNTFNRRD  262



>ref|XP_004152776.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
Length=276

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K +ML+FAE++GW+IQK+DEE +  FC E+GV+R VLKVWMHNNKNTV K++
Sbjct  205  KDRMLEFAEKVGWRIQKQDEEEVERFCTEVGVKRQVLKVWMHNNKNTVKKQN  256



>ref|XP_006291497.1| hypothetical protein CARUB_v10017644mg [Capsella rubella]
 gb|EOA24395.1| hypothetical protein CARUB_v10017644mg [Capsella rubella]
Length=323

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  488
            K KM +FA++IGWKIQKRDE+ + +FCREIGV++GVLKVWMHNNKNT 
Sbjct  209  KEKMHEFADKIGWKIQKRDEDNVREFCREIGVDKGVLKVWMHNNKNTF  256



>ref|XP_010441087.1| PREDICTED: zinc-finger homeodomain protein 10 [Camelina sativa]
Length=342

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FAER+GWK+QKRD++ + +FCR+IGV++ VLKVWMHNNKNT  +RD
Sbjct  219  KEKMHEFAERLGWKMQKRDDDDVREFCRQIGVDKSVLKVWMHNNKNTFNRRD  270



>ref|XP_007157626.1| hypothetical protein PHAVU_002G085400g [Phaseolus vulgaris]
 gb|ESW29620.1| hypothetical protein PHAVU_002G085400g [Phaseolus vulgaris]
Length=264

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KM +F+E++GW++QK DE L+ DFC EIGV RGV KVWMHNNKNT  KR
Sbjct  185  KEKMQNFSEKLGWRMQKGDEGLVQDFCNEIGVSRGVFKVWMHNNKNTCRKR  235



>ref|XP_003551238.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=250

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAE++GW+IQK DE ++ +FC E GV+R VLKVWMHNNK+T+GK+
Sbjct  199  KDKMLAFAEKLGWRIQKHDEGVVQEFCSETGVQRHVLKVWMHNNKHTLGKK  249



>gb|EEE69868.1| hypothetical protein OsJ_29679 [Oryza sativa Japonica Group]
Length=247

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+GK+
Sbjct  195  KDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKK  245



>ref|XP_009396485.1| PREDICTED: zinc-finger homeodomain protein 6-like [Musa acuminata 
subsp. malaccensis]
Length=380

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  488
            K KML FAERIGW IQ++D E+I  FC EIGV R VLKVWMHNNK+T+
Sbjct  294  KNKMLAFAERIGWTIQRQDSEMIEQFCAEIGVRRQVLKVWMHNNKHTI  341



>gb|EMT05330.1| ZF-HD homeobox protein [Aegilops tauschii]
Length=84

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+GK+
Sbjct  30   KDKMLAFAERVGWRIQKHDEAAVLQFCDEVGVKRHVLKVWMHNNKHTLGKK  80



>emb|CBI27705.3| unnamed protein product [Vitis vinifera]
Length=127

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGK  482
            K KML FAER GW+IQK++E L+  FC+EIG++R VLKVWMHNNKN   K
Sbjct  73   KEKMLSFAERAGWRIQKQEESLVQQFCQEIGIKRRVLKVWMHNNKNLARK  122



>emb|CAC34408.1| ZF-HD homeobox protein [Flaveria bidentis]
Length=241

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KML FAE++GWK+Q+ D++++ DFC EIG+ R VLKVWMHNNKNT+ K++ 
Sbjct  152  KEKMLTFAEKVGWKLQRCDDKMVADFCSEIGIRRRVLKVWMHNNKNTLAKKEQ  204



>ref|XP_004293203.2| PREDICTED: zinc-finger homeodomain protein 6 [Fragaria vesca 
subsp. vesca]
Length=349

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 5/75 (7%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD-----NIT  467
            K +M++FAE++GW+IQK+DEE +  FC E+GV+R VL+VWMHNNKNTV K       +IT
Sbjct  262  KVRMVEFAEKVGWRIQKQDEEDVERFCDEVGVKRQVLRVWMHNNKNTVKKMQHDHDHDIT  321

Query  466  TTPaaaaaADNGNAH  422
            TT +  A  +N  AH
Sbjct  322  TTTSQLALENNVEAH  336



>gb|EPS61775.1| hypothetical protein M569_13018, partial [Genlisea aurea]
Length=276

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML FAE++GWKIQK++E ++  FC+E+GV+R VLKVWMHNNK+T+ K++
Sbjct  225  KEKMLIFAEKVGWKIQKQEESVVQQFCQEVGVKRRVLKVWMHNNKHTLAKKN  276



>ref|XP_011010943.1| PREDICTED: zinc-finger homeodomain protein 9-like [Populus euphratica]
Length=324

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K +M  FAE++GWK+QK DE+L+ +FC E+GV+R  LKVWMHNNKN+ GK++++
Sbjct  217  KERMHQFAEKVGWKMQKGDEDLVQEFCNEVGVDRSALKVWMHNNKNSFGKKEHL  270



>ref|XP_003633412.1| PREDICTED: zinc-finger homeodomain protein 4 [Vitis vinifera]
Length=281

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTT  461
            K KML FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K+  + ++
Sbjct  223  KEKMLSFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKTPLPSS  279



>ref|XP_008219382.1| PREDICTED: zinc-finger homeodomain protein 2 [Prunus mume]
Length=282

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML+FAE++GW+IQK DE  + +FC E GV+R VLKVWMHNNK+T+GK+
Sbjct  229  KEKMLEFAEKVGWRIQKHDEAAVEEFCGETGVKRQVLKVWMHNNKHTLGKK  279



