BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF043B08

Length=714
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002310798.2|  hypothetical protein POPTR_0007s12510g             301   8e-97   Populus trichocarpa [western balsam poplar]
ref|XP_011025730.1|  PREDICTED: probable protein phosphatase 2C 80      301   9e-97   Populus euphratica
emb|CBI17553.3|  unnamed protein product                                294   2e-95   Vitis vinifera
ref|XP_010099838.1|  putative protein phosphatase 2C 80                 297   4e-95   Morus notabilis
gb|KHN00560.1|  Hypothetical protein glysoja_000228                     295   2e-94   Glycine soja [wild soybean]
ref|XP_006574705.1|  PREDICTED: probable protein phosphatase 2C 5...    293   2e-94   Glycine max [soybeans]
ref|XP_006599390.1|  PREDICTED: probable protein phosphatase 2C 5...    293   3e-94   
ref|XP_003547993.2|  PREDICTED: probable protein phosphatase 2C 5...    293   3e-94   
gb|KHN44501.1|  Hypothetical protein glysoja_035733                     293   3e-94   Glycine soja [wild soybean]
ref|XP_006599391.1|  PREDICTED: probable protein phosphatase 2C 5...    292   3e-94   
ref|XP_006599388.1|  PREDICTED: probable protein phosphatase 2C 5...    293   4e-94   
ref|XP_006599386.1|  PREDICTED: probable protein phosphatase 2C 5...    293   5e-94   
ref|XP_006599387.1|  PREDICTED: probable protein phosphatase 2C 5...    292   6e-94   
ref|XP_002268376.2|  PREDICTED: probable protein phosphatase 2C 5...    295   1e-93   Vitis vinifera
ref|XP_002525110.1|  protein phosphatase 2c, putative                   292   2e-93   Ricinus communis
ref|XP_007160777.1|  hypothetical protein PHAVU_001G015900g             293   1e-92   Phaseolus vulgaris [French bean]
gb|KEH40106.1|  protein phosphatase 2C family protein                   293   1e-92   Medicago truncatula
gb|KHN12726.1|  Hypothetical protein glysoja_008689                     292   2e-92   Glycine soja [wild soybean]
ref|XP_006601312.1|  PREDICTED: probable protein phosphatase 2C 5...    292   2e-92   Glycine max [soybeans]
ref|XP_003550371.1|  PREDICTED: probable protein phosphatase 2C 5...    292   2e-92   Glycine max [soybeans]
ref|XP_008338675.1|  PREDICTED: probable protein phosphatase 2C 80      290   2e-92   Malus domestica [apple tree]
ref|XP_006375083.1|  hypothetical protein POPTR_0014s04230g             292   3e-92   
ref|XP_008453722.1|  PREDICTED: probable protein phosphatase 2C 80      290   3e-92   Cucumis melo [Oriental melon]
ref|XP_004149170.1|  PREDICTED: probable protein phosphatase 2C 5...    290   3e-92   Cucumis sativus [cucumbers]
ref|XP_007156027.1|  hypothetical protein PHAVU_003G252300g             287   3e-92   Phaseolus vulgaris [French bean]
ref|XP_007156026.1|  hypothetical protein PHAVU_003G252300g             287   3e-92   Phaseolus vulgaris [French bean]
ref|XP_008220774.1|  PREDICTED: probable protein phosphatase 2C 55      291   4e-92   Prunus mume [ume]
ref|XP_007223264.1|  hypothetical protein PRUPE_ppa004472mg             291   4e-92   Prunus persica
ref|XP_009356669.1|  PREDICTED: probable protein phosphatase 2C 80      289   5e-92   Pyrus x bretschneideri [bai li]
ref|XP_010649173.1|  PREDICTED: probable protein phosphatase 2C 5...    291   5e-92   Vitis vinifera
gb|KJB14503.1|  hypothetical protein B456_002G129300                    291   5e-92   Gossypium raimondii
ref|XP_006375084.1|  hypothetical protein POPTR_0014s04230g             291   6e-92   
gb|KJB14505.1|  hypothetical protein B456_002G129300                    291   6e-92   Gossypium raimondii
ref|XP_003544423.1|  PREDICTED: probable protein phosphatase 2C 5...    291   6e-92   Glycine max [soybeans]
ref|XP_004499136.1|  PREDICTED: probable protein phosphatase 2C 5...    291   7e-92   
ref|XP_006595942.1|  PREDICTED: probable protein phosphatase 2C 5...    291   7e-92   Glycine max [soybeans]
gb|KHG04398.1|  hypothetical protein F383_28830                         291   8e-92   Gossypium arboreum [tree cotton]
ref|XP_011031594.1|  PREDICTED: probable protein phosphatase 2C 55      291   9e-92   Populus euphratica
ref|XP_002510354.1|  protein phosphatase 2c, putative                   290   1e-91   
ref|XP_007017484.1|  Phosphatase 2c, putative isoform 6                 290   2e-91   
emb|CBI19663.3|  unnamed protein product                                282   2e-91   Vitis vinifera
ref|XP_007017480.1|  Phosphatase 2c, putative isoform 2                 290   2e-91   
ref|XP_008241643.1|  PREDICTED: probable protein phosphatase 2C 80      287   3e-91   Prunus mume [ume]
ref|XP_007017483.1|  Phosphatase 2c, putative isoform 5                 290   3e-91   
ref|XP_007017482.1|  Phosphatase 2c, putative isoform 4                 290   3e-91   
ref|XP_008377320.1|  PREDICTED: probable protein phosphatase 2C 55      289   3e-91   Malus domestica [apple tree]
ref|XP_008798754.1|  PREDICTED: probable protein phosphatase 2C 55      288   4e-91   Phoenix dactylifera
gb|KDP38477.1|  hypothetical protein JCGZ_04402                         288   5e-91   Jatropha curcas
ref|XP_009364699.1|  PREDICTED: probable protein phosphatase 2C 55      289   5e-91   Pyrus x bretschneideri [bai li]
ref|XP_007017479.1|  Phosphatase 2c, putative isoform 1                 290   5e-91   
ref|XP_010905077.1|  PREDICTED: probable protein phosphatase 2C 55      288   5e-91   Elaeis guineensis
ref|XP_004300615.1|  PREDICTED: probable protein phosphatase 2C 80      286   6e-91   Fragaria vesca subsp. vesca
ref|XP_011074517.1|  PREDICTED: probable protein phosphatase 2C 55      288   9e-91   Sesamum indicum [beniseed]
ref|XP_007202065.1|  hypothetical protein PRUPE_ppa005911mg             285   2e-90   Prunus persica
gb|KHG03504.1|  hypothetical protein F383_27679                         283   2e-90   Gossypium arboreum [tree cotton]
ref|XP_006425719.1|  hypothetical protein CICLE_v10025600mg             285   2e-90   Citrus clementina [clementine]
gb|EYU32793.1|  hypothetical protein MIMGU_mgv1a004775mg                287   2e-90   Erythranthe guttata [common monkey flower]
ref|XP_009365583.1|  PREDICTED: probable protein phosphatase 2C 55      287   2e-90   Pyrus x bretschneideri [bai li]
ref|XP_008466602.1|  PREDICTED: probable protein phosphatase 2C 5...    287   2e-90   Cucumis melo [Oriental melon]
gb|KJB17810.1|  hypothetical protein B456_003G016400                    283   3e-90   Gossypium raimondii
gb|KGN59939.1|  hypothetical protein Csa_3G855330                       286   4e-90   Cucumis sativus [cucumbers]
ref|XP_010936931.1|  PREDICTED: probable protein phosphatase 2C 5...    286   4e-90   Elaeis guineensis
ref|XP_010244316.1|  PREDICTED: probable protein phosphatase 2C 5...    286   4e-90   Nelumbo nucifera [Indian lotus]
emb|CAN83089.1|  hypothetical protein VITISV_042874                     282   6e-90   Vitis vinifera
dbj|BAC42578.1|  unknown protein                                        279   6e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010558162.1|  PREDICTED: probable protein phosphatase 2C 8...    283   6e-90   Tarenaya hassleriana [spider flower]
ref|XP_009416847.1|  PREDICTED: probable protein phosphatase 2C 55      285   7e-90   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP02816.1|  unnamed protein product                                285   7e-90   Coffea canephora [robusta coffee]
ref|XP_010484599.1|  PREDICTED: probable protein phosphatase 2C 80      283   9e-90   Camelina sativa [gold-of-pleasure]
ref|XP_002865051.1|  predicted protein                                  283   9e-90   Arabidopsis lyrata subsp. lyrata
ref|XP_010558153.1|  PREDICTED: probable protein phosphatase 2C 8...    283   1e-89   Tarenaya hassleriana [spider flower]
ref|XP_004291892.1|  PREDICTED: probable protein phosphatase 2C 55      285   1e-89   Fragaria vesca subsp. vesca
ref|XP_009407379.1|  PREDICTED: probable protein phosphatase 2C 55      284   2e-89   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB46038.1|  hypothetical protein                                   279   2e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465009.1|  PREDICTED: probable protein phosphatase 2C 80      281   3e-89   Camelina sativa [gold-of-pleasure]
ref|XP_006434953.1|  hypothetical protein CICLE_v10000910mg             284   3e-89   Citrus clementina [clementine]
ref|NP_975004.1|  putative protein phosphatase 2C 80                    281   3e-89   Arabidopsis thaliana [mouse-ear cress]
gb|KDO84475.1|  hypothetical protein CISIN_1g010417mg                   284   3e-89   Citrus sinensis [apfelsine]
ref|XP_006434954.1|  hypothetical protein CICLE_v10000910mg             284   3e-89   Citrus clementina [clementine]
ref|NP_201473.1|  putative protein phosphatase 2C 80                    281   3e-89   Arabidopsis thaliana [mouse-ear cress]
gb|KJB43550.1|  hypothetical protein B456_007G205500                    276   4e-89   Gossypium raimondii
gb|KDO84477.1|  hypothetical protein CISIN_1g010417mg                   284   4e-89   Citrus sinensis [apfelsine]
gb|KJB43552.1|  hypothetical protein B456_007G205500                    276   4e-89   Gossypium raimondii
ref|XP_006473471.1|  PREDICTED: probable protein phosphatase 2C 5...    284   4e-89   Citrus sinensis [apfelsine]
ref|XP_006473470.1|  PREDICTED: probable protein phosphatase 2C 5...    284   5e-89   Citrus sinensis [apfelsine]
ref|XP_008786118.1|  PREDICTED: probable protein phosphatase 2C 5...    283   6e-89   Phoenix dactylifera
ref|XP_007046996.1|  Phosphatase 2C family protein                      282   6e-89   
ref|XP_002868114.1|  hypothetical protein ARALYDRAFT_493218             281   1e-88   
ref|XP_009145699.1|  PREDICTED: probable protein phosphatase 2C 55      281   1e-88   
ref|XP_010444748.1|  PREDICTED: probable protein phosphatase 2C 80      280   1e-88   Camelina sativa [gold-of-pleasure]
emb|CDY60192.1|  BnaA01g35420D                                          281   1e-88   Brassica napus [oilseed rape]
ref|XP_009612193.1|  PREDICTED: probable protein phosphatase 2C 55      282   2e-88   Nicotiana tomentosiformis
emb|CDP07546.1|  unnamed protein product                                282   2e-88   Coffea canephora [robusta coffee]
ref|XP_011099582.1|  PREDICTED: probable protein phosphatase 2C 55      278   2e-88   
ref|XP_010028040.1|  PREDICTED: probable protein phosphatase 2C 55      282   2e-88   Eucalyptus grandis [rose gum]
ref|XP_010664663.1|  PREDICTED: probable protein phosphatase 2C 55      282   3e-88   Vitis vinifera
gb|KFK26524.1|  hypothetical protein AALP_AA8G260300                    281   3e-88   Arabis alpina [alpine rockcress]
ref|XP_007156917.1|  hypothetical protein PHAVU_002G028000g             280   4e-88   Phaseolus vulgaris [French bean]
ref|XP_008466601.1|  PREDICTED: probable protein phosphatase 2C 5...    281   5e-88   Cucumis melo [Oriental melon]
gb|KHG28173.1|  hypothetical protein F383_08076                         281   5e-88   Gossypium arboreum [tree cotton]
ref|XP_011083714.1|  PREDICTED: probable protein phosphatase 2C 5...    281   6e-88   Sesamum indicum [beniseed]
ref|XP_011083717.1|  PREDICTED: probable protein phosphatase 2C 5...    281   7e-88   Sesamum indicum [beniseed]
emb|CDY40532.1|  BnaC01g19800D                                          280   7e-88   Brassica napus [oilseed rape]
gb|EPS68754.1|  hypothetical protein M569_06015                         277   1e-87   Genlisea aurea
gb|KJB58309.1|  hypothetical protein B456_009G204100                    280   1e-87   Gossypium raimondii
ref|XP_010923448.1|  PREDICTED: probable protein phosphatase 2C 55      280   1e-87   Elaeis guineensis
ref|NP_193391.3|  putative protein phosphatase 2C                       279   1e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006856074.1|  hypothetical protein AMTR_s00059p00109810          281   1e-87   Amborella trichopoda
ref|XP_010556299.1|  PREDICTED: probable protein phosphatase 2C 55      280   1e-87   Tarenaya hassleriana [spider flower]
gb|KJB43548.1|  hypothetical protein B456_007G205500                    276   1e-87   Gossypium raimondii
ref|XP_006383232.1|  hypothetical protein POPTR_0005s12720g             277   1e-87   Populus trichocarpa [western balsam poplar]
ref|XP_006280550.1|  hypothetical protein CARUB_v10026491mg             277   2e-87   Capsella rubella
gb|KDP31794.1|  hypothetical protein JCGZ_12255                         275   2e-87   Jatropha curcas
ref|XP_009614756.1|  PREDICTED: probable protein phosphatase 2C 55      279   4e-87   Nicotiana tomentosiformis
gb|KJB43549.1|  hypothetical protein B456_007G205500                    276   5e-87   Gossypium raimondii
ref|XP_009761616.1|  PREDICTED: probable protein phosphatase 2C 55      278   6e-87   Nicotiana sylvestris
ref|XP_006393865.1|  hypothetical protein EUTSA_v10004287mg             275   7e-87   Eutrema salsugineum [saltwater cress]
gb|KJB43554.1|  hypothetical protein B456_007G205500                    276   9e-87   Gossypium raimondii
ref|XP_010434801.1|  PREDICTED: probable protein phosphatase 2C 55      276   1e-86   Camelina sativa [gold-of-pleasure]
ref|XP_006414328.1|  hypothetical protein EUTSA_v10025106mg             276   1e-86   Eutrema salsugineum [saltwater cress]
ref|XP_010440128.1|  PREDICTED: probable protein phosphatase 2C 55      276   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_006283668.1|  hypothetical protein CARUB_v10004725mg             276   2e-86   
ref|XP_010999959.1|  PREDICTED: probable protein phosphatase 2C 8...    274   2e-86   Populus euphratica
ref|XP_010999955.1|  PREDICTED: probable protein phosphatase 2C 8...    274   2e-86   Populus euphratica
gb|EYU45128.1|  hypothetical protein MIMGU_mgv1a005010mg                276   3e-86   Erythranthe guttata [common monkey flower]
ref|XP_010449755.1|  PREDICTED: probable protein phosphatase 2C 55      275   4e-86   Camelina sativa [gold-of-pleasure]
gb|KJB58311.1|  hypothetical protein B456_009G204100                    276   5e-86   Gossypium raimondii
ref|XP_009805012.1|  PREDICTED: probable protein phosphatase 2C 55      276   7e-86   Nicotiana sylvestris
ref|XP_004252785.1|  PREDICTED: probable protein phosphatase 2C 55      276   8e-86   Solanum lycopersicum
gb|KDP42844.1|  hypothetical protein JCGZ_23786                         271   2e-85   Jatropha curcas
ref|XP_010547493.1|  PREDICTED: probable protein phosphatase 2C 80      272   2e-85   Tarenaya hassleriana [spider flower]
ref|XP_010244315.1|  PREDICTED: probable protein phosphatase 2C 5...    275   2e-85   Nelumbo nucifera [Indian lotus]
ref|XP_003574421.1|  PREDICTED: probable protein phosphatase 2C 55      270   3e-85   Brachypodium distachyon [annual false brome]
ref|XP_006342592.1|  PREDICTED: probable protein phosphatase 2C 5...    274   4e-85   Solanum tuberosum [potatoes]
ref|XP_009386157.1|  PREDICTED: probable protein phosphatase 2C 5...    269   1e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414756.1|  PREDICTED: probable protein phosphatase 2C 55      271   2e-84   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS48221.1|  putative protein phosphatase 2C 55                      262   7e-84   Triticum urartu
ref|XP_009386155.1|  PREDICTED: probable protein phosphatase 2C 8...    269   9e-84   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK28352.1|  putative protein phosphatase 2c 55-like                 267   1e-83   Arabis alpina [alpine rockcress]
gb|ACU19890.1|  unknown                                                 261   1e-83   Glycine max [soybeans]
ref|XP_008377406.1|  PREDICTED: probable protein phosphatase 2C 55      269   3e-83   
ref|XP_009386156.1|  PREDICTED: probable protein phosphatase 2C 5...    266   4e-83   
gb|KDP42845.1|  hypothetical protein JCGZ_23787                         267   4e-83   Jatropha curcas
gb|EMT00499.1|  Putative protein phosphatase 2C 55                      261   6e-83   
ref|NP_001051657.1|  Os03g0809300                                       266   9e-83   
gb|EAY92287.1|  hypothetical protein OsI_14009                          266   1e-82   Oryza sativa Indica Group [Indian rice]
gb|EMS60700.1|  putative protein phosphatase 2C 55                      262   2e-82   Triticum urartu
gb|EMT01244.1|  Putative protein phosphatase 2C 55                      259   3e-82   
ref|NP_001130546.1|  uncharacterized protein LOC100191645               265   4e-82   Zea mays [maize]
ref|XP_008644409.1|  PREDICTED: probable protein phosphatase 2C 80      265   5e-82   Zea mays [maize]
ref|XP_002463676.1|  hypothetical protein SORBIDRAFT_01g004030          264   7e-82   Sorghum bicolor [broomcorn]
dbj|BAJ98946.1|  predicted protein                                      261   1e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003538844.1|  PREDICTED: probable protein phosphatase 2C 5...    261   2e-81   Glycine max [soybeans]
emb|CDY53852.1|  BnaA07g37470D                                          260   4e-81   Brassica napus [oilseed rape]
ref|XP_004512015.1|  PREDICTED: probable protein phosphatase 2C 5...    260   8e-81   Cicer arietinum [garbanzo]
emb|CDY30759.1|  BnaC07g16590D                                          259   8e-81   Brassica napus [oilseed rape]
ref|XP_009103494.1|  PREDICTED: probable protein phosphatase 2C 80      259   1e-80   Brassica rapa
ref|XP_004981332.1|  PREDICTED: uncharacterized protein LOC101762678    266   2e-80   
dbj|BAJ91094.1|  predicted protein                                      261   2e-80   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003564015.1|  PREDICTED: probable protein phosphatase 2C 55      259   5e-80   Brachypodium distachyon [annual false brome]
ref|XP_010680832.1|  PREDICTED: probable protein phosphatase 2C 80      258   7e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006341911.1|  PREDICTED: probable protein phosphatase 2C 5...    256   8e-80   Solanum tuberosum [potatoes]
ref|XP_004238238.1|  PREDICTED: probable protein phosphatase 2C 55      256   2e-79   Solanum lycopersicum
gb|EYU44672.1|  hypothetical protein MIMGU_mgv1a007071mg                256   3e-79   Erythranthe guttata [common monkey flower]
gb|EEE60152.1|  hypothetical protein OsJ_13054                          269   5e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009764148.1|  PREDICTED: probable protein phosphatase 2C 55      253   2e-78   Nicotiana sylvestris
gb|AES94920.2|  protein phosphatase 2C family protein                   249   2e-76   Medicago truncatula
ref|XP_010070043.1|  PREDICTED: probable protein phosphatase 2C 80      248   5e-76   Eucalyptus grandis [rose gum]
ref|XP_003611962.1|  Mitochondrial catalytic protein                    245   1e-74   
ref|XP_001758147.1|  predicted protein                                  237   5e-74   
ref|XP_004251474.1|  PREDICTED: probable protein phosphatase 2C 55      239   3e-73   Solanum lycopersicum
gb|EPS61381.1|  hypothetical protein M569_13414                         236   3e-73   Genlisea aurea
ref|XP_009610356.1|  PREDICTED: probable protein phosphatase 2C 55      239   4e-73   Nicotiana tomentosiformis
ref|XP_006366049.1|  PREDICTED: probable protein phosphatase 2C 5...    238   8e-73   Solanum tuberosum [potatoes]
ref|XP_002974846.1|  hypothetical protein SELMODRAFT_101879             233   2e-72   
ref|XP_002963762.1|  hypothetical protein SELMODRAFT_79882              231   8e-72   
ref|XP_009760583.1|  PREDICTED: probable protein phosphatase 2C 55      235   1e-71   Nicotiana sylvestris
ref|XP_009600510.1|  PREDICTED: probable protein phosphatase 2C 55      234   2e-71   Nicotiana tomentosiformis
ref|XP_004244138.1|  PREDICTED: probable protein phosphatase 2C 55      234   3e-71   Solanum lycopersicum
ref|XP_006366044.1|  PREDICTED: probable protein phosphatase 2C 5...    234   3e-71   
gb|KHN36141.1|  Hypothetical protein glysoja_003264                     219   3e-65   Glycine soja [wild soybean]
ref|XP_011026862.1|  PREDICTED: probable protein phosphatase 2C 80      180   2e-51   Populus euphratica
ref|XP_007040568.1|  Phosphatase 2C family protein, putative            178   4e-51   
gb|KJB14506.1|  hypothetical protein B456_002G129300                    179   2e-49   Gossypium raimondii
emb|CDP04031.1|  unnamed protein product                                175   8e-49   Coffea canephora [robusta coffee]
ref|XP_011075613.1|  PREDICTED: probable protein phosphatase 2C 55      169   1e-47   Sesamum indicum [beniseed]
ref|XP_005846774.1|  hypothetical protein CHLNCDRAFT_24539              169   1e-47   Chlorella variabilis
gb|ABD93533.1|  mitochondrial catalytic protein                         165   1e-47   Petunia axillaris subsp. parodii
gb|ABD93536.1|  mitochondrial catalytic protein                         165   1e-47   Solanum tuberosum [potatoes]
ref|XP_010936938.1|  PREDICTED: probable protein phosphatase 2C 5...    173   2e-47   
gb|ABD93530.1|  mitochondrial catalytic protein                         165   2e-47   Physalis sp. TA1367
gb|ABD93532.1|  mitochondrial catalytic protein                         165   2e-47   Solanum melongena [aubergine]
gb|KDO84478.1|  hypothetical protein CISIN_1g010417mg                   172   4e-47   Citrus sinensis [apfelsine]
gb|ABD93531.1|  mitochondrial catalytic protein                         164   4e-47   Solanum lycopersicum
ref|XP_008786119.1|  PREDICTED: probable protein phosphatase 2C 5...    171   7e-47   
gb|ABD93537.1|  mitochondrial catalytic protein                         163   7e-47   Coffea canephora [robusta coffee]
ref|XP_010106023.1|  putative protein phosphatase 2C 55                 170   3e-46   
emb|CDP14203.1|  unnamed protein product                                164   1e-45   Coffea canephora [robusta coffee]
gb|KIY99217.1|  hypothetical protein MNEG_8745                          168   2e-45   Monoraphidium neglectum
ref|XP_007156916.1|  hypothetical protein PHAVU_002G028000g             164   7e-45   Phaseolus vulgaris [French bean]
gb|KDP42842.1|  hypothetical protein JCGZ_23784                         165   2e-44   Jatropha curcas
gb|KJB24190.1|  hypothetical protein B456_004G132100                    160   4e-44   Gossypium raimondii
ref|XP_002284713.1|  PREDICTED: probable protein phosphatase 2C 55      159   1e-43   Vitis vinifera
ref|XP_007042336.1|  Phosphatase 2C 55, putative                        160   1e-43   
ref|XP_002274456.3|  PREDICTED: probable protein phosphatase 2C 55      158   2e-43   
gb|KDP30212.1|  hypothetical protein JCGZ_16994                         158   4e-43   Jatropha curcas
ref|XP_007212971.1|  hypothetical protein PRUPE_ppa021121mg             156   6e-43   
ref|XP_009400624.1|  PREDICTED: probable protein phosphatase 2C 55      158   4e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|KIY99196.1|  hypothetical protein MNEG_8763                          158   6e-42   Monoraphidium neglectum
ref|XP_010262929.1|  PREDICTED: probable protein phosphatase 2C 55      154   2e-41   Nelumbo nucifera [Indian lotus]
gb|EYU18665.1|  hypothetical protein MIMGU_mgv1a024209mg                153   2e-41   Erythranthe guttata [common monkey flower]
gb|KDP40767.1|  hypothetical protein JCGZ_24766                         152   3e-41   Jatropha curcas
ref|XP_001696623.1|  serine/threonine phosphatase, family 2C            154   6e-41   Chlamydomonas reinhardtii
gb|KDP40765.1|  hypothetical protein JCGZ_24764                         152   6e-41   Jatropha curcas
gb|EYU18664.1|  hypothetical protein MIMGU_mgv1a024169mg                152   9e-41   Erythranthe guttata [common monkey flower]
gb|KDP38810.1|  hypothetical protein JCGZ_04967                         152   1e-40   Jatropha curcas
ref|XP_010323161.1|  PREDICTED: probable protein phosphatase 2C 55      152   2e-40   
gb|ABD93535.1|  mitochondrial catalytic protein                         145   4e-40   Capsicum annuum
ref|XP_006354601.1|  PREDICTED: probable protein phosphatase 2C 8...    151   7e-40   
gb|ADE77197.1|  unknown                                                 147   1e-39   Picea sitchensis
ref|XP_009335499.1|  PREDICTED: probable protein phosphatase 2C 55      150   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_002284716.1|  PREDICTED: probable protein phosphatase 2C 55      147   2e-39   
ref|XP_009798171.1|  PREDICTED: probable protein phosphatase 2C 55      146   5e-39   Nicotiana sylvestris
ref|XP_009797174.1|  PREDICTED: probable protein phosphatase 2C 55      145   9e-39   Nicotiana sylvestris
ref|XP_002945739.1|  Serine/threonine phosphatase, family 2C            148   2e-38   Volvox carteri f. nagariensis
ref|XP_002525008.1|  protein phosphatase 2c, putative                   145   2e-38   Ricinus communis
emb|CBI18942.3|  unnamed protein product                                146   2e-38   Vitis vinifera
ref|XP_009595170.1|  PREDICTED: probable protein phosphatase 2C 55      147   3e-38   Nicotiana tomentosiformis
ref|XP_010086629.1|  putative protein phosphatase 2C 55                 145   3e-38   Morus notabilis
emb|CBI30073.3|  unnamed protein product                                152   4e-38   Vitis vinifera
ref|XP_005647282.1|  protein serine/threonine phosphatase 2C            143   1e-37   Coccomyxa subellipsoidea C-169
gb|EYU18666.1|  hypothetical protein MIMGU_mgv1a011411mg                144   1e-37   Erythranthe guttata [common monkey flower]
gb|EYU18663.1|  hypothetical protein MIMGU_mgv1a026339mg                142   4e-37   Erythranthe guttata [common monkey flower]
ref|XP_008359355.1|  PREDICTED: probable protein phosphatase 2C 55      143   6e-37   
ref|XP_008366514.1|  PREDICTED: probable protein phosphatase 2C 55      143   6e-37   
ref|XP_009622463.1|  PREDICTED: probable protein phosphatase 2C 55      143   8e-37   Nicotiana tomentosiformis
ref|XP_004249735.1|  PREDICTED: probable protein phosphatase 2C 55      142   9e-37   Solanum lycopersicum
ref|XP_008463803.1|  PREDICTED: probable protein phosphatase 2C 55      140   1e-36   Cucumis melo [Oriental melon]
gb|EYU20627.1|  hypothetical protein MIMGU_mgv1a021452mg                140   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_006351386.1|  PREDICTED: probable protein phosphatase 2C 5...    141   2e-36   Solanum tuberosum [potatoes]
ref|XP_004244352.1|  PREDICTED: probable protein phosphatase 2C 55      140   2e-36   Solanum lycopersicum
ref|XP_011397842.1|  putative protein phosphatase 2C 80                 141   4e-36   Auxenochlorella protothecoides
ref|XP_009341188.1|  PREDICTED: probable protein phosphatase 2C 55      141   5e-36   Pyrus x bretschneideri [bai li]
gb|ABD93534.1|  mitochondrial catalytic protein                         134   9e-36   Nicotiana tomentosiformis
ref|XP_007212931.1|  hypothetical protein PRUPE_ppa021890mg             137   2e-35   
gb|ETK87262.1|  hypothetical protein, variant 2                         137   2e-35   Phytophthora parasitica
ref|XP_002297969.2|  hypothetical protein POPTR_0001s10840g             137   3e-35   
ref|XP_008905224.1|  hypothetical protein, variant 3                    136   1e-34   Phytophthora parasitica INRA-310
gb|ETL40689.1|  hypothetical protein, variant 3                         136   1e-34   Phytophthora parasitica
gb|ETL93829.1|  hypothetical protein, variant 3                         136   1e-34   Phytophthora parasitica
gb|ETL40688.1|  hypothetical protein, variant 2                         136   1e-34   Phytophthora parasitica
ref|XP_008905223.1|  hypothetical protein, variant 2                    136   1e-34   Phytophthora parasitica INRA-310
gb|ETL93828.1|  hypothetical protein, variant 2                         136   2e-34   Phytophthora parasitica
ref|XP_010530610.1|  PREDICTED: probable protein phosphatase 2C 6...    139   4e-34   Tarenaya hassleriana [spider flower]
ref|XP_010530608.1|  PREDICTED: probable protein phosphatase 2C 6...    139   5e-34   Tarenaya hassleriana [spider flower]
ref|XP_010530607.1|  PREDICTED: probable protein phosphatase 2C 6...    139   7e-34   Tarenaya hassleriana [spider flower]
ref|XP_004170054.1|  PREDICTED: probable protein phosphatase 2C 5...    133   8e-34   
ref|XP_010086628.1|  putative protein phosphatase 2C 55                 134   1e-33   Morus notabilis
emb|CAB38808.1|  putative protein                                       139   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010099880.1|  putative protein phosphatase 2C 55                 133   2e-33   Morus notabilis
ref|XP_008378699.1|  PREDICTED: probable protein phosphatase 2C 55      134   3e-33   
ref|XP_011462004.1|  PREDICTED: probable protein phosphatase 2C 55      132   5e-33   Fragaria vesca subsp. vesca
emb|CBI15146.3|  unnamed protein product                                130   6e-33   Vitis vinifera
ref|XP_008226582.1|  PREDICTED: probable protein phosphatase 2C 55      132   8e-33   Prunus mume [ume]
ref|XP_009782699.1|  PREDICTED: probable protein phosphatase 2C 55      133   8e-33   Nicotiana sylvestris
gb|KDP27378.1|  hypothetical protein JCGZ_20202                         136   9e-33   Jatropha curcas
ref|XP_006412349.1|  hypothetical protein EUTSA_v10024559mg             135   1e-32   Eutrema salsugineum [saltwater cress]
ref|XP_004146087.1|  PREDICTED: probable protein phosphatase 2C 5...    130   2e-32   Cucumis sativus [cucumbers]
emb|CBI29829.3|  unnamed protein product                                129   2e-32   Vitis vinifera
ref|XP_004146091.1|  PREDICTED: probable protein phosphatase 2C 5...    129   2e-32   Cucumis sativus [cucumbers]
ref|XP_010653772.1|  PREDICTED: probable protein phosphatase 2C 55      129   2e-32   
ref|XP_008226580.1|  PREDICTED: probable protein phosphatase 2C 55      129   3e-32   Prunus mume [ume]
ref|XP_008463804.1|  PREDICTED: probable protein phosphatase 2C 55      129   4e-32   Cucumis melo [Oriental melon]
ref|XP_010447231.1|  PREDICTED: probable protein phosphatase 2C 6...    134   4e-32   Camelina sativa [gold-of-pleasure]
ref|NP_567923.1|  putative protein phosphatase 2C 62                    134   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447232.1|  PREDICTED: probable protein phosphatase 2C 6...    134   5e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006283128.1|  hypothetical protein CARUB_v10004154mg             134   5e-32   Capsella rubella
ref|XP_002867174.1|  hypothetical protein ARALYDRAFT_328389             134   7e-32   
ref|XP_010068812.1|  PREDICTED: probable protein phosphatase 2C 80      127   2e-31   Eucalyptus grandis [rose gum]
ref|XP_008226369.1|  PREDICTED: probable protein phosphatase 2C 55      129   2e-31   
ref|XP_010432553.1|  PREDICTED: probable protein phosphatase 2C 62      132   2e-31   
ref|XP_007214007.1|  hypothetical protein PRUPE_ppa014726mg             128   3e-31   
ref|XP_001433954.1|  hypothetical protein                               127   4e-31   
ref|XP_006412350.1|  hypothetical protein EUTSA_v10024559mg             131   4e-31   
ref|XP_010663282.1|  PREDICTED: uncharacterized protein LOC100260...    130   5e-31   
ref|XP_010663279.1|  PREDICTED: uncharacterized protein LOC100260...    130   6e-31   
ref|XP_010663278.1|  PREDICTED: uncharacterized protein LOC100260...    130   6e-31   
ref|XP_001777173.1|  predicted protein                                  129   7e-31   
ref|XP_007214047.1|  hypothetical protein PRUPE_ppa017442mg             125   1e-30   
ref|XP_010261223.1|  PREDICTED: probable protein phosphatase 2C 6...    130   2e-30   
ref|XP_007210721.1|  hypothetical protein PRUPE_ppa022635mg             125   2e-30   
gb|EMS50480.1|  putative protein phosphatase 2C 71                      125   2e-30   
ref|XP_006351800.1|  PREDICTED: probable protein phosphatase 2C 7...    124   2e-30   
gb|ABF94414.1|  Protein phosphatase 2C containing protein, expressed    126   3e-30   
gb|ABF94413.1|  Protein phosphatase 2C containing protein, expressed    126   3e-30   
ref|XP_010261225.1|  PREDICTED: probable protein phosphatase 2C 6...    129   3e-30   
ref|XP_003571765.1|  PREDICTED: probable protein phosphatase 2C 7...    127   3e-30   
ref|XP_006372807.1|  hypothetical protein POPTR_0017s05230g             122   5e-30   
emb|CCI47547.1|  unnamed protein product                                129   5e-30   
gb|EEC74670.1|  hypothetical protein OsI_10348                          126   6e-30   
gb|EMT17535.1|  Putative protein phosphatase 2C 71                      125   8e-30   
gb|ABF94415.1|  Protein phosphatase 2C containing protein, expressed    126   9e-30   
sp|Q6J2K6.1|BIP2C_ORYSI  RecName: Full=Probable protein phosphata...    126   9e-30   
ref|XP_008378700.1|  PREDICTED: probable protein phosphatase 2C 55      122   9e-30   
ref|NP_001049240.1|  Os03g0192500                                       126   1e-29   
gb|ABF94416.1|  Protein phosphatase 2C containing protein, expressed    126   1e-29   
emb|CDY72337.1|  BnaAnng40740D                                          124   1e-29   
ref|XP_008782121.1|  PREDICTED: probable protein phosphatase 2C 62      126   2e-29   
ref|XP_010107582.1|  putative protein phosphatase 2C 55                 122   2e-29   
ref|XP_010926263.1|  PREDICTED: probable protein phosphatase 2C B...    126   2e-29   
ref|XP_008226368.1|  PREDICTED: probable protein phosphatase 2C 55      122   2e-29   
ref|XP_002314236.2|  hypothetical protein POPTR_0009s02640g             122   2e-29   
ref|XP_008229691.1|  PREDICTED: probable protein phosphatase 2C 80      124   3e-29   
ref|XP_010234711.1|  PREDICTED: probable protein phosphatase 2C 7...    124   4e-29   
ref|XP_011042047.1|  PREDICTED: probable protein phosphatase 2C 55      122   4e-29   
ref|XP_006651122.1|  PREDICTED: probable protein phosphatase 2C B...    124   4e-29   
ref|XP_002533514.1|  protein phosphatase 2c, putative                   125   5e-29   
ref|XP_010107580.1|  putative protein phosphatase 2C 55                 122   5e-29   
gb|KFK29974.1|  hypothetical protein AALP_AA7G201400                    125   5e-29   
gb|KFK29975.1|  hypothetical protein AALP_AA7G201400                    125   5e-29   
ref|XP_006377196.1|  hypothetical protein POPTR_0011s01820g             119   7e-29   
gb|EYU21567.1|  hypothetical protein MIMGU_mgv1a022753mg                120   8e-29   
ref|XP_006662299.1|  PREDICTED: probable protein phosphatase 2C 7...    122   8e-29   
ref|XP_002300447.2|  hypothetical protein POPTR_0001s39000g             120   8e-29   
gb|AAM08826.1|AC113335_6  Putative protein phosphatase 2C               122   2e-28   
dbj|BAJ91225.1|  predicted protein                                      121   2e-28   
ref|NP_001064455.1|  Os10g0370000                                       121   2e-28   
ref|XP_004985380.1|  PREDICTED: probable protein phosphatase 2C B...    122   2e-28   
ref|XP_009379587.1|  PREDICTED: probable protein phosphatase 2C 71      122   2e-28   
ref|XP_010103824.1|  hypothetical protein L484_024126                   117   2e-28   
dbj|BAK06252.1|  predicted protein                                      121   2e-28   
ref|XP_011045605.1|  PREDICTED: probable protein phosphatase 2C 80      119   2e-28   
ref|XP_002307353.2|  hypothetical protein POPTR_0005s17490g             119   2e-28   
ref|XP_006826982.1|  hypothetical protein AMTR_s00010p00203750          122   2e-28   
ref|XP_003547076.1|  PREDICTED: probable protein phosphatase 2C 6...    123   3e-28   
gb|KHN33513.1|  Hypothetical protein glysoja_005555                     123   3e-28   
ref|XP_009362478.1|  PREDICTED: probable protein phosphatase 2C B...    123   4e-28   
ref|XP_009362477.1|  PREDICTED: probable protein phosphatase 2C B...    123   5e-28   
ref|XP_009362476.1|  PREDICTED: probable protein phosphatase 2C B...    123   5e-28   
ref|XP_009390293.1|  PREDICTED: probable protein phosphatase 2C B...    122   6e-28   
ref|XP_009362474.1|  PREDICTED: probable protein phosphatase 2C 6...    122   7e-28   
ref|XP_009362471.1|  PREDICTED: probable protein phosphatase 2C B...    122   7e-28   
ref|XP_009362475.1|  PREDICTED: probable protein phosphatase 2C 6...    122   7e-28   
ref|XP_007226263.1|  hypothetical protein PRUPE_ppa018548mg             117   7e-28   
ref|XP_009362473.1|  PREDICTED: probable protein phosphatase 2C 6...    122   7e-28   
ref|XP_009362470.1|  PREDICTED: probable protein phosphatase 2C 6...    122   7e-28   
ref|NP_001151619.1|  LOC100285253                                       120   8e-28   
ref|XP_009362468.1|  PREDICTED: probable protein phosphatase 2C 6...    122   8e-28   
ref|XP_009362469.1|  PREDICTED: probable protein phosphatase 2C 6...    122   9e-28   
ref|XP_008391500.1|  PREDICTED: probable protein phosphatase 2C 71      120   1e-27   
ref|XP_004983226.1|  PREDICTED: probable protein phosphatase 2C 7...    119   2e-27   
ref|XP_010030054.1|  PREDICTED: probable protein phosphatase 2C B...    120   2e-27   
gb|KCW57011.1|  hypothetical protein EUGRSUZ_I02678                     120   2e-27   
ref|XP_007212980.1|  hypothetical protein PRUPE_ppa022479mg             116   2e-27   
ref|XP_004230532.1|  PREDICTED: probable protein phosphatase 2C 62      121   3e-27   
ref|XP_009121670.1|  PREDICTED: probable protein phosphatase 2C 6...    120   5e-27   
emb|CDX68984.1|  BnaC01g04690D                                          119   6e-27   
ref|XP_009613267.1|  PREDICTED: probable protein phosphatase 2C 62      119   6e-27   
ref|XP_003285997.1|  hypothetical protein DICPUDRAFT_86952              117   7e-27   
ref|XP_008218906.1|  PREDICTED: probable protein phosphatase 2C 6...    117   1e-26   
ref|XP_008218905.1|  PREDICTED: probable protein phosphatase 2C 6...    117   1e-26   
emb|CEG67319.1|  hypothetical protein RMATCC62417_03767                 115   1e-26   
emb|CDS07785.1|  hypothetical protein LRAMOSA01734                      115   1e-26   
ref|XP_009594170.1|  PREDICTED: probable protein phosphatase 2C 55      114   2e-26   
dbj|BAJ94895.1|  predicted protein                                      116   2e-26   
emb|CEJ04126.1|  hypothetical protein RMCBS344292_18093                 115   2e-26   
ref|XP_006377701.1|  hypothetical protein POPTR_0011s10370g             112   3e-26   
ref|XP_010314134.1|  PREDICTED: probable protein phosphatase 2C 55      114   3e-26   
ref|XP_009405151.1|  PREDICTED: probable protein phosphatase 2C 71      117   3e-26   
ref|NP_001169678.1|  uncharacterized protein LOC100383559               116   3e-26   
ref|XP_004341592.1|  stage ii sporulation protein e (spoiie) doma...    114   5e-26   
emb|CEI89085.1|  hypothetical protein RMCBS344292_03456                 113   6e-26   
ref|XP_010107578.1|  putative protein phosphatase 2C 80                 111   6e-26   
emb|CEG81394.1|  hypothetical protein RMATCC62417_15604                 113   7e-26   
emb|CDX99127.1|  BnaA06g18180D                                          112   7e-26   
ref|XP_009795764.1|  PREDICTED: probable protein phosphatase 2C 62      116   8e-26   
emb|CDH48835.1|  protein phosphatase 2c 80                              113   9e-26   
ref|XP_007148425.1|  hypothetical protein PHAVU_006G207400g             116   1e-25   
ref|XP_003558609.1|  PREDICTED: probable protein phosphatase 2C B...    115   1e-25   
gb|EIE88469.1|  hypothetical protein RO3G_13180                         112   1e-25   
ref|XP_005704755.1|  phosphatase isoform 2                              111   1e-25   
ref|XP_009121595.1|  PREDICTED: probable protein phosphatase 2C 6...    115   2e-25   
ref|XP_005704756.1|  phosphatase isoform 1                              111   2e-25   
ref|XP_005823054.1|  hypothetical protein GUITHDRAFT_165821             112   2e-25   
ref|XP_004295441.1|  PREDICTED: probable protein phosphatase 2C 55      111   2e-25   
emb|CDS12243.1|  hypothetical protein LRAMOSA04438                      112   2e-25   
gb|EMT23848.1|  Putative protein phosphatase 2C BIPP2C1                 114   2e-25   
ref|XP_010530611.1|  PREDICTED: probable protein phosphatase 2C 6...    114   3e-25   
ref|XP_004955098.1|  PREDICTED: putative protein phosphatase 2C 2...    111   3e-25   
emb|CDH53433.1|  protein phosphatase 2c-related protein                 112   3e-25   
emb|CDH53434.1|  protein phosphatase 2c-related protein                 112   3e-25   
dbj|GAM16845.1|  hypothetical protein SAMD00019534_000200               113   3e-25   
ref|XP_010444987.1|  PREDICTED: probable protein phosphatase 2C 62      114   4e-25   
emb|CDX75361.1|  BnaA01g03410D                                          114   5e-25   
gb|EPB82617.1|  hypothetical protein HMPREF1544_10650                   111   6e-25   
ref|XP_005714182.1|  unnamed protein product                            111   7e-25   
emb|CDO97469.1|  unnamed protein product                                113   7e-25   
ref|XP_008875750.1|  hypothetical protein H310_10999                    108   8e-25   
emb|CEG67320.1|  hypothetical protein RMATCC62417_03767                 110   9e-25   
dbj|GAN09792.1|  conserved hypothetical protein                         110   9e-25   
gb|EPY30693.1|  protein phosphatase 2C                                  109   9e-25   
ref|XP_007043012.1|  Phosphatase 2c-like protein isoform 1              113   1e-24   
emb|CEP15662.1|  hypothetical protein                                   110   1e-24   
gb|EPB93077.1|  hypothetical protein HMPREF1544_00151                   110   1e-24   
emb|CEG69466.1|  hypothetical protein RMATCC62417_05535                 109   1e-24   
gb|EMS55022.1|  putative protein phosphatase 2C BIPP2C1                 110   2e-24   
gb|ESA03680.1|  hypothetical protein GLOINDRAFT_336645                  109   2e-24   
dbj|GAN09367.1|  Ser/Thr phosphatase, family 2C                         109   3e-24   
ref|XP_001696357.1|  serine/threonine protein phosphatase               109   3e-24   
gb|EIE89445.1|  hypothetical protein RO3G_14156                         108   3e-24   
emb|CEP12144.1|  hypothetical protein                                   108   3e-24   
ref|XP_004302000.1|  PREDICTED: probable protein phosphatase 2C 6...    111   4e-24   
emb|CEG64649.1|  hypothetical protein RMATCC62417_01586                 108   4e-24   
dbj|BAJ87820.1|  predicted protein                                      105   5e-24   
ref|XP_008226583.1|  PREDICTED: probable protein phosphatase 2C 55      107   5e-24   
ref|XP_005650758.1|  hypothetical protein COCSUDRAFT_6667               106   6e-24   
gb|EIE76334.1|  hypothetical protein RO3G_01038                         107   7e-24   
ref|XP_003593175.1|  Protein phosphatase                                111   8e-24   
ref|XP_005648047.1|  protein serine/threonine phosphatase 2C            108   9e-24   
gb|AES63426.2|  SpoIIE-like protein phosphatase domain protein          110   1e-23   
ref|XP_009829190.1|  hypothetical protein H257_05879                    106   1e-23   
ref|XP_002172922.1|  serine/threonine protein phosphatase Azr1          106   2e-23   
gb|EPY35807.1|  protein phosphatase 2C                                  104   2e-23   
gb|KHJ94956.1|  protein phosphatase 2C                                  106   2e-23   
emb|CEI91203.1|  hypothetical protein RMCBS344292_05501                 106   2e-23   
gb|EYB86482.1|  hypothetical protein Y032_0278g1164                     105   2e-23   
gb|EYB86481.1|  hypothetical protein Y032_0278g1164                     105   3e-23   
gb|EIE90619.1|  hypothetical protein RO3G_15330                         105   6e-23   
gb|EYB86480.1|  hypothetical protein Y032_0278g1164                     105   6e-23   
ref|XP_010666863.1|  PREDICTED: probable protein phosphatase 2C 6...    108   7e-23   
ref|XP_010666864.1|  PREDICTED: probable protein phosphatase 2C 6...    107   8e-23   
ref|XP_004485561.1|  PREDICTED: probable protein phosphatase 2C 6...    108   9e-23   
ref|XP_004366562.1|  protein phosphatase 2C-related protein             106   1e-22   
ref|XP_004485562.1|  PREDICTED: probable protein phosphatase 2C 6...    107   1e-22   
ref|XP_008680538.1|  PREDICTED: putative protein phosphatase 2C 24      105   1e-22   
emb|CEG64449.1|  hypothetical protein RMATCC62417_01420                 103   1e-22   
ref|XP_005711457.1|  unnamed protein product                            103   1e-22   
ref|XP_008678849.1|  PREDICTED: putative protein phosphatase 2C 24      103   2e-22   
gb|ETN70837.1|  protein phosphatase 2C                                  103   2e-22   
ref|XP_002046496.1|  GJ12462                                            103   2e-22   
ref|XP_005708105.1|  phosphatase                                        103   2e-22   
gb|AFW63096.1|  hypothetical protein ZEAMMB73_264183                    105   2e-22   
ref|XP_002611832.1|  hypothetical protein BRAFLDRAFT_83144              103   2e-22   
ref|XP_005821130.1|  hypothetical protein GUITHDRAFT_147406             102   3e-22   
dbj|GAM17626.1|  hypothetical protein SAMD00019534_008010               106   3e-22   
gb|KJB32020.1|  hypothetical protein B456_005G218800                    106   3e-22   
dbj|GAN03550.1|  folylpolyglutamate synthase                            106   3e-22   
gb|EPS57887.1|  hypothetical protein M569_16931                         101   3e-22   
gb|KJB32025.1|  hypothetical protein B456_005G218800                    106   4e-22   
gb|AAR10004.1|  similar to Drosophila melanogaster CG12091              100   4e-22   
ref|XP_003880435.1|  protein phosphatase 2C, related                    103   4e-22   
gb|AFW63097.1|  hypothetical protein ZEAMMB73_588977                    102   5e-22   
gb|KJB32010.1|  hypothetical protein B456_005G218800                    105   5e-22   
gb|KJB32018.1|  hypothetical protein B456_005G218800                    105   5e-22   
gb|KJB32013.1|  hypothetical protein B456_005G218800                    105   5e-22   
emb|CDP96633.1|  Protein Bm6256, isoform b                              102   6e-22   
gb|KJB32022.1|  hypothetical protein B456_005G218800                    105   6e-22   
ref|XP_003139043.1|  5-azacytidine resistance protein azr1              102   6e-22   
ref|XP_011414169.1|  PREDICTED: protein phosphatase PTC7 homolog        102   6e-22   
gb|EJW88113.1|  hypothetical protein WUBG_00973                         102   6e-22   
gb|KJB32014.1|  hypothetical protein B456_005G218800                    105   6e-22   
ref|XP_001895607.1|  5-azacytidine resistance protein azr1              102   7e-22   
gb|KJB32015.1|  hypothetical protein B456_005G218800                    105   7e-22   
ref|XP_011087848.1|  PREDICTED: probable protein phosphatase 2C 6...    105   7e-22   
gb|KFH73804.1|  hypothetical protein MVEG_01018                         104   7e-22   
ref|XP_006681892.1|  hypothetical protein BATDEDRAFT_20752              100   8e-22   
gb|EFA76898.1|  protein phosphatase 2C-related protein                  105   9e-22   
ref|XP_001354256.1|  GA11388                                            101   9e-22   
ref|XP_008368164.1|  PREDICTED: probable protein phosphatase 2C B...    100   9e-22   
ref|XP_010921019.1|  PREDICTED: probable protein phosphatase 2C 1...    100   1e-21   
ref|NP_001156048.1|  protein phosphatase PTC7 homolog                   100   2e-21   
gb|ACO12191.1|  phosphatase PTC7 homolog                                100   2e-21   
ref|XP_008352815.1|  PREDICTED: probable protein phosphatase 2C B...  98.2    2e-21   
ref|XP_010921018.1|  PREDICTED: probable protein phosphatase 2C 1...    100   2e-21   
gb|KIM33310.1|  hypothetical protein M408DRAFT_326073                 99.4    2e-21   
dbj|GAN07160.1|  protein serine/threonine phosphatase 2C                100   2e-21   
emb|CEP15328.1|  hypothetical protein                                   100   3e-21   
gb|KHG12651.1|  hypothetical protein F383_02061                         103   3e-21   
ref|XP_641223.1|  protein phosphatase 2C-related protein                102   3e-21   
gb|EPB86593.1|  hypothetical protein HMPREF1544_06569                   100   3e-21   
gb|EJY70655.1|  Protein phosphatase 2C-related protein                  100   3e-21   
ref|XP_010521990.1|  PREDICTED: probable protein phosphatase 2C 26    99.8    3e-21   
ref|XP_001984084.1|  GH15200                                          99.8    4e-21   
ref|XP_010698275.1|  protein phosphatase 2C-like protein              98.2    4e-21   
gb|KIK47030.1|  hypothetical protein CY34DRAFT_799724                 99.0    4e-21   
gb|KII88511.1|  hypothetical protein PLICRDRAFT_30007                 99.8    4e-21   
ref|XP_002093135.1|  GE20952                                          99.8    4e-21   
gb|ERG81774.1|  protein phosphatase ptc7-like protein                   100   4e-21   
ref|XP_008333510.1|  PREDICTED: protein phosphatase PTC7 homolog      99.4    5e-21   
gb|KIJ69408.1|  hypothetical protein HYDPIDRAFT_106015                99.8    5e-21   
ref|XP_003058086.1|  predicted protein                                98.6    7e-21   
ref|XP_011309022.1|  PREDICTED: protein phosphatase PTC7 homolog      97.4    7e-21   
ref|NP_001151986.1|  T-cell activation protein phosphatase 2C-lik...  99.0    7e-21   
ref|XP_008605802.1|  hypothetical protein SDRG_02021                  98.6    7e-21   
ref|XP_001416779.1|  predicted protein                                99.8    8e-21   
ref|XP_003701145.1|  PREDICTED: protein phosphatase PTC7 homolog      98.6    8e-21   
gb|AFW63095.1|  hypothetical protein ZEAMMB73_118247                  99.0    8e-21   
ref|XP_001564352.1|  conserved hypothetical protein                   97.4    8e-21   
ref|XP_008238888.1|  PREDICTED: probable protein phosphatase 2C 55    98.6    8e-21   
ref|XP_007883781.1|  PREDICTED: protein phosphatase PTC7 homolog      97.8    8e-21   