>ref|XP_011012906.1| PREDICTED: zinc-finger homeodomain protein 4-like [Populus euphratica]
Length=280

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTT  461
            K KML+FAE++GWK+QK++E ++  FC+EIG++R VLKVWMHNNK  + K++  TTT
Sbjct  223  KEKMLNFAEKVGWKLQKQEETVVQQFCQEIGIKRRVLKVWMHNNKLNLAKKNPSTTT  279



>ref|XP_007222197.1| hypothetical protein PRUPE_ppa009679mg [Prunus persica]
 gb|EMJ23396.1| hypothetical protein PRUPE_ppa009679mg [Prunus persica]
Length=282

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML+FAE++GW+IQK DE  + +FC E GV+R VLKVWMHNNK+T+GK+
Sbjct  229  KEKMLEFAEKVGWRIQKHDEAAVEEFCGETGVKRQVLKVWMHNNKHTLGKK  279



>ref|XP_003520078.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=291

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K KM +FAE++GW++QK +E L+ DFC EIGV RGV KVWMHNNKNT  +  ++
Sbjct  207  KQKMYNFAEKLGWRMQKAEEGLVQDFCNEIGVSRGVFKVWMHNNKNTSARNKSL  260



>ref|XP_009365549.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=344

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTT  461
            K +M++F E++GW+IQK+DEE +  FC E+GV+R VL+VWMHNNKNT+ K+ ++  T
Sbjct  262  KERMMEFGEKVGWRIQKQDEEEVERFCAEVGVKRQVLRVWMHNNKNTIKKQGDVAAT  318



>ref|XP_008460585.1| PREDICTED: zinc-finger homeodomain protein 4 [Cucumis melo]
Length=298

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTT  461
            K KML FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K++ ++ +
Sbjct  234  KEKMLRFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKETMSPS  290



>ref|XP_007215708.1| hypothetical protein PRUPE_ppa008908mg [Prunus persica]
 gb|EMJ16907.1| hypothetical protein PRUPE_ppa008908mg [Prunus persica]
Length=315

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -1

Query  613  FAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
              ER+GWK+QKRDEE++ +FC EI V++GVLKVWMHNNKNT  KRD
Sbjct  189  LGERVGWKMQKRDEEIVQEFCNEINVDKGVLKVWMHNNKNTFAKRD  234



>ref|XP_007156483.1| hypothetical protein PHAVU_003G289700g [Phaseolus vulgaris]
 gb|ESW28477.1| hypothetical protein PHAVU_003G289700g [Phaseolus vulgaris]
Length=219

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAE++GW+IQK DE L+ +FC + G++R VLKVWMHNNK+T+GK+
Sbjct  168  KDKMLAFAEKLGWRIQKHDESLVQEFCSQTGLQRHVLKVWMHNNKHTLGKK  218



>gb|KDO82923.1| hypothetical protein CISIN_1g046396mg [Citrus sinensis]
Length=314

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML FAER+GWK+ + +E+L  DFC E+GV R V KVWMHNNKN  G++D
Sbjct  216  KEKMLSFAERLGWKMNRAEEKLTQDFCSEVGVSRRVFKVWMHNNKNASGRKD  267



>ref|XP_006438687.1| hypothetical protein CICLE_v10032160mg [Citrus clementina]
 ref|XP_006483155.1| PREDICTED: transcription factor HB29-like [Citrus sinensis]
 gb|ESR51927.1| hypothetical protein CICLE_v10032160mg [Citrus clementina]
Length=314

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML FAER+GWK+ + +E+L  DFC E+GV R V KVWMHNNKN  G++D
Sbjct  216  KEKMLSFAERLGWKMNRAEEKLTQDFCSEVGVSRRVFKVWMHNNKNASGRKD  267



>ref|XP_004238801.1| PREDICTED: zinc-finger homeodomain protein 10-like [Solanum lycopersicum]
Length=297

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  F+E++GWK+QK DE  +++FC EIGV +GVL+VWMHNNKNT GK+D
Sbjct  184  KEKMHSFSEKLGWKLQKCDEAAVDEFCNEIGVGKGVLRVWMHNNKNTFGKKD  235



>gb|KHN07994.1| ZF-HD homeobox protein [Glycine soja]
Length=214

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAE++GW++QK D+ ++ +FC EIGV+R VLKVWMHNNK+T+GK+
Sbjct  163  KDKMLVFAEKLGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTLGKK  213



>ref|XP_003550152.1| PREDICTED: ZF-HD homeobox protein At5g65410-like [Glycine max]
Length=286

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KML+FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K+ N
Sbjct  219  KDKMLNFAEKVGWKIQKQEESVVQHFCQEIGVKRRVLKVWMHNNKHNLAKKIN  271



>ref|XP_002525870.1| transcription factor, putative [Ricinus communis]
 gb|EEF36564.1| transcription factor, putative [Ricinus communis]
Length=311

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K KML+FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K+  +
Sbjct  241  KEKMLNFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKSPL  294



>emb|CDO97666.1| unnamed protein product [Coffea canephora]
Length=299

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KML+FAE++GWKIQK++E ++  FC+E+GV+R VLKVWMHNNK+ + K+++
Sbjct  234  KEKMLNFAEKVGWKIQKQEEAVVQQFCQEVGVKRRVLKVWMHNNKHNLAKKNH  286



>gb|KHN07993.1| ZF-HD homeobox protein [Glycine soja]
Length=234

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAE++GW++QK D+ ++ +FC EIGV+R VLKVWMHNNK+T+GK+
Sbjct  183  KDKMLVFAEKLGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTLGKK  233



>gb|ABY61020.1| zinc finger-homeodomain protein 1 [Eschscholzia californica]
Length=267

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KM+ FAER+GW+IQK DEE++  FC E GV R VLKVWMHNNK+T+GK+
Sbjct  216  KDKMIVFAERLGWRIQKHDEEIVQQFCNETGVRRQVLKVWMHNNKHTLGKK  266



>ref|XP_010527865.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
Length=316

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KML+FAER+GWKIQ+++E ++  FC+E+GV+R VLKVWMHNNK+ + K+++
Sbjct  234  KEKMLNFAERVGWKIQRQEESVVQQFCQEVGVKRRVLKVWMHNNKHNLAKKNS  286



>ref|XP_009762783.1| PREDICTED: zinc-finger homeodomain protein 4-like [Nicotiana 
sylvestris]
Length=306

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTTP  458
            K KM +FAE++GWKIQK++E ++  FC+E+G++R VLKVWMHNNK+ + K+++  T P
Sbjct  245  KEKMFNFAEKVGWKIQKQEETVVQQFCQELGIKRRVLKVWMHNNKHNLAKKNSNVTIP  302



>ref|XP_004495441.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cicer arietinum]
Length=201

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITT  464
            K KM DFAE+ GW+IQK +E ++  FC+EIG++R VLKVWMHNNKNT  KR N++T
Sbjct  146  KEKMQDFAEKAGWRIQKLEESVVQKFCQEIGIKRRVLKVWMHNNKNTFAKR-NLST  200



>ref|XP_011028421.1| PREDICTED: zinc-finger homeodomain protein 4 [Populus euphratica]
Length=296

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML+FAE++GWK+QK++E ++  FC+EIGV+R VLKVWMHNNK+++ K++
Sbjct  234  KEKMLNFAEKVGWKLQKQEETVVQQFCQEIGVKRRVLKVWMHNNKHSLAKKN  285



>gb|KHN07995.1| ZF-HD homeobox protein [Glycine soja]
Length=234

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAE++GW++QK D+ ++ +FC EIGV+R VLKVWMHNNK+T+GK+
Sbjct  183  KDKMLVFAEKLGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTLGKK  233



>ref|XP_004499360.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cicer arietinum]
Length=318

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTTP  458
            K KML FAE++GWKIQK++E L+  FC+EIGV R VLKVWMHNNK+ + K+ +    P
Sbjct  257  KDKMLSFAEKVGWKIQKQEESLVQQFCQEIGVRRRVLKVWMHNNKHNLAKKLHTNLPP  314



>ref|XP_003529692.1| PREDICTED: ZF-HD homeobox protein At5g65410-like isoform X1 [Glycine 
max]
 ref|XP_006584131.1| PREDICTED: ZF-HD homeobox protein At5g65410-like isoform X2 [Glycine 
max]
Length=283

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML+FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K++
Sbjct  222  KDKMLNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKN  273



>gb|KHN07843.1| ZF-HD homeobox protein [Glycine soja]
Length=166

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 4/79 (5%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR--DNITTTP  458
            K KM  F+E++GW++QK D+ L+ +FC EIGV RGV KVWMHNNKNT+ K+  D I    
Sbjct  48   KEKMHGFSEKLGWRMQKGDDGLVQEFCNEIGVSRGVFKVWMHNNKNTLRKKPEDGIGNAN  107

Query  457  aaaaaADNGNAH--SLGFD  407
            A  +  D+GNA+  S GFD
Sbjct  108  APQSNNDDGNANGGSGGFD  126



>ref|XP_010527155.1| PREDICTED: zinc-finger homeodomain protein 1 [Tarenaya hassleriana]
Length=179

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K +ML  AERIGW+IQ++DEEL+  FC E GV R VLKVW+HNNK+T+GKR
Sbjct  111  KERMLGLAERIGWRIQRQDEELVQRFCEETGVSRQVLKVWLHNNKHTLGKR  161



>ref|NP_001062055.1| Os08g0479400 [Oryza sativa Japonica Group]
 sp|Q6ZB90.1|ZHD2_ORYSJ RecName: Full=Zinc-finger homeodomain protein 2; Short=OsZHD2 
[Oryza sativa Japonica Group]
 sp|A2YWA6.1|ZHD2_ORYSI RecName: Full=Zinc-finger homeodomain protein 2 [Oryza sativa 
Indica Group]
 dbj|BAD09750.1| putative ZF-HD homeobox protein [Oryza sativa Japonica Group]
 dbj|BAF23969.1| Os08g0479400 [Oryza sativa Japonica Group]
 gb|EAZ07367.1| hypothetical protein OsI_29618 [Oryza sativa Indica Group]
 dbj|BAG98791.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+GK+
Sbjct  238  KDKMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTLGKK  288



>gb|KHN03576.1| ZF-HD homeobox protein [Glycine soja]
Length=277

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KML+FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K+ N
Sbjct  210  KDKMLNFAEKVGWKIQKQEESVVQHFCQEIGVKRRVLKVWMHNNKHNLAKKIN  262



>ref|XP_003530620.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=261

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAE++GW++QK D+ ++ +FC EIGV+R VLKVWMHNNK+T+GK+
Sbjct  210  KDKMLVFAEKLGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTLGKK  260



>ref|XP_006385095.1| hypothetical protein POPTR_0004s23860g, partial [Populus trichocarpa]
 gb|ERP62892.1| hypothetical protein POPTR_0004s23860g, partial [Populus trichocarpa]
Length=312

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML+FAE++GWK+QK++E ++  FC+EIGV+R VLKVWMHNNK+++ K++
Sbjct  251  KEKMLNFAEKVGWKLQKQEETVVQQFCQEIGVKRRVLKVWMHNNKHSLAKKN  302