>ref|XP_002310798.2| hypothetical protein POPTR_0007s12510g [Populus trichocarpa]
 gb|EEE91248.2| hypothetical protein POPTR_0007s12510g [Populus trichocarpa]
Length=417

 Score =   301 bits (770),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG+++RELM +S++AI  EP  SIDPARVLEKAH+  KAKGSSTACIIAL S+GLHAI
Sbjct  215  VNAGEFSRELMSHSVNAIQEEPNGSIDPARVLEKAHANMKAKGSSTACIIALKSEGLHAI  274

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+FESPVQQHGFNFTYQLE+G+  DLPSSGQVFTI V  GDVI+AG
Sbjct  275  NLGDSGFMVVRDGCTVFESPVQQHGFNFTYQLETGNGGDLPSSGQVFTIPVAPGDVIIAG  334

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  VV  A+ +G  PEATAQKIAALARQRALD  RQTPF+ AAQ+AGY
Sbjct  335  TDGLFDNLYNNEVTAVVVHAIRTGLGPEATAQKIAALARQRALDTNRQTPFSTAAQDAGY  394

Query  136  QYYGGK  119
            +YYGGK
Sbjct  395  RYYGGK  400



>ref|XP_011025730.1| PREDICTED: probable protein phosphatase 2C 80 [Populus euphratica]
 ref|XP_011025731.1| PREDICTED: probable protein phosphatase 2C 80 [Populus euphratica]
 ref|XP_011025732.1| PREDICTED: probable protein phosphatase 2C 80 [Populus euphratica]
Length=417

 Score =   301 bits (770),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG+++RELM +S++AI  EP  SIDPARVLEKAH+  KAKGSSTACIIAL S+GLHAI
Sbjct  215  VNAGEFSRELMSHSVNAIQEEPIGSIDPARVLEKAHTNMKAKGSSTACIIALKSEGLHAI  274

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+FESPVQQHGFNFTYQLE+G+  DLPSSGQVFTI V  GDVI+AG
Sbjct  275  NLGDSGFMVVRDGCTVFESPVQQHGFNFTYQLETGNGGDLPSSGQVFTIPVAPGDVIIAG  334

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  VV  A+ +G  PEATAQKIAALARQRALD  RQTPF+ AAQ+AGY
Sbjct  335  TDGLFDNLYNNEVTAVVVHAIRTGLGPEATAQKIAALARQRALDTNRQTPFSTAAQDAGY  394

Query  136  QYYGGK  119
            +YYGGK
Sbjct  395  RYYGGK  400



>emb|CBI17553.3| unnamed protein product [Vitis vinifera]
Length=332

 Score =   294 bits (753),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG+YARELM  S+ AI  EPK SIDP+RVLEKAHS TKAKGSSTACI+AL  QGL AI
Sbjct  130  VDAGEYARELMSNSVTAIQEEPKGSIDPSRVLEKAHSSTKAKGSSTACIVALTDQGLQAI  189

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF+SPVQQHGFNFTYQLESG   DLPSSGQVFTI V  GDVIVAG
Sbjct  190  NLGDSGFIVVRDGCTIFQSPVQQHGFNFTYQLESGRAGDLPSSGQVFTIPVAPGDVIVAG  249

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  EV  VV  AV +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  250  TDGLFDNLYNSEVTAVVVHAVRAGLGPQVTAQKIAALARQRAQDRMRQTPFSTAAQDAGF  309

Query  136  QYYGGK  119
            +YYGGK
Sbjct  310  RYYGGK  315



>ref|XP_010099838.1| putative protein phosphatase 2C 80 [Morus notabilis]
 gb|EXB80598.1| putative protein phosphatase 2C 80 [Morus notabilis]
Length=426

 Score =   297 bits (760),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG+++RELM  S+ AI  EPK SIDPARVLEKAH   KAKGSSTACIIAL  +GLHAI
Sbjct  224  VNAGEFSRELMANSVRAIREEPKGSIDPARVLEKAHLVAKAKGSSTACIIALTEKGLHAI  283

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF+SP QQ GFNFTYQLESGS ADLPS+GQVFTI V  GDVIVAG
Sbjct  284  NLGDSGFIVVRDGCTIFQSPAQQRGFNFTYQLESGSGADLPSAGQVFTIPVSPGDVIVAG  343

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  VV  AV +G  P+ATAQKIAALARQRALDR RQTPFA AAQEAGY
Sbjct  344  TDGLFDNLYNNEVTAVVLHAVRAGLEPQATAQKIAALARQRALDRTRQTPFATAAQEAGY  403

Query  136  QYYGGK  119
            +YYGGK
Sbjct  404  RYYGGK  409



>gb|KHN00560.1| Hypothetical protein glysoja_000228 [Glycine soja]
Length=430

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +A+ELM +S+ AI  EPKDSI+PARVLEKAHS TKAKGSSTACIIAL + GLHAI
Sbjct  157  VNAGLFAQELMSHSVRAIQEEPKDSINPARVLEKAHSCTKAKGSSTACIIALTNMGLHAI  216

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQH FNFTYQLESG+  DLPSSG+VFTI V  GDV+V G
Sbjct  217  NLGDSGFIVVRDGCTIFRSPVQQHDFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVVG  276

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY DEVA +V DAV +G  P  TAQ+IA LARQRALDR RQTPF+ AAQEAG+
Sbjct  277  TDGLFDNLYNDEVAEIVLDAVRAGLEPLVTAQRIAVLARQRALDRNRQTPFSTAAQEAGF  336

Query  136  QYYGGK  119
            +YYGGK
Sbjct  337  RYYGGK  342



>ref|XP_006574705.1| PREDICTED: probable protein phosphatase 2C 55-like [Glycine max]
Length=364

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +A+ELM +S+ AI  EPKDSI+PARVLEKAHS TKAKGSSTACIIAL + GLHAI
Sbjct  157  VNAGLFAQELMSHSVRAIQEEPKDSINPARVLEKAHSCTKAKGSSTACIIALTNMGLHAI  216

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQH FNFTYQLESG+  DLPSSG+VFTI V  GDV+V G
Sbjct  217  NLGDSGFIVVRDGCTIFRSPVQQHDFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVVG  276

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EVA +V DAV +G  P  TAQ+IA LARQRALDR RQTPF+ AAQEAG+
Sbjct  277  TDGLFDNLYNEEVAEIVLDAVRAGLEPLVTAQRIAVLARQRALDRNRQTPFSTAAQEAGF  336

Query  136  QYYGGK  119
            +YYGGK
Sbjct  337  RYYGGK  342



>ref|XP_006599390.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X6 
[Glycine max]
Length=373

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +ARELM +S+ AI  EPK+SI+PARVLEKAHS TKAKGSSTACII L   GLHAI
Sbjct  155  VNAGLFARELMSHSVRAIEEEPKNSINPARVLEKAHSCTKAKGSSTACIITLTDTGLHAI  214

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQHGFNFTYQLESG+  DLPSSG+VFTI V  GDV+VAG
Sbjct  215  NLGDSGFIVVRDGCTIFRSPVQQHGFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVAG  274

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY DEV  VV  +V +G  P+ TAQKIA LARQRALDR R TPF+ AAQEAG+
Sbjct  275  TDGLFDNLYNDEVTEVVLHSVRAGLEPQVTAQKIAVLARQRALDRNRPTPFSTAAQEAGF  334

Query  136  QYYGGK  119
            +YYGGK
Sbjct  335  RYYGGK  340



>ref|XP_003547993.2| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Glycine max]
Length=360

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +ARELM +S+ AI  EPK+SI+PARVLEKAHS TKAKGSSTACII L   GLHAI
Sbjct  155  VNAGLFARELMSHSVRAIEEEPKNSINPARVLEKAHSCTKAKGSSTACIITLTDTGLHAI  214

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQHGFNFTYQLESG+  DLPSSG+VFTI V  GDV+VAG
Sbjct  215  NLGDSGFIVVRDGCTIFRSPVQQHGFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVAG  274

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY DEV  VV  +V +G  P+ TAQKIA LARQRALDR R TPF+ AAQEAG+
Sbjct  275  TDGLFDNLYNDEVTEVVLHSVRAGLEPQVTAQKIAVLARQRALDRNRPTPFSTAAQEAGF  334

Query  136  QYYGGK  119
            +YYGGK
Sbjct  335  RYYGGK  340



>gb|KHN44501.1| Hypothetical protein glysoja_035733 [Glycine soja]
Length=362

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +ARELM +S+ AI  EPK+SI+PARVLEKAHS TKAKGSSTACII L   GLHAI
Sbjct  155  VNAGLFARELMSHSVRAIEEEPKNSINPARVLEKAHSCTKAKGSSTACIITLTDTGLHAI  214

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQHGFNFTYQLESG+  DLPSSG+VFTI V  GDV+VAG
Sbjct  215  NLGDSGFIVVRDGCTIFRSPVQQHGFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVAG  274

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY DEV  VV  +V +G  P+ TAQKIA LARQRALDR R TPF+ AAQEAG+
Sbjct  275  TDGLFDNLYNDEVTEVVLHSVRAGLEPQVTAQKIAVLARQRALDRNRPTPFSTAAQEAGF  334

Query  136  QYYGGK  119
            +YYGGK
Sbjct  335  RYYGGK  340



>ref|XP_006599391.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X7 
[Glycine max]
 ref|XP_006599392.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X8 
[Glycine max]
Length=364

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +ARELM +S+ AI  EPK+SI+PARVLEKAHS TKAKGSSTACII L   GLHAI
Sbjct  155  VNAGLFARELMSHSVRAIEEEPKNSINPARVLEKAHSCTKAKGSSTACIITLTDTGLHAI  214

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQHGFNFTYQLESG+  DLPSSG+VFTI V  GDV+VAG
Sbjct  215  NLGDSGFIVVRDGCTIFRSPVQQHGFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVAG  274

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY DEV  VV  +V +G  P+ TAQKIA LARQRALDR R TPF+ AAQEAG+
Sbjct  275  TDGLFDNLYNDEVTEVVLHSVRAGLEPQVTAQKIAVLARQRALDRNRPTPFSTAAQEAGF  334

Query  136  QYYGGK  119
            +YYGGK
Sbjct  335  RYYGGK  340



>ref|XP_006599388.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X4 
[Glycine max]
 ref|XP_006599389.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X5 
[Glycine max]
Length=378

 Score =   293 bits (749),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +ARELM +S+ AI  EPK+SI+PARVLEKAHS TKAKGSSTACII L   GLHAI
Sbjct  155  VNAGLFARELMSHSVRAIEEEPKNSINPARVLEKAHSCTKAKGSSTACIITLTDTGLHAI  214

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQHGFNFTYQLESG+  DLPSSG+VFTI V  GDV+VAG
Sbjct  215  NLGDSGFIVVRDGCTIFRSPVQQHGFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVAG  274

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY DEV  VV  +V +G  P+ TAQKIA LARQRALDR R TPF+ AAQEAG+
Sbjct  275  TDGLFDNLYNDEVTEVVLHSVRAGLEPQVTAQKIAVLARQRALDRNRPTPFSTAAQEAGF  334

Query  136  QYYGGK  119
            +YYGGK
Sbjct  335  RYYGGK  340



>ref|XP_006599386.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Glycine max]
Length=396

 Score =   293 bits (750),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +ARELM +S+ AI  EPK+SI+PARVLEKAHS TKAKGSSTACII L   GLHAI
Sbjct  155  VNAGLFARELMSHSVRAIEEEPKNSINPARVLEKAHSCTKAKGSSTACIITLTDTGLHAI  214

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQHGFNFTYQLESG+  DLPSSG+VFTI V  GDV+VAG
Sbjct  215  NLGDSGFIVVRDGCTIFRSPVQQHGFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVAG  274

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY DEV  VV  +V +G  P+ TAQKIA LARQRALDR R TPF+ AAQEAG+
Sbjct  275  TDGLFDNLYNDEVTEVVLHSVRAGLEPQVTAQKIAVLARQRALDRNRPTPFSTAAQEAGF  334

Query  136  QYYGGK  119
            +YYGGK
Sbjct  335  RYYGGK  340



>ref|XP_006599387.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X3 
[Glycine max]
Length=383

 Score =   292 bits (748),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +ARELM +S+ AI  EPK+SI+PARVLEKAHS TKAKGSSTACII L   GLHAI
Sbjct  155  VNAGLFARELMSHSVRAIEEEPKNSINPARVLEKAHSCTKAKGSSTACIITLTDTGLHAI  214

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQHGFNFTYQLESG+  DLPSSG+VFTI V  GDV+VAG
Sbjct  215  NLGDSGFIVVRDGCTIFRSPVQQHGFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVAG  274

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY DEV  VV  +V +G  P+ TAQKIA LARQRALDR R TPF+ AAQEAG+
Sbjct  275  TDGLFDNLYNDEVTEVVLHSVRAGLEPQVTAQKIAVLARQRALDRNRPTPFSTAAQEAGF  334

Query  136  QYYGGK  119
            +YYGGK
Sbjct  335  RYYGGK  340



>ref|XP_002268376.2| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Vitis 
vinifera]
Length=500

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG+YARELM  S+ AI  EPK SIDP+RVLEKAHS TKAKGSSTACI+AL  QGL AI
Sbjct  298  VDAGEYARELMSNSVTAIQEEPKGSIDPSRVLEKAHSSTKAKGSSTACIVALTDQGLQAI  357

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF+SPVQQHGFNFTYQLESG   DLPSSGQVFTI V  GDVIVAG
Sbjct  358  NLGDSGFIVVRDGCTIFQSPVQQHGFNFTYQLESGRAGDLPSSGQVFTIPVAPGDVIVAG  417

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  EV  VV  AV +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  418  TDGLFDNLYNSEVTAVVVHAVRAGLGPQVTAQKIAALARQRAQDRMRQTPFSTAAQDAGF  477

Query  136  QYYGGK  119
            +YYGGK
Sbjct  478  RYYGGK  483



>ref|XP_002525110.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF37237.1| protein phosphatase 2c, putative [Ricinus communis]
Length=416

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            INAG+YARELM  S+ AI  EP   IDP RVLEKAHS TKA+GSSTACIIAL ++G+HAI
Sbjct  214  INAGEYARELMSNSVSAIEEEPTGLIDPGRVLEKAHSSTKAQGSSTACIIALTNEGIHAI  273

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F+SPVQQHGFNFTYQLESG R DLPSSGQVFT  V  GDVI+AG
Sbjct  274  NLGDSGFMVVRDGCTVFQSPVQQHGFNFTYQLESGGRGDLPSSGQVFTFPVSPGDVIIAG  333

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  VV  AV +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  334  TDGLFDNLYNNEVTAVVVHAVRAGLGPQVTAQKIAALARQRAQDRNRQTPFSAAAQDAGF  393

Query  136  QYYGGK  119
            +YYGGK
Sbjct  394  RYYGGK  399



>ref|XP_007160777.1| hypothetical protein PHAVU_001G015900g [Phaseolus vulgaris]
 gb|ESW32771.1| hypothetical protein PHAVU_001G015900g [Phaseolus vulgaris]
Length=507