>gb|KHN40205.1| ZF-HD homeobox protein [Glycine soja]
Length=204

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML+FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K++
Sbjct  143  KDKMLNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKN  194



>ref|XP_010681042.1| PREDICTED: zinc-finger homeodomain protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=284

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KMLD AE++GWKIQK+DE +++ FC E GV+R VLKVWMHNNK T+GK+
Sbjct  233  KDKMLDLAEKLGWKIQKQDELVVHQFCHETGVKRHVLKVWMHNNKLTLGKK  283



>gb|KJB64195.1| hypothetical protein B456_010G036300 [Gossypium raimondii]
Length=245

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  488
            K KMLDFAE++GW+IQK DE  I  FC E GV+R VLKVWMHNNKNT+
Sbjct  195  KEKMLDFAEKLGWRIQKHDEAAIQQFCEETGVKRHVLKVWMHNNKNTL  242



>ref|XP_010939727.1| PREDICTED: zinc-finger homeodomain protein 2 [Elaeis guineensis]
Length=281

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK DE  +  FC E G++R VLKVWMHNNK+T+GK+
Sbjct  230  KDKMLAFAERVGWRIQKHDEAAVQQFCNEAGIKRHVLKVWMHNNKHTLGKK  280



>ref|XP_008378554.1| PREDICTED: zinc-finger homeodomain protein 2-like [Malus domestica]
Length=270

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML+FAE++GW+IQK DE  I +FC E GV+R V KVWMHNNK+T+GK+
Sbjct  217  KEKMLEFAEKVGWRIQKHDEAAIEEFCGETGVKRHVFKVWMHNNKHTLGKK  267



>gb|AAT39967.1| Putative ZF-HD homeobox protein, identical [Solanum demissum]
Length=291

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  F+E++GWK+QK DE  +++FC EIGV + VL+VWMHNNKNT+GK+D
Sbjct  178  KEKMHSFSEKLGWKLQKCDETAVDEFCNEIGVGKSVLRVWMHNNKNTIGKKD  229



>ref|XP_007048627.1| Homeobox protein 21, putative [Theobroma cacao]
 gb|EOX92784.1| Homeobox protein 21, putative [Theobroma cacao]
Length=253

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KML+FAE+ GW+IQK DE ++  FC+EIG++R VLKVWMHNNK ++ K+D+
Sbjct  198  KEKMLNFAEKAGWRIQKLDESVVQQFCQEIGIKRRVLKVWMHNNKQSLAKKDS  250



>gb|EEE68874.1| hypothetical protein OsJ_27685 [Oryza sativa Japonica Group]
Length=267

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+GK+
Sbjct  215  KDKMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTLGKK  265



>ref|XP_006349273.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Solanum tuberosum]
Length=287

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KML+FAE++GWKIQK++E ++  FC+E+GV+R VLKVWMHNNK+++ K+++
Sbjct  227  KDKMLNFAEKVGWKIQKQEEGVVQQFCQEVGVKRRVLKVWMHNNKHSLAKKND  279



>emb|CAC34410.1| ZF-HD homeobox protein [Flaveria bidentis]
Length=259

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT-VGKRDN  473
            K KM + AER+GWK+QK+DE+LI +FC EIGV++GV KVWMHNNK T  GK+D+
Sbjct  142  KQKMHELAERVGWKMQKKDEDLIINFCNEIGVDKGVFKVWMHNNKMTSAGKKDS  195



>ref|XP_006366102.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=287

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  F+E++GWK+QK DE  +++FC EIGV + VL+VWMHNNKNT+GK+D
Sbjct  178  KEKMHSFSEKLGWKLQKCDETAVDEFCNEIGVGKSVLRVWMHNNKNTIGKKD  229



>ref|XP_011003997.1| PREDICTED: zinc-finger homeodomain protein 2-like [Populus euphratica]
Length=268

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K +ML+FAE+IGW+IQK D+  +N FC EIGV+R VLKVWMHNNKN   +RD +
Sbjct  199  KERMLEFAEKIGWRIQKHDDMALNQFCNEIGVKRNVLKVWMHNNKNAHRRRDGV  252



>ref|XP_006660219.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Oryza brachyantha]
Length=290

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+GK+
Sbjct  239  KDKMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTLGKK  289



>emb|CDP01539.1| unnamed protein product [Coffea canephora]
Length=252

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KM D AE++GWKIQK+DEE++   C E+G++R VLKVWMHNNK+T+GK+
Sbjct  201  KEKMSDLAEKLGWKIQKQDEEVVQQLCNELGIKRQVLKVWMHNNKHTLGKK  251



>gb|KJB30399.1| hypothetical protein B456_005G141400 [Gossypium raimondii]
Length=262

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITT  464
            K KM  FAER+GW++ K +E+LI +FC E+GV RGVLKVWMHNNKNT  K++ ++ 
Sbjct  159  KEKMHAFAERLGWRMPKGEEKLIQEFCNEVGVNRGVLKVWMHNNKNTFSKKEILSV  214



>ref|XP_008810728.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=344

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  488
            K KML FAER+GW+I K+DE L+  FC E+GV R VLKVWMHNNK+T+
Sbjct  270  KEKMLAFAERVGWRIHKQDEALVEQFCAEVGVRRQVLKVWMHNNKHTI  317



>ref|NP_001149424.1| LOC100283050 [Zea mays]
 gb|ACG35395.1| ZF-HD protein dimerisation region containing protein [Zea mays]
Length=308

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K +ML FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+GK+
Sbjct  257  KXRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTLGKK  307



>ref|XP_010099792.1| hypothetical protein L484_010980 [Morus notabilis]
 gb|EXB80410.1| hypothetical protein L484_010980 [Morus notabilis]
Length=336

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML+FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K+
Sbjct  278  KEKMLNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAKK  328



>ref|XP_007046103.1| Homeobox protein 34, putative [Theobroma cacao]
 gb|EOY01935.1| Homeobox protein 34, putative [Theobroma cacao]
Length=305

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  FAER+GW++ K +E LI  FC E+GV+RGVLKVWMHNNKNT  K++
Sbjct  197  KEKMHAFAERLGWRMPKSEERLIEGFCNEVGVDRGVLKVWMHNNKNTFSKKE  248



>ref|XP_010060081.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Eucalyptus grandis]
 gb|KCW66609.1| hypothetical protein EUGRSUZ_F00403 [Eucalyptus grandis]
Length=330

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK DE  +  FC E GV+R VLKVWMHNNK+T+GK+
Sbjct  279  KEKMLGFAERLGWRIQKHDETAVEQFCAETGVKRHVLKVWMHNNKHTLGKK  329



>gb|KJB80187.1| hypothetical protein B456_013G085500 [Gossypium raimondii]
Length=292

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KM DFA R+GW++ K +E+L+ +FC E+GV+RGVLKVWMHNNKN  GK+
Sbjct  202  KQKMHDFAVRVGWRMPKGEEKLVKEFCDEVGVDRGVLKVWMHNNKNNFGKK  252



>gb|KJB58948.1| hypothetical protein B456_009G231800 [Gossypium raimondii]
Length=255

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK DE  +  FC E GV+R VLKVWMHNNK T+GK+
Sbjct  204  KDKMLGFAERLGWRIQKHDEAAVEQFCEETGVKRQVLKVWMHNNKYTLGKK  254



>gb|ABO92969.1| ZF-HD homeobox domain-containing protein [Solanum tuberosum]
Length=285

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  F+E++GWK+QK DE  +++FC EIGV + VL+VWMHNNKNT+GK+D
Sbjct  172  KEKMHSFSEKLGWKLQKCDETAVDEFCNEIGVGKNVLRVWMHNNKNTIGKKD  223



>ref|XP_011087615.1| PREDICTED: zinc-finger homeodomain protein 4 [Sesamum indicum]
Length=291

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML FAE++GWKIQK++E ++  FC+E+GV+R VLKVWMHNNK+ + K++
Sbjct  230  KEKMLSFAEKVGWKIQKQEESVVQQFCQEVGVKRRVLKVWMHNNKHNLAKKN  281



>gb|KJB70777.1| hypothetical protein B456_011G090900 [Gossypium raimondii]
Length=297

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML+FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + +++
Sbjct  228  KEKMLNFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNLARKN  279



>ref|XP_001777987.1| predicted protein [Physcomitrella patens]
 gb|EDQ57200.1| predicted protein [Physcomitrella patens]
Length=165

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KM  FAE++GWKIQK DE  + +FC E+GV+R VLKVWMHNNKNT+GK+
Sbjct  113  KEKMGVFAEKLGWKIQKHDEAAVQEFCAEVGVKRHVLKVWMHNNKNTIGKK  163



>ref|XP_008789175.1| PREDICTED: zinc-finger homeodomain protein 4-like [Phoenix dactylifera]
Length=253

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITT  464
            K KML+FA+RIGW++Q+++E ++  FC+EIGV+R VLKVWMHNNK+++ K++   T
Sbjct  198  KEKMLNFADRIGWRLQRQEESMVQQFCQEIGVKRRVLKVWMHNNKHSLAKKELPPT  253



>ref|XP_009609489.1| PREDICTED: putative FBD-associated F-box protein At5g38570 [Nicotiana 
tomentosiformis]
Length=270

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 2/54 (4%)
 Frame = -1

Query  622  MLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNK--NTVGKRDNIT  467
            ML+FAERIGWK+QK+D ELI++FC +IGVE+ + KVW+HNNK  +T+GKRD  T
Sbjct  1    MLEFAERIGWKLQKQDGELISEFCSKIGVEKRIFKVWLHNNKKNSTLGKRDQPT  54



>tpg|DAA48505.1| TPA: putative homeobox DNA-binding domain superfamily protein 
[Zea mays]
Length=308

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K +ML FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+GK+
Sbjct  257  KDRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTLGKK  307



>emb|CDP11470.1| unnamed protein product [Coffea canephora]
Length=268

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK+DE L+  FC E  V+R VLKVWMHNNK+++GK+
Sbjct  217  KEKMLAFAERLGWRIQKQDEALVQQFCAETNVKRHVLKVWMHNNKHSLGKK  267



>ref|XP_002267747.1| PREDICTED: zinc-finger homeodomain protein 3 [Vitis vinifera]
Length=250

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 43/56 (77%), Gaps = 2/56 (4%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITT  464
            K KML FAER GW+IQK++E L+  FC+EIG++R VLKVWMHNNKN    R N +T
Sbjct  196  KEKMLSFAERAGWRIQKQEESLVQQFCQEIGIKRRVLKVWMHNNKNLA--RKNPST  249



>gb|ABY61023.1| zinc finger homeodomain protein 1 [Saruma henryi]
Length=242

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK+DE ++  FC E  V+R VLKVWMHNNK+T+GK+
Sbjct  191  KDKMLGFAERVGWRIQKQDEAVVQQFCMETNVKRHVLKVWMHNNKHTLGKK  241



>gb|KJB48886.1| hypothetical protein B456_008G092000 [Gossypium raimondii]
Length=231

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML+ AERIGW+IQK DE L+  FC E GV+R V KVWMHNNK+T+GK+
Sbjct  180  KEKMLELAERIGWRIQKHDELLVQQFCNENGVKRQVFKVWMHNNKHTLGKK  230