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +N+G Y+RELM  S+DAI  EPK SIDPARVLEKAHS TKAKGSSTACIIAL  QGL+AI
Sbjct  305  VNSGYYSRELMSKSVDAIQEEPKGSIDPARVLEKAHSSTKAKGSSTACIIALTDQGLNAI  364

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLE GS  DLPSSGQVFTI V  GDVIVAG
Sbjct  365  NLGDSGFMVVRDGCTVFRSPVQQHDFNFTYQLECGSNGDLPSSGQVFTIPVAPGDVIVAG  424

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G +P+ TAQKIAALARQRALD+ RQTPF+ AAQ+AG+
Sbjct  425  TDGLFDNLYNNEITAVVVHAMRAGLSPQVTAQKIAALARQRALDKDRQTPFSTAAQDAGF  484

Query  136  QYYGGK  119
            +YYGGK
Sbjct  485  RYYGGK  490



>gb|KEH40106.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=508

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +N+G Y+RELM  S+DAI  EPK S+DPARVLEKA+S TKAKGSSTACIIAL  QGLHAI
Sbjct  306  VNSGYYSRELMSNSVDAIREEPKGSVDPARVLEKAYSSTKAKGSSTACIIALTDQGLHAI  365

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+V+RDGCTIF+SPVQQH FNFTYQLE  S +DLPSSGQVFT+AV  GDVIVAG
Sbjct  366  NLGDSGFMVIRDGCTIFQSPVQQHDFNFTYQLECSSHSDLPSSGQVFTVAVAPGDVIVAG  425

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV   V +G +P+ TAQKIAALARQRALD+ RQTPF+ AAQ+AG+
Sbjct  426  TDGLFDNLYNNEITAVVVHGVRAGFSPQVTAQKIAALARQRALDKDRQTPFSTAAQDAGF  485

Query  136  QYYGGK  119
            +YYGGK
Sbjct  486  RYYGGK  491



>gb|KHN12726.1| Hypothetical protein glysoja_008689 [Glycine soja]
Length=506

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG Y+RELM  S++AI  EPK S+DPARVLEKAHS TKA+GSSTACIIAL  QGL+AI
Sbjct  304  VNAGYYSRELMSKSVEAIQEEPKGSVDPARVLEKAHSSTKARGSSTACIIALTDQGLNAI  363

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLE GS  DLPSSGQVFTI V  GDVIVAG
Sbjct  364  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLECGSNGDLPSSGQVFTIPVAPGDVIVAG  423

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G +P+ TAQKIAALARQRALD+ RQTPF+ AAQ+AG+
Sbjct  424  TDGLFDNLYNNEITAVVVHAMRTGLSPQVTAQKIAALARQRALDKDRQTPFSTAAQDAGF  483

Query  136  QYYGGK  119
            +YYGGK
Sbjct  484  RYYGGK  489



>ref|XP_006601312.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Glycine max]
Length=496

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG Y+RELM  S++AI  EPK SIDPARVLEKAHS TKA+GSSTACIIAL  QGL+AI
Sbjct  294  VNAGYYSRELMSKSVEAIQDEPKGSIDPARVLEKAHSSTKARGSSTACIIALTDQGLNAI  353

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLE GS  DLPSSGQVFTI V  GDVIVAG
Sbjct  354  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLECGSNGDLPSSGQVFTIPVAPGDVIVAG  413

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G +P+ TAQKIAALARQRALD+ RQTPF+ AAQ+AG+
Sbjct  414  TDGLFDNLYNNEITAVVVHAMRTGLSPQVTAQKIAALARQRALDKDRQTPFSTAAQDAGF  473

Query  136  QYYGGK  119
            +YYGGK
Sbjct  474  RYYGGK  479



>ref|XP_003550371.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Glycine max]
Length=506

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG Y+RELM  S++AI  EPK SIDPARVLEKAHS TKA+GSSTACIIAL  QGL+AI
Sbjct  304  VNAGYYSRELMSKSVEAIQDEPKGSIDPARVLEKAHSSTKARGSSTACIIALTDQGLNAI  363

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLE GS  DLPSSGQVFTI V  GDVIVAG
Sbjct  364  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLECGSNGDLPSSGQVFTIPVAPGDVIVAG  423

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G +P+ TAQKIAALARQRALD+ RQTPF+ AAQ+AG+
Sbjct  424  TDGLFDNLYNNEITAVVVHAMRTGLSPQVTAQKIAALARQRALDKDRQTPFSTAAQDAGF  483

Query  136  QYYGGK  119
            +YYGGK
Sbjct  484  RYYGGK  489



>ref|XP_008338675.1| PREDICTED: probable protein phosphatase 2C 80 [Malus domestica]
Length=434

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG ++RELM +S+ AI  EP+   DPARVLEKAHS TKAKGSSTACII L  +GL AI
Sbjct  232  VNAGYFSRELMSHSVRAIQEEPEGCFDPARVLEKAHSCTKAKGSSTACIIGLTEKGLQAI  291

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F+SPVQQHGFNFTYQLESGS ADLPSSGQVF I V SGDVI+AG
Sbjct  292  NLGDSGFLVVRDGCTVFQSPVQQHGFNFTYQLESGSGADLPSSGQVFLIPVASGDVIIAG  351

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  AV +G  P+ TAQKIAALARQRALD+ RQTPF+ AAQEAG+
Sbjct  352  TDGLFDNLYNNEITAVVVHAVRAGLAPQVTAQKIAALARQRALDKNRQTPFSTAAQEAGF  411

Query  136  QYYGGK  119
            +YYGGK
Sbjct  412  RYYGGK  417



>ref|XP_006375083.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
 ref|XP_006375085.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
 gb|ERP52880.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
 gb|ERP52882.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
Length=510

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I++G Y+RELM  S+ A+  EPK SIDPARVLEKAHS TKAKGSSTACIIAL  QGLHAI
Sbjct  308  IDSGLYSRELMSNSVTAVQEEPKGSIDPARVLEKAHSSTKAKGSSTACIIALTDQGLHAI  367

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCT+F SPVQQHGFNFTYQLE+G+  DLPSSGQVFTI V  GDVIVAG
Sbjct  368  NLGDSGFIVVRDGCTVFRSPVQQHGFNFTYQLENGNNGDLPSSGQVFTIPVAPGDVIVAG  427

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ATAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  428  TDGLFDNLYNNEINAVVVHAMRAGLEPQATAQKIAALARQRAQDKDRQTPFSTAAQDAGF  487

Query  136  QYYGGK  119
            +YYGGK
Sbjct  488  RYYGGK  493



>ref|XP_008453722.1| PREDICTED: probable protein phosphatase 2C 80 [Cucumis melo]
 ref|XP_008453723.1| PREDICTED: probable protein phosphatase 2C 80 [Cucumis melo]
Length=452

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG +ARELM  S++AI  +P +S+DPA+VLEKAHS T AKGSSTACII L+ +GLHAI
Sbjct  250  IDAGKFARELMSNSINAIQEQPGESVDPAKVLEKAHSGTTAKGSSTACIICLSEKGLHAI  309

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIV+RDG TIF SPVQQHGFNFTYQLESG+  DLPSSG+VF I V  GDVIVAG
Sbjct  310  NLGDSGFIVIRDGSTIFRSPVQQHGFNFTYQLESGNGGDLPSSGEVFMIPVALGDVIVAG  369

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E++ VV +AV SG  PEATAQ IAALARQRALDR RQTPF+ AAQEAGY
Sbjct  370  TDGLFDNLYSNEISAVVVNAVRSGLEPEATAQNIAALARQRALDRNRQTPFSAAAQEAGY  429

Query  136  QYYGGK  119
            +YYGGK
Sbjct  430  RYYGGK  435



>ref|XP_004149170.1| PREDICTED: probable protein phosphatase 2C 55-like [Cucumis sativus]
 ref|XP_004164788.1| PREDICTED: probable protein phosphatase 2C 55-like [Cucumis sativus]
 gb|KGN53266.1| hypothetical protein Csa_4G038830 [Cucumis sativus]
Length=450

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG +ARELM  S++AI  +P +S+DPA+VLEKAHS T AKGSSTACII+L+ +GLHAI
Sbjct  248  IDAGKFARELMSNSINAIQEQPGESVDPAKVLEKAHSGTTAKGSSTACIISLSEKGLHAI  307

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIV+RDG TIF SPVQQHGFNFTYQLESG+  DLPSSG++F I V  GDVIVAG
Sbjct  308  NLGDSGFIVIRDGSTIFRSPVQQHGFNFTYQLESGNGGDLPSSGEIFMIPVALGDVIVAG  367

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E++ VV +AV SG  PEATAQ IAALARQRALDR RQTPF+ AAQEAGY
Sbjct  368  TDGLFDNLYSNEISAVVVNAVRSGLEPEATAQNIAALARQRALDRNRQTPFSAAAQEAGY  427

Query  136  QYYGGK  119
            +YYGGK
Sbjct  428  RYYGGK  433



>ref|XP_007156027.1| hypothetical protein PHAVU_003G252300g [Phaseolus vulgaris]
 gb|ESW28021.1| hypothetical protein PHAVU_003G252300g [Phaseolus vulgaris]
Length=365

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +A+ELM +S+ AI   PK  +DPA VLEKAHS TKAKGSSTACIIAL   GLHAI
Sbjct  158  VNAGLFAQELMSHSVRAIEEGPKGPVDPASVLEKAHSCTKAKGSSTACIIALTDTGLHAI  217

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIV+RDGCTIF+SPVQQH FNFTYQLESG   DLPSSG+VFTI+V  GDV+VAG
Sbjct  218  NLGDSGFIVIRDGCTIFKSPVQQHDFNFTYQLESGDGCDLPSSGEVFTISVAPGDVVVAG  277

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY DEVA VV +AV +G  P+ TAQKIAALARQRALDR RQ+PF+ AAQEAG+
Sbjct  278  TDGLFDNLYNDEVAEVVLNAVRAGLEPQVTAQKIAALARQRALDRNRQSPFSAAAQEAGF  337

Query  136  QYYGGK  119
             YYGGK
Sbjct  338  NYYGGK  343



>ref|XP_007156026.1| hypothetical protein PHAVU_003G252300g [Phaseolus vulgaris]
 gb|ESW28020.1| hypothetical protein PHAVU_003G252300g [Phaseolus vulgaris]
Length=359

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +A+ELM +S+ AI   PK  +DPA VLEKAHS TKAKGSSTACIIAL   GLHAI
Sbjct  158  VNAGLFAQELMSHSVRAIEEGPKGPVDPASVLEKAHSCTKAKGSSTACIIALTDTGLHAI  217

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIV+RDGCTIF+SPVQQH FNFTYQLESG   DLPSSG+VFTI+V  GDV+VAG
Sbjct  218  NLGDSGFIVIRDGCTIFKSPVQQHDFNFTYQLESGDGCDLPSSGEVFTISVAPGDVVVAG  277

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY DEVA VV +AV +G  P+ TAQKIAALARQRALDR RQ+PF+ AAQEAG+
Sbjct  278  TDGLFDNLYNDEVAEVVLNAVRAGLEPQVTAQKIAALARQRALDRNRQSPFSAAAQEAGF  337

Query  136  QYYGGK  119
             YYGGK
Sbjct  338  NYYGGK  343



>ref|XP_008220774.1| PREDICTED: probable protein phosphatase 2C 55 [Prunus mume]
 ref|XP_008220775.1| PREDICTED: probable protein phosphatase 2C 55 [Prunus mume]
Length=508

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +N+G Y+RELM  S+ A+  EPK S+DPARVLEKAHS TKAKGSSTACIIAL  QG+HAI
Sbjct  306  VNSGLYSRELMSNSVAAVQEEPKGSVDPARVLEKAHSSTKAKGSSTACIIALTEQGIHAI  365

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCT+F SPVQQH FNFTYQLESGS  DLPSSGQVFT+ V  GDVI+AG
Sbjct  366  NLGDSGFIVVRDGCTVFRSPVQQHDFNFTYQLESGSNGDLPSSGQVFTVPVAPGDVIIAG  425

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  426  TDGLFDNLYNNEITAVVVHAIRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGF  485

Query  136  QYYGGK  119
            +YYGGK
Sbjct  486  RYYGGK  491



>ref|XP_007223264.1| hypothetical protein PRUPE_ppa004472mg [Prunus persica]
 gb|EMJ24463.1| hypothetical protein PRUPE_ppa004472mg [Prunus persica]
Length=508

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +N+G Y+RELM  S+ A+  EPK S+DPARVLEKAHS TKAKGSSTACIIAL  QG+HAI
Sbjct  306  VNSGLYSRELMSNSVAAVQEEPKGSVDPARVLEKAHSSTKAKGSSTACIIALTEQGIHAI  365

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCT+F SPVQQH FNFTYQLESGS  DLPSSGQVFT+ V  GDVI+AG
Sbjct  366  NLGDSGFIVVRDGCTVFRSPVQQHDFNFTYQLESGSNGDLPSSGQVFTVPVAPGDVIIAG  425

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  426  TDGLFDNLYNNEITAVVVHAIRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGF  485

Query  136  QYYGGK  119
            +YYGGK
Sbjct  486  RYYGGK  491



>ref|XP_009356669.1| PREDICTED: probable protein phosphatase 2C 80 [Pyrus x bretschneideri]
Length=434

 Score =   289 bits (740),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG ++RELM +S+ AI  EP+   DPARVLEKAHS TKAKGSSTACII L  +GL AI
Sbjct  232  VNAGYFSRELMSHSVRAIQEEPEGCFDPARVLEKAHSCTKAKGSSTACIIGLTEKGLQAI  291

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F+SPVQQHGFNFTYQLESGS ADLPSSGQVF I V SGDVI+AG
Sbjct  292  NLGDSGFLVVRDGCTVFQSPVQQHGFNFTYQLESGSGADLPSSGQVFLIPVASGDVIIAG  351

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  AV +G  P+ TAQKIAALARQRALD+ RQTPF+ AAQEAG+
Sbjct  352  TDGLFDNLYNNEITAVVVHAVRAGFAPQVTAQKIAALARQRALDKNRQTPFSTAAQEAGF  411

Query  136  QYYGGK  119
            +YYGGK
Sbjct  412  RYYGGK  417



>ref|XP_010649173.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Vitis 
vinifera]
 ref|XP_010649174.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Vitis 
vinifera]
 ref|XP_010649176.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Vitis 
vinifera]
Length=501

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIAL-NSQGLHA  500
            ++AG+YARELM  S+ AI  EPK SIDP+RVLEKAHS TKAKGSSTACI+AL + QGL A
Sbjct  298  VDAGEYARELMSNSVTAIQEEPKGSIDPSRVLEKAHSSTKAKGSSTACIVALTDQQGLQA  357

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            INLGDSGFIVVRDGCTIF+SPVQQHGFNFTYQLESG   DLPSSGQVFTI V  GDVIVA
Sbjct  358  INLGDSGFIVVRDGCTIFQSPVQQHGFNFTYQLESGRAGDLPSSGQVFTIPVAPGDVIVA  417

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDGLFDNLY  EV  VV  AV +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG
Sbjct  418  GTDGLFDNLYNSEVTAVVVHAVRAGLGPQVTAQKIAALARQRAQDRMRQTPFSTAAQDAG  477

Query  139  YQYYGGK  119
            ++YYGGK
Sbjct  478  FRYYGGK  484



>gb|KJB14503.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
 gb|KJB14504.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
Length=514

 Score =   291 bits (746),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+RELM  S+ AI  EPK SIDPARVLEKAHS TKAKGSSTACIIAL  QGLHAI
Sbjct  305  VDAGLYSRELMSNSVSAIQEEPKGSIDPARVLEKAHSSTKAKGSSTACIIALTDQGLHAI  364

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLESGS  DLPSSGQVF + V  GDVI+AG
Sbjct  365  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVIIAG  424

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  AV +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  425  TDGLFDNLYNNEITAVVVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGF  484

Query  136  QYYGGK  119
            +YYGGK
Sbjct  485  RYYGGK  490



>ref|XP_006375084.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
 gb|ERP52881.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
Length=521

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I++G Y+RELM  S+ A+  EPK SIDPARVLEKAHS TKAKGSSTACIIAL  QGLHAI
Sbjct  308  IDSGLYSRELMSNSVTAVQEEPKGSIDPARVLEKAHSSTKAKGSSTACIIALTDQGLHAI  367

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCT+F SPVQQHGFNFTYQLE+G+  DLPSSGQVFTI V  GDVIVAG
Sbjct  368  NLGDSGFIVVRDGCTVFRSPVQQHGFNFTYQLENGNNGDLPSSGQVFTIPVAPGDVIVAG  427

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ATAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  428  TDGLFDNLYNNEINAVVVHAMRAGLEPQATAQKIAALARQRAQDKDRQTPFSTAAQDAGF  487

Query  136  QYYGGK  119
            +YYGGK
Sbjct  488  RYYGGK  493



>gb|KJB14505.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
 gb|KJB14507.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
 gb|KJB14508.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
Length=511

 Score =   291 bits (745),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+RELM  S+ AI  EPK SIDPARVLEKAHS TKAKGSSTACIIAL  QGLHAI
Sbjct  305  VDAGLYSRELMSNSVSAIQEEPKGSIDPARVLEKAHSSTKAKGSSTACIIALTDQGLHAI  364

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLESGS  DLPSSGQVF + V  GDVI+AG
Sbjct  365  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVIIAG  424

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  AV +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  425  TDGLFDNLYNNEITAVVVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGF  484

Query  136  QYYGGK  119
            +YYGGK
Sbjct  485  RYYGGK  490



>ref|XP_003544423.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Glycine max]
 gb|KHN20995.1| Hypothetical protein glysoja_009303 [Glycine soja]
Length=506

 Score =   291 bits (745),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG Y+RELM  S++AI  EPK S+DPARVLEKAHS TKA+GSSTACIIAL  QGL+AI
Sbjct  304  VNAGYYSRELMSKSVEAIQEEPKGSVDPARVLEKAHSSTKARGSSTACIIALTDQGLNAI  363

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLE GS  DLPSSGQVFTI V  GDVIVAG
Sbjct  364  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLECGSNGDLPSSGQVFTIPVAPGDVIVAG  423

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G +P+ TAQKIAALARQRA+D+ RQTPF+ AAQ+AG+
Sbjct  424  TDGLFDNLYNNEITAVVVHAMRAGLSPQVTAQKIAALARQRAMDKDRQTPFSTAAQDAGF  483

Query  136  QYYGGK  119
            +YYGGK
Sbjct  484  RYYGGK  489



>ref|XP_004499136.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Cicer arietinum]
 ref|XP_004499137.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Cicer arietinum]
Length=505

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +++G Y+RELM +S+DAI  EPK S+DPARVLEKAHS TKAKGSSTACIIAL  QGL+AI
Sbjct  303  VDSGYYSRELMSHSVDAIQEEPKGSVDPARVLEKAHSSTKAKGSSTACIIALTDQGLNAI  362

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+V+RDGCTIF SPVQQH FNFTYQLE G   DLPSSGQVFT+AV  GDVIVAG
Sbjct  363  NLGDSGFMVIRDGCTIFRSPVQQHDFNFTYQLECGRNGDLPSSGQVFTVAVAPGDVIVAG  422

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV   V +G +P+ TAQKIAALARQRALD+ RQTPF+ AAQ+AG+
Sbjct  423  TDGLFDNLYNNEITAVVVHGVRAGLSPQVTAQKIAALARQRALDKDRQTPFSTAAQDAGF  482

Query  136  QYYGGK  119
            +YYGGK
Sbjct  483  RYYGGK  488



>ref|XP_006595942.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Glycine max]
Length=496

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG Y+RELM  S++AI  EPK S+DPARVLEKAHS TKA+GSSTACIIAL  QGL+AI
Sbjct  294  VNAGYYSRELMSKSVEAIQEEPKGSVDPARVLEKAHSSTKARGSSTACIIALTDQGLNAI  353

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLE GS  DLPSSGQVFTI V  GDVIVAG
Sbjct  354  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLECGSNGDLPSSGQVFTIPVAPGDVIVAG  413

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G +P+ TAQKIAALARQRA+D+ RQTPF+ AAQ+AG+
Sbjct  414  TDGLFDNLYNNEITAVVVHAMRAGLSPQVTAQKIAALARQRAMDKDRQTPFSTAAQDAGF  473

Query  136  QYYGGK  119
            +YYGGK
Sbjct  474  RYYGGK  479



>gb|KHG04398.1| hypothetical protein F383_28830 [Gossypium arboreum]
Length=533

 Score =   291 bits (746),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+RELM  S+ AI  EPK SIDPARVLEKAHS TKAKGSSTACIIAL  QGLHAI
Sbjct  305  VDAGLYSRELMSNSVSAIREEPKGSIDPARVLEKAHSSTKAKGSSTACIIALTDQGLHAI  364

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLESGS  DLPSSGQVF + V  GDVI+AG
Sbjct  365  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVIIAG  424

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  AV +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  425  TDGLFDNLYNNEITAVVVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGF  484

Query  136  QYYGGK  119
            +YYGGK
Sbjct  485  RYYGGK  490



>ref|XP_011031594.1| PREDICTED: probable protein phosphatase 2C 55 [Populus euphratica]
Length=521

 Score =   291 bits (745),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I++G Y+RELM  S+ A+  EPK SIDPARVLEKAHS TKAKGSSTACIIAL  QGLHAI
Sbjct  308  IDSGLYSRELMSNSVAAVQEEPKGSIDPARVLEKAHSSTKAKGSSTACIIALTDQGLHAI  367

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCT+F SPVQQHGFNFTYQLE+G+  DLPSSGQVFTI V  GDVIVAG
Sbjct  368  NLGDSGFIVVRDGCTVFRSPVQQHGFNFTYQLENGNNGDLPSSGQVFTIPVAPGDVIVAG  427

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ATAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  428  TDGLFDNLYNNEINAVVVHAMRAGLEPQATAQKIAALARQRAQDKDRQTPFSTAAQDAGF  487

Query  136  QYYGGK  119
            +YYGGK
Sbjct  488  RYYGGK  493



>ref|XP_002510354.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF52541.1| protein phosphatase 2c, putative [Ricinus communis]
Length=512

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +++G Y+RELM +S+ AI  EPK S+DPARVLEKAHS TKAKGSSTACIIAL  +GLHAI
Sbjct  310  VDSGKYSRELMSHSVTAIRDEPKRSVDPARVLEKAHSSTKAKGSSTACIIALTDEGLHAI  369

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCT+F SPVQQH FNFTYQLESG+  DLPSSGQVFTI V  GDVIVAG
Sbjct  370  NLGDSGFIVVRDGCTVFRSPVQQHDFNFTYQLESGNNGDLPSSGQVFTIPVAPGDVIVAG  429

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  430  TDGLFDNLYNNEITAVVVHAMRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGF  489

Query  136  QYYGGK  119
            +YYGGK
Sbjct  490  RYYGGK  495



>ref|XP_007017484.1| Phosphatase 2c, putative isoform 6 [Theobroma cacao]
 gb|EOY14709.1| Phosphatase 2c, putative isoform 6 [Theobroma cacao]
Length=513

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+RELM  S+ AI  EPK S+DPARVLEKAHS TKAKGSSTACIIAL  QGLHAI
Sbjct  307  VDAGQYSRELMSNSVSAIQEEPKGSVDPARVLEKAHSCTKAKGSSTACIIALTDQGLHAI  366

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLESGS  DLPSSGQVF + V  GDV++AG
Sbjct  367  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVVIAG  426

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  AV +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  427  TDGLFDNLYNNEITAVVVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGF  486

Query  136  QYYGGK  119
            +YYGGK
Sbjct  487  RYYGGK  492



>emb|CBI19663.3| unnamed protein product [Vitis vinifera]
Length=286

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +++G YARELM  S+ AI  EPK S+DPARVLEKAH  TKAKGSSTACIIAL  QGLHAI
Sbjct  75   VDSGQYARELMSNSVTAIQEEPKGSVDPARVLEKAHFSTKAKGSSTACIIALTEQGLHAI  134

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIV+RDGCT+F SPVQQH FNFTYQLESG+  DLPSSGQVFTI V  GDV++AG
Sbjct  135  NLGDSGFIVIRDGCTVFRSPVQQHDFNFTYQLESGNGGDLPSSGQVFTIPVAPGDVVIAG  194

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  VV  A  +   P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG 
Sbjct  195  TDGLFDNLYNNEVIAVVVHATRASLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGI  254

Query  136  QYYGGK  119
            +YYGGK
Sbjct  255  RYYGGK  260



>ref|XP_007017480.1| Phosphatase 2c, putative isoform 2 [Theobroma cacao]
 ref|XP_007017481.1| Phosphatase 2c, putative isoform 2 [Theobroma cacao]
 gb|EOY14705.1| Phosphatase 2c, putative isoform 2 [Theobroma cacao]
 gb|EOY14706.1| Phosphatase 2c, putative isoform 2 [Theobroma cacao]
Length=514

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+RELM  S+ AI  EPK S+DPARVLEKAHS TKAKGSSTACIIAL  QGLHAI
Sbjct  307  VDAGQYSRELMSNSVSAIQEEPKGSVDPARVLEKAHSCTKAKGSSTACIIALTDQGLHAI  366

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLESGS  DLPSSGQVF + V  GDV++AG
Sbjct  367  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVVIAG  426

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  AV +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  427  TDGLFDNLYNNEITAVVVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGF  486

Query  136  QYYGGK  119
            +YYGGK
Sbjct  487  RYYGGK  492



>ref|XP_008241643.1| PREDICTED: probable protein phosphatase 2C 80 [Prunus mume]
Length=438

 Score =   287 bits (735),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG ++RELM +S+ AI  EP+   DPARVLEKAHS TKAKGSSTACII L  +GL AI
Sbjct  236  VNAGHFSRELMSHSVRAIQEEPEGCFDPARVLEKAHSCTKAKGSSTACIIGLTEKGLQAI  295

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDG T+F+SPVQQHGFNFTYQLESGS ADLPSSGQVF I V+ GDVI+AG
Sbjct  296  NLGDSGFVVVRDGSTVFQSPVQQHGFNFTYQLESGSGADLPSSGQVFLIPVVPGDVIIAG  355

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  VV  AV +G  P+ TAQKIAALARQRALD+ RQTPF+ AAQEAG+
Sbjct  356  TDGLFDNLYNNEVTAVVVHAVRAGLEPQVTAQKIAALARQRALDKNRQTPFSTAAQEAGF  415

Query  136  QYYGGK  119
            +YYGGK
Sbjct  416  RYYGGK  421



>ref|XP_007017483.1| Phosphatase 2c, putative isoform 5, partial [Theobroma cacao]
 gb|EOY14708.1| Phosphatase 2c, putative isoform 5, partial [Theobroma cacao]
Length=520

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+RELM  S+ AI  EPK S+DPARVLEKAHS TKAKGSSTACIIAL  QGLHAI
Sbjct  307  VDAGQYSRELMSNSVSAIQEEPKGSVDPARVLEKAHSCTKAKGSSTACIIALTDQGLHAI  366

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLESGS  DLPSSGQVF + V  GDV++AG
Sbjct  367  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVVIAG  426

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  AV +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  427  TDGLFDNLYNNEITAVVVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGF  486

Query  136  QYYGGK  119
            +YYGGK
Sbjct  487  RYYGGK  492



>ref|XP_007017482.1| Phosphatase 2c, putative isoform 4 [Theobroma cacao]
 gb|EOY14707.1| Phosphatase 2c, putative isoform 4 [Theobroma cacao]
Length=522

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+RELM  S+ AI  EPK S+DPARVLEKAHS TKAKGSSTACIIAL  QGLHAI
Sbjct  307  VDAGQYSRELMSNSVSAIQEEPKGSVDPARVLEKAHSCTKAKGSSTACIIALTDQGLHAI  366

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLESGS  DLPSSGQVF + V  GDV++AG
Sbjct  367  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVVIAG  426

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  AV +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  427  TDGLFDNLYNNEITAVVVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGF  486

Query  136  QYYGGK  119
            +YYGGK
Sbjct  487  RYYGGK  492



>ref|XP_008377320.1| PREDICTED: probable protein phosphatase 2C 55 [Malus domestica]
 ref|XP_008377321.1| PREDICTED: probable protein phosphatase 2C 55 [Malus domestica]
Length=507

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +N+G Y+RELM  S+ A+  EPK S+DPARVLEKAHS TKA+GSSTACIIAL  QG+HA+
Sbjct  305  VNSGLYSRELMSNSVAAVQEEPKGSVDPARVLEKAHSSTKARGSSTACIIALTEQGIHAV  364

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCT+F SPVQQH FNFTYQLESG+  DLPSSGQVFT+ V  GDVI+AG
Sbjct  365  NLGDSGFIVVRDGCTVFRSPVQQHDFNFTYQLESGNNGDLPSSGQVFTVPVAPGDVIIAG  424

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  425  TDGLFDNLYNNEITAVVVHAIRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGF  484

Query  136  QYYGGK  119
            +YYGGK
Sbjct  485  RYYGGK  490



>ref|XP_008798754.1| PREDICTED: probable protein phosphatase 2C 55 [Phoenix dactylifera]
 ref|XP_008798755.1| PREDICTED: probable protein phosphatase 2C 55 [Phoenix dactylifera]
 ref|XP_008798756.1| PREDICTED: probable protein phosphatase 2C 55 [Phoenix dactylifera]
Length=486

 Score =   288 bits (738),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM +S+ AI  EPK SI+PARVLEKA+S TKAKGSSTACIIAL  QG+HA+
Sbjct  285  VDAGQYARELMSHSVAAIQEEPKGSINPARVLEKAYSSTKAKGSSTACIIALTHQGIHAV  344

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQH FNFTYQLESG+ +DLPS+ QVFT  V +GDVIVAG
Sbjct  345  NLGDSGFIVVRDGCTIFRSPVQQHDFNFTYQLESGNASDLPSAAQVFTFPVAAGDVIVAG  404

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQEAGY
Sbjct  405  TDGLFDNLYNNEITAVVVHAIRAGLEPQVTAQKIAALARQRAQDKNRQTPFSSAAQEAGY  464

Query  136  QYYGGK  119
            +YYGGK
Sbjct  465  RYYGGK  470



>gb|KDP38477.1| hypothetical protein JCGZ_04402 [Jatropha curcas]
Length=464

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+RELM  S+ AI  EPK SIDP RVLEKAHS TKAKGSSTACIIAL  +GLHAI
Sbjct  257  VDAGIYSRELMNNSVTAIQEEPKGSIDPVRVLEKAHSSTKAKGSSTACIIALTDEGLHAI  316

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCT+F SPVQQH FNFTYQLESG   DLPSSGQVFTIAV  GDVIVAG
Sbjct  317  NLGDSGFIVVRDGCTVFRSPVQQHDFNFTYQLESGDNGDLPSSGQVFTIAVAPGDVIVAG  376

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  E+  VV  A  +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  377  TDGLFDNLYNSEINAVVVHATRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGF  436

Query  136  QYYGGK  119
            +YYGGK
Sbjct  437  RYYGGK  442



>ref|XP_009364699.1| PREDICTED: probable protein phosphatase 2C 55 [Pyrus x bretschneideri]
 ref|XP_009364704.1| PREDICTED: probable protein phosphatase 2C 55 [Pyrus x bretschneideri]
Length=507

 Score =   289 bits (739),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +N+G Y+RELM  S+ A+  EPK S+DPARVLEKAHS TKA+GSSTACIIAL  QG+HA+
Sbjct  305  VNSGLYSRELMSNSVAAVQEEPKGSVDPARVLEKAHSSTKARGSSTACIIALTEQGIHAV  364

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCT+F SPVQQH FNFTYQLESG+  DLPSSGQVFT+ V  GDVI+AG
Sbjct  365  NLGDSGFIVVRDGCTVFRSPVQQHDFNFTYQLESGNNGDLPSSGQVFTVPVAPGDVIIAG  424

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  425  TDGLFDNLYNNEITAVVVHAIRAGLGPQVTAQKIAALARQRAQDRDRQTPFSPAAQDAGF  484

Query  136  QYYGGK  119
            +YYGGK
Sbjct  485  RYYGGK  490



>ref|XP_007017479.1| Phosphatase 2c, putative isoform 1 [Theobroma cacao]
 gb|EOY14704.1| Phosphatase 2c, putative isoform 1 [Theobroma cacao]
Length=552

 Score =   290 bits (742),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+RELM  S+ AI  EPK S+DPARVLEKAHS TKAKGSSTACIIAL  QGLHAI
Sbjct  307  VDAGQYSRELMSNSVSAIQEEPKGSVDPARVLEKAHSCTKAKGSSTACIIALTDQGLHAI  366

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLESGS  DLPSSGQVF + V  GDV++AG
Sbjct  367  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVVIAG  426

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  AV +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  427  TDGLFDNLYNNEITAVVVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGF  486

Query  136  QYYGGK  119
            +YYGGK
Sbjct  487  RYYGGK  492



>ref|XP_010905077.1| PREDICTED: probable protein phosphatase 2C 55 [Elaeis guineensis]
Length=486

 Score =   288 bits (737),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM +S+ AI  EPK SI+PARVLEKA+S TKAKGSSTACIIAL  QG+HA+
Sbjct  285  VDAGQYARELMSHSVAAIQEEPKGSINPARVLEKAYSSTKAKGSSTACIIALTDQGIHAV  344

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQH FNFTYQLESG+ +DLPS+ QVFT  V +GDVIVAG
Sbjct  345  NLGDSGFIVVRDGCTIFRSPVQQHDFNFTYQLESGNASDLPSAAQVFTFPVAAGDVIVAG  404

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQEAGY
Sbjct  405  TDGLFDNLYNNEITAVVVHAIRAGLEPQVTAQKIAALARQRAQDKNRQTPFSSAAQEAGY  464

Query  136  QYYGGK  119
            +YYGGK
Sbjct  465  RYYGGK  470



>ref|XP_004300615.1| PREDICTED: probable protein phosphatase 2C 80 [Fragaria vesca 
subsp. vesca]
Length=439

 Score =   286 bits (733),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +ARELM +S+ AI  EP  S +PARVLEKAHS TKAKGSSTACII L  +GLHAI
Sbjct  237  VNAGLFARELMAHSLKAIQEEPMGSFEPARVLEKAHSCTKAKGSSTACIIGLTEKGLHAI  296

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDG TIF SPVQQHGFNFTYQLESGS ADLPSSG+VF I V +GDVI+AG
Sbjct  297  NLGDSGFIVVRDGSTIFRSPVQQHGFNFTYQLESGSGADLPSSGEVFLIPVAAGDVIIAG  356

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  EV  +V  AV +G  P+ATA+KIAALAR RALD+ RQTPF+ AAQ+AG+
Sbjct  357  TDGLFDNLYNTEVTAIVVHAVRTGLEPQATAKKIAALARTRALDKNRQTPFSTAAQDAGF  416

Query  136  QYYGGK  119
            +YYGGK
Sbjct  417  RYYGGK  422



>ref|XP_011074517.1| PREDICTED: probable protein phosphatase 2C 55 [Sesamum indicum]
Length=518

 Score =   288 bits (738),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S++AI  EP+ S+DPARVLEKA++ TKAKGSSTACIIAL  QGLHAI
Sbjct  308  VDAGQYARELMSNSVNAIQEEPRGSVDPARVLEKAYTSTKAKGSSTACIIALTDQGLHAI  367

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLESG+  DLPSSGQVFTI V  GDV++AG
Sbjct  368  NLGDSGFMVVRDGCTVFRSPVQQHDFNFTYQLESGNAGDLPSSGQVFTIPVAPGDVVIAG  427

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +++  VV  AV +G  P+ATAQKIAALARQRA D+ RQTPF+ AAQEAG+
Sbjct  428  TDGLFDNLYNNDITAVVVHAVRAGLGPQATAQKIAALARQRAQDKNRQTPFSTAAQEAGF  487

Query  136  QYYGGK  119
            +YYGGK
Sbjct  488  RYYGGK  493



>ref|XP_007202065.1| hypothetical protein PRUPE_ppa005911mg [Prunus persica]
 gb|EMJ03264.1| hypothetical protein PRUPE_ppa005911mg [Prunus persica]
Length=438

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG ++RELM +S+ AI  EP+   DP+RVLEKAHS TKAKGSSTACII L  +GL AI
Sbjct  236  VNAGHFSRELMSHSVRAIQEEPEGCFDPSRVLEKAHSCTKAKGSSTACIIGLTEKGLQAI  295

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDG TIF+SPVQQHGFNFTYQLESGS ADLPSSGQVF I V+ GDVI+AG
Sbjct  296  NLGDSGFVVVRDGSTIFQSPVQQHGFNFTYQLESGSGADLPSSGQVFFIPVVPGDVIIAG  355

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  V+  AV +G  P+ TAQKIAALARQRALD+ RQTPF+ AAQEAG+
Sbjct  356  TDGLFDNLYNNEVTAVLVHAVRAGLEPQVTAQKIAALARQRALDKNRQTPFSTAAQEAGF  415

Query  136  QYYGGK  119
            +YYGGK
Sbjct  416  RYYGGK  421



>gb|KHG03504.1| hypothetical protein F383_27679 [Gossypium arboreum]
Length=375

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG++ARELM  S+ AI  EPK S+DPARVLEKAHS TK++GSSTAC+IAL+ +GLHAI
Sbjct  173  IDAGEFARELMSNSVKAIRDEPKGSVDPARVLEKAHSSTKSQGSSTACVIALHKEGLHAI  232

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDG T+F SPVQQHGFNFTYQLESG+  DLPSSGQVF I +L GDVIVAG
Sbjct  233  NLGDSGFIVVRDGSTVFHSPVQQHGFNFTYQLESGNNGDLPSSGQVFRIPILPGDVIVAG  292

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EVA VV  A+ +G +PE+TA++I ALAR+RA+D+ +QTPFA AAQ+AGY
Sbjct  293  TDGLFDNLYNNEVAAVVVHALRAGFSPESTAKEIVALARERAVDKNKQTPFAKAAQDAGY  352

Query  136  QYYGGK  119
            +Y GGK
Sbjct  353  RYNGGK  358



>ref|XP_006425719.1| hypothetical protein CICLE_v10025600mg [Citrus clementina]
 ref|XP_006466757.1| PREDICTED: probable protein phosphatase 2C 80-like [Citrus sinensis]
 gb|ESR38959.1| hypothetical protein CICLE_v10025600mg [Citrus clementina]
 gb|KDO79493.1| hypothetical protein CISIN_1g013301mg [Citrus sinensis]
Length=446

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG++ARELM +S  A+  E   +IDPARVLEKAHS TKAKGSSTACIIAL S+ +HA+
Sbjct  244  VDAGEFARELMSHSFRAVQEESTHAIDPARVLEKAHSSTKAKGSSTACIIALTSKAIHAV  303

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF+SPVQQHGFNFTYQLESG+  DLPSSGQVFTI    GDVIVAG
Sbjct  304  NLGDSGFMVVRDGCTIFQSPVQQHGFNFTYQLESGNTGDLPSSGQVFTIPAAPGDVIVAG  363

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  VV  A+ +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  364  TDGLFDNLYNNEVTAVVVHALRAGLGPQVTAQKIAALARQRAQDRNRQTPFSTAAQDAGF  423

Query  136  QYYGGK  119
            +YYGGK
Sbjct  424  RYYGGK  429



>gb|EYU32793.1| hypothetical protein MIMGU_mgv1a004775mg [Erythranthe guttata]
Length=511

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S+ AI  EP+ SIDPARVLEKAH+KTKAKGSSTACIIAL +QGLHAI
Sbjct  302  VDAGKYARELMSNSVYAIQEEPRGSIDPARVLEKAHTKTKAKGSSTACIIALTNQGLHAI  361

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+V+R+GCT+F SP+QQH FNFTYQLESG+  DLPSSGQVFTI V  GDV++AG
Sbjct  362  NLGDSGFMVIRNGCTVFRSPIQQHDFNFTYQLESGNAGDLPSSGQVFTIPVAPGDVVIAG  421

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY ++V  VV  A+ +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQEAG+
Sbjct  422  TDGLFDNLYNNDVTSVVVHAMRAGLGPQVTAQKIAALARQRAQDKNRQTPFSAAAQEAGF  481

Query  136  QYYGGK  119
            +YYGGK
Sbjct  482  RYYGGK  487



>ref|XP_009365583.1| PREDICTED: probable protein phosphatase 2C 55 [Pyrus x bretschneideri]
Length=516

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +N+G Y+RELM  S+ A+  EPK SIDPARVLEKAHS TKA+GSSTACIIAL  QG+HA+
Sbjct  314  VNSGLYSRELMSNSVAAVQEEPKGSIDPARVLEKAHSSTKARGSSTACIIALTEQGIHAV  373

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCT+F SPVQQH FNFTYQLESG+  DLPSSGQVFT+ V   DVIVAG
Sbjct  374  NLGDSGFIVVRDGCTVFRSPVQQHDFNFTYQLESGNSGDLPSSGQVFTVPVAPRDVIVAG  433

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  434  TDGLFDNLYNNEITAVVVHAIRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGF  493

Query  136  QYYGGK  119
            +YYGGK
Sbjct  494  RYYGGK  499



>ref|XP_008466602.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Cucumis 
melo]
Length=503

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+RELM  S+ A+  EPK SIDPARVLEKAHSKTKAKGSSTACIIAL  QGLHAI
Sbjct  301  VDAGQYSRELMSNSVSAVQEEPKGSIDPARVLEKAHSKTKAKGSSTACIIALTEQGLHAI  360

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFT+QLESG+  DLPSSGQVF++ V  GDVI+AG
Sbjct  361  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTFQLESGNNGDLPSSGQVFSVPVAPGDVIIAG  420

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G   + TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  421  TDGLFDNLYNNEITAVVVHAMRAGLGAQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGF  480

Query  136  QYYGGK  119
            +YYGGK
Sbjct  481  RYYGGK  486



>gb|KJB17810.1| hypothetical protein B456_003G016400 [Gossypium raimondii]
 gb|KJB17811.1| hypothetical protein B456_003G016400 [Gossypium raimondii]
 gb|KJB17812.1| hypothetical protein B456_003G016400 [Gossypium raimondii]
Length=375

 Score =   283 bits (723),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG++ARELM  S+ AI  EPK S+DPARVLEKAHS TK++GSSTACII+L+ +GLHAI
Sbjct  173  IDAGEFARELMSNSVKAIRDEPKGSVDPARVLEKAHSSTKSQGSSTACIISLHKEGLHAI  232

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDG T+F SPVQQHGFNFTYQLESG+  DLPSSGQVF I +L GDVIVAG
Sbjct  233  NLGDSGFIVVRDGSTVFHSPVQQHGFNFTYQLESGNNGDLPSSGQVFRIPILPGDVIVAG  292

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EVA VV  A+ +G +PE+TA++I ALAR+RA+D+ +QTPFA AAQ+AGY
Sbjct  293  TDGLFDNLYNNEVAAVVVHALRAGFSPESTAKEIVALARERAVDKNKQTPFAKAAQDAGY  352

Query  136  QYYGGK  119
            +Y GGK
Sbjct  353  RYNGGK  358



>gb|KGN59939.1| hypothetical protein Csa_3G855330 [Cucumis sativus]
Length=503

 Score =   286 bits (733),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+RELM  S+ A+  EPK SIDPARVLEKAHSKTKAKGSSTACIIAL  QGLHAI
Sbjct  301  VDAGQYSRELMSNSVSAVQEEPKGSIDPARVLEKAHSKTKAKGSSTACIIALTEQGLHAI  360

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFT+QLESG+  DLPSSGQVF++ V  GDVI+AG
Sbjct  361  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTFQLESGNNGDLPSSGQVFSVPVAPGDVIIAG  420

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G   + TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  421  TDGLFDNLYNNEITAVVVHAMRAGLGAQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGF  480

Query  136  QYYGGK  119
            +YYGGK
Sbjct  481  RYYGGK  486



>ref|XP_010936931.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Elaeis 
guineensis]
Length=497

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S +AI  EPK SIDPARVLEKA+S TKAKGSSTACIIAL  QGLHA+
Sbjct  296  VDAGQYARELMSNSANAIREEPKGSIDPARVLEKAYSSTKAKGSSTACIIALTDQGLHAV  355

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLESGS +DLPS  QVFT  V  GDVI+AG
Sbjct  356  NLGDSGFVVVRDGCTIFRSPVQQHDFNFTYQLESGSGSDLPSVAQVFTFPVSPGDVIIAG  415

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  EV  VV  AV +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AGY
Sbjct  416  TDGLFDNLYNTEVTAVVVQAVRTGLGPQVTAQKIAALARQRAQDKNRQTPFSIAAQDAGY  475

Query  136  QYYGGK  119
            +YYGGK
Sbjct  476  RYYGGK  481



>ref|XP_010244316.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Nelumbo 
nucifera]
Length=512

 Score =   286 bits (733),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S+ AI  EPK SIDPARVLEKAH  TKAKGSSTACIIAL  QG+HAI
Sbjct  310  IDAGQYARELMSNSVTAIKEEPKGSIDPARVLEKAHLTTKAKGSSTACIIALTDQGIHAI  369

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCT+F+SPVQQH FNFTYQLE G+  DLPSSGQVFTI V  GDVI+AG
Sbjct  370  NLGDSGFIVVRDGCTVFQSPVQQHSFNFTYQLECGNGGDLPSSGQVFTIPVAPGDVIIAG  429

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  VV  A  +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  430  TDGLFDNLYNNEVTAVVVHAARAGFEPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGF  489

Query  136  QYYGGK  119
            +YYGGK
Sbjct  490  RYYGGK  495



>emb|CAN83089.1| hypothetical protein VITISV_042874 [Vitis vinifera]
Length=375

 Score =   282 bits (721),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +++G YARELM  S+ AI  EPK S+DPARVLEKAH  TKAKGSSTACIIAL  QGLHAI
Sbjct  140  VDSGQYARELMSNSVTAIQEEPKGSVDPARVLEKAHFSTKAKGSSTACIIALTEQGLHAI  199

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIV+RDGCT+F SPVQQH FNFTYQLESG+  DLPSSGQVFTI V  GDV++AG
Sbjct  200  NLGDSGFIVIRDGCTVFRSPVQQHDFNFTYQLESGNGGDLPSSGQVFTIPVAPGDVVIAG  259

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  VV  A  +   P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG 
Sbjct  260  TDGLFDNLYNNEVIAVVVHATRASLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGI  319

Query  136  QYYGGK  119
            +YYGGK
Sbjct  320  RYYGGK  325



>dbj|BAC42578.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63356.1| At4g16580 [Arabidopsis thaliana]
Length=300

 Score =   279 bits (714),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S++AI  EPK SIDPARVLEKAH+ TK++GSSTACIIAL +QGLHAI
Sbjct  95   IDAGYYSRELMSNSVNAIQDEPKGSIDPARVLEKAHTCTKSQGSSTACIIALTNQGLHAI  154

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVR+G T+F SPVQQH FNFTYQLESG   DLPSSGQVFT+AV  GDVI+AG
Sbjct  155  NLGDSGFMVVREGHTVFRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTVAVAPGDVIIAG  214

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  +V  AV +  +P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  215  TDGLFDNLYNNEITAIVVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGF  274

Query  136  QYYGGK  119
            +YYGGK
Sbjct  275  RYYGGK  280



>ref|XP_010558162.1| PREDICTED: probable protein phosphatase 2C 80 isoform X2 [Tarenaya 
hassleriana]
Length=426

 Score =   283 bits (725),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +ARELM YS+ AI  + K SIDP  VLEKAHS+T+AKGSSTACII L  +G+HAI
Sbjct  228  VNAGLFARELMSYSVTAIQEQAKGSIDPLMVLEKAHSQTRAKGSSTACIITLTDKGIHAI  287

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF VVR+G T+F+SPVQQHGFNFTYQLESG   D+PSSGQVFTI V SGDVIVAG
Sbjct  288  NLGDSGFTVVREGTTLFQSPVQQHGFNFTYQLESGDGGDIPSSGQVFTIPVESGDVIVAG  347

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+AGVV  +V +G +P++TA+K+AALARQRA+DR RQTPF+ +AQEAGY
Sbjct  348  TDGLFDNLYNNEIAGVVVSSVRAGLDPKSTAEKMAALARQRAVDRNRQTPFSASAQEAGY  407

Query  136  QYYGGK  119
            +YYGGK
Sbjct  408  RYYGGK  413



>ref|XP_009416847.1| PREDICTED: probable protein phosphatase 2C 55 [Musa acuminata 
subsp. malaccensis]
Length=470

 Score =   285 bits (728),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S++AI  EPK S+DPARVLEKA++ TKA+GSSTACIIAL  QG+HAI
Sbjct  269  VDAGQYARELMSNSVNAIREEPKGSVDPARVLEKAYTITKARGSSTACIIALTDQGIHAI  328

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVV+DGCTIF SPVQQH FNFTYQLESG+ +DLPS+ QVFT  V SGDVI+AG
Sbjct  329  NLGDSGFIVVKDGCTIFRSPVQQHDFNFTYQLESGNGSDLPSAAQVFTFPVSSGDVIIAG  388

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A  +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AGY
Sbjct  389  TDGLFDNLYNNEITAVVVHATRAGLGPQVTAQKIAALARQRAQDRNRQTPFSTAAQDAGY  448

Query  136  QYYGGK  119
            +YYGGK
Sbjct  449  RYYGGK  454



>emb|CDP02816.1| unnamed protein product [Coffea canephora]
Length=467

 Score =   285 bits (728),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            INAG+YA ELM  SMDAI +EP + IDPARVLEKAHS+T A GSSTACII L  Q LHAI
Sbjct  262  INAGEYASELMSNSMDAIKNEPGEFIDPARVLEKAHSETNAVGSSTACIIVLKDQFLHAI  321

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDG T FESPVQQHGFNF YQLE G++ DLPSSGQVF I+VL GDVIVAG
Sbjct  322  NLGDSGFIVVRDGSTTFESPVQQHGFNFPYQLERGNKGDLPSSGQVFKISVLPGDVIVAG  381

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLYK E+  +V  AV SG  PE TAQK+AALAR RA DR+RQTPF+ AAQE G+
Sbjct  382  TDGLFDNLYKREITTIVGAAVTSGFTPELTAQKVAALARHRAQDRERQTPFSTAAQEIGF  441

Query  136  QYYGGK  119
             YYGGK
Sbjct  442  SYYGGK  447



>ref|XP_010484599.1| PREDICTED: probable protein phosphatase 2C 80 [Camelina sativa]
Length=419

 Score =   283 bits (724),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 161/187 (86%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDS-IDPARVLEKAHSKTKAKGSSTACIIALNSQGLHA  500
            +NAG ++RELM YS+ AI    K S IDP  VLEKAHS+T+AKGSSTACIIAL  +GLHA
Sbjct  219  VNAGLFSRELMSYSLSAIQERHKGSAIDPLMVLEKAHSQTRAKGSSTACIIALTDKGLHA  278

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            INLGDSGF VVR+G T+F+SPVQQHGFNFTYQLESG+ AD+PSSGQVFTI V SGDVIVA
Sbjct  279  INLGDSGFTVVREGTTVFQSPVQQHGFNFTYQLESGNSADVPSSGQVFTIDVESGDVIVA  338

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDG++DNLY +E+ GVV  +V +G +P+ATAQKIA LARQRA+D+KRQ+PFA AAQEAG
Sbjct  339  GTDGMYDNLYNEEITGVVVSSVRAGLDPKATAQKIADLARQRAVDKKRQSPFATAAQEAG  398

Query  139  YQYYGGK  119
            Y+YYGGK
Sbjct  399  YRYYGGK  405



>ref|XP_002865051.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41310.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=413

 Score =   283 bits (723),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPK-DSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHA  500
            +NAG ++RELM YS+ AI  + K  SIDP  VLEKAHS+T+AKGSSTACIIAL  +GLHA
Sbjct  213  VNAGLFSRELMSYSVSAIQEQHKGSSIDPLLVLEKAHSQTRAKGSSTACIIALTDKGLHA  272

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            INLGDSGF VVR+G T+F+SPVQQHGFNFTYQLESG+ AD+PSSGQVFTI V SGDVIVA
Sbjct  273  INLGDSGFTVVREGTTVFQSPVQQHGFNFTYQLESGNSADVPSSGQVFTIDVESGDVIVA  332

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDG++DNLY +E+ GVV  +V +G +P+ATAQKIA LARQRA+D+KRQ+PFA AAQEAG
Sbjct  333  GTDGVYDNLYNEEITGVVVSSVRAGLDPKATAQKIADLARQRAVDKKRQSPFATAAQEAG  392

Query  139  YQYYGGK  119
            Y+YYGGK
Sbjct  393  YRYYGGK  399



>ref|XP_010558153.1| PREDICTED: probable protein phosphatase 2C 80 isoform X1 [Tarenaya 
hassleriana]
Length=441

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +ARELM YS+ AI  + K SIDP  VLEKAHS+T+AKGSSTACII L  +G+HAI
Sbjct  243  VNAGLFARELMSYSVTAIQEQAKGSIDPLMVLEKAHSQTRAKGSSTACIITLTDKGIHAI  302

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF VVR+G T+F+SPVQQHGFNFTYQLESG   D+PSSGQVFTI V SGDVIVAG
Sbjct  303  NLGDSGFTVVREGTTLFQSPVQQHGFNFTYQLESGDGGDIPSSGQVFTIPVESGDVIVAG  362

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+AGVV  +V +G +P++TA+K+AALARQRA+DR RQTPF+ +AQEAGY
Sbjct  363  TDGLFDNLYNNEIAGVVVSSVRAGLDPKSTAEKMAALARQRAVDRNRQTPFSASAQEAGY  422

Query  136  QYYGGK  119
            +YYGGK
Sbjct  423  RYYGGK  428



>ref|XP_004291892.1| PREDICTED: probable protein phosphatase 2C 55 [Fragaria vesca 
subsp. vesca]
 ref|XP_011459565.1| PREDICTED: probable protein phosphatase 2C 55 [Fragaria vesca 
subsp. vesca]
Length=497

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +N+G Y+RELM  S+ A+  EP  S+DPARVLEKAHS TKA+GSSTACIIAL  QG+HAI
Sbjct  295  VNSGLYSRELMSNSVTAVQEEPIGSVDPARVLEKAHSSTKARGSSTACIIALTEQGIHAI  354

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCT+F SPVQQH FNFTYQLE+G  +DLPSSGQVFT+ V  GDVIVAG
Sbjct  355  NLGDSGFIVVRDGCTVFRSPVQQHDFNFTYQLENGVNSDLPSSGQVFTVPVAPGDVIVAG  414

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  415  TDGLFDNLYNNEITAVVVHAMRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGF  474

Query  136  QYYGGK  119
            +YYGGK
Sbjct  475  RYYGGK  480



>ref|XP_009407379.1| PREDICTED: probable protein phosphatase 2C 55 [Musa acuminata 
subsp. malaccensis]
Length=472

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S++AI  EPK S+DPARVL+KA+S TKA+GSSTACIIAL  QG+HAI
Sbjct  271  IDAGQYARELMSNSVNAIQEEPKGSVDPARVLDKAYSITKARGSSTACIIALTDQGIHAI  330

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTI  SPVQQH FNFTYQLESG+ +DLPS+ QVFT  V SGDVI+AG
Sbjct  331  NLGDSGFIVVRDGCTIIRSPVQQHDFNFTYQLESGNGSDLPSAAQVFTFLVASGDVIIAG  390

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A  +G  P+ TAQKIAALARQRALD+ RQTPF+ AAQ+AGY
Sbjct  391  TDGLFDNLYNNEITAVVVHATRAGLGPQVTAQKIAALARQRALDKNRQTPFSTAAQDAGY  450

Query  136  QYYGGK  119
            +YYGGK
Sbjct  451  RYYGGK  456



>emb|CAB46038.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78700.1| hypothetical protein [Arabidopsis thaliana]
Length=335

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S++AI  EPK SIDPARVLEKAH+ TK++GSSTACIIAL +QGLHAI
Sbjct  130  IDAGYYSRELMSNSVNAIQDEPKGSIDPARVLEKAHTCTKSQGSSTACIIALTNQGLHAI  189

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVR+G T+F SPVQQH FNFTYQLESG   DLPSSGQVFT+AV  GDVI+AG
Sbjct  190  NLGDSGFMVVREGHTVFRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTVAVAPGDVIIAG  249

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  +V  AV +  +P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  250  TDGLFDNLYNNEITAIVVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGF  309

Query  136  QYYGGK  119
            +YYGGK
Sbjct  310  RYYGGK  315



>ref|XP_010465009.1| PREDICTED: probable protein phosphatase 2C 80 [Camelina sativa]
 ref|XP_010465014.1| PREDICTED: probable protein phosphatase 2C 80 [Camelina sativa]
Length=412

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 161/187 (86%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPK-DSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHA  500
            +NAG ++RELM +S+ AI    K  SIDP  VLEKAHS+T+AKGSSTACIIAL  +GLHA
Sbjct  212  VNAGLFSRELMSHSLSAIQERHKGSSIDPLMVLEKAHSQTRAKGSSTACIIALTDKGLHA  271

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            INLGDSGF VVR+G T+F+SPVQQHGFNFTYQLESG+ AD+PSSGQVFTI V SGDVIVA
Sbjct  272  INLGDSGFTVVREGTTVFQSPVQQHGFNFTYQLESGNSADVPSSGQVFTIDVESGDVIVA  331

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDG++DNLY +E+ GVV  +V +G +P+ATAQKIA LARQRA+D+KRQ+PFA AAQEAG
Sbjct  332  GTDGMYDNLYNEEITGVVVSSVRAGLDPKATAQKIADLARQRAVDKKRQSPFATAAQEAG  391

Query  139  YQYYGGK  119
            Y+YYGGK
Sbjct  392  YRYYGGK  398



>ref|XP_006434953.1| hypothetical protein CICLE_v10000910mg [Citrus clementina]
 gb|ESR48193.1| hypothetical protein CICLE_v10000910mg [Citrus clementina]
Length=507

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG Y+RELM  S+ AI  EP  SIDPARVLEKAHS T+AKGSSTACIIAL  QGL AI
Sbjct  300  VNAGLYSRELMSNSVAAIQEEPDGSIDPARVLEKAHSSTRAKGSSTACIIALTDQGLRAI  359

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLE GS +DLPSSGQVFTI V  GDVI+AG
Sbjct  360  NLGDSGFVVVRDGCTVFRSPVQQHDFNFTYQLEYGSNSDLPSSGQVFTIPVAPGDVIIAG  419

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  420  TDGLFDNLYNNEITAVVVHAMRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGF  479

Query  136  QYYGGK  119
            +YYGGK
Sbjct  480  RYYGGK  485



>ref|NP_975004.1| putative protein phosphatase 2C 80 [Arabidopsis thaliana]
 gb|AED98256.1| putative protein phosphatase 2C 80 [Arabidopsis thaliana]
Length=411

 Score =   281 bits (719),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 160/187 (86%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPK-DSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHA  500
            +NAG ++RELM YS+ AI  + K  SIDP  VLEKAHS+TKAKGSSTACII L  +GLHA
Sbjct  211  VNAGLFSRELMSYSVSAIQEQHKGSSIDPLVVLEKAHSQTKAKGSSTACIIVLKDKGLHA  270

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            INLGDSGF VVR+G T+F+SPVQQHGFNFTYQLESG+ AD+PSSGQVFTI V SGDVIVA
Sbjct  271  INLGDSGFTVVREGTTVFQSPVQQHGFNFTYQLESGNSADVPSSGQVFTIDVQSGDVIVA  330

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDG++DNLY +E+ GVV  +V +G +P+ TAQKIA LARQRA+D+KRQ+PFA AAQEAG
Sbjct  331  GTDGVYDNLYNEEITGVVVSSVRAGLDPKGTAQKIAELARQRAVDKKRQSPFATAAQEAG  390

Query  139  YQYYGGK  119
            Y+YYGGK
Sbjct  391  YRYYGGK  397



>gb|KDO84475.1| hypothetical protein CISIN_1g010417mg [Citrus sinensis]
 gb|KDO84476.1| hypothetical protein CISIN_1g010417mg [Citrus sinensis]
Length=507

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG Y+RELM  S+ AI  EP  SIDPARVLEKAHS T+AKGSSTACIIAL  QGL AI
Sbjct  300  VNAGLYSRELMSNSVAAIQEEPDGSIDPARVLEKAHSSTRAKGSSTACIIALTDQGLRAI  359

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLE GS +DLPSSGQVFTI V  GDVI+AG
Sbjct  360  NLGDSGFVVVRDGCTVFRSPVQQHDFNFTYQLEYGSNSDLPSSGQVFTIPVAPGDVIIAG  419

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  420  TDGLFDNLYNNEITAVVVHAMRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGF  479

Query  136  QYYGGK  119
            +YYGGK
Sbjct  480  RYYGGK  485



>ref|XP_006434954.1| hypothetical protein CICLE_v10000910mg [Citrus clementina]
 gb|ESR48194.1| hypothetical protein CICLE_v10000910mg [Citrus clementina]
Length=511

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG Y+RELM  S+ AI  EP  SIDPARVLEKAHS T+AKGSSTACIIAL  QGL AI
Sbjct  300  VNAGLYSRELMSNSVAAIQEEPDGSIDPARVLEKAHSSTRAKGSSTACIIALTDQGLRAI  359

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLE GS +DLPSSGQVFTI V  GDVI+AG
Sbjct  360  NLGDSGFVVVRDGCTVFRSPVQQHDFNFTYQLEYGSNSDLPSSGQVFTIPVAPGDVIIAG  419

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  420  TDGLFDNLYNNEITAVVVHAMRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGF  479

Query  136  QYYGGK  119
            +YYGGK
Sbjct  480  RYYGGK  485



>ref|NP_201473.1| putative protein phosphatase 2C 80 [Arabidopsis thaliana]
 sp|Q9LVQ8.1|P2C80_ARATH RecName: Full=Probable protein phosphatase 2C 80; Short=AtPP2C80 
[Arabidopsis thaliana]
 dbj|BAA97278.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM97071.1| putative protein [Arabidopsis thaliana]
 gb|AAN15547.1| putative protein [Arabidopsis thaliana]
 dbj|BAC41805.1| unknown protein [Arabidopsis thaliana]
 gb|AED98255.1| putative protein phosphatase 2C 80 [Arabidopsis thaliana]
Length=414

 Score =   281 bits (719),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 160/187 (86%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPK-DSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHA  500
            +NAG ++RELM YS+ AI  + K  SIDP  VLEKAHS+TKAKGSSTACII L  +GLHA
Sbjct  214  VNAGLFSRELMSYSVSAIQEQHKGSSIDPLVVLEKAHSQTKAKGSSTACIIVLKDKGLHA  273

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            INLGDSGF VVR+G T+F+SPVQQHGFNFTYQLESG+ AD+PSSGQVFTI V SGDVIVA
Sbjct  274  INLGDSGFTVVREGTTVFQSPVQQHGFNFTYQLESGNSADVPSSGQVFTIDVQSGDVIVA  333

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDG++DNLY +E+ GVV  +V +G +P+ TAQKIA LARQRA+D+KRQ+PFA AAQEAG
Sbjct  334  GTDGVYDNLYNEEITGVVVSSVRAGLDPKGTAQKIAELARQRAVDKKRQSPFATAAQEAG  393

Query  139  YQYYGGK  119
            Y+YYGGK
Sbjct  394  YRYYGGK  400



>gb|KJB43550.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
Length=271

 Score =   276 bits (706),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -3

Query  673  NAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAIN  494
            +AG++ARELM  S+ AI  EPK SIDPARVLEKAHS TK++GSSTACIIAL  +G+HAIN
Sbjct  70   DAGEFARELMCNSVAAIQGEPKGSIDPARVLEKAHSSTKSQGSSTACIIALTGEGIHAIN  129

Query  493  LGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAGT  314
            LGDSGFIVVRDGCT+F SPVQQHGFNFTYQLESG   DLPSS QVF I VLSGDVI+AGT
Sbjct  130  LGDSGFIVVRDGCTVFHSPVQQHGFNFTYQLESGDGGDLPSSVQVFKIPVLSGDVIIAGT  189

Query  313  DGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGYQ  134
            DGLFDNLY +E+   V   +  G NP+  A++IA LAR+RA+D+ RQTPFA AAQ+AG++
Sbjct  190  DGLFDNLYNNEITAAVVHGLRVGFNPQLMAKQIATLARERAVDKNRQTPFAKAAQDAGFR  249

Query  133  YYGGK  119
            YYGGK
Sbjct  250  YYGGK  254



>gb|KDO84477.1| hypothetical protein CISIN_1g010417mg [Citrus sinensis]
Length=511

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG Y+RELM  S+ AI  EP  SIDPARVLEKAHS T+AKGSSTACIIAL  QGL AI
Sbjct  300  VNAGLYSRELMSNSVAAIQEEPDGSIDPARVLEKAHSSTRAKGSSTACIIALTDQGLRAI  359

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLE GS +DLPSSGQVFTI V  GDVI+AG
Sbjct  360  NLGDSGFVVVRDGCTVFRSPVQQHDFNFTYQLEYGSNSDLPSSGQVFTIPVAPGDVIIAG  419

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  420  TDGLFDNLYNNEITAVVVHAMRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGF  479

Query  136  QYYGGK  119
            +YYGGK
Sbjct  480  RYYGGK  485



>gb|KJB43552.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
Length=274

 Score =   276 bits (706),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -3

Query  673  NAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAIN  494
            +AG++ARELM  S+ AI  EPK SIDPARVLEKAHS TK++GSSTACIIAL  +G+HAIN
Sbjct  73   DAGEFARELMCNSVAAIQGEPKGSIDPARVLEKAHSSTKSQGSSTACIIALTGEGIHAIN  132

Query  493  LGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAGT  314
            LGDSGFIVVRDGCT+F SPVQQHGFNFTYQLESG   DLPSS QVF I VLSGDVI+AGT
Sbjct  133  LGDSGFIVVRDGCTVFHSPVQQHGFNFTYQLESGDGGDLPSSVQVFKIPVLSGDVIIAGT  192

Query  313  DGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGYQ  134
            DGLFDNLY +E+   V   +  G NP+  A++IA LAR+RA+D+ RQTPFA AAQ+AG++
Sbjct  193  DGLFDNLYNNEITAAVVHGLRVGFNPQLMAKQIATLARERAVDKNRQTPFAKAAQDAGFR  252

Query  133  YYGGK  119
            YYGGK
Sbjct  253  YYGGK  257



>ref|XP_006473471.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Citrus sinensis]
Length=507

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG Y+RELM  S+ AI  EP  SIDPARVLEKAHS T+AKGSSTACIIAL  QGL AI
Sbjct  300  VNAGLYSRELMSNSVAAIQEEPDGSIDPARVLEKAHSSTRAKGSSTACIIALTDQGLRAI  359

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLE GS +DLPSSGQVFTI V  GDVI+AG
Sbjct  360  NLGDSGFVVVRDGCTVFRSPVQQHDFNFTYQLEYGSNSDLPSSGQVFTIPVAPGDVIIAG  419

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  420  TDGLFDNLYNNEITAVVVHAMRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGF  479

Query  136  QYYGGK  119
            +YYGGK
Sbjct  480  RYYGGK  485



>ref|XP_006473470.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Citrus sinensis]
Length=511

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG Y+RELM  S+ AI  EP  SIDPARVLEKAHS T+AKGSSTACIIAL  QGL AI
Sbjct  300  VNAGLYSRELMSNSVAAIQEEPDGSIDPARVLEKAHSSTRAKGSSTACIIALTDQGLRAI  359

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLE GS +DLPSSGQVFTI V  GDVI+AG
Sbjct  360  NLGDSGFVVVRDGCTVFRSPVQQHDFNFTYQLEYGSNSDLPSSGQVFTIPVAPGDVIIAG  419

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  420  TDGLFDNLYNNEITAVVVHAMRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGF  479

Query  136  QYYGGK  119
            +YYGGK
Sbjct  480  RYYGGK  485



>ref|XP_008786118.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Phoenix 
dactylifera]
Length=498