>ref|XP_009395689.1| PREDICTED: zinc-finger homeodomain protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=359

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER GW+IQ++D  ++  FC EIGV R VLKVWMHNNK+TV ++
Sbjct  284  KDKMLAFAERAGWRIQRQDSAMVEQFCAEIGVRRQVLKVWMHNNKHTVTRK  334



>ref|XP_004973708.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Setaria italica]
Length=298

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K +ML FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+GK+
Sbjct  247  KDRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTLGKK  297



>ref|XP_006827241.1| hypothetical protein AMTR_s00010p00261450 [Amborella trichopoda]
 gb|ERM94478.1| hypothetical protein AMTR_s00010p00261450 [Amborella trichopoda]
Length=232

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  F++++GWK+QK+DE LI +FC EIG+ R VLKVWMHNNK+T+G++D
Sbjct  172  KEKMYGFSDKLGWKMQKQDEGLIQEFCDEIGIRRSVLKVWMHNNKSTLGRKD  223



>ref|XP_004489767.1| PREDICTED: ZF-HD homeobox protein At5g65410-like [Cicer arietinum]
Length=259

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML+ AE++GW+IQK DE L+ +FC E GV+R VLKVWMHNNK+T+GK+
Sbjct  208  KDKMLELAEKLGWRIQKHDEGLVQEFCNESGVKRHVLKVWMHNNKHTLGKK  258



>ref|XP_006394037.1| hypothetical protein EUTSA_v10005568mg [Eutrema salsugineum]
 dbj|BAJ34581.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31323.1| hypothetical protein EUTSA_v10005568mg [Eutrema salsugineum]
Length=286

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGK  482
            K +ML  AERIGW+IQ++D+ELI  FC+E GV R VLKVW+HNNK+T+GK
Sbjct  205  KERMLGLAERIGWRIQRQDDELIQRFCQETGVPRQVLKVWLHNNKHTLGK  254



>emb|CDY34299.1| BnaA01g14020D [Brassica napus]
Length=225

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK D+  +  FC E GV R VLK+WMHNNKN++GK+
Sbjct  174  KDKMLAFAERLGWRIQKHDDAAVEQFCAETGVRRQVLKIWMHNNKNSLGKK  224



>ref|NP_001151888.1| ZF-HD protein dimerisation region containing protein [Zea mays]
 gb|ACG44773.1| ZF-HD protein dimerisation region containing protein [Zea mays]
Length=273

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K +ML FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+GK+
Sbjct  222  KDRMLAFAERVGWRIQKHDEAAVQQFCDEVCVKRHVLKVWMHNNKHTLGKK  272



>gb|ABY61018.1| zinc finger-homeodomain protein 1 [Welwitschia mirabilis]
Length=316

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM +FA+R+GW+IQK+DE  +  FC E+GV+R VLKVWMHNNK+T+GK+ 
Sbjct  265  KEKMQNFADRLGWRIQKQDESAVQQFCNEVGVKRHVLKVWMHNNKHTLGKKS  316



>ref|XP_009607017.1| PREDICTED: zinc-finger homeodomain protein 4-like [Nicotiana 
tomentosiformis]
Length=261

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KML+FAE+IGWK+QK+++ ++  FC+E+GV+R VLKVWMHNNK+++ K+++
Sbjct  200  KEKMLNFAEKIGWKMQKQEDAMVQQFCQEVGVKRRVLKVWMHNNKHSLAKKNS  252



>emb|CDY33960.1| BnaC02g43770D [Brassica napus]
Length=269

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGK  482
            K +ML  AERIGW+IQ++D+E+I  FC+E GV R VLKVW+HNNK+T+GK
Sbjct  191  KERMLGLAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHNNKHTLGK  240



>ref|XP_009381483.1| PREDICTED: zinc-finger homeodomain protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=281

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK DE  +  FC E  ++R VLKVWMHNNKNT+GK+
Sbjct  230  KDKMLAFAERLGWRIQKHDEAAVQQFCEETCIKRHVLKVWMHNNKNTLGKK  280



>gb|ADE77597.1| unknown [Picea sitchensis]
Length=249

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KM  FAE++GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+GK+
Sbjct  198  KDKMCSFAEKLGWRIQKHDEAAVQQFCMELGVKRHVLKVWMHNNKHTLGKK  248



>ref|XP_004288462.1| PREDICTED: zinc-finger homeodomain protein 1-like [Fragaria vesca 
subsp. vesca]
Length=267

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K +ML+ AER+GW+IQK+DE  +  FC E GV+R VLKVWMHNNK+T+GK+
Sbjct  216  KERMLELAERLGWRIQKQDEAAVQSFCDETGVKRHVLKVWMHNNKHTLGKK  266



>ref|XP_009138327.1| PREDICTED: zinc-finger homeodomain protein 2 [Brassica rapa]
Length=225

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK D+  +  FC E GV R VLK+WMHNNKN++GK+
Sbjct  174  KEKMLAFAERLGWRIQKHDDATVEQFCAETGVRRQVLKIWMHNNKNSLGKK  224



>ref|XP_010086552.1| hypothetical protein L484_001444 [Morus notabilis]
 gb|EXB20251.1| hypothetical protein L484_001444 [Morus notabilis]
Length=370

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTT  461
            K KM  FAE++GWK+Q+ +E+++ +FC E+G+ +GVLKVWMHNNK+T+GKR + ++ 
Sbjct  258  KEKMCLFAEKLGWKMQRSEEKVVEEFCNEVGIRKGVLKVWMHNNKHTLGKRSSSSSA  314