 Score =   283 bits (724),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YAREL+  S+ AI  EPK SIDPARVLEKA+S TKAKGSSTACIIAL  QG+HA+
Sbjct  297  VDAGQYARELISNSVSAIREEPKGSIDPARVLEKAYSSTKAKGSSTACIIALTHQGIHAV  356

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQH FNFTYQLESG+ +DLPSS QVFT  V  GDVI+AG
Sbjct  357  NLGDSGFIVVRDGCTIFRSPVQQHDFNFTYQLESGNGSDLPSSAQVFTFPVAPGDVIIAG  416

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  VV  AV +   P+ TAQKIAALARQRA DR RQTPF+ AAQ+AGY
Sbjct  417  TDGLFDNLYNNEVTAVVVHAVRARLGPQVTAQKIAALARQRAQDRNRQTPFSSAAQDAGY  476

Query  136  QYYGGK  119
            ++YGGK
Sbjct  477  RFYGGK  482



>ref|XP_007046996.1| Phosphatase 2C family protein [Theobroma cacao]
 gb|EOX91153.1| Phosphatase 2C family protein [Theobroma cacao]
Length=452

 Score =   282 bits (721),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG++ARELM  S+  I  EPK SIDPARVLE+AHS TK++GSSTACIIAL  +G+HAI
Sbjct  250  IDAGEFARELMSNSVTVIQDEPKGSIDPARVLERAHSSTKSQGSSTACIIALTKEGIHAI  309

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCT+F SPVQQHGFNFTYQLESG+  DLPSSGQVF I VL GDVIVAG
Sbjct  310  NLGDSGFIVVRDGCTVFHSPVQQHGFNFTYQLESGNDGDLPSSGQVFRIPVLPGDVIVAG  369

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV   V  A+ SG +PE TA++IAALAR+RA+D+ +QTPFA AA +AG+
Sbjct  370  TDGLFDNLYNNEVTAAVVHALRSGFSPEVTAKQIAALARERAVDKHQQTPFAKAALDAGF  429

Query  136  QYYGGK  119
            +YYGGK
Sbjct  430  RYYGGK  435



>ref|XP_002868114.1| hypothetical protein ARALYDRAFT_493218 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44373.1| hypothetical protein ARALYDRAFT_493218 [Arabidopsis lyrata subsp. 
lyrata]
Length=467

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S++AI  EPK SIDPARVLEKAH+ TK++GSSTACIIAL +QGLHAI
Sbjct  262  IDAGYYSRELMSNSVNAIQDEPKGSIDPARVLEKAHTCTKSQGSSTACIIALTNQGLHAI  321

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVR+G T+F SPVQQH FNFTYQLESG   DLPSSGQVFT+AV  GDVI+AG
Sbjct  322  NLGDSGFMVVREGHTVFRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTVAVAPGDVIIAG  381

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  +V  AV +  +P+ TAQKIAALARQRALD+ RQTPF+ AAQ+AG+
Sbjct  382  TDGLFDNLYNNEITAIVVHAVRANIDPQVTAQKIAALARQRALDKNRQTPFSTAAQDAGF  441

Query  136  QYYGGK  119
            +YYGGK
Sbjct  442  RYYGGK  447



>ref|XP_009145699.1| PREDICTED: probable protein phosphatase 2C 55 [Brassica rapa]
Length=467

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S++AI  EPK SIDPARVLEKAH+ TK++GSSTACIIAL  QGL+AI
Sbjct  260  IDAGYYSRELMSNSVNAIQDEPKGSIDPARVLEKAHTSTKSQGSSTACIIALTDQGLNAI  319

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVR+G T+F SPVQQH FNFTYQLESGS  DLPSSGQVFT+AV  GDVI+AG
Sbjct  320  NLGDSGFMVVREGHTVFRSPVQQHDFNFTYQLESGSNGDLPSSGQVFTVAVAPGDVIIAG  379

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  +V  AV +G +P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  380  TDGLFDNLYNNEITAIVVQAVRAGTDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGF  439

Query  136  QYYGGK  119
            +YYGGK
Sbjct  440  RYYGGK  445



>ref|XP_010444748.1| PREDICTED: probable protein phosphatase 2C 80 [Camelina sativa]
Length=410

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 160/187 (86%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDS-IDPARVLEKAHSKTKAKGSSTACIIALNSQGLHA  500
            +NAG ++RELM YS+ AI    K S IDP  VLEKAHS+T+AKGSSTACIIAL  +GLHA
Sbjct  210  VNAGLFSRELMSYSLSAIQERHKGSAIDPLMVLEKAHSQTRAKGSSTACIIALTDKGLHA  269

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            INLGDSGF VVR+G T+F+SPVQQHGFNFTYQLESG+ AD+PSSGQVFTI V SGDVIVA
Sbjct  270  INLGDSGFTVVREGTTVFQSPVQQHGFNFTYQLESGNSADVPSSGQVFTIDVESGDVIVA  329

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDG++DNLY +E+ GVV  +V +  +P+ATAQKIA LARQRA+D+KRQ+PFA AAQEAG
Sbjct  330  GTDGMYDNLYNEEITGVVVSSVRARLDPKATAQKIADLARQRAVDKKRQSPFATAAQEAG  389

Query  139  YQYYGGK  119
            Y+YYGGK
Sbjct  390  YRYYGGK  396



>emb|CDY60192.1| BnaA01g35420D [Brassica napus]
Length=467

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S++AI  EPK SIDPARVLEKAH+ TK++GSSTACIIAL  QGL+AI
Sbjct  260  IDAGYYSRELMSNSVNAIQDEPKGSIDPARVLEKAHTSTKSQGSSTACIIALTDQGLNAI  319

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVR+G T+F SPVQQH FNFTYQLESGS  DLPSSGQVFT+AV  GDVI+AG
Sbjct  320  NLGDSGFMVVREGHTVFRSPVQQHDFNFTYQLESGSNGDLPSSGQVFTVAVAPGDVIIAG  379

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  +V  AV +G +P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  380  TDGLFDNLYNNEITAIVVQAVRAGTDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGF  439

Query  136  QYYGGK  119
            +YYGGK
Sbjct  440  RYYGGK  445



>ref|XP_009612193.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
 ref|XP_009612194.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
Length=517

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S+ AI  EPK S+DPARVLEKA+S TKAKGSSTACIIAL  +GLHAI
Sbjct  307  VDAGQYARELMSNSVSAIREEPKGSVDPARVLEKAYSHTKAKGSSTACIIALTDEGLHAI  366

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFT+QLESGS  DLPSSG+V+ I V  GDVI+AG
Sbjct  367  NLGDSGFLVVRDGCTVFRSPVQQHDFNFTFQLESGSAGDLPSSGEVYKIPVAPGDVIIAG  426

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  ++  +V  A  +G  P+ TAQKIAALARQRALD+ RQTPF+ AAQEAG+
Sbjct  427  TDGLFDNLYNSDITAIVVHATRAGLAPQVTAQKIAALARQRALDKNRQTPFSAAAQEAGF  486

Query  136  QYYGGK  119
            +YYGGK
Sbjct  487  RYYGGK  492



>emb|CDP07546.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S+ AI  EPK S+DPARVLEKA+  TKA+GSSTACI+AL  QGLHAI
Sbjct  303  VDAGLYARELMSNSVTAIEDEPKGSVDPARVLEKAYMSTKARGSSTACIVALTDQGLHAI  362

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLESG+  DLPSSGQ+FTI V  GDVIVAG
Sbjct  363  NLGDSGFMVVRDGCTVFRSPVQQHDFNFTYQLESGNAGDLPSSGQLFTIPVAPGDVIVAG  422

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +++  VV  AV +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  423  TDGLFDNLYNNDITAVVVHAVRAGLGPQVTAQKIAALARQRAQDKNRQTPFSSAAQDAGF  482

Query  136  QYYGGK  119
            +YYGGK
Sbjct  483  RYYGGK  488



>ref|XP_011099582.1| PREDICTED: probable protein phosphatase 2C 55 [Sesamum indicum]
Length=382

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG+YARELM  S+ AI   P   ++P RVLEKAH+ TKA GSSTACIIAL +Q LHAI
Sbjct  180  VNAGEYARELMSNSVKAIREVPDGDVEPLRVLEKAHAATKAMGSSTACIIALKNQDLHAI  239

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFI+VRDG T+FESPVQQHGFNFTYQLE G+R DLPSSGQVF I+V+ GDV+VAG
Sbjct  240  NLGDSGFIIVRDGSTVFESPVQQHGFNFTYQLERGNRGDLPSSGQVFKISVVPGDVVVAG  299

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            +DGLFDNLY  EVA +V DA+  G +P+ATA+KIAA AR RA+DRK +TPF+ AAQEAG+
Sbjct  300  SDGLFDNLYSKEVAAIVADALREGLSPDATAEKIAAFARLRAVDRKHRTPFSTAAQEAGF  359

Query  136  QYYGGK  119
             YYGGK
Sbjct  360  SYYGGK  365



>ref|XP_010028040.1| PREDICTED: probable protein phosphatase 2C 55 [Eucalyptus grandis]
 ref|XP_010028118.1| PREDICTED: probable protein phosphatase 2C 55 [Eucalyptus grandis]
 gb|KCW88093.1| hypothetical protein EUGRSUZ_A00501 [Eucalyptus grandis]
Length=515

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S+ AI  EPK SIDP RVLEKA+S TKAKGSSTACIIAL  QGLHAI
Sbjct  308  IDAGQYSRELMSNSITAIQDEPKGSIDPFRVLEKAYSSTKAKGSSTACIIALTDQGLHAI  367

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FN TYQLE G+  DLPSSGQVFTI V  GDV++AG
Sbjct  368  NLGDSGFMVVRDGCTIFRSPVQQHDFNLTYQLECGNSGDLPSSGQVFTIPVAPGDVVIAG  427

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A  +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  428  TDGLFDNLYNNEITAVVVHATRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGF  487

Query  136  QYYGGK  119
            +YYGGK
Sbjct  488  RYYGGK  493



>ref|XP_010664663.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
 ref|XP_010664664.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
 ref|XP_010664665.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
 ref|XP_010664666.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
Length=519

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +++G YARELM  S+ AI  EPK S+DPARVLEKAH  TKAKGSSTACIIAL  QGLHAI
Sbjct  308  VDSGQYARELMSNSVTAIQEEPKGSVDPARVLEKAHFSTKAKGSSTACIIALTEQGLHAI  367

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIV+RDGCT+F SPVQQH FNFTYQLESG+  DLPSSGQVFTI V  GDV++AG
Sbjct  368  NLGDSGFIVIRDGCTVFRSPVQQHDFNFTYQLESGNGGDLPSSGQVFTIPVAPGDVVIAG  427

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  VV  A  +   P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG 
Sbjct  428  TDGLFDNLYNNEVIAVVVHATRASLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGI  487

Query  136  QYYGGK  119
            +YYGGK
Sbjct  488  RYYGGK  493



>gb|KFK26524.1| hypothetical protein AALP_AA8G260300 [Arabis alpina]
Length=473

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S++AI  EPK SIDPARVLEKAH+ TK+KGSSTACIIAL  QGLHAI
Sbjct  268  IDAGYYSRELMSNSVNAIQDEPKGSIDPARVLEKAHTSTKSKGSSTACIIALTGQGLHAI  327

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVR+G T+F SPVQQH FNFTYQLESG   DLPSSGQVFT+AV  GDVI+AG
Sbjct  328  NLGDSGFMVVREGHTVFRSPVQQHDFNFTYQLESGCNGDLPSSGQVFTVAVAPGDVIIAG  387

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  AV    +P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  388  TDGLFDNLYNNEITAVVVHAVRGSIDPQITAQKIAALARQRAQDKNRQTPFSTAAQDAGF  447

Query  136  QYYGGK  119
            +YYGGK
Sbjct  448  RYYGGK  453



>ref|XP_007156917.1| hypothetical protein PHAVU_002G028000g [Phaseolus vulgaris]
 gb|ESW28911.1| hypothetical protein PHAVU_002G028000g [Phaseolus vulgaris]
Length=446

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +N+G ++REL+  S+ AI  EP+ S +P RVLEKAHS TKAKGSSTACI+AL  +GLH I
Sbjct  244  VNSGLFSRELISNSVRAIQEEPQGSFNPTRVLEKAHSNTKAKGSSTACIVALTDKGLHGI  303

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF+SPVQQH FNFTYQLESG+ ADLPSSG+VFTI V SGDV++AG
Sbjct  304  NLGDSGFIVVRDGCTIFQSPVQQHDFNFTYQLESGNGADLPSSGEVFTIPVTSGDVVIAG  363

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  E+  VV  A+ +G  P+ TAQKIAALARQRALD+ R TPF+ AAQEAG 
Sbjct  364  TDGLFDNLYNSEITAVVVHAIRAGLEPQVTAQKIAALARQRALDQSRPTPFSTAAQEAGL  423

Query  136  QYYGGK  119
            +YYGGK
Sbjct  424  RYYGGK  429



>ref|XP_008466601.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Cucumis 
melo]
Length=507

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 157/190 (83%), Gaps = 4/190 (2%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQ----G  509
            ++AG Y+RELM  S+ A+  EPK SIDPARVLEKAHSKTKAKGSSTACIIAL  Q    G
Sbjct  301  VDAGQYSRELMSNSVSAVQEEPKGSIDPARVLEKAHSKTKAKGSSTACIIALTEQASLQG  360

Query  508  LHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDV  329
            LHAINLGDSGF+VVRDGCTIF SPVQQH FNFT+QLESG+  DLPSSGQVF++ V  GDV
Sbjct  361  LHAINLGDSGFMVVRDGCTIFRSPVQQHDFNFTFQLESGNNGDLPSSGQVFSVPVAPGDV  420

Query  328  IVAGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQ  149
            I+AGTDGLFDNLY +E+  VV  A+ +G   + TAQKIAALARQRA D+ RQTPF+ AAQ
Sbjct  421  IIAGTDGLFDNLYNNEITAVVVHAMRAGLGAQVTAQKIAALARQRAQDKDRQTPFSTAAQ  480

Query  148  EAGYQYYGGK  119
            +AG++YYGGK
Sbjct  481  DAGFRYYGGK  490



>gb|KHG28173.1| hypothetical protein F383_08076 [Gossypium arboreum]
Length=524

 Score =   281 bits (720),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG ++RELM  S+ AI  EPK SI+PARVLEKAHS TKAKGSSTAC+IAL  QGLHAI
Sbjct  297  IDAGQFSRELMSKSVSAIQEEPKGSINPARVLEKAHSSTKAKGSSTACVIALGDQGLHAI  356

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLESG+ ADLPSSGQ+F + V  GDVI+AG
Sbjct  357  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLESGNNADLPSSGQIFAVPVAPGDVIIAG  416

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  PE TAQKIAALA++RA  R RQTPF+ AAQ+AG+
Sbjct  417  TDGLFDNLYNNEITAVVVHALRAGFGPEVTAQKIAALAQERAQARDRQTPFSTAAQDAGF  476

Query  136  QYYGGK  119
            +YYGGK
Sbjct  477  RYYGGK  482



>ref|XP_011083714.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Sesamum 
indicum]
 ref|XP_011083715.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Sesamum 
indicum]
 ref|XP_011083716.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Sesamum 
indicum]
Length=517

 Score =   281 bits (719),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S++AI  EPK SI+P RVLEKA++ TKAKGSSTACIIAL  QGLHAI
Sbjct  307  VDAGKYARELMSNSVNAIQEEPKGSINPTRVLEKAYTSTKAKGSSTACIIALTDQGLHAI  366

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLE G+  DLPSSG+VFTI V  GDVI+AG
Sbjct  367  NLGDSGFMVVRDGCTVFRSPVQQHDFNFTYQLEGGNAGDLPSSGEVFTIPVAQGDVIIAG  426

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  ++  VV  AV +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQEAG+
Sbjct  427  TDGLFDNLYNSDITAVVVHAVRAGFAPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGF  486

Query  136  QYYGGK  119
            +YYGGK
Sbjct  487  RYYGGK  492



>ref|XP_011083717.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Sesamum 
indicum]
Length=516

 Score =   281 bits (719),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S++AI  EPK SI+P RVLEKA++ TKAKGSSTACIIAL  QGLHAI
Sbjct  306  VDAGKYARELMSNSVNAIQEEPKGSINPTRVLEKAYTSTKAKGSSTACIIALTDQGLHAI  365

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLE G+  DLPSSG+VFTI V  GDVI+AG
Sbjct  366  NLGDSGFMVVRDGCTVFRSPVQQHDFNFTYQLEGGNAGDLPSSGEVFTIPVAQGDVIIAG  425

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  ++  VV  AV +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQEAG+
Sbjct  426  TDGLFDNLYNSDITAVVVHAVRAGFAPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGF  485

Query  136  QYYGGK  119
            +YYGGK
Sbjct  486  RYYGGK  491



>emb|CDY40532.1| BnaC01g19800D [Brassica napus]
Length=469

 Score =   280 bits (715),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S++AI  EPK SIDPARVLEKAH+ TK++GSSTACIIAL  QGL+AI
Sbjct  262  IDAGYYSRELMSNSVNAIHDEPKGSIDPARVLEKAHTSTKSQGSSTACIIALTDQGLNAI  321

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVR+G T+F SPVQQH FNFTYQLESGS  DLPSSGQ+FT+AV  GDVI+AG
Sbjct  322  NLGDSGFMVVREGHTVFRSPVQQHDFNFTYQLESGSNGDLPSSGQMFTVAVAPGDVIIAG  381

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  +V  AV +G +P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  382  TDGLFDNLYNNEITAIVVQAVRAGTDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGF  441

Query  136  QYYGGK  119
            +YYGGK
Sbjct  442  RYYGGK  447



>gb|EPS68754.1| hypothetical protein M569_06015, partial [Genlisea aurea]
Length=415

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S++AI  EPK S+DPARVLEKA+++T+AKGSSTACIIAL +QGLHAI
Sbjct  214  IDAGKYARELMSNSVNAIQDEPKGSVDPARVLEKAYNETRAKGSSTACIIALTTQGLHAI  273

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SP QQH FNFTYQLESG+  DLPSSGQVFT+ V  GDV++AG
Sbjct  274  NLGDSGFMVVRDGCTVFRSPAQQHDFNFTYQLESGNSGDLPSSGQVFTVPVAPGDVVIAG  333

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  ++  VV  A  +G  P+  AQKI ALARQRA D+ RQTPF+ AAQEAG+
Sbjct  334  TDGLFDNLYNSDITAVVVHAQRAGFGPQIAAQKIVALARQRAQDKNRQTPFSTAAQEAGF  393

Query  136  QYYGGK  119
            +YYGGK
Sbjct  394  RYYGGK  399



>gb|KJB58309.1| hypothetical protein B456_009G204100 [Gossypium raimondii]
 gb|KJB58310.1| hypothetical protein B456_009G204100 [Gossypium raimondii]
 gb|KJB58312.1| hypothetical protein B456_009G204100 [Gossypium raimondii]
Length=505

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG ++RELM  S+ AI  EPK SI+PARVLEKAHS  KAKGSSTAC+IAL  QGLHAI
Sbjct  298  IDAGQFSRELMSKSVSAIQEEPKGSINPARVLEKAHSSIKAKGSSTACVIALGDQGLHAI  357

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLESG+ ADLPSSGQ+F + +  GDVI+AG
Sbjct  358  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLESGNNADLPSSGQIFAVPIAPGDVIIAG  417

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  PE TAQKIAALAR+RA  + RQTPF+ AAQ+AG+
Sbjct  418  TDGLFDNLYNNEITAVVVHALRAGFGPEVTAQKIAALARERAQAKDRQTPFSTAAQDAGF  477

Query  136  QYYGGK  119
            +YYGGK
Sbjct  478  RYYGGK  483



>ref|XP_010923448.1| PREDICTED: probable protein phosphatase 2C 55 [Elaeis guineensis]
Length=497

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YAR+LM  S+ AI  EPK SIDPARVLEKA+S TKAKGSSTACIIAL  QG+HA+
Sbjct  296  VDAGQYARDLMSNSVSAIREEPKGSIDPARVLEKAYSSTKAKGSSTACIIALTDQGIHAV  355

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQH FNFTYQLESG+ +DLPS+ QVF   V  GDVI+AG
Sbjct  356  NLGDSGFIVVRDGCTIFRSPVQQHDFNFTYQLESGNGSDLPSAAQVFNFPVAPGDVIIAG  415

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  VV  AV +   P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AGY
Sbjct  416  TDGLFDNLYSNEVTAVVVHAVRARLGPQVTAQKIAALARQRAQDKNRQTPFSAAAQDAGY  475

Query  136  QYYGGK  119
            +YYGGK
Sbjct  476  RYYGGK  481



>ref|NP_193391.3| putative protein phosphatase 2C [Arabidopsis thaliana]
 sp|Q9SUK9.2|P2C55_ARATH RecName: Full=Probable protein phosphatase 2C 55; Short=AtPP2C55 
[Arabidopsis thaliana]
 gb|AEE83773.1| putative protein phosphatase 2C [Arabidopsis thaliana]
Length=467

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S++AI  EPK SIDPARVLEKAH+ TK++GSSTACIIAL +QGLHAI
Sbjct  262  IDAGYYSRELMSNSVNAIQDEPKGSIDPARVLEKAHTCTKSQGSSTACIIALTNQGLHAI  321

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVR+G T+F SPVQQH FNFTYQLESG   DLPSSGQVFT+AV  GDVI+AG
Sbjct  322  NLGDSGFMVVREGHTVFRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTVAVAPGDVIIAG  381

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  +V  AV +  +P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  382  TDGLFDNLYNNEITAIVVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGF  441

Query  136  QYYGGK  119
            +YYGGK
Sbjct  442  RYYGGK  447



>ref|XP_006856074.1| hypothetical protein AMTR_s00059p00109810 [Amborella trichopoda]
 gb|ERN17541.1| hypothetical protein AMTR_s00059p00109810 [Amborella trichopoda]
Length=527

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM +S+ AI  EPK  +DPARVLEKA++ TKA+GSSTACI+AL  +GLHA+
Sbjct  326  VDAGQYARELMSHSVKAIEEEPKGYVDPARVLEKAYTSTKARGSSTACIVALTDKGLHAV  385

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQH FNFTYQLESG+ +DLPSS Q+F+I V  GDV++AG
Sbjct  386  NLGDSGFIVVRDGCTIFRSPVQQHNFNFTYQLESGNGSDLPSSAQIFSIPVAPGDVMIAG  445

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  EV  VV  AV +G +P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  446  TDGLFDNLYNSEVTAVVVHAVRAGLSPQVTAQKIAALARQRAQDQHRQTPFSTAAQDAGF  505

Query  136  QYYGGK  119
            +YYGGK
Sbjct  506  RYYGGK  511



>ref|XP_010556299.1| PREDICTED: probable protein phosphatase 2C 55 [Tarenaya hassleriana]
Length=514

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S+ AI  EPK S+DPARVLEKA++ TKAKGSSTACI+AL   GLHAI
Sbjct  309  IDAGLYSRELMSNSVSAIQDEPKGSVDPARVLEKAYTSTKAKGSSTACILALTDLGLHAI  368

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLESG+  DLPSSGQVFT+ V  GD+I++G
Sbjct  369  NLGDSGFMVVRDGCTVFRSPVQQHDFNFTYQLESGNNGDLPSSGQVFTVQVAPGDIIISG  428

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  AV  G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG+
Sbjct  429  TDGLFDNLYNNEITAVVVQAVRGGLGPKVTAQKIAALARQRAEDRDRQTPFSKAAQDAGF  488

Query  136  QYYGGK  119
            +YYGGK
Sbjct  489  RYYGGK  494



>gb|KJB43548.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
 gb|KJB43551.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
 gb|KJB43553.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
 gb|KJB43555.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
Length=377

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -3

Query  673  NAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAIN  494
            +AG++ARELM  S+ AI  EPK SIDPARVLEKAHS TK++GSSTACIIAL  +G+HAIN
Sbjct  176  DAGEFARELMCNSVAAIQGEPKGSIDPARVLEKAHSSTKSQGSSTACIIALTGEGIHAIN  235

Query  493  LGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAGT  314
            LGDSGFIVVRDGCT+F SPVQQHGFNFTYQLESG   DLPSS QVF I VLSGDVI+AGT
Sbjct  236  LGDSGFIVVRDGCTVFHSPVQQHGFNFTYQLESGDGGDLPSSVQVFKIPVLSGDVIIAGT  295

Query  313  DGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGYQ  134
            DGLFDNLY +E+   V   +  G NP+  A++IA LAR+RA+D+ RQTPFA AAQ+AG++
Sbjct  296  DGLFDNLYNNEITAAVVHGLRVGFNPQLMAKQIATLARERAVDKNRQTPFAKAAQDAGFR  355

Query  133  YYGGK  119
            YYGGK
Sbjct  356  YYGGK  360



>ref|XP_006383232.1| hypothetical protein POPTR_0005s12720g [Populus trichocarpa]
 gb|ERP61029.1| hypothetical protein POPTR_0005s12720g [Populus trichocarpa]
Length=423

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG+++RELM +S+ AI  EP  S DPARVLEKAH+KTKA+GSSTACII LNS+G+ AI
Sbjct  221  VNAGEFSRELMSHSVSAIQEEPNGSFDPARVLEKAHAKTKAQGSSTACIITLNSEGIRAI  280

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCTIF SPVQQHGFNFTYQLESG+  DLPSSGQVFT+ V  GDVI+AG
Sbjct  281  NLGDSGFMVVRDGCTIFRSPVQQHGFNFTYQLESGNGGDLPSSGQVFTVPVAPGDVIIAG  340

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EVA VV  A+ +G  PEA AQKIAALARQRA+DR +QTPF+ AAQ+AGY
Sbjct  341  TDGLFDNLYNNEVAAVVVHAIRTGLGPEAAAQKIAALARQRAVDRNQQTPFSTAAQDAGY  400

Query  136  QYYGGK  119
            +YYGGK
Sbjct  401  RYYGGK  406



>ref|XP_006280550.1| hypothetical protein CARUB_v10026491mg [Capsella rubella]
 gb|EOA13448.1| hypothetical protein CARUB_v10026491mg [Capsella rubella]
Length=413

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (86%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDS-IDPARVLEKAHSKTKAKGSSTACIIALNSQGLHA  500
            +NAG ++RELM YS+ AI    K S IDP  VLEKAHS+T+AKGSSTACIIAL  +GLHA
Sbjct  213  VNAGLFSRELMSYSLSAIQDRQKGSPIDPLLVLEKAHSQTRAKGSSTACIIALTDKGLHA  272

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            INLGDSGF VVR+G T+F+SPVQQHGFNFTYQLESG+ AD+PSSGQVFTI V SGDVIVA
Sbjct  273  INLGDSGFTVVREGTTVFQSPVQQHGFNFTYQLESGNSADVPSSGQVFTIDVESGDVIVA  332

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            G+DG++DNLY +E+ GVV  +V +G +P+ATAQKIA LAR RA+D+KRQ+PFA AAQEAG
Sbjct  333  GSDGMYDNLYNEEITGVVVSSVRAGLDPKATAQKIADLARLRAVDKKRQSPFAAAAQEAG  392

Query  139  YQYYGGK  119
            Y+YYGGK
Sbjct  393  YRYYGGK  399



>gb|KDP31794.1| hypothetical protein JCGZ_12255 [Jatropha curcas]
Length=375

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            INAG Y+RELM  S+ AI  EP  SIDPARVLEKAHS TKAKGSSTACI+AL ++G+ AI
Sbjct  173  INAGLYSRELMSNSVSAIKDEPVGSIDPARVLEKAHSNTKAKGSSTACIVALTNEGIRAI  232

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDG T+F+SPVQQHGFNFTYQLESG+  D PSS QVF   V  GDVIVAG
Sbjct  233  NLGDSGFMVVRDGSTVFQSPVQQHGFNFTYQLESGNHGDQPSSSQVFIFPVSPGDVIVAG  292

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV   V  A  +G  P+ATAQKIA LARQRALDR RQTPF+ AAQ+AG+
Sbjct  293  TDGLFDNLYNNEVTAAVVHAARAGLGPQATAQKIADLARQRALDRNRQTPFSAAAQDAGF  352

Query  136  QYYGGK  119
            +YYGGK
Sbjct  353  RYYGGK  358



>ref|XP_009614756.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
Length=518

 Score =   279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S+ AI  EPK S+DPARVL+KA++ TKAKGSSTACIIAL  QGLHAI
Sbjct  309  VDAGQYARELMSNSVTAIQDEPKRSVDPARVLDKAYTCTKAKGSSTACIIALTDQGLHAI  368

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLESG+  DLPSSG+VF I V  GDVI+AG
Sbjct  369  NLGDSGFMVVRDGCTVFRSPVQQHDFNFTYQLESGNSGDLPSSGEVFKIPVAPGDVIIAG  428

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +++  +V  A  +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQEAG+
Sbjct  429  TDGLFDNLYNNDITAIVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSAAAQEAGF  488

Query  136  QYYGGK  119
            +YYGGK
Sbjct  489  RYYGGK  494



>gb|KJB43549.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
Length=435

 Score =   276 bits (707),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -3

Query  673  NAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAIN  494
            +AG++ARELM  S+ AI  EPK SIDPARVLEKAHS TK++GSSTACIIAL  +G+HAIN
Sbjct  234  DAGEFARELMCNSVAAIQGEPKGSIDPARVLEKAHSSTKSQGSSTACIIALTGEGIHAIN  293

Query  493  LGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAGT  314
            LGDSGFIVVRDGCT+F SPVQQHGFNFTYQLESG   DLPSS QVF I VLSGDVI+AGT
Sbjct  294  LGDSGFIVVRDGCTVFHSPVQQHGFNFTYQLESGDGGDLPSSVQVFKIPVLSGDVIIAGT  353

Query  313  DGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGYQ  134
            DGLFDNLY +E+   V   +  G NP+  A++IA LAR+RA+D+ RQTPFA AAQ+AG++
Sbjct  354  DGLFDNLYNNEITAAVVHGLRVGFNPQLMAKQIATLARERAVDKNRQTPFAKAAQDAGFR  413

Query  133  YYGGK  119
            YYGGK
Sbjct  414  YYGGK  418



>ref|XP_009761616.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
 ref|XP_009761618.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
Length=518

 Score =   278 bits (712),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S+ AI  EPK S+DPARVL+KA++ TKAKGSSTACIIAL  QGLHAI
Sbjct  309  VDAGQYARELMSNSVTAIQDEPKRSVDPARVLDKAYTCTKAKGSSTACIIALTDQGLHAI  368

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLESG+  DLPSSG+VF I V  GDVI+AG
Sbjct  369  NLGDSGFMVVRDGCTVFRSPVQQHDFNFTYQLESGNSGDLPSSGEVFKIPVAPGDVIIAG  428

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +++  +V  A  +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQEAG+
Sbjct  429  TDGLFDNLYNNDITAIVVHAARAGLGPQMTAQKIAALARQRAQDKNRQTPFSAAAQEAGF  488

Query  136  QYYGGK  119
            +YYGGK
Sbjct  489  RYYGGK  494



>ref|XP_006393865.1| hypothetical protein EUTSA_v10004287mg [Eutrema salsugineum]
 gb|ESQ31151.1| hypothetical protein EUTSA_v10004287mg [Eutrema salsugineum]
Length=422

 Score =   275 bits (704),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 160/187 (86%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPK-DSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHA  500
            +NAG ++RELM +S+ AI  + K  SIDP  VLEKAHS+T+AKGSSTACIIAL  +GLHA
Sbjct  222  VNAGLFSRELMSFSVSAIREQAKGSSIDPLMVLEKAHSQTRAKGSSTACIIALTDKGLHA  281

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            INLGDSGF VVRDG T+F+SPVQQHGFNFTYQLESG+  D+P+SGQVF I V+SGDVIVA
Sbjct  282  INLGDSGFTVVRDGTTVFQSPVQQHGFNFTYQLESGNGGDMPNSGQVFMIDVVSGDVIVA  341

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDG++DNLY +E+ GVV  +V +G +P+ATAQKIA LAR RA+DRKRQ+PF+ AAQEAG
Sbjct  342  GTDGVYDNLYNEEITGVVVSSVRAGLDPKATAQKIADLARARAVDRKRQSPFSAAAQEAG  401

Query  139  YQYYGGK  119
            ++YYGGK
Sbjct  402  FRYYGGK  408



>gb|KJB43554.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
Length=452

 Score =   276 bits (706),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -3

Query  673  NAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAIN  494
            +AG++ARELM  S+ AI  EPK SIDPARVLEKAHS TK++GSSTACIIAL  +G+HAIN
Sbjct  251  DAGEFARELMCNSVAAIQGEPKGSIDPARVLEKAHSSTKSQGSSTACIIALTGEGIHAIN  310

Query  493  LGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAGT  314
            LGDSGFIVVRDGCT+F SPVQQHGFNFTYQLESG   DLPSS QVF I VLSGDVI+AGT
Sbjct  311  LGDSGFIVVRDGCTVFHSPVQQHGFNFTYQLESGDGGDLPSSVQVFKIPVLSGDVIIAGT  370

Query  313  DGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGYQ  134
            DGLFDNLY +E+   V   +  G NP+  A++IA LAR+RA+D+ RQTPFA AAQ+AG++
Sbjct  371  DGLFDNLYNNEITAAVVHGLRVGFNPQLMAKQIATLARERAVDKNRQTPFAKAAQDAGFR  430

Query  133  YYGGK  119
            YYGGK
Sbjct  431  YYGGK  435



>ref|XP_010434801.1| PREDICTED: probable protein phosphatase 2C 55 [Camelina sativa]
Length=472

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S++AI  EPK SIDPARVLEKAH+ TK+ GSSTACIIAL +QGL+AI
Sbjct  267  IDAGYYSRELMSNSVNAIQDEPKGSIDPARVLEKAHTSTKSLGSSTACIIALTNQGLNAI  326

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVR+G T+F SPVQQH FNFTYQLESG   DLPSSGQVFT+AV  GDVI+AG
Sbjct  327  NLGDSGFMVVREGHTVFRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTVAVAPGDVIIAG  386

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  +V  AV +  +P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  387  TDGLFDNLYNNEITAIVVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGF  446

Query  136  QYYGGK  119
            +YYGGK
Sbjct  447  RYYGGK  452



>ref|XP_006414328.1| hypothetical protein EUTSA_v10025106mg [Eutrema salsugineum]
 gb|ESQ55781.1| hypothetical protein EUTSA_v10025106mg [Eutrema salsugineum]
Length=470

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S+ AI  EPK SIDPARVLEKAH+ TK++GSSTACIIAL  QGL +I
Sbjct  265  IDAGYYSRELMSNSVHAIQDEPKGSIDPARVLEKAHTCTKSQGSSTACIIALTDQGLQSI  324

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVR+G T+F SPVQQH FNFTYQLESGS  DLPSSGQVFT+AV  GDVI+AG
Sbjct  325  NLGDSGFMVVREGHTVFRSPVQQHDFNFTYQLESGSNGDLPSSGQVFTVAVAPGDVIIAG  384

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  +V  AV  G +P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  385  TDGLFDNLYNNEITAIVVHAVRGGIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGF  444

Query  136  QYYGGK  119
            +YYGGK
Sbjct  445  RYYGGK  450



>ref|XP_010440128.1| PREDICTED: probable protein phosphatase 2C 55 [Camelina sativa]
Length=472

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S++AI  EPK SIDPARVLEKAH+ TK+ GSSTACIIAL +QGL+AI
Sbjct  267  IDAGFYSRELMSNSVNAIQDEPKGSIDPARVLEKAHTSTKSLGSSTACIIALTNQGLNAI  326

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVR+G T+F SPVQQH FNFTYQLESG   DLPSSGQVFT+AV  GDVI+AG
Sbjct  327  NLGDSGFMVVREGHTVFRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTVAVAPGDVIIAG  386

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  +V  AV +  +P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  387  TDGLFDNLYNNEITAIVVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGF  446

Query  136  QYYGGK  119
            +YYGGK
Sbjct  447  RYYGGK  452



>ref|XP_006283668.1| hypothetical protein CARUB_v10004725mg [Capsella rubella]
 gb|EOA16566.1| hypothetical protein CARUB_v10004725mg [Capsella rubella]
Length=475

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S++AI  EPK SIDPARVLEKAH+ TK+ GSSTACIIAL +QGL+AI
Sbjct  270  IDAGYYSRELMSNSVNAIQDEPKGSIDPARVLEKAHTSTKSLGSSTACIIALTNQGLNAI  329

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVR+G T+F SPVQQH FNFTYQLESG   DLPSSGQVFT+AV  GDVI+AG
Sbjct  330  NLGDSGFMVVREGHTVFRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTVAVAPGDVIIAG  389

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  +V  AV +  +P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  390  TDGLFDNLYNNEITAIVVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGF  449

Query  136  QYYGGK  119
            +YYGGK
Sbjct  450  RYYGGK  455



>ref|XP_010999959.1| PREDICTED: probable protein phosphatase 2C 80 isoform X2 [Populus 
euphratica]
Length=417

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG+++RELM +S+ AI  EP  S DPARVLEKAH+KTKA+GSSTACII L S+G+ AI
Sbjct  215  VNAGEFSRELMSHSVSAIQEEPNGSFDPARVLEKAHAKTKAQGSSTACIITLKSEGIRAI  274

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+FESPVQQHGFNFTYQLESG+  DLPSSGQVFTI V  GDVI+AG
Sbjct  275  NLGDSGFMVVRDGCTVFESPVQQHGFNFTYQLESGNGGDLPSSGQVFTIPVAPGDVIIAG  334

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  VV  A+ +G  P A AQKIAALARQRA+DR RQTPF+ AAQ+AGY
Sbjct  335  TDGLFDNLYNNEVTAVVVHAIRTGLGPGAAAQKIAALARQRAVDRNRQTPFSTAAQDAGY  394

Query  136  QYYGGK  119
            +YYGGK
Sbjct  395  RYYGGK  400



>ref|XP_010999955.1| PREDICTED: probable protein phosphatase 2C 80 isoform X1 [Populus 
euphratica]
 ref|XP_010999956.1| PREDICTED: probable protein phosphatase 2C 80 isoform X1 [Populus 
euphratica]
 ref|XP_010999958.1| PREDICTED: probable protein phosphatase 2C 80 isoform X1 [Populus 
euphratica]
Length=423

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG+++RELM +S+ AI  EP  S DPARVLEKAH+KTKA+GSSTACII L S+G+ AI
Sbjct  221  VNAGEFSRELMSHSVSAIQEEPNGSFDPARVLEKAHAKTKAQGSSTACIITLKSEGIRAI  280

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+FESPVQQHGFNFTYQLESG+  DLPSSGQVFTI V  GDVI+AG
Sbjct  281  NLGDSGFMVVRDGCTVFESPVQQHGFNFTYQLESGNGGDLPSSGQVFTIPVAPGDVIIAG  340

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV  VV  A+ +G  P A AQKIAALARQRA+DR RQTPF+ AAQ+AGY
Sbjct  341  TDGLFDNLYNNEVTAVVVHAIRTGLGPGAAAQKIAALARQRAVDRNRQTPFSTAAQDAGY  400

Query  136  QYYGGK  119
            +YYGGK
Sbjct  401  RYYGGK  406



>gb|EYU45128.1| hypothetical protein MIMGU_mgv1a005010mg [Erythranthe guttata]
Length=501

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S++AI  EPK SIDPARVLEKAH+ TKAKGSSTACIIAL  Q LHAI
Sbjct  297  IDAGKYARELMSNSVNAIQEEPKGSIDPARVLEKAHTGTKAKGSSTACIIALAEQSLHAI  356

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCT+F SPVQQH FNFTYQLE G+  D+PSSGQVFTI V  GDVI+AG
Sbjct  357  NLGDSGFIVVRDGCTVFRSPVQQHDFNFTYQLECGNSGDMPSSGQVFTIPVAPGDVIIAG  416

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            T GLF NLY  ++  VV  AV +G  P+ TAQKIA  ARQRALD+ RQTPF  AAQEAG+
Sbjct  417  TAGLFANLYNRDITAVVVHAVRAGLGPQVTAQKIAVFARQRALDKNRQTPFFTAAQEAGF  476

Query  136  QYYGGK  119
            +Y GGK
Sbjct  477  RYSGGK  482



>ref|XP_010449755.1| PREDICTED: probable protein phosphatase 2C 55 [Camelina sativa]
Length=472

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG Y+RELM  S++AI  EPK SIDPARVLEKAH+ TK+ GSSTACIIAL +QGL+AI
Sbjct  267  IDAGFYSRELMSNSVNAIQDEPKGSIDPARVLEKAHTSTKSLGSSTACIIALTNQGLNAI  326

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVR+G T+F SPVQQH FNFTYQLESG   DLPSSGQVFT AV  GDVI+AG
Sbjct  327  NLGDSGFMVVREGHTVFRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTFAVAPGDVIIAG  386

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  +V  AV +  +P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG+
Sbjct  387  TDGLFDNLYNNEITAIVVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGF  446

Query  136  QYYGGK  119
            +YYGGK
Sbjct  447  RYYGGK  452



>gb|KJB58311.1| hypothetical protein B456_009G204100 [Gossypium raimondii]
Length=506

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 155/187 (83%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG ++RELM  S+ AI  EPK SI+PARVLEKAHS  KAKGSSTAC+IAL  QGLHAI
Sbjct  298  IDAGQFSRELMSKSVSAIQEEPKGSINPARVLEKAHSSIKAKGSSTACVIALGDQGLHAI  357

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQV-FTIAVLSGDVIVA  320
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLESG+ ADLPSSGQV F + +  GDVI+A
Sbjct  358  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLESGNNADLPSSGQVIFAVPIAPGDVIIA  417

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDGLFDNLY +E+  VV  A+ +G  PE TAQKIAALAR+RA  + RQTPF+ AAQ+AG
Sbjct  418  GTDGLFDNLYNNEITAVVVHALRAGFGPEVTAQKIAALARERAQAKDRQTPFSTAAQDAG  477

Query  139  YQYYGGK  119
            ++YYGGK
Sbjct  478  FRYYGGK  484



>ref|XP_009805012.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
 ref|XP_009805013.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
Length=517

 Score =   276 bits (705),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  ++ AI  EPK S+DPARVLEKA+  TKAKGSSTACIIAL  +GLHAI
Sbjct  307  VDAGQYARELMSNAVSAICEEPKGSVDPARVLEKAYIHTKAKGSSTACIIALTDEGLHAI  366

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFT+QLESGS  DLPSSG+V+ I V  GDVI+AG
Sbjct  367  NLGDSGFLVVRDGCTVFRSPVQQHDFNFTFQLESGSAGDLPSSGEVYKIPVAPGDVIIAG  426

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  ++  +V  A  +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQEAG+
Sbjct  427  TDGLFDNLYNSDITAIVVHATRAGLAPQVTAQKIAALARQRAQDKNRQTPFSAAAQEAGF  486

Query  136  QYYGGK  119
            +YYGGK
Sbjct  487  RYYGGK  492



>ref|XP_004252785.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
 ref|XP_010314634.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
Length=519

 Score =   276 bits (705),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S+ AI  EPK S+DPARVL+KA++ TKAKGSSTACIIAL  QGLHAI
Sbjct  310  IDAGKYARELMSNSVAAIQDEPKGSVDPARVLDKAYTCTKAKGSSTACIIALTDQGLHAI  369

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDG T+F SPVQQH FNFTYQLESG+  DLPSSG+VF I V  GDVI+AG
Sbjct  370  NLGDSGFIVVRDGSTVFRSPVQQHDFNFTYQLESGNAGDLPSSGEVFKIPVAQGDVIIAG  429

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +++  +V  A  +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQEAG+
Sbjct  430  TDGLFDNLYNNDINAIVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSSAAQEAGF  489

Query  136  QYYGGK  119
            +YYGGK
Sbjct  490  RYYGGK  495



>gb|KDP42844.1| hypothetical protein JCGZ_23786 [Jatropha curcas]
Length=375

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            INAG YARELM  S+ AI  EP  SIDPARVLEKAHSKTKAKGSSTACI+AL ++ + AI
Sbjct  173  INAGLYARELMLNSVSAIQEEPVGSIDPARVLEKAHSKTKAKGSSTACIVALINEEIRAI  232

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF VVRDGCT+F+SP QQH FNF YQLESG+   LPSSGQVF   V  GDVIVAG
Sbjct  233  NLGDSGFTVVRDGCTVFQSPAQQHCFNFPYQLESGNEGRLPSSGQVFRFPVSPGDVIVAG  292

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV   V DA+ +G  P+ TAQKIAAL  QRALD  RQTPF+ AAQ AG+
Sbjct  293  TDGLFDNLYNNEVTTAVVDALRAGLRPQITAQKIAALTSQRALDENRQTPFSTAAQRAGF  352

Query  136  QYYGGK  119
             YYGGK
Sbjct  353  SYYGGK  358



>ref|XP_010547493.1| PREDICTED: probable protein phosphatase 2C 80 [Tarenaya hassleriana]
 ref|XP_010547494.1| PREDICTED: probable protein phosphatase 2C 80 [Tarenaya hassleriana]
 ref|XP_010547495.1| PREDICTED: probable protein phosphatase 2C 80 [Tarenaya hassleriana]
Length=433

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 156/187 (83%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPK-DSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHA  500
            +NAG +ARELM  S+ AI  + K  SIDP  VLEKAH++T AKGSSTACII L  +G+HA
Sbjct  235  VNAGLFARELMSNSVMAIQGQAKGSSIDPLTVLEKAHAQTTAKGSSTACIITLTDKGIHA  294

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            INLGDSGFIVVR+G T+F+SPVQQHGFNFTYQLESG+R D+PSSGQVFTI V  GD IVA
Sbjct  295  INLGDSGFIVVREGTTLFQSPVQQHGFNFTYQLESGNRGDMPSSGQVFTIEVKEGDAIVA  354

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDGLFDNLY DE+ GVV ++V +G +P+ TA+KIA LARQ A+DR RQTPF+ AAQEAG
Sbjct  355  GTDGLFDNLYNDEIVGVVVNSVRAGLDPKGTAEKIAELARQIAVDRNRQTPFSAAAQEAG  414

Query  139  YQYYGGK  119
            Y+YYGGK
Sbjct  415  YRYYGGK  421



>ref|XP_010244315.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Nelumbo 
nucifera]
Length=532

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 155/206 (75%), Gaps = 20/206 (10%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQ-----  512
            I+AG YARELM  S+ AI  EPK SIDPARVLEKAH  TKAKGSSTACIIAL  Q     
Sbjct  310  IDAGQYARELMSNSVTAIKEEPKGSIDPARVLEKAHLTTKAKGSSTACIIALTDQAMNFI  369

Query  511  ---------------GLHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADL  377
                           G+HAINLGDSGFIVVRDGCT+F+SPVQQH FNFTYQLE G+  DL
Sbjct  370  RRIRNHPLPQHLFVHGIHAINLGDSGFIVVRDGCTVFQSPVQQHSFNFTYQLECGNGGDL  429

Query  376  PSSGQVFTIAVLSGDVIVAGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQ  197
            PSSGQVFTI V  GDVI+AGTDGLFDNLY +EV  VV  A  +G  P+ TAQKIAALARQ
Sbjct  430  PSSGQVFTIPVAPGDVIIAGTDGLFDNLYNNEVTAVVVHAARAGFEPQVTAQKIAALARQ  489

Query  196  RALDRKRQTPFADAAQEAGYQYYGGK  119
            RA D+ RQTPF+ AAQ+AG++YYGGK
Sbjct  490  RAQDKNRQTPFSTAAQDAGFRYYGGK  515



>ref|XP_003574421.1| PREDICTED: probable protein phosphatase 2C 55 [Brachypodium distachyon]
Length=380

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YAR++M +++ AI  EPKDSID +RVLEKAH  T  KGSSTACI+AL  QG+ AI
Sbjct  174  IDAGQYARDIMSHAVTAIEQEPKDSIDLSRVLEKAHRNTTVKGSSTACIVALTDQGIQAI  233

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            +LGDSGFI++RDGCT+F SP+QQH FNFTYQLESG+ +DLPS+ QVF +   SGDV+VAG
Sbjct  234  SLGDSGFILIRDGCTLFRSPIQQHDFNFTYQLESGNSSDLPSAAQVFMVPAASGDVLVAG  293

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A  +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQEAGY
Sbjct  294  TDGLFDNLYNNEITAVVVHATRAGLEPQVTAQKIAALARQRAQDKGRQTPFSSAAQEAGY  353

Query  136  QYYGGK  119
            +YYGGK
Sbjct  354  RYYGGK  359



>ref|XP_006342592.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Solanum tuberosum]
 ref|XP_006342593.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Solanum tuberosum]
 ref|XP_006342594.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X3 
[Solanum tuberosum]
 ref|XP_006342595.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X4 
[Solanum tuberosum]
Length=519

 Score =   274 bits (700),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S+ AI  EPK S+DPARVL+KA++ TKAKGSSTACIIAL  QGLHA+
Sbjct  310  IDAGKYARELMSNSVAAIQDEPKGSVDPARVLDKAYTCTKAKGSSTACIIALTDQGLHAV  369

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDG T+F SPVQQH FNFTYQLESG+  DLPSSG+VF I V  GDVI+ G
Sbjct  370  NLGDSGFIVVRDGSTVFRSPVQQHDFNFTYQLESGNAGDLPSSGEVFKIPVAQGDVIITG  429

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +++  +V  A  +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQEAG+
Sbjct  430  TDGLFDNLYNNDINAIVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSSAAQEAGF  489

Query  136  QYYGGK  119
            +YYGGK
Sbjct  490  RYYGGK  495



>ref|XP_009386157.1| PREDICTED: probable protein phosphatase 2C 55 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=383

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+R LM ++ DAI  E K SIDP RVLEKA+ +TKA+GSSTACIIAL  QG+ A+
Sbjct  182  VDAGQYSRALMSHASDAIEEESKGSIDPLRVLEKAYLRTKAQGSSTACIIALTDQGIRAV  241

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQH FNFTYQLESG+ +DLPS+ QVFT  V SGDVIVAG
Sbjct  242  NLGDSGFIVVRDGCTIFRSPVQQHDFNFTYQLESGNASDLPSAAQVFTFPVESGDVIVAG  301

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  ++  VV   + +G  P+  AQKIAALARQRA D+ RQTPF+ +AQEAGY
Sbjct  302  TDGLFDNLYNSDITAVVVHGIRAGLGPQVMAQKIAALARQRAQDKNRQTPFSTSAQEAGY  361

Query  136  QYYGGK  119
            +YYGGK
Sbjct  362  RYYGGK  367



>ref|XP_009414756.1| PREDICTED: probable protein phosphatase 2C 55 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+R LM +S+DAI  E K SIDP RVLEKA+++TKA+GSSTACIIAL  QG+ A+
Sbjct  272  VDAGQYSRALMSHSVDAIEEESKGSIDPLRVLEKAYTRTKAEGSSTACIIALTDQGIRAV  331

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQH FNFTYQLES + +DLPS+ QVF+  V SGDVIVAG
Sbjct  332  NLGDSGFIVVRDGCTIFRSPVQQHDFNFTYQLESNNASDLPSAAQVFSFPVESGDVIVAG  391

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  E+  VV   + +G  P+  AQKIAALARQRA D+ RQTPF+ AAQEAGY
Sbjct  392  TDGLFDNLYNSEITAVVVHGIRAGLGPQVMAQKIAALARQRAQDKNRQTPFSAAAQEAGY  451

Query  136  QYYGGK  119
            +YYGGK
Sbjct  452  RYYGGK  457



>gb|EMS48221.1| putative protein phosphatase 2C 55 [Triticum urartu]
Length=257

 Score =   262 bits (670),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YAR++M  ++ AI  EPKDSID  RVLEKAHS T   GSSTACIIAL +QG+ AI
Sbjct  55   IDAGQYARDIMSNAVTAIEEEPKDSIDLTRVLEKAHSSTTVPGSSTACIIALTNQGIQAI  114

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIV+RDGCT+  SPVQQH FNF+YQL+SG+ +DLP++ QVF + V SGDVIVAG
Sbjct  115  NLGDSGFIVIRDGCTLCRSPVQQHDFNFSYQLQSGNSSDLPNAAQVFKVPVASGDVIVAG  174

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +++  VV  A  +G +P+ TAQKIAALARQRA D+ R TPF+ AAQ+AGY
Sbjct  175  TDGLFDNLYNNDITAVVVHATRAGLDPQVTAQKIAALARQRAQDKNRPTPFSTAAQDAGY  234

Query  136  QYYGGK  119
            +YYGGK
Sbjct  235  RYYGGK  240



>ref|XP_009386155.1| PREDICTED: probable protein phosphatase 2C 80 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=472

 Score =   269 bits (688),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+R LM ++ DAI  E K SIDP RVLEKA+ +TKA+GSSTACIIAL  QG+ A+
Sbjct  271  VDAGQYSRALMSHASDAIEEESKGSIDPLRVLEKAYLRTKAQGSSTACIIALTDQGIRAV  330

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIF SPVQQH FNFTYQLESG+ +DLPS+ QVFT  V SGDVIVAG
Sbjct  331  NLGDSGFIVVRDGCTIFRSPVQQHDFNFTYQLESGNASDLPSAAQVFTFPVESGDVIVAG  390

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  ++  VV   + +G  P+  AQKIAALARQRA D+ RQTPF+ +AQEAGY
Sbjct  391  TDGLFDNLYNSDITAVVVHGIRAGLGPQVMAQKIAALARQRAQDKNRQTPFSTSAQEAGY  450

Query  136  QYYGGK  119
            +YYGGK
Sbjct  451  RYYGGK  456



>gb|KFK28352.1| putative protein phosphatase 2c 55-like [Arabis alpina]
Length=411

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPK-DSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHA  500
            +++G ++RELM YS+ AI    K  SIDP  VLEKAHS+T+AKGSSTACIIAL  +GLHA
Sbjct  211  VDSGLFSRELMSYSVSAIRELAKGSSIDPLMVLEKAHSQTRAKGSSTACIIALTDKGLHA  270

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            INLGDSGF VVRDG T+F+SPVQQHGFNFTYQLESG+  D+P+SGQVF I V SGDVIVA
Sbjct  271  INLGDSGFTVVRDGTTVFQSPVQQHGFNFTYQLESGNGGDMPNSGQVFMIDVESGDVIVA  330

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            G+DG++DNLY +++ GVV  +V +G +P+ATA+KIA LAR+RALDR+RQ+PFA AA EAG
Sbjct  331  GSDGVYDNLYNEDITGVVVSSVRAGLDPKATAKKIADLARERALDRQRQSPFATAAHEAG  390

Query  139  YQYYGGK  119
            ++YYGGK
Sbjct  391  FRYYGGK  397



>gb|ACU19890.1| unknown [Glycine max]
Length=247

 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +A+EL+   + AI  EPK S +  RVL +AH+ TK KGSSTACI+AL  +GLHAI
Sbjct  45   VNAGLFAQELISNLVRAIQKEPKGSFNLTRVLREAHANTKVKGSSTACIVALTDKGLHAI  104

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIFESP QQH FNF YQLESG+ ADLPSSG+VFTI V SGDV+++G
Sbjct  105  NLGDSGFIVVRDGCTIFESPSQQHDFNFPYQLESGNGADLPSSGEVFTIPVASGDVVISG  164

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  E+ GVV  A+ +G  P+ TAQKIAALARQRAL +  +TPF+ AA++AG+
Sbjct  165  TDGLFDNLYNSEITGVVEHAIRAGLEPQVTAQKIAALARQRALSKSSRTPFSTAAEKAGF  224

Query  136  QYYGGK  119
             YYGGK
Sbjct  225  CYYGGK  230



>ref|XP_008377406.1| PREDICTED: probable protein phosphatase 2C 55 [Malus domestica]
Length=506

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +N+G Y+RELM  S+ A+  EPK +IDPARVLEKAHS TKA+GSSTACIIAL  QG+HA+
Sbjct  304  VNSGLYSRELMSNSVAAVQEEPKGAIDPARVLEKAHSSTKARGSSTACIIALTEQGIHAV  363

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVR G T+F SPVQQH FNF+YQL +G+  DLPSSGQVFT+ V   DVI+AG
Sbjct  364  NLGDSGFIVVRGGSTVFRSPVQQHNFNFSYQLGTGNNGDLPSSGQVFTVPVAPRDVIIAG  423

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  A+ +G  P+ TAQKIAALARQRA DR RQTPF+ AAQ+AG 
Sbjct  424  TDGLFDNLYNNEITAVVVHAMRAGXGPQVTAQKIAALARQRAQDRNRQTPFSTAAQDAGV  483

Query  136  QYYGGK  119
             +YGGK
Sbjct  484  LHYGGK  489



>ref|XP_009386156.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=442

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = -3

Query  667  GDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAINLG  488
            G Y+R LM ++ DAI  E K SIDP RVLEKA+ +TKA+GSSTACIIAL  QG+ A+NLG
Sbjct  244  GQYSRALMSHASDAIEEESKGSIDPLRVLEKAYLRTKAQGSSTACIIALTDQGIRAVNLG  303

Query  487  DSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAGTDG  308
            DSGFIVVRDGCTIF SPVQQH FNFTYQLESG+ +DLPS+ QVFT  V SGDVIVAGTDG
Sbjct  304  DSGFIVVRDGCTIFRSPVQQHDFNFTYQLESGNASDLPSAAQVFTFPVESGDVIVAGTDG  363

Query  307  LFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGYQYY  128
            LFDNLY  ++  VV   + +G  P+  AQKIAALARQRA D+ RQTPF+ +AQEAGY+YY
Sbjct  364  LFDNLYNSDITAVVVHGIRAGLGPQVMAQKIAALARQRAQDKNRQTPFSTSAQEAGYRYY  423

Query  127  GGK  119
            GGK
Sbjct  424  GGK  426



>gb|KDP42845.1| hypothetical protein JCGZ_23787 [Jatropha curcas]
Length=462

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            INAG YARELM  S+ AI  EP  SIDPA VLEKAHS TKAKGSSTACI+AL ++ + AI
Sbjct  260  INAGLYARELMLNSVSAIQEEPVGSIDPATVLEKAHSNTKAKGSSTACIVALINEEIRAI  319

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F+SP QQH FNF YQLESG+  DLPSSGQVF   V  GDVIVAG
Sbjct  320  NLGDSGFMVVRDGCTVFQSPAQQHCFNFPYQLESGNEGDLPSSGQVFIFPVSPGDVIVAG  379

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +EV   V DA+ +G  P+ TAQKIAA+  QRALD  RQTPF+ AAQ AG+
Sbjct  380  TDGLFDNLYNNEVTTAVVDALRAGLGPQVTAQKIAAMTSQRALDENRQTPFSTAAQLAGF  439

Query  136  QYYGGK  119
             Y+GGK
Sbjct  440  SYHGGK  445



>gb|EMT00499.1| Putative protein phosphatase 2C 55 [Aegilops tauschii]
Length=277

 Score =   261 bits (666),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YAR++M  ++ AI  EPKDSID  RVLEKAHS T   GSSTACIIA+ +QG+ AI
Sbjct  75   IDAGQYARDIMSNAVTAIEEEPKDSIDLTRVLEKAHSSTTVPGSSTACIIAITNQGIQAI  134

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIV+RDGCT+  SPVQQH FNF+YQL+SG+ +DLP++ QVF + V SGDVIVAG
Sbjct  135  NLGDSGFIVIRDGCTLCRSPVQQHDFNFSYQLQSGNSSDLPNAAQVFKVPVASGDVIVAG  194

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +++  VV  A  +G  P+ TAQKIAALARQRA D+ R TPF+ AAQ+AGY
Sbjct  195  TDGLFDNLYNNDITAVVVHATRAGLEPQVTAQKIAALARQRAQDKNRPTPFSTAAQDAGY  254

Query  136  QYYGGK  119
            +YYGGK
Sbjct  255  RYYGGK  260



>ref|NP_001051657.1| Os03g0809300 [Oryza sativa Japonica Group]
 gb|AAT77924.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99474.1| 5-azacytidine resistance protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13571.1| Os03g0809300 [Oryza sativa Japonica Group]
Length=479

 Score =   266 bits (681),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YA+ELM  SM AI  EP+ +IDP+RVLEKA++ TKA+GSSTACI+AL  QG+HA+
Sbjct  277  VDAGLYAKELMSNSMSAIKDEPQGTIDPSRVLEKAYTCTKARGSSTACIVALKEQGIHAV  336

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFI+VRDG T+  SPVQQH FNFTYQLESG  +DLPSS Q F   V  GDVI+AG
Sbjct  337  NLGDSGFIIVRDGRTVLRSPVQQHDFNFTYQLESGGGSDLPSSAQTFHFPVAPGDVIIAG  396

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E++ +V +A+ +G  PEATA+KIAALA+Q+A+DR RQ+PFA AAQEAGY
Sbjct  397  TDGLFDNLYSNEISAIVVEALRTGLEPEATAKKIAALAQQKAMDRNRQSPFAAAAQEAGY  456

Query  136  QYYGGK  119
            +Y+GGK
Sbjct  457  RYFGGK  462



>gb|EAY92287.1| hypothetical protein OsI_14009 [Oryza sativa Indica Group]
Length=481

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YA+ELM  SM AI  EP+ +IDP+RVLEKA++ TKA+GSSTACI+AL  QG+HA+
Sbjct  279  VDAGLYAKELMSNSMSAIKDEPQGTIDPSRVLEKAYTCTKARGSSTACIVALKEQGIHAV  338

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFI+VRDG T+  SPVQQH FNFTYQLESG  +DLPSS Q F   V  GDVI+AG
Sbjct  339  NLGDSGFIIVRDGRTVLRSPVQQHDFNFTYQLESGGGSDLPSSAQTFHFPVAPGDVIIAG  398

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E++ +V +A+ +G  PEATA+KIAALA+Q+A+DR RQ+PFA AAQEAGY
Sbjct  399  TDGLFDNLYSNEISAIVVEALRTGLEPEATAKKIAALAQQKAMDRNRQSPFAAAAQEAGY  458

Query  136  QYYGGK  119
            +Y+GGK
Sbjct  459  RYFGGK  464



>gb|EMS60700.1| putative protein phosphatase 2C 55 [Triticum urartu]
Length=356

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YA+ELM  SM AI  EP+ +IDP+RVLEKA + TKA+GSSTACII L  QGLHA+
Sbjct  154  VDAGLYAKELMSKSMSAIKDEPEGAIDPSRVLEKAFTGTKARGSSTACIITLKEQGLHAV  213

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDG T+ +SP QQH FNFTYQLESG  +DLPSS  VF  +V SGDVI+AG
Sbjct  214  NLGDSGFIVVRDGRTVLKSPSQQHDFNFTYQLESGGGSDLPSSADVFHYSVASGDVIIAG  273

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV +A+ SG   + TAQKIAALAR+RA D+ RQ+PFA AAQEAGY
Sbjct  274  TDGLFDNLYDNEITAVVVEALRSGLGAQGTAQKIAALARERAEDKHRQSPFAAAAQEAGY  333

Query  136  QYYGGK  119
            +YYGGK
Sbjct  334  RYYGGK  339



>gb|EMT01244.1| Putative protein phosphatase 2C 55 [Aegilops tauschii]
Length=281

 Score =   259 bits (662),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YA+ELM  SM AI  EP+ +IDP+RVLEKA + TKA+GSSTACII L  QGLHA+
Sbjct  79   VDAGLYAKELMSKSMSAIKDEPEGAIDPSRVLEKAFTGTKARGSSTACIITLKEQGLHAV  138

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDG T+ +SP QQH FNFTYQLESG  +DLPSS  VF  +V  GDVI+AG
Sbjct  139  NLGDSGFIVVRDGRTVLKSPSQQHDFNFTYQLESGGGSDLPSSADVFHYSVAPGDVIIAG  198

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV +A+ SG   + TAQKIAALAR+RA D+ RQ+PFA AAQEAGY
Sbjct  199  TDGLFDNLYDNEITAVVVEALRSGLGAQGTAQKIAALARERAEDKHRQSPFAAAAQEAGY  258

Query  136  QYYGGK  119
            +YYGGK
Sbjct  259  RYYGGK  264



>ref|NP_001130546.1| uncharacterized protein LOC100191645 [Zea mays]
 ref|XP_008669529.1| PREDICTED: uncharacterized protein LOC100191645 isoform X1 [Zea 
mays]
 gb|ACF78805.1| unknown [Zea mays]
 gb|ACN25431.1| unknown [Zea mays]
 gb|ACN27581.1| unknown [Zea mays]
 gb|ACN34217.1| unknown [Zea mays]
 tpg|DAA52105.1| TPA: hypothetical protein ZEAMMB73_937237 [Zea mays]
 tpg|DAA52106.1| TPA: hypothetical protein ZEAMMB73_937237 [Zea mays]
 tpg|DAA52107.1| TPA: hypothetical protein ZEAMMB73_937237 [Zea mays]
Length=466

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YA+ELM  SM AI  EP+ +IDP RVLEKA+  TKA+GSSTACII L  QG+HA+
Sbjct  264  VDAGLYAKELMRNSMSAIKDEPEGTIDPTRVLEKAYISTKARGSSTACIITLKDQGIHAV  323

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDG T+  SP QQH FNFTYQLESG  +DLPSS QVF   V  GDVIVAG
Sbjct  324  NLGDSGFVVVRDGRTVLRSPSQQHDFNFTYQLESGGGSDLPSSAQVFHFPVAPGDVIVAG  383

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E++GV+ +A+  G  P+  AQKIAALARQRA D+ RQ+PFA AAQEAGY
Sbjct  384  TDGLFDNLYNNEISGVIVEALRVGLEPQIAAQKIAALARQRATDKNRQSPFASAAQEAGY  443

Query  136  QYYGGK  119
            +YYGGK
Sbjct  444  RYYGGK  449



>ref|XP_008644409.1| PREDICTED: probable protein phosphatase 2C 80 [Zea mays]
 gb|AFW67259.1| hypothetical protein ZEAMMB73_004391 [Zea mays]
Length=468

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YA+ELM  SM AI  EP+ +IDP RVLEKA+  TKA+GSSTACII L  QG+HA+
Sbjct  269  IDAGLYAKELMRNSMSAIKDEPEGTIDPTRVLEKAYMSTKARGSSTACIITLKDQGIHAV  328

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDG T+  SP QQH FN TYQLESG  +DLPSS QVF   V  GDVIVAG
Sbjct  329  NLGDSGFVVVRDGRTVLRSPSQQHDFNLTYQLESGGGSDLPSSAQVFHFPVAPGDVIVAG  388

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E++GV+ +A+  G  P+  AQKIAALARQRA D+ RQ+PFA AAQEAGY
Sbjct  389  TDGLFDNLYNNEISGVIVEALRVGLEPQVAAQKIAALARQRATDKNRQSPFASAAQEAGY  448

Query  136  QYYGGK  119
            +YYGGK
Sbjct  449  RYYGGK  454



>ref|XP_002463676.1| hypothetical protein SORBIDRAFT_01g004030 [Sorghum bicolor]
 gb|EER90674.1| hypothetical protein SORBIDRAFT_01g004030 [Sorghum bicolor]
Length=466

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YA+ELM  S+ AI  EP+ +IDP RVLEKA+  TKA+GSSTACII L  QG+HA+
Sbjct  267  VDAGLYAKELMRNSLSAIKDEPEGTIDPTRVLEKAYMSTKARGSSTACIITLKDQGIHAV  326

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDG T+  SP QQH FNFTYQLESG  +DLPSS QVF   V  GDVIVAG
Sbjct  327  NLGDSGFVVVRDGRTVLRSPSQQHDFNFTYQLESGGGSDLPSSAQVFHFPVAPGDVIVAG  386

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E++GV+ +A+  G  P+  AQKIAALARQRA D+ RQ+PFA AAQEAGY
Sbjct  387  TDGLFDNLYNNEISGVIVEALRVGLEPQIAAQKIAALARQRATDKNRQSPFASAAQEAGY  446