>ref|XP_006433874.1| hypothetical protein CICLE_v10002355mg [Citrus clementina]
 ref|XP_006472516.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Citrus sinensis]
 gb|ESR47114.1| hypothetical protein CICLE_v10002355mg [Citrus clementina]
 gb|KDO81100.1| hypothetical protein CISIN_1g043261mg [Citrus sinensis]
Length=233

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAE++GW+IQK DE  +  FC E GV+R VLKVWMHNNK+T+GK+
Sbjct  182  KEKMLGFAEQLGWRIQKHDEASVEQFCAETGVKRHVLKVWMHNNKHTLGKK  232



>ref|XP_009602563.1| PREDICTED: zinc-finger homeodomain protein 2-like [Nicotiana 
tomentosiformis]
Length=254

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW++QK+DE L+  FC E  V+R V KVWMHNNK+T+GK+
Sbjct  203  KDKMLAFAERLGWRMQKQDEALVQQFCAETNVQRHVFKVWMHNNKHTLGKK  253



>ref|XP_010254805.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
 ref|XP_010254806.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
 ref|XP_010254807.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
Length=363

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K +ML+FAE+IGWKIQK+DE  +  FC E+GV+R VLKVWMHNNK+++ K+ 
Sbjct  311  KDRMLEFAEKIGWKIQKQDEPEVQQFCAEVGVKRQVLKVWMHNNKHSMKKKQ  362



>ref|XP_009130511.1| PREDICTED: zinc-finger homeodomain protein 1-like [Brassica rapa]
 emb|CDY37827.1| BnaAnng04880D [Brassica napus]
Length=272

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGK  482
            K +ML  AERIGW+IQ++D+E+I  FC+E GV R VLKVW+HNNK+T+GK
Sbjct  195  KERMLGLAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHNNKHTLGK  244



>ref|XP_009788413.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
sylvestris]
Length=215

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  F+E++GW++QK DE  +++FC EIGV +GV +VWMHNNK+T+GK+D
Sbjct  145  KNKMYSFSEKLGWRLQKCDEAKVDEFCNEIGVGKGVFRVWMHNNKSTLGKKD  196



>gb|ABY61024.1| zinc finger-homeodomain protein 2 [Saruma henryi]
Length=258

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML FAE++GW+IQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K++
Sbjct  202  KEKMLSFAEKVGWRIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKN  253



>ref|XP_010252306.1| PREDICTED: zinc-finger homeodomain protein 4 [Nelumbo nucifera]
Length=271

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITT  464
            K KML FAE++GW+IQK++E ++  FC+EIG++R VLKVWMHNNK+ + K++  T 
Sbjct  216  KEKMLGFAEKVGWRIQKQEEAVVQQFCQEIGIKRRVLKVWMHNNKHNMAKKNAPTA  271



>ref|XP_009406459.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=271

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K KML FAE++GWK+QK++E ++  FC+EIGV+R VLKVWMHNNK+ + K++ +
Sbjct  215  KEKMLSFAEKVGWKLQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHHLAKKNPL  268



>gb|KDP29745.1| hypothetical protein JCGZ_18680 [Jatropha curcas]
Length=246

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K +ML  AER+GW+IQK DE ++  FC E GV+R VLKVWMHNNK+T+GK+
Sbjct  195  KERMLSLAERLGWRIQKHDEAVVQQFCNETGVKRHVLKVWMHNNKHTLGKK  245



>ref|XP_009758154.1| PREDICTED: zinc-finger homeodomain protein 2-like [Nicotiana 
sylvestris]
Length=254

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW++QK+DE L+  FC E  V+R V KVWMHNNK+T+GK+
Sbjct  203  KDKMLAFAERLGWRMQKQDEALVQQFCAETNVQRHVFKVWMHNNKHTLGKK  253



>ref|XP_007023152.1| Homeobox protein 31 [Theobroma cacao]
 gb|EOY25774.1| Homeobox protein 31 [Theobroma cacao]
Length=292

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML+FA+++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K++
Sbjct  227  KEKMLNFADKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKN  278



>ref|XP_010065227.1| PREDICTED: zinc-finger homeodomain protein 4-like [Eucalyptus 
grandis]
 gb|KCW62572.1| hypothetical protein EUGRSUZ_G00066 [Eucalyptus grandis]
Length=332

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KM  FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K++
Sbjct  270  KEKMFSFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKN  321



>ref|XP_010246039.1| PREDICTED: zinc-finger homeodomain protein 1-like [Nelumbo nucifera]
Length=310

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDN  473
            K KML+FAE++GW+IQK D+  +N FC E+GV+R VLKVWMHNNKN   KR+N
Sbjct  239  KDKMLEFAEKLGWRIQKHDDVALNQFCSEVGVKRHVLKVWMHNNKNAQRKREN  291



>ref|XP_006376247.1| hypothetical protein POPTR_0013s11330g [Populus trichocarpa]
 gb|ERP54044.1| hypothetical protein POPTR_0013s11330g [Populus trichocarpa]
Length=254

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K +ML+FAE+IGW+IQK D+  +N FC E+G++R VLKVWMHNNKN   +RD +
Sbjct  178  KERMLEFAEKIGWRIQKHDDMALNQFCNEVGIKRNVLKVWMHNNKNAHRRRDGV  231



>ref|XP_009403385.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403391.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403399.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=259

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K KML FAE++GW++QK++E ++  FC+EIGV+R VLKVWMHNNK+ + K+ ++
Sbjct  203  KEKMLSFAEKLGWRLQKQEESMVQQFCQEIGVKRRVLKVWMHNNKHHLAKKTSL  256