Query  136  QYYGGK  119
            +YYGGK
Sbjct  447  RYYGGK  452



>dbj|BAJ98946.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=386

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YAR++M  ++ AI  EPKDSID  RVLEKAHS T   GSSTACIIAL  QGL AI
Sbjct  184  IDAGQYARDIMSNAVTAIEEEPKDSIDLTRVLEKAHSSTTVPGSSTACIIALTDQGLQAI  243

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIV+RDGCT+  SPVQQH FNF+YQLESG+  DLP++ QVF + V SGDVIVAG
Sbjct  244  NLGDSGFIVIRDGCTLCRSPVQQHDFNFSYQLESGNSNDLPNAAQVFKVPVASGDVIVAG  303

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +++  VV  A  +G  P+  AQKIAALARQRA D+ RQ+PF+ AAQ+AG+
Sbjct  304  TDGLFDNLYNNDITAVVVHATRAGLEPQVAAQKIAALARQRAQDKNRQSPFSTAAQDAGF  363

Query  136  QYYGGK  119
            +YYGGK
Sbjct  364  RYYGGK  369



>ref|XP_003538844.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Glycine 
max]
 ref|XP_006590679.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Glycine 
max]
 ref|XP_006590680.1| PREDICTED: probable protein phosphatase 2C 55 isoform X3 [Glycine 
max]
 gb|KHN42000.1| Hypothetical protein glysoja_003740 [Glycine soja]
Length=423

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +A+EL+   + AI  EPK S +  RVL +AH+ TK KGSSTACI+AL  +GLHAI
Sbjct  221  VNAGLFAQELISNLVRAIQKEPKGSFNLTRVLREAHANTKVKGSSTACIVALTDKGLHAI  280

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDGCTIFESP QQH FNF YQLESG+ ADLPSSG+VFTI V SGDV+++G
Sbjct  281  NLGDSGFIVVRDGCTIFESPSQQHDFNFPYQLESGNGADLPSSGEVFTIPVASGDVVISG  340

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  E+ GVV  A+ +G  P+ TAQKIAALARQRAL +  +TPF+ AA++AG+
Sbjct  341  TDGLFDNLYNSEITGVVEHAIRAGLEPQVTAQKIAALARQRALSKSSRTPFSTAAEKAGF  400

Query  136  QYYGGK  119
             YYGGK
Sbjct  401  CYYGGK  406



>emb|CDY53852.1| BnaA07g37470D [Brassica napus]
Length=409

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 154/188 (82%), Gaps = 2/188 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPK-DSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHA  500
            +NAG ++RELM YS+ AI    K  SIDP  VLEKAHS+T+A+GSSTACIIAL  +GLHA
Sbjct  208  VNAGLFSRELMSYSVAAIRELAKGSSIDPLMVLEKAHSQTRAQGSSTACIIALTDKGLHA  267

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESG-SRADLPSSGQVFTIAVLSGDVIV  323
            INLGDSGF VVRDG T+F+SPVQQHGFNFTYQL  G S  D+P SGQVF I V +GDVIV
Sbjct  268  INLGDSGFTVVRDGTTVFQSPVQQHGFNFTYQLGCGDSGGDMPRSGQVFMIDVEAGDVIV  327

Query  322  AGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEA  143
            AGTDG++DNLY +++ GVV  +V +G +P+ TAQKIA LAR RALD+KRQ+PFA AAQEA
Sbjct  328  AGTDGVYDNLYNEDITGVVVSSVRAGLDPKGTAQKIADLARARALDKKRQSPFATAAQEA  387

Query  142  GYQYYGGK  119
            GY+YYGGK
Sbjct  388  GYRYYGGK  395



>ref|XP_004512015.1| PREDICTED: probable protein phosphatase 2C 55-like [Cicer arietinum]
Length=437

 Score =   260 bits (665),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +A+EL+  S+ A+  EPK S +P RVLEKAHS TKAKGSSTACI+AL  + L+AI
Sbjct  235  VNAGLFAQELISNSVRAVQEEPKGSFNPLRVLEKAHSNTKAKGSSTACIVALADEALNAI  294

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIV+R G  IF+SPVQQH FNFTYQLESG+  DLPSSG+VFTI V  GDVIVAG
Sbjct  295  NLGDSGFIVIRGGSIIFKSPVQQHDFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVIVAG  354

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +++  VV +A  +   P+ TAQKIAALARQRALD+KR +PF+ AA EAGY
Sbjct  355  TDGLFDNLYNNDITAVVVNATRARLEPQTTAQKIAALARQRALDKKRPSPFSAAALEAGY  414

Query  136  QYYGGK  119
            +YYGGK
Sbjct  415  RYYGGK  420



>emb|CDY30759.1| BnaC07g16590D [Brassica napus]
Length=410

 Score =   259 bits (663),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 154/188 (82%), Gaps = 2/188 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPK-DSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHA  500
            +NAG ++RELM YS+ AI    K  SIDP  VLEKAHS+T+A+GSSTACIIAL  +GLHA
Sbjct  209  VNAGLFSRELMSYSVAAIRELAKGSSIDPLMVLEKAHSQTRAQGSSTACIIALTDKGLHA  268

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESG-SRADLPSSGQVFTIAVLSGDVIV  323
            INLGDSGF VVRDG T+F+SPVQQHGFNFTYQL  G S  D+P SGQVF I V +GDVIV
Sbjct  269  INLGDSGFTVVRDGTTVFQSPVQQHGFNFTYQLGCGDSGGDMPHSGQVFMIDVEAGDVIV  328

Query  322  AGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEA  143
            AGTDG++DNLY +++ GVV  +V +G +P+ TAQKIA LAR RA+D+KRQ+PFA AAQEA
Sbjct  329  AGTDGVYDNLYNEDITGVVVSSVRAGLDPKGTAQKIADLARARAVDKKRQSPFATAAQEA  388

Query  142  GYQYYGGK  119
            GY+YYGGK
Sbjct  389  GYRYYGGK  396



>ref|XP_009103494.1| PREDICTED: probable protein phosphatase 2C 80 [Brassica rapa]
 ref|XP_009103495.1| PREDICTED: probable protein phosphatase 2C 80 [Brassica rapa]
Length=409

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 154/188 (82%), Gaps = 2/188 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPK-DSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHA  500
            +NAG ++RELM YS+ AI    K  SIDP  VLEKAHS+T+A+GSSTACIIAL  +GLHA
Sbjct  208  VNAGLFSRELMSYSVAAIRELAKGSSIDPLMVLEKAHSQTRAQGSSTACIIALTDKGLHA  267

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESG-SRADLPSSGQVFTIAVLSGDVIV  323
            INLGDSGF VVRDG T+F+SPVQQHGFNFTYQL  G S  D+P SGQVF I V +GDVIV
Sbjct  268  INLGDSGFTVVRDGTTVFQSPVQQHGFNFTYQLGCGDSGGDMPRSGQVFMIDVEAGDVIV  327

Query  322  AGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEA  143
            AGTDG++DNLY +++ GVV  +V +G +P+ TAQKIA LAR RA+D+KRQ+PFA AAQEA
Sbjct  328  AGTDGVYDNLYNEDITGVVVSSVRAGLDPKGTAQKIADLARARAVDKKRQSPFATAAQEA  387

Query  142  GYQYYGGK  119
            GY+YYGGK
Sbjct  388  GYRYYGGK  395



>ref|XP_004981332.1| PREDICTED: uncharacterized protein LOC101762678 [Setaria italica]
Length=716

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YA+ELM  SM AI  EP+ +IDP+RVLEKA++ TKA+GSSTACII L  QG+HA+
Sbjct  266  VDAGLYAKELMRNSMSAIKDEPEGTIDPSRVLEKAYTSTKARGSSTACIITLKDQGIHAV  325

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDG T+  SP QQH FNFTYQLESG  +DLPSS QVF   V  GDVIVAG
Sbjct  326  NLGDSGFVVVRDGRTVLRSPSQQHDFNFTYQLESGGGSDLPSSAQVFHFPVAPGDVIVAG  385

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E++GV+ +A+  G  P+  AQKIAALARQRA D+ RQ+PFA AAQEAGY
Sbjct  386  TDGLFDNLYNNEISGVIVEALRVGLEPQIAAQKIAALARQRATDKNRQSPFASAAQEAGY  445

Query  136  QYYGGK  119
            +YYGGK
Sbjct  446  RYYGGK  451



>dbj|BAJ91094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YA+ELM  S+ AI  EP+ +IDP+RVLEKA + TKA+GSSTACII L  QGLHA+
Sbjct  277  VDAGLYAKELMSKSISAIKDEPEGAIDPSRVLEKAFTGTKARGSSTACIITLKEQGLHAV  336

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDG T+ +SP QQH FNFTYQLESG  +DLPSS  VF  +V  GDVI+AG
Sbjct  337  NLGDSGFIVVRDGRTVLKSPSQQHDFNFTYQLESGGGSDLPSSADVFHYSVAPGDVIIAG  396

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV +A+ SG   + TAQKIAALAR+RALD+ RQ+PFA AAQEAGY
Sbjct  397  TDGLFDNLYDNEITAVVVEALRSGLGAQGTAQKIAALARERALDKHRQSPFAAAAQEAGY  456

Query  136  QYYGGK  119
            +YYGGK
Sbjct  457  RYYGGK  462



>ref|XP_003564015.1| PREDICTED: probable protein phosphatase 2C 55 [Brachypodium distachyon]
Length=474

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YA+ELM  S+ AI  EP+ +IDP+RVLEKA   TKA+GSSTACIIAL  QG+HA+
Sbjct  272  VDAGLYAKELMSKSIGAIKDEPEGAIDPSRVLEKAFISTKARGSSTACIIALTEQGIHAV  331

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDG T+  SP QQH FNFTYQLESG  +DLPSS +VF   V +GDVI+AG
Sbjct  332  NLGDSGFIVVRDGRTVLRSPSQQHDFNFTYQLESGGGSDLPSSAEVFRYPVATGDVIIAG  391

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  +V +A  +G   +ATAQKIAALAR+RALD+ RQ+PFA AAQEAGY
Sbjct  392  TDGLFDNLYTNEITTIVVEAARAGLGAQATAQKIAALARERALDKNRQSPFAAAAQEAGY  451

Query  136  QYYGGK  119
            ++YGGK
Sbjct  452  RFYGGK  457



>ref|XP_010680832.1| PREDICTED: probable protein phosphatase 2C 80 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010680833.1| PREDICTED: probable protein phosphatase 2C 80 [Beta vulgaris 
subsp. vulgaris]
Length=455

 Score =   258 bits (660),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YAR LM  SM AIL + KD +DPA++LEKAH+ TK  GSSTACIIAL +QG+HAI
Sbjct  253  VDAGVYARLLMSNSMTAILEDSKDGVDPAKILEKAHADTKVIGSSTACIIALTNQGIHAI  312

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIV+RDG T+F SPVQQ+GFNF YQL SG+  DLPSSGQVFT  V SGDV+VAG
Sbjct  313  NLGDSGFIVIRDGSTVFRSPVQQYGFNFPYQLASGTGGDLPSSGQVFTFPVASGDVVVAG  372

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  +V  A  SG  P+ATA+ IA+LA+QRA DR RQ+PFA AA +AG+
Sbjct  373  TDGLFDNLYDNEITALVVQAKRSGLEPQATARNIASLAQQRAQDRHRQSPFAAAAHDAGF  432

Query  136  QYYGGK  119
            +Y GGK
Sbjct  433  RYIGGK  438



>ref|XP_006341911.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Solanum tuberosum]
 ref|XP_006341912.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Solanum tuberosum]
Length=393

 Score =   256 bits (655),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG+Y+RELM  ++ AI  EPK S+DPARVLEKA++ T+AKGSSTACIIAL  QGLHAI
Sbjct  186  VDAGEYSRELMANAVMAIREEPKGSVDPARVLEKAYTLTRAKGSSTACIIALTDQGLHAI  245

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLES-GSRADLPSSGQVFTIAVLSGDVIVA  320
            NLGDSGF+V+RDGCT+ +SPVQQH FNFTYQLES G+  D P+SG+VF I V  GDVI+A
Sbjct  246  NLGDSGFMVIRDGCTVLKSPVQQHDFNFTYQLESGGTGGDSPTSGEVFKIPVAPGDVIIA  305

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDGLFDNLY  ++  VV  A  +   P+  AQKIAALAR+RALD+ RQ+PF+ AAQ+AG
Sbjct  306  GTDGLFDNLYTSDITAVVVHARRAHLPPQVVAQKIAALARERALDKNRQSPFSTAAQDAG  365

Query  139  YQYYGGK  119
             ++YGGK
Sbjct  366  IRFYGGK  372



>ref|XP_004238238.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
 ref|XP_010320377.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
 ref|XP_010320378.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
Length=393

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG+Y+RELM  ++ AI  EPK S+DPARVLEKA++ T+AKGSSTACIIAL  QGLHAI
Sbjct  186  VDAGEYSRELMANAVMAIREEPKGSVDPARVLEKAYTLTRAKGSSTACIIALTDQGLHAI  245

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLES-GSRADLPSSGQVFTIAVLSGDVIVA  320
            NLGDSGF+V+RDGCT+ +SPVQQH FNFTYQLES G+  D P+SG+VF I V  GDVI+A
Sbjct  246  NLGDSGFMVIRDGCTVLKSPVQQHDFNFTYQLESGGTGGDSPTSGEVFKIPVAPGDVIIA  305

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDGLFDNLY  ++  VV  A  +   P+  AQKIAALAR+RALD+ RQ+PF+ AAQ+AG
Sbjct  306  GTDGLFDNLYTSDITAVVVHARRAHLPPQVVAQKIAALARERALDKNRQSPFSAAAQDAG  365

Query  139  YQYYGGK  119
             ++YGGK
Sbjct  366  IRFYGGK  372



>gb|EYU44672.1| hypothetical protein MIMGU_mgv1a007071mg [Erythranthe guttata]
Length=420

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG YARELM  S+ AI       +DP  VLEKAH++T A GSSTACII L +Q LHAI
Sbjct  222  VNAGIYARELMSNSVKAIRENTDSDVDPLLVLEKAHARTNAMGSSTACIICLRNQDLHAI  281

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF +VRDG  IFESPVQQHGFNFT+QLE G+  D+PSSGQVF I V++GDVIVAG
Sbjct  282  NLGDSGFTIVRDGQIIFESPVQQHGFNFTFQLERGNTGDMPSSGQVFKIPVVAGDVIVAG  341

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            +DGLFDNLY  E+A +V D+V     P+ TA+KIA +AR RALDRK +TPF+ AAQEAGY
Sbjct  342  SDGLFDNLYNKEIAAIVGDSVRDCVGPDETAKKIADVARARALDRKHRTPFSTAAQEAGY  401

Query  136  QYYGGK  119
             YYGGK
Sbjct  402  AYYGGK  407



>gb|EEE60152.1| hypothetical protein OsJ_13054 [Oryza sativa Japonica Group]
Length=1379

 Score =   269 bits (688),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  676   INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
             ++AG YA+ELM  SM AI  EP+ +IDP+RVLEKA++ TKA+GSSTACI+AL  QG+HA+
Sbjct  1177  VDAGLYAKELMSNSMSAIKDEPQGTIDPSRVLEKAYTCTKARGSSTACIVALKEQGIHAV  1236

Query  496   NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
             NLGDSGFI+VRDG T+  SPVQQH FNFTYQLESG  +DLPSS Q F   V  GDVI+AG
Sbjct  1237  NLGDSGFIIVRDGRTVLRSPVQQHDFNFTYQLESGGGSDLPSSAQTFHFPVAPGDVIIAG  1296

Query  316   TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
             TDGLFDNLY +E++ +V +A+ +G  PEATA+KIAALA+Q+A+DR RQ+PFA AAQEAGY
Sbjct  1297  TDGLFDNLYSNEISAIVVEALRTGLEPEATAKKIAALAQQKAMDRNRQSPFAAAAQEAGY  1356

Query  136   QYYGGK  119
             +Y+GGK
Sbjct  1357  RYFGGK  1362



>ref|XP_009764148.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
 ref|XP_009764149.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
 ref|XP_009764150.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
Length=378

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG+YARELM  S+ AI  EPKDSID  +VLEKAH +T A+GSSTACIIAL  +GL A+
Sbjct  176  IDAGEYARELMSNSISAIQEEPKDSIDLIKVLEKAHMRTNARGSSTACIIALADEGLIAV  235

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF++VRDG  IF+SP Q H FNF YQLE  S  DLPS  +VF IAV  GDV++AG
Sbjct  236  NLGDSGFMLVRDGSAIFKSPAQLHSFNFPYQLEGSSAGDLPSLAEVFKIAVAPGDVVIAG  295

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  ++ GVV  AV SG  PE TAQKIAALA+QRA+D  + +PF+DAA+EAG+
Sbjct  296  TDGLFDNLYDTDITGVVVHAVESGLEPETTAQKIAALAQQRAMDPTKPSPFSDAAKEAGF  355

Query  136  QYYGGK  119
            +Y+GGK
Sbjct  356  EYHGGK  361



>gb|AES94920.2| protein phosphatase 2C family protein [Medicago truncatula]
Length=450

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 147/187 (79%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG YA+EL+  S  AI  EPK S +P RVLEKAHSKTKA GSST CIIAL  + L+AI
Sbjct  247  VNAGLYAQELVANSARAIREEPKGSFNPVRVLEKAHSKTKAMGSSTVCIIALIDEALNAI  306

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQL-ESGSRADLPSSGQVFTIAVLSGDVIVA  320
            NLGDSGFIV+RDG  IF+SPVQQ GFNF YQL  SG+  DLPSSG+VFT+ V  GD+IVA
Sbjct  307  NLGDSGFIVIRDGSVIFKSPVQQRGFNFPYQLARSGTEGDLPSSGEVFTVPVAPGDIIVA  366

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDGLFDN+Y +++ GVV  A  +   P+ATAQKIAALARQRALD KRQ+PF+ AA E G
Sbjct  367  GTDGLFDNMYNNDIVGVVVGATRARLGPQATAQKIAALARQRALDTKRQSPFSAAALEYG  426

Query  139  YQYYGGK  119
            Y++ GGK
Sbjct  427  YRFDGGK  433



>ref|XP_010070043.1| PREDICTED: probable protein phosphatase 2C 80 [Eucalyptus grandis]
 gb|KCW58599.1| hypothetical protein EUGRSUZ_H01259 [Eucalyptus grandis]
Length=437

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+RELM+ S+ AI  E + S+DPA VLEKAH+ TKAKGSSTACIIAL  +G+HAI
Sbjct  235  VDAGLYSRELMFNSISAIKEETEGSVDPAIVLEKAHANTKAKGSSTACIIALKGEGIHAI  294

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIVVRDG TIF SPVQQHGFNFTYQLE+G   DLPSSGQVF I V  GD IVAG
Sbjct  295  NLGDSGFIVVRDGKTIFRSPVQQHGFNFTYQLENGRNGDLPSSGQVFRIPVSDGDGIVAG  354

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY DEV+ +V +AV SG +P+A A+KIAA ARQRALDR RQTPFAD+AQEAGY
Sbjct  355  TDGLFDNLYDDEVSALVAEAVKSGLDPQAMARKIAAAARQRALDRYRQTPFADSAQEAGY  414

Query  136  QYYGGK  119
            +Y+GGK
Sbjct  415  RYHGGK  420



>ref|XP_003611962.1| Mitochondrial catalytic protein [Medicago truncatula]
 ref|XP_003636283.1| Mitochondrial catalytic protein [Medicago truncatula]
Length=452

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 147/189 (78%), Gaps = 3/189 (2%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIAL--NSQGLH  503
            +NAG YA+EL+  S  AI  EPK S +P RVLEKAHSKTKA GSST CIIAL    + L+
Sbjct  247  VNAGLYAQELVANSARAIREEPKGSFNPVRVLEKAHSKTKAMGSSTVCIIALIDEVKALN  306

Query  502  AINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQL-ESGSRADLPSSGQVFTIAVLSGDVI  326
            AINLGDSGFIV+RDG  IF+SPVQQ GFNF YQL  SG+  DLPSSG+VFT+ V  GD+I
Sbjct  307  AINLGDSGFIVIRDGSVIFKSPVQQRGFNFPYQLARSGTEGDLPSSGEVFTVPVAPGDII  366

Query  325  VAGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQE  146
            VAGTDGLFDN+Y +++ GVV  A  +   P+ATAQKIAALARQRALD KRQ+PF+ AA E
Sbjct  367  VAGTDGLFDNMYNNDIVGVVVGATRARLGPQATAQKIAALARQRALDTKRQSPFSAAALE  426

Query  145  AGYQYYGGK  119
             GY++ GGK
Sbjct  427  YGYRFDGGK  435



>ref|XP_001758147.1| predicted protein [Physcomitrella patens]
 gb|EDQ76969.1| predicted protein, partial [Physcomitrella patens]
Length=256

 Score =   237 bits (605),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 148/186 (80%), Gaps = 1/186 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AGDYARELM  S  A+  EP   IDPARV+ +AH++TK  GSSTACI+AL+  GL A 
Sbjct  47   VDAGDYARELMLQSRIAVAQEPHGYIDPARVMFRAHARTKCPGSSTACILALSDYGLQAA  106

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+++R+G T+F+SPVQQH FN  +QLESG  +D PS+ +VF++ V +GDV+VAG
Sbjct  107  NLGDSGFMLMRNGRTVFKSPVQQHQFNIPFQLESGG-SDPPSAAEVFSLQVAAGDVLVAG  165

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+ GVV  +  +G +P+ TA+KI ALAR+RA DR RQTPF+ AAQEAG+
Sbjct  166  TDGLFDNLYDNELVGVVIHSTRAGLDPQVTAEKIVALARERAEDRNRQTPFSTAAQEAGF  225

Query  136  QYYGGK  119
            ++YGGK
Sbjct  226  RFYGGK  231



>ref|XP_004251474.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
Length=377

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 142/186 (76%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG+YARELM   M  I  EPKDS+D  RVLEKA+ +TKAKGSSTACI+AL  + L+A+
Sbjct  172  IDAGEYARELMSNCMSVIQEEPKDSVDLIRVLEKAYMRTKAKGSSTACIVALTDEDLYAV  231

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF++VR G  IF+SPVQQHGFNF YQLE  +  D PS  Q F I V  GDV+V G
Sbjct  232  NLGDSGFMLVRHGSAIFKSPVQQHGFNFPYQLEGSTAGDSPSLAQAFKITVAPGDVLVVG  291

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  ++  VV  AV +G  P+ TA+KIAALA+QRA+D  + +PF+DAA+EAG+
Sbjct  292  TDGLFDNLYDADITEVVIHAVEAGFGPQMTAKKIAALAQQRAMDTTKPSPFSDAAKEAGF  351

Query  136  QYYGGK  119
            +Y GGK
Sbjct  352  EYQGGK  357



>gb|EPS61381.1| hypothetical protein M569_13414, partial [Genlisea aurea]
Length=274

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 141/189 (75%), Gaps = 3/189 (2%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG+Y+R LM  S+ AI     D ID   VLEKAHS+T   GSSTACII+L +Q +HAI
Sbjct  72   IDAGEYSRGLMRNSVQAIREALPDDIDLLSVLEKAHSRTNFSGSSTACIISLKNQDVHAI  131

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFI+VR+G T+FESPVQQHGFNF YQLE     DLPSS QVF I V +GDVIVAG
Sbjct  132  NLGDSGFIIVRNGETVFESPVQQHGFNFPYQLERSKMGDLPSSAQVFKIPVEAGDVIVAG  191

Query  316  TDGLFDNLYKDEVAGVVRDAV---NSGCNPEATAQKIAALARQRALDRKRQTPFADAAQE  146
            +DGLFDNLY  E+A ++         G +PEATA+KIA  AR+RALD K +TPF+ AAQ+
Sbjct  192  SDGLFDNLYSREIAAIIVGEAAKGEEGLSPEATAEKIAWFARERALDTKSETPFSVAAQQ  251

Query  145  AGYQYYGGK  119
            AG+ YYGGK
Sbjct  252  AGFTYYGGK  260



>ref|XP_009610356.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
 ref|XP_009610357.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
Length=377

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S+ AI  EPK SID  R L+KA+ +TKAKGSSTACI+AL  +GL+A+
Sbjct  175  IDAGLYARELMSNSLAAIQEEPKGSIDLIRALDKAYVRTKAKGSSTACIVALTDEGLYAV  234

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF++VR G   F+SP QQHGFNF YQL+  +  D PSS  VF IAV  GDV++AG
Sbjct  235  NLGDSGFMLVRHGYAAFKSPAQQHGFNFPYQLDCNNAGDSPSSAMVFKIAVAPGDVLIAG  294

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +++ GVV  +V +G  P+ TAQ+IA LA+QRA+D K+ +PF+D AQEAG+
Sbjct  295  TDGLFDNLYDEDIKGVVLQSVEAGLGPQMTAQRIAELAQQRAMDPKKSSPFSDGAQEAGF  354

Query  136  QYYGGK  119
            +Y+GGK
Sbjct  355  EYHGGK  360



>ref|XP_006366049.1| PREDICTED: probable protein phosphatase 2C 55-like [Solanum tuberosum]
Length=373

 Score =   238 bits (606),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM +S+ AI  EPK S+D  RVLEKA+ +TKAKGSSTACI+AL   GL+A+
Sbjct  175  IDAGLYARELMSHSLSAIQDEPKGSVDLIRVLEKAYVRTKAKGSSTACIVALTEGGLYAV  234

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF++VR+GC  F+SP QQHGFNF YQL+  +  D PSS  VF I V+ GDV++ G
Sbjct  235  NLGDSGFMLVRNGCAAFKSPSQQHGFNFPYQLDCNNAGDSPSSAMVFNITVVPGDVLIVG  294

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY ++++GVV  A+ +G  P+ TAQ+IA LA+ RA+D  + +PF+D A+E+G+
Sbjct  295  TDGLFDNLYDEDISGVVFQAMEAGLGPQMTAQRIAELAQLRAMDHTKSSPFSDGARESGF  354

Query  136  QYYGGK  119
             Y+GGK
Sbjct  355  DYHGGK  360



>ref|XP_002974846.1| hypothetical protein SELMODRAFT_101879, partial [Selaginella 
moellendorffii]
 gb|EFJ24366.1| hypothetical protein SELMODRAFT_101879, partial [Selaginella 
moellendorffii]
Length=249

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 141/186 (76%), Gaps = 1/186 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S+ A   EP   +DP R+L +AHSKTK KGSSTACI+AL+  GL A 
Sbjct  50   VDAGQYARELMVQSIIAAQQEPHGLVDPVRILVRAHSKTKCKGSSTACILALSDNGLQAA  109

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIV+R+G T+F+SPVQQH FN  YQLE G  +D P+  QVF++ V +GDVIV G
Sbjct  110  NLGDSGFIVLRNGKTVFKSPVQQHLFNIPYQLEHGG-SDPPTCAQVFSVQVAAGDVIVVG  168

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDN+Y  EVA VV  +  SG  P+ TA+K+A LAR  ALDR RQTPFA AAQ+AGY
Sbjct  169  TDGLFDNVYDTEVASVVVHSTRSGFGPQLTAEKLATLARSSALDRNRQTPFAAAAQDAGY  228

Query  136  QYYGGK  119
            +++GGK
Sbjct  229  RFHGGK  234



>ref|XP_002963762.1| hypothetical protein SELMODRAFT_79882, partial [Selaginella moellendorffii]
 gb|EFJ35633.1| hypothetical protein SELMODRAFT_79882, partial [Selaginella moellendorffii]
Length=249

 Score =   231 bits (589),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 141/186 (76%), Gaps = 1/186 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S+ A   EP   +DP R+L +AHSKTK KGSSTACI+AL+  GL A 
Sbjct  50   VDAGQYARELMVQSIIAAQQEPHGLVDPVRILVRAHSKTKCKGSSTACILALSDNGLQAA  109

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGFIV+R+G T+F+SPVQQH FN  YQLE G  +D P+  QVF++ V +GDVIV G
Sbjct  110  NLGDSGFIVLRNGKTVFKSPVQQHLFNIPYQLEHGG-SDPPTCAQVFSVQVAAGDVIVVG  168

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDN+Y  EVA VV  +  SG  P+ TA+K+A LA+  ALDR RQTPFA AAQ+AGY
Sbjct  169  TDGLFDNVYDTEVASVVVHSTRSGFGPQLTAEKLATLAKASALDRNRQTPFAAAAQDAGY  228

Query  136  QYYGGK  119
            +++GGK
Sbjct  229  RFHGGK  234



>ref|XP_009760583.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
 ref|XP_009760585.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
Length=377

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 144/186 (77%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S+ AI  EPK SID  R L+KA+ KTKAKGSSTACI+AL  +GL+A+
Sbjct  175  IDAGLYARELMSNSLAAIQEEPKGSIDLIRALDKAYVKTKAKGSSTACIVALTEEGLYAV  234

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF++VR G   F+SP QQHGFNF YQL+  +  D PSS  VF IAV  GDV++AG
Sbjct  235  NLGDSGFMLVRHGYAAFKSPAQQHGFNFPYQLDCNNAGDSPSSAMVFKIAVAPGDVLIAG  294

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +++ GVV  +V +G  P+ TA++IA LA+QRA+D  + +PF+D AQEAG+
Sbjct  295  TDGLFDNLYDEDIKGVVLQSVEAGLGPQMTARRIAELAQQRAMDPIKSSPFSDGAQEAGF  354

Query  136  QYYGGK  119
            +Y+GGK
Sbjct  355  EYHGGK  360



>ref|XP_009600510.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
 ref|XP_009600511.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
Length=377

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S+ AI  EPK SID  R L+KA+ +TKAKGSSTACI+AL  +GL+A+
Sbjct  175  IDAGLYARELMSNSLAAIQEEPKGSIDLIRALDKAYVRTKAKGSSTACIVALTDEGLYAV  234

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF++VR G   F+SP QQHGFNF YQL+  +  D PSS  VF IAV  GDV++AG
Sbjct  235  NLGDSGFMLVRHGYATFKSPAQQHGFNFPYQLDCNNAGDSPSSAMVFKIAVAPGDVLIAG  294

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +++  VV  +V +G  P+ TAQ+IA LA+QRA+D  + +PF+D AQEAG+
Sbjct  295  TDGLFDNLYDEDIKVVVLQSVEAGLGPQMTAQRIAELAQQRAMDTNKSSPFSDGAQEAGF  354

Query  136  QYYGGK  119
            +Y+GGK
Sbjct  355  EYHGGK  360



>ref|XP_004244138.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
Length=373

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 142/186 (76%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM +S+ AI  EPK S+D  RVLEKA+ +TKAKGS TACI+AL   GL+A+
Sbjct  175  IDAGLYARELMSHSLSAIQDEPKGSVDLIRVLEKAYVRTKAKGSCTACIVALTEGGLYAV  234

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF++VR+GC  F+SP QQHGFNF YQL+  +  D PSS  VF I  L GDV++ G
Sbjct  235  NLGDSGFMLVRNGCAAFKSPSQQHGFNFPYQLDCNNAGDSPSSAMVFKITALPGDVLIVG  294

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY ++++GVV  A+  G  P+ TAQ+IA LA+ RA+D  + +PF+D A+EAG+
Sbjct  295  TDGLFDNLYDEDISGVVFQAMEDGLAPQMTAQRIAELAQLRAMDHIKSSPFSDGAREAGF  354

Query  136  QYYGGK  119
             Y+GGK
Sbjct  355  DYHGGK  360



>ref|XP_006366044.1| PREDICTED: probable protein phosphatase 2C 55-like [Solanum tuberosum]
Length=373

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 142/186 (76%), Gaps = 0/186 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM +S+ AI  EPK S+D  RVLEKA+ +TKAKGSSTACI+AL   GL+A+
Sbjct  175  IDAGLYARELMSHSLSAIKDEPKGSVDLIRVLEKAYVRTKAKGSSTACIVALTEGGLYAV  234

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF++VR+GC  F+SP QQHGFNF YQL+  +  D PSS  VF I  L GDV++  
Sbjct  235  NLGDSGFMLVRNGCAAFKSPSQQHGFNFPYQLDCSNTGDSPSSTMVFKITALPGDVLIVS  294

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY + ++GVV  A+ +G  P+ TAQ+IA LA+ RA+D  + +PF+D A+EAG+
Sbjct  295  TDGLFDNLYDEYISGVVFQAMEAGLGPQMTAQRIAELAQLRAMDHTKSSPFSDGAREAGF  354

Query  136  QYYGGK  119
             Y+GGK
Sbjct  355  DYHGGK  360



>gb|KHN36141.1| Hypothetical protein glysoja_003264 [Glycine soja]
Length=415

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 132/186 (71%), Gaps = 23/186 (12%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG +A EL+  S+ AI  EPK S +P RVLEKAH+ TK               GLHAI
Sbjct  236  VNAGLFAPELISNSVRAIQKEPKGSFNPTRVLEKAHANTK---------------GLHAI  280

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NL DSGFIVVRDG TIFE PVQQH FNF YQLESG+ ADLPSSG+VFTI V SGD ++AG
Sbjct  281  NLSDSGFIVVRDGLTIFEFPVQQHDFNFPYQLESGNGADLPSSGEVFTIPVASGDAVIAG  340

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY  E+ GVV  A+         AQKIAALARQRAL +  +TPF+ AAQ+AG+
Sbjct  341  TDGLFDNLYNSEITGVVVHAIR--------AQKIAALARQRALSKSSRTPFSTAAQKAGF  392

Query  136  QYYGGK  119
             YYGGK
Sbjct  393  CYYGGK  398



>ref|XP_011026862.1| PREDICTED: probable protein phosphatase 2C 80 [Populus euphratica]
Length=290

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 130/188 (69%), Gaps = 2/188 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILH-EPKDSIDPARVLEKAHSKTKAKGSSTACIIALNS-QGLH  503
            I+AG+YAR+LM  +  A+++ +P+  +DP +VL+ A+SKTK KGSSTACI+ L+  +GL 
Sbjct  87   IDAGEYARQLMSNAECAVVNGDPESKVDPTKVLDAAYSKTKVKGSSTACILTLDQDEGLT  146