>emb|CDY03431.1| BnaC01g16510D [Brassica napus]
Length=223

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAER+GW+IQK D+  +  FC E GV R VLK+WMHNNKN++GK+
Sbjct  172  KEKMLAFAERLGWRIQKHDDAAVEQFCAETGVRRQVLKIWMHNNKNSLGKK  222



>ref|XP_003518249.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=258

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAE++GW+IQK DE  +  FC EI V+R VLKVWMHNNK+T+GK+
Sbjct  207  KDKMLAFAEQLGWRIQKHDESAVEQFCAEINVKRNVLKVWMHNNKSTLGKK  257



>ref|XP_006836924.1| hypothetical protein AMTR_s00099p00145100 [Amborella trichopoda]
 gb|ERM99777.1| hypothetical protein AMTR_s00099p00145100 [Amborella trichopoda]
Length=267

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KML FAE++GW+IQK++E ++  FC+EIGV+R VLKVWMHNNK+ + K+
Sbjct  214  KEKMLSFAEKVGWRIQKQEEGVVQQFCQEIGVKRRVLKVWMHNNKHNLAKK  264



>ref|XP_010927875.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
Length=263

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML+FA RIGW++Q+++E ++  FC+EIGV+R VLKVWMHNNK+++ K++
Sbjct  208  KEKMLNFAHRIGWRLQRQEEGMVQQFCQEIGVKRRVLKVWMHNNKHSLAKKE  259



>ref|XP_004299701.1| PREDICTED: zinc-finger homeodomain protein 2-like [Fragaria vesca 
subsp. vesca]
Length=254

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KM++FAE++GW+IQK DE  + +FC   GV+R VLKVWMHNNK+T+GK+
Sbjct  203  KEKMVEFAEKVGWRIQKHDEAAVEEFCAVTGVKRQVLKVWMHNNKHTIGKK  253



>ref|XP_010104483.1| hypothetical protein L484_025452 [Morus notabilis]
 gb|EXC01084.1| hypothetical protein L484_025452 [Morus notabilis]
Length=302

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTT  461
            K +ML FA+RIGW+IQ++D+  IN FC EIGV+R VLKVWMHNNKN   +R++   +
Sbjct  231  KDRMLAFADRIGWRIQRQDDVAINQFCSEIGVKRNVLKVWMHNNKNAHRRRESAPPS  287



>gb|KEH32742.1| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=365

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML+FAE++GWK QK++E ++  FC+EIGV+R VLKVWMHNNK+ + K+ 
Sbjct  296  KEKMLNFAEKVGWKFQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAKKQ  347



>ref|XP_006426297.1| hypothetical protein CICLE_v10027024mg [Citrus clementina]
 ref|XP_006466284.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Citrus sinensis]
 gb|ESR39537.1| hypothetical protein CICLE_v10027024mg [Citrus clementina]
 gb|KDO60627.1| hypothetical protein CISIN_1g026161mg [Citrus sinensis]
Length=242

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K +ML+ AE++GW+IQK DEE++  FC + GV+R VLKVWMHNNK+T+GK+
Sbjct  191  KDRMLELAEKLGWRIQKHDEEVVQQFCNDTGVKRHVLKVWMHNNKHTLGKK  241



>ref|XP_009416998.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416999.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=267

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K KML FAE++GW++QK++E ++  FC+EIGV+R VLKVWMHNNK+ + K++++
Sbjct  211  KEKMLSFAEKVGWRLQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHHLAKKNSL  264



>ref|XP_002514009.1| transcription factor, putative [Ricinus communis]
 gb|EEF48592.1| transcription factor, putative [Ricinus communis]
Length=270

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKR  479
            K KMLDF+ER+GW+IQK DE  +  FC + G++R VLKVWMHNNK+T+GK+
Sbjct  219  KDKMLDFSERLGWRIQKHDEAAVEQFCSDNGIKRQVLKVWMHNNKHTLGKK  269



>ref|XP_010908151.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
Length=264

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K KML FAERIGW++Q+++E ++  FC+EIGV R VL+VWMHNNK+ + K++
Sbjct  209  KEKMLSFAERIGWRLQRQEESVVEQFCQEIGVNRKVLRVWMHNNKHNLAKKE  260



>ref|XP_002325543.2| hypothetical protein POPTR_0019s11070g [Populus trichocarpa]
 gb|EEE99924.2| hypothetical protein POPTR_0019s11070g [Populus trichocarpa]
Length=244

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRD  476
            K +ML+FAE+IGW+IQK D+  +N FC E+GV+R VLKVWMHNNKN   +RD
Sbjct  175  KERMLEFAEKIGWRIQKHDDMALNQFCNEVGVKRNVLKVWMHNNKNAHRRRD  226



>gb|KJB75536.1| hypothetical protein B456_012G046200 [Gossypium raimondii]
Length=196

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNITTT  461
            K KML FAE+ GW+IQK DE  +  FC+EIG++R VLKVWMHNNK +   ++NI+  
Sbjct  140  KEKMLSFAEKAGWRIQKLDENAVQQFCQEIGIKRRVLKVWMHNNKQSFANKNNISAA  196



>ref|XP_006376248.1| hypothetical protein POPTR_0013s11330g [Populus trichocarpa]
 gb|ERP54045.1| hypothetical protein POPTR_0013s11330g [Populus trichocarpa]
Length=281

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  631  KGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVGKRDNI  470
            K +ML+FAE+IGW+IQK D+  +N FC E+G++R VLKVWMHNNKN   +RD +
Sbjct  205  KERMLEFAEKIGWRIQKHDDMALNQFCNEVGIKRNVLKVWMHNNKNAHRRRDGV  258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875