Query  502  AINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIV  323
             +N+GDSGF+V+R G  +++S +QQ+ FN+ YQL+   R+  PS  QV T+ V +GDVIV
Sbjct  147  TVNMGDSGFLVIRKGGDVYKSAIQQYSFNYPYQLQDNDRSRTPSGAQVTTLPVEAGDVIV  206

Query  322  AGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEA  143
            AGTDGLFDNLY  ++  +VR  +  G +P+  A  +A  A   ++DR+  TPF + + EA
Sbjct  207  AGTDGLFDNLYPRQIEELVRTMIEGGSDPQDVAWAVAGQAYCASMDREAFTPFTEGSLEA  266

Query  142  GYQYYGGK  119
            G    GGK
Sbjct  267  GKSSVGGK  274



>ref|XP_007040568.1| Phosphatase 2C family protein, putative [Theobroma cacao]
 gb|EOY25069.1| Phosphatase 2C family protein, putative [Theobroma cacao]
Length=258

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 121/187 (65%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQG-LHA  500
            ++AG YARELM  S+ AIL +P   +DP  VL +A  KTKA+GSST CII L     LHA
Sbjct  58   VDAGLYARELMNNSLLAILTQPDRQVDPMEVLNEAFRKTKAEGSSTVCIITLQEDNILHA  117

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            +N+GDSGF+++R G  +++SP+QQH FN+ YQL + + +D P   QV  +AV  GDVI+A
Sbjct  118  VNMGDSGFMLIRQGAAVYKSPIQQHSFNYPYQLGNSANSDKPWQAQVIKLAVEPGDVIIA  177

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDGLFDNL +  +       +  G +PE  A  +A  A   +LDR+  TP+  A+  AG
Sbjct  178  GTDGLFDNLSESLILEAAAAGIELGLDPEEVAWPVAQQAYNISLDREAVTPYVQASMMAG  237

Query  139  YQYYGGK  119
             ++ GGK
Sbjct  238  QRHTGGK  244



>gb|KJB14506.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
Length=456

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+RELM  S+ AI  EPK SIDPARVLEKAHS TKAKGSSTACIIAL  QGLHAI
Sbjct  305  VDAGLYSRELMSNSVSAIQEEPKGSIDPARVLEKAHSSTKAKGSSTACIIALTDQGLHAI  364

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQV  359
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLESGS  DLPSSGQV
Sbjct  365  NLGDSGFMVVRDGCTIFRSPVQQHDFNFTYQLESGSNGDLPSSGQV  410



>emb|CDP04031.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 125/188 (66%), Gaps = 4/188 (2%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YAR+LM  S  A   EP  +++P RV+++A+S TKA GSSTACII L+   L A 
Sbjct  175  IDAGKYARDLMKNSRVAAESEPNGAVNPKRVMQEAYSNTKAPGSSTACIITLSGNALRAA  234

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            N+GDSGFIVVRDG  +++SPVQQH FN  YQL  G+  D PS  Q   I V  GD++VAG
Sbjct  235  NVGDSGFIVVRDGKVVYQSPVQQHHFNCPYQL--GNSKDDPSLAQELQIEVQKGDIVVAG  292

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDR-KRQTPFADAAQEAG  140
            TDG+FDNL+  E+  V++ + N G  P+  A  IA LA   + DR    TPFA  ++EAG
Sbjct  293  TDGVFDNLHGFEIEEVIKSSSNKGDKPDYMACTIANLALYNSFDRYAADTPFARKSREAG  352

Query  139  YQYY-GGK  119
            + ++ GGK
Sbjct  353  HSHHKGGK  360



>ref|XP_011075613.1| PREDICTED: probable protein phosphatase 2C 55 [Sesamum indicum]
Length=259

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 122/186 (66%), Gaps = 1/186 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG+YARELM  + +A+       +DP  VL  A  KT A GSSTACII+++   L A 
Sbjct  56   IDAGEYARELMRNAAEAVHGRHPTDVDPKDVLIDAFLKTGAPGSSTACIISISGGRLRAA  115

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+V+R G T+++SP QQHGFN+ YQ+ S S ADLP   +   +AV  GD+++A 
Sbjct  116  NLGDSGFLVIRGGKTVYKSPAQQHGFNYPYQMGSKS-ADLPDEAEEMVMAVERGDIVIAA  174

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNL+ +++   V   +     PE  A  +A  AR+++L+ +  +PF  AA EAG 
Sbjct  175  TDGLFDNLFPEDIEETVELCLKKESLPEVVACTLARAAREKSLEERTASPFEVAAYEAGV  234

Query  136  QYYGGK  119
            +++GGK
Sbjct  235  EHFGGK  240



>ref|XP_005846774.1| hypothetical protein CHLNCDRAFT_24539 [Chlorella variabilis]
 gb|EFN54672.1| hypothetical protein CHLNCDRAFT_24539 [Chlorella variabilis]
Length=267

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 119/187 (64%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++ G Y+RELM ++  A          P  ++E A+  T A+GSSTACI+ L ++ LHA 
Sbjct  62   VDPGLYSRELMSHAKKAATTCEPGPNAPQHLMEVAYLSTLARGSSTACILCLENERLHAS  121

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESG-SRADLPSSGQVFTIAVLSGDVIVA  320
            NLGDSGF+V+RDG  +F SP QQH FNF YQ+ S  S +D P   + F++ V  GD++VA
Sbjct  122  NLGDSGFMVIRDGELVFMSPQQQHEFNFPYQIGSADSMSDTPQVARRFSVEVRQGDIVVA  181

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
             TDGLFDN+Y DE A +V  +   G N +A A  +A  AR RA D    +PFA  AQ+ G
Sbjct  182  ATDGLFDNVYPDEAASLVSASKERGENAQAVAVTLAQFARMRAADPTHLSPFAYGAQQLG  241

Query  139  YQYYGGK  119
            Y+Y+GGK
Sbjct  242  YRYFGGK  248



>gb|ABD93533.1| mitochondrial catalytic protein [Petunia axillaris subsp. parodii]
Length=139

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S+ AI  EPK S+DPARVL+KA++ TKAKGSSTACIIAL  QGLHAI
Sbjct  36   IDAGKYARELMSNSVAAIQDEPKGSVDPARVLDKAYTCTKAKGSSTACIIALTDQGLHAI  95

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSG  365
            NLGDSGFIVVRDG T+F SPVQQH FNFTYQLESG+  DLPSSG
Sbjct  96   NLGDSGFIVVRDGSTVFRSPVQQHDFNFTYQLESGNAGDLPSSG  139



>gb|ABD93536.1| mitochondrial catalytic protein [Solanum tuberosum]
Length=138

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S+ AI  EPK S+DPARVL+KA++ TKAKGSSTACIIAL  QGLHA+
Sbjct  35   IDAGKYARELMSNSVAAIQDEPKGSVDPARVLDKAYTCTKAKGSSTACIIALTDQGLHAV  94

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSG  365
            NLGDSGFIVVRDG T+F SPVQQH FNFTYQLESG+  DLPSSG
Sbjct  95   NLGDSGFIVVRDGSTVFRSPVQQHDFNFTYQLESGNAGDLPSSG  138



>ref|XP_010936938.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Elaeis 
guineensis]
Length=404

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S +AI  EPK SIDPARVLEKA+S TKAKGSSTACIIAL  QGLHA+
Sbjct  296  VDAGQYARELMSNSANAIREEPKGSIDPARVLEKAYSSTKAKGSSTACIIALTDQGLHAV  355

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTI  350
            NLGDSGF+VVRDGCTIF SPVQQH FNFTYQLESGS +DLPS  Q   +
Sbjct  356  NLGDSGFVVVRDGCTIFRSPVQQHDFNFTYQLESGSGSDLPSVAQWVIV  404



>gb|ABD93530.1| mitochondrial catalytic protein [Physalis sp. TA1367]
Length=136

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S+ AI  EPK S+DPARVL+KA++ TKAKGSSTACIIAL  QGLHA+
Sbjct  34   VDAGQYARELMSNSVTAIQDEPKGSVDPARVLDKAYTSTKAKGSSTACIIALTDQGLHAV  93

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSS  368
            NLGDSGFIVVRDG T+F SPVQQH FNFTYQLESG+  DLPSS
Sbjct  94   NLGDSGFIVVRDGSTVFRSPVQQHDFNFTYQLESGNAGDLPSS  136



>gb|ABD93532.1| mitochondrial catalytic protein [Solanum melongena]
Length=135

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S+ AI  EPK S+DPARVL KA++ TKAKGSSTACIIAL  QGLHAI
Sbjct  33   IDAGKYARELMSNSVTAIQDEPKGSVDPARVLNKAYACTKAKGSSTACIIALTDQGLHAI  92

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSS  368
            NLGDSGFIVVRDGCT+F SPVQQH FNFTYQLES +  DLPSS
Sbjct  93   NLGDSGFIVVRDGCTVFRSPVQQHDFNFTYQLESDNAGDLPSS  135



>gb|KDO84478.1| hypothetical protein CISIN_1g010417mg [Citrus sinensis]
Length=431

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 95/129 (74%), Gaps = 7/129 (5%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +NAG Y+RELM  S+ AI  EP  SIDPARVLEKAHS T+AKGSSTACIIAL  QGL AI
Sbjct  300  VNAGLYSRELMSNSVAAIQEEPDGSIDPARVLEKAHSSTRAKGSSTACIIALTDQGLRAI  359

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF+VVRDGCT+F SPVQQH FNFTYQLE GS +DLPSSGQV       G  I   
Sbjct  360  NLGDSGFVVVRDGCTVFRSPVQQHDFNFTYQLEYGSNSDLPSSGQV-------GSFIFPC  412

Query  316  TDGLFDNLY  290
                  NLY
Sbjct  413  AHHFSQNLY  421



>gb|ABD93531.1| mitochondrial catalytic protein [Solanum lycopersicum]
Length=136

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S+ AI  EPK S+DPARVL+KA++ TKAKGSSTACIIAL  QGLHAI
Sbjct  34   IDAGKYARELMSNSVAAIQDEPKGSVDPARVLDKAYTCTKAKGSSTACIIALTDQGLHAI  93

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSS  368
            NLGDSGFIVVRDG T+F SPVQQH FNFTYQLESG+  DLPSS
Sbjct  94   NLGDSGFIVVRDGSTVFRSPVQQHDFNFTYQLESGNAGDLPSS  136



>ref|XP_008786119.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Phoenix 
dactylifera]
Length=424

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YAREL+  S+ AI  EPK SIDPARVLEKA+S TKAKGSSTACIIAL  QG+HA+
Sbjct  297  VDAGQYARELISNSVSAIREEPKGSIDPARVLEKAYSSTKAKGSSTACIIALTHQGIHAV  356

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTI  350
            NLGDSGFIVVRDGCTIF SPVQQH FNFTYQLESG+ +DLPSS Q   +
Sbjct  357  NLGDSGFIVVRDGCTIFRSPVQQHDFNFTYQLESGNGSDLPSSAQWLIV  405



>gb|ABD93537.1| mitochondrial catalytic protein [Coffea canephora]
Length=138

 Score =   163 bits (413),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S+ AI  EPK S+DPARVL+KA++ TKAKGSSTACIIAL  QGLHAI
Sbjct  36   IDAGKYARELMSNSVAAIQDEPKGSVDPARVLDKAYTCTKAKGSSTACIIALTDQGLHAI  95

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSS  368
            NLGDSGFIVVRDG T+F SPVQQH FNFTYQLESG+  DLPSS
Sbjct  96   NLGDSGFIVVRDGSTVFRSPVQQHDFNFTYQLESGNAGDLPSS  138



>ref|XP_010106023.1| putative protein phosphatase 2C 55 [Morus notabilis]
 gb|EXC07293.1| putative protein phosphatase 2C 55 [Morus notabilis]
Length=460

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 110/186 (59%), Gaps = 50/186 (27%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG Y+RELM  S+ A+  EPK SIDPARVLEKAHS TKAKGSSTACIIALN       
Sbjct  308  VDAGLYSRELMSNSVTAVQEEPKGSIDPARVLEKAHSITKAKGSSTACIIALNEH-----  362

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
                                                         VFT+ V  GDVI+AG
Sbjct  363  ---------------------------------------------VFTVPVAPGDVIIAG  377

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNLY +E+  VV  AV +G  P+ TAQKIAALARQRA D+ RQTPF+ AAQ+AG 
Sbjct  378  TDGLFDNLYNNEITAVVVHAVRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGI  437

Query  136  QYYGGK  119
            +YYGGK
Sbjct  438  RYYGGK  443



>emb|CDP14203.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 118/191 (62%), Gaps = 7/191 (4%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILH--EPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLH  503
            I+AG+YARELM  +  ++L   E + S+ P +VL +A+  TKAKGSSTACI+ L    LH
Sbjct  78   IDAGEYARELMNNASFSVLEQAEEEGSVSPLQVLHEAYWMTKAKGSSTACIVTLQEDFLH  137

Query  502  AINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIV  323
            A+N+GDSGF+V++ G  +F+SP  Q  FN  YQL  G+  D P S Q F + V   DV+V
Sbjct  138  AVNIGDSGFLVIKKGKVVFQSPAMQKRFNCPYQL--GNERDTPDSAQEFKVDVEHDDVLV  195

Query  322  AGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEA  143
             GTDGLFDNL+  ++  +V + V    +P+  A  IA LA   +L + R TP+  +A E 
Sbjct  196  VGTDGLFDNLFPHQIGSIVHNCVEGKLSPKMMASLIAELAWYHSLQKDRSTPYTKSAMEV  255

Query  142  GY---QYYGGK  119
            G     Y GGK
Sbjct  256  GLVQENYLGGK  266



>gb|KIY99217.1| hypothetical protein MNEG_8745 [Monoraphidium neglectum]
Length=430

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 119/190 (63%), Gaps = 4/190 (2%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAI--LHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLH  503
            ++AG YAR LM ++ +    L      + P  VLE+A+ +T  +GSST CI++LN   L 
Sbjct  223  VDAGAYARLLMSHAKEEAEALLSGGGPLSPQAVLERAYYRTNVQGSSTVCILSLNGATLC  282

Query  502  AINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLES--GSRADLPSSGQVFTIAVLSGDV  329
            A NLGDSGFI+VRDG   F+SP QQH FNF YQ+ S  G  +D P+S   F + V  GDV
Sbjct  283  ASNLGDSGFILVRDGLPAFQSPQQQHNFNFPYQIGSADGGASDHPASAMRFELGVQPGDV  342

Query  328  IVAGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQ  149
            +V GTDGL+DN++ +E A +V      G  PEA A  +   AR RA D K Q+PF+ +A 
Sbjct  343  VVCGTDGLWDNVFAEEAATIVARCKAQGDGPEAAANTLCRYARMRATDPKYQSPFSYSAL  402

Query  148  EAGYQYYGGK  119
            +AGY Y GGK
Sbjct  403  QAGYMYVGGK  412



>ref|XP_007156916.1| hypothetical protein PHAVU_002G028000g [Phaseolus vulgaris]
 gb|ESW28910.1| hypothetical protein PHAVU_002G028000g [Phaseolus vulgaris]
Length=350

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +N+G ++REL+  S+ AI  EP+ S +P RVLEKAHS TKAKGSSTACI+AL  +GLH I
Sbjct  244  VNSGLFSRELISNSVRAIQEEPQGSFNPTRVLEKAHSNTKAKGSSTACIVALTDKGLHGI  303

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQ  362
            NLGDSGFIVVRDGCTIF+SPVQQH FNFTYQLESG+ ADLPSSG+
Sbjct  304  NLGDSGFIVVRDGCTIFQSPVQQHDFNFTYQLESGNGADLPSSGE  348



>gb|KDP42842.1| hypothetical protein JCGZ_23784 [Jatropha curcas]
Length=410

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            INAG YARELM  S+ AI  EP  SIDPARVLEKAHS TKAKGSSTACI+AL ++ + AI
Sbjct  219  INAGLYARELMLNSVSAIQEEPVGSIDPARVLEKAHSNTKAKGSSTACIVALINEEIRAI  278

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQV  359
            NLGDSGF+VVRDGCT+F+SP QQH FNF YQLESG+  DLPSSGQ+
Sbjct  279  NLGDSGFMVVRDGCTVFQSPAQQHCFNFPYQLESGNEGDLPSSGQI  324



>gb|KJB24190.1| hypothetical protein B456_004G132100 [Gossypium raimondii]
Length=253

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 116/187 (62%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNS-QGLHA  500
            ++AG YA EL+  S+ A L +P   +DP +VL++A SKTKA+GSSTACII L     LHA
Sbjct  53   VDAGLYAAELINNSLLATLTQPLTQVDPMKVLDEAFSKTKAQGSSTACIITLQEGNMLHA  112

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            +N+GDS F+V+R G  I++SP+Q H FNF YQL + +    P   QV  + V +GDVI+A
Sbjct  113  VNVGDSRFMVIRRGEIIYKSPIQLHSFNFPYQLGNSANCAKPRQAQVIKVRVEAGDVIIA  172

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDGLFDNL++ ++       +      E    + A LA Q + D+   TPF +A++  G
Sbjct  173  GTDGLFDNLFELQILATASKGIEQDLGAEEMVWETAQLAYQTSRDKAAVTPFMEASKRGG  232

Query  139  YQYYGGK  119
                GGK
Sbjct  233  RFRDGGK  239



>ref|XP_002284713.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
Length=279

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 120/188 (64%), Gaps = 4/188 (2%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG+YAR+LM   + A+  + K  +DP  +LE+A+ KT+ KGSSTACII L ++ LH +
Sbjct  74   IDAGEYARQLMDNCLTALYAKNKKIVDPKMILEEAYLKTEIKGSSTACIITLTNEYLHIV  133

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            N+GDSG ++ RDG  I++SP QQH FN  YQL  G R+D  S  +  TI V +GDV+VAG
Sbjct  134  NVGDSGIMLFRDGDLIYKSPAQQHRFNSPYQL--GKRSDDLSVAEELTIEVKAGDVMVAG  191

Query  316  TDGLFDNLYKDEVAGVVRDAVN--SGCNPEATAQKIAALARQRALDRKRQTPFADAAQEA  143
            TDGLFDN++  E+  V+R      S   P+  A+  A LA + +  +   +P++ AA   
Sbjct  192  TDGLFDNVFASEIEDVIRVVCKKESCLEPQVLARSFAKLALKNSRHKDGDSPYSRAAMIE  251

Query  142  GYQYYGGK  119
            GY   GGK
Sbjct  252  GYLKNGGK  259



>ref|XP_007042336.1| Phosphatase 2C 55, putative [Theobroma cacao]
 gb|EOX98167.1| Phosphatase 2C 55, putative [Theobroma cacao]
Length=302

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 121/192 (63%), Gaps = 7/192 (4%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAIL--HEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLH  503
            ++AG+YAR+LM  ++ A+   H  K S+DP RVL +A+  TK +GSSTACI+ L +  LH
Sbjct  99   VDAGEYARQLMANAIVAVHEEHMLKGSVDPGRVLHEAYFHTKVEGSSTACILTLKTDFLH  158

Query  502  AINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIV  323
            A+N+GDSGF+V RD   ++ SP+QQH FN  YQL +   +D P       + V +GD++V
Sbjct  159  AVNVGDSGFMVFRDAKLVYRSPIQQHDFNCPYQLGNSKTSDGPDMAMELFVRVKAGDIVV  218

Query  322  AGTDGLFDNLYKDEVAGVVRDAVN----SGCNPEATAQKIAALARQRALDRKRQTPFADA  155
             GTDGLFDN+Y  E+  +++   N    S C P+  A  IA  A   + D+   +PFA A
Sbjct  219  LGTDGLFDNMYPTEMEEILKRETNEQEGSIC-PKKIASLIAGYALYNSFDKFAFSPFATA  277

Query  154  AQEAGYQYYGGK  119
            A++AG  + GGK
Sbjct  278  AKKAGLNHMGGK  289



>ref|XP_002274456.3| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
Length=246

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 116/188 (62%), Gaps = 2/188 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQG-LHA  500
            ++ G YARELM   + A+  E K  ++P  VL +A+ KTKA GSSTACII L     LH 
Sbjct  46   VDEGKYARELMKNCVLALDSENKGVVNPMMVLNEAYFKTKAPGSSTACIITLTRDNYLHV  105

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            +N+GDSGF++ RDG  +++SP+QQ GFN  YQL     +D PSS +   +AV   D++V 
Sbjct  106  VNVGDSGFMLFRDGEMVYKSPIQQRGFNCPYQLGRSKGSDRPSSAEELKVAVKERDILVV  165

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDGLFDN++  E+  ++ +    G  P+  A  +A LA   +LD+   TPFA A + AG
Sbjct  166  GTDGLFDNMFVSEMKEIIGNVEKEGLTPKELAWTLAELASYNSLDKDGDTPFAQAKRFAG  225

Query  139  Y-QYYGGK  119
              Q  GGK
Sbjct  226  CGQDKGGK  233



>gb|KDP30212.1| hypothetical protein JCGZ_16994 [Jatropha curcas]
Length=280

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 119/188 (63%), Gaps = 3/188 (2%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQG-LHA  500
            I+AG+YARELM  S+ A+  E K +++P  VL++A+S T  KGSSTACII L+S   LH 
Sbjct  82   IDAGEYARELMTNSVIALQDEEKGNVNPRSVLQEAYSNTNVKGSSTACIITLSSNNCLHY  141

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            +NLGDSGF++ RD   I +S VQQHGFN  YQL +  R DLP       I V +GD+IVA
Sbjct  142  VNLGDSGFMLFRDKKCIHKSVVQQHGFNCPYQLGTRCR-DLPCMAYEEKIDVEAGDIIVA  200

Query  319  GTDGLFDNLYKDEVAGVV-RDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEA  143
            GTDG+ DN+Y  E+  ++ +         E  A+ IA  A   ALD    +PFA AA+ A
Sbjct  201  GTDGMLDNIYPSEIMEILAKTDEKKQMFAEELAETIAEWALFNALDEDYVSPFARAAEMA  260

Query  142  GYQYYGGK  119
            GY + GGK
Sbjct  261  GYSHSGGK  268



>ref|XP_007212971.1| hypothetical protein PRUPE_ppa021121mg [Prunus persica]
 gb|EMJ14170.1| hypothetical protein PRUPE_ppa021121mg [Prunus persica]
Length=243

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 121/188 (64%), Gaps = 4/188 (2%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPK-DSIDPARVLEKAHSKTKAKGSSTACIIALNSQG-LH  503
            ++A  YARELM  S+ ++  +     +DP RVL +A+ KTK KGSSTACI+ L  +G L+
Sbjct  43   VDASQYARELMRNSIKSVKKQQAFGGVDPRRVLNEAYVKTKCKGSSTACILTLKDKGVLN  102

Query  502  AINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIV  323
             +N+GDSGF+V+R+   ++ SP  QH FN  YQL   +  D P S     I V  GD++V
Sbjct  103  FVNVGDSGFMVLRNYKLLYVSPRPQHRFNHPYQLGYSTHFDNPRSATKTKIRVFPGDILV  162

Query  322  AGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEA  143
             GTDGL+DN+Y +E+   V +       PEA A  +A++AR R+LD+ R +PF+ AAQ+A
Sbjct  163  LGTDGLWDNMYPNEIVQFVENMRE--MKPEALACALASVARGRSLDKGRFSPFSRAAQKA  220

Query  142  GYQYYGGK  119
            G ++ GGK
Sbjct  221  GIKHLGGK  228



>ref|XP_009400624.1| PREDICTED: probable protein phosphatase 2C 55 [Musa acuminata 
subsp. malaccensis]
Length=382

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 120/186 (65%), Gaps = 2/186 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG+YARELM  +  A+   P+  +DP +VL  AH+ T A G+STACI+AL  Q +H +
Sbjct  183  IDAGEYARELMSRAEQAVRASPEGCVDPFQVLATAHALTNALGASTACIMALKGQYIHTV  242

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            N+GDSGF+VVRD   ++ SP QQ GFN  YQL++    +  +  +V ++ V  GD+IV  
Sbjct  243  NIGDSGFLVVRDDAVLYHSPAQQRGFNTPYQLQNS--GETLNDAEVKSMGVEPGDIIVVA  300

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDG+FDNL+  EV  +++  +    + E  A  IA  A++ +L R ++TPF+ A ++AG 
Sbjct  301  TDGVFDNLFDSEVVRLIKSGLVLNLSAERIASLIADEAQRNSLRRTKETPFSIACRKAGK  360

Query  136  QYYGGK  119
            +  GGK
Sbjct  361  RRKGGK  366



>gb|KIY99196.1| hypothetical protein MNEG_8763 [Monoraphidium neglectum]
Length=421

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 118/190 (62%), Gaps = 6/190 (3%)
 Frame = -3

Query  676  INAGDYARELMYYS---MDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGL  506
            ++AG YAR  M ++    +A+L     ++ P  VLE+A+ +T  +GSST CI++LN   L
Sbjct  215  VDAGAYARLFMVHAKEEAEALLGG-DAALSPQTVLERAYYRTNVQGSSTVCILSLNGSTL  273

Query  505  HAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLES--GSRADLPSSGQVFTIAVLSGD  332
             A NLGDSGF++VRDG   F+SP QQH FNF YQL S  G  +D P S   F + V  GD
Sbjct  274  CASNLGDSGFVLVRDGGAAFQSPQQQHNFNFPYQLGSADGGASDHPQSAMRFELTVQPGD  333

Query  331  VIVAGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAA  152
            +++ GTDGL+DN++ +E A +V      G  PEA A  +   AR RA D K  +PF+ +A
Sbjct  334  IVITGTDGLWDNVFAEEAATIVARCRVQGDGPEAAAHALCRYARMRATDPKYHSPFSYSA  393

Query  151  QEAGYQYYGG  122
             +AGY + GG
Sbjct  394  IQAGYVFLGG  403



>ref|XP_010262929.1| PREDICTED: probable protein phosphatase 2C 55 [Nelumbo nucifera]
Length=287

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +++G+YARELM  S  A+  EP+D++D  RVL  A S T A GSSTACI+ L ++ LHA+
Sbjct  102  VDSGEYARELMKNSTIALQAEPEDAVDLERVLRVACSNTNAIGSSTACIMQLFNECLHAV  161

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            N+GDSGF+V+RDG   + SP+QQH FN  YQL +  + D P+S  V  + +  GDVIVAG
Sbjct  162  NVGDSGFLVIRDGKIFYSSPIQQHKFNCPYQLGNNPKCDQPNSAMVLKVPIKLGDVIVAG  221

Query  316  TDGLFDNLYKDE-VAGVVRDAVNSGCNPE  233
            TDGLFDNLYK E V  V++     G +P+
Sbjct  222  TDGLFDNLYKHEIVEDVIQGTRFMGVDPQ  250



>gb|EYU18665.1| hypothetical protein MIMGU_mgv1a024209mg [Erythranthe guttata]
Length=257

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 119/186 (64%), Gaps = 1/186 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            +++G+YARELM  +   + +     + P +VL +A+S T A GSSTACII++    L A 
Sbjct  55   VDSGEYARELMRNAEYDVKNYRSIDVGPKQVLRQAYSDTAAAGSSTACIISIAGNLLLAA  114

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            N+GDSGF+V+R G T + SPVQQ+ FNF YQL+  SRA+        T+ V  GD++VAG
Sbjct  115  NVGDSGFMVIRAGKTFYRSPVQQYRFNFPYQLQKSSRANGAEQAAELTVEVEGGDIVVAG  174

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGLFDNL+ DE+  +V D   SG +  + ++ +A  A  ++LD+   +PF  AA EAG 
Sbjct  175  TDGLFDNLFVDEIETIVNDYC-SGNSKLSLSEILATAALGKSLDKTTVSPFEVAAYEAGK  233

Query  136  QYYGGK  119
            +  GGK
Sbjct  234  RRSGGK  239



>gb|KDP40767.1| hypothetical protein JCGZ_24766 [Jatropha curcas]
Length=243

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 119/189 (63%), Gaps = 5/189 (3%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQG-LHA  500
            I+AG+YAR+LM  S  A+ HE K S++P RVLE+A+  T  +GSSTACII L++   LH 
Sbjct  45   IDAGEYARQLMANSAIALQHEHKGSVNPGRVLEEAYLNTSVQGSSTACIITLSTNNCLHY  104

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            +NLGDSGF++ RD   I++SPVQQH FN  YQL + S +D+P       I V +GD++V 
Sbjct  105  VNLGDSGFMLFRDKKYIYKSPVQQHEFNRPYQLGTCS-SDMPCIAYEEKIGVQAGDIVVV  163

Query  319  GTDGLFDNLYKDEVAGVVR--DAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQE  146
            G+DGL DN+Y  E+  ++   D  N   + E  A  I   A   ++D    +PFA  AQ 
Sbjct  164  GSDGLLDNIYPYEIIKILEQTDGDNE-TSVEDLAWAIGDCALFNSIDEDYHSPFARDAQR  222

Query  145  AGYQYYGGK  119
            AGY + GGK
Sbjct  223  AGYLHTGGK  231



>ref|XP_001696623.1| serine/threonine phosphatase, family 2C [Chlamydomonas reinhardtii]
 gb|EDP08600.1| serine/threonine phosphatase, family 2C [Chlamydomonas reinhardtii]
Length=373

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 118/193 (61%), Gaps = 7/193 (4%)
 Frame = -3

Query  676  INAGDYARELM----YYSMDAILHEPKDSIDPA--RVLEKAHSKTKAKGSSTACIIALNS  515
            ++AG YAR+LM      + ++    P   ++ +   +LE+A+S+T  +GSSTAC+  LN 
Sbjct  164  VDAGAYARQLMGNAAVVADESTASAPDAQVELSAQEILERAYSQTTVRGSSTACVAVLNG  223

Query  514  QGLHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESG-SRADLPSSGQVFTIAVLS  338
              L   NLGDSG +++R G   F +P QQHGFNF YQ+ S  S +D PSS Q F +AV  
Sbjct  224  DSLGVSNLGDSGLLILRAGKVAFHTPQQQHGFNFPYQIGSADSMSDSPSSAQRFEVAVQP  283

Query  337  GDVIVAGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFAD  158
            GD++V GTDGL+DN + +EVA V++            AQ +A  AR RA D K  +PFA 
Sbjct  284  GDLLVLGTDGLWDNCFDEEVASVLKYCGEQKMEVAKMAQVLAHYARHRASDSKFASPFAY  343

Query  157  AAQEAGYQYYGGK  119
            AA +AGY Y GGK
Sbjct  344  AAFQAGYAYMGGK  356



>gb|KDP40765.1| hypothetical protein JCGZ_24764 [Jatropha curcas]
Length=280

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 119/188 (63%), Gaps = 3/188 (2%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQG-LHA  500
            I+AG+YAR+LM  S  A+ HE K S++P RVLE+A+  T  +GSSTACII L++   LH 
Sbjct  82   IDAGEYARQLMANSAIALQHEHKGSVNPGRVLEEAYLNTSVQGSSTACIITLSTNNCLHY  141

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            +NLGDSGF++ RD   I++SPVQQH FN  YQL + S +D+P       I V +GD++V 
Sbjct  142  VNLGDSGFMLFRDKKYIYKSPVQQHEFNRPYQLGTCS-SDMPCIAYEEKIGVQAGDIVVV  200

Query  319  GTDGLFDNLYKDEVAGVVRDAV-NSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEA  143
            G+DGL DN+Y  E+  ++     ++  + E  A  I   A   ++D    +PFA  AQ A
Sbjct  201  GSDGLLDNIYPYEIIKILEQTDGDNETSVEDLAWAIGDCALFNSIDEDYHSPFARDAQRA  260

Query  142  GYQYYGGK  119
            GY + GGK
Sbjct  261  GYLHTGGK  268



>gb|EYU18664.1| hypothetical protein MIMGU_mgv1a024169mg [Erythranthe guttata]
Length=276

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%), Gaps = 11/191 (6%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKD----SIDPARVLEKAHSKTKAKGSSTACIIALNSQG  509
            I+AG+YARELM  +     +E KD     ++P  VL +A   T A+GSSTACII+L    
Sbjct  56   IDAGEYARELMKNAE----YEVKDYCPIDVEPKEVLRQAFLNTAAEGSSTACIISLAGNI  111

Query  508  LHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLE-SGSRADLPSSGQVFTIAVLSGD  332
            L A N+GDSGF V+R G T + SPVQQ+GFNF YQL+ S S  D     +  T+ + SGD
Sbjct  112  LTAANVGDSGFTVIRGGRTFYRSPVQQYGFNFPYQLQNSSSEDDGAEQAEEMTVEMESGD  171

Query  331  VIVAGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAA  152
            V+VAGTDGLFDNL+ +++  +VRD  +   +  + ++ +A  A +R+ D    TPF  AA
Sbjct  172  VVVAGTDGLFDNLFPEDIETIVRDYCSD--SMLSLSETLATAALERSEDTTTVTPFEVAA  229

Query  151  QEAGYQYYGGK  119
             EAG ++ GGK
Sbjct  230  YEAGKRHLGGK  240



>gb|KDP38810.1| hypothetical protein JCGZ_04967 [Jatropha curcas]
Length=280

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 123/191 (64%), Gaps = 9/191 (5%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQG-LHA  500
            ++AG YAR LM  S+ A+  E K S++P +VL++A+S T  KGSSTACII ++S   LH 
Sbjct  82   VDAGIYARRLMENSIIALQGEKKGSVNPRKVLQEAYSNTNVKGSSTACIITIDSNNCLHY  141

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            +NLGDSGF++ R+   I++S VQQH FN  YQL + S  DLP       I V +GD++VA
Sbjct  142  VNLGDSGFLLFRENKYIYKSKVQQHEFNHPYQLGTCSD-DLPCLAYEEKILVEAGDIVVA  200

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRAL----DRKRQTPFADAA  152
            GTDGL DN+Y  E+  ++  A   G N E +A+++A    +RAL    D +  +PFA  A
Sbjct  201  GTDGLLDNIYPSEITKILEKA--DGKN-EVSAEELAWRIVERALFNSVDEEYHSPFAREA  257

Query  151  QEAGYQYYGGK  119
            + AGY + GGK
Sbjct  258  EMAGYLHTGGK  268



>ref|XP_010323161.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
Length=317

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 123/192 (64%), Gaps = 6/192 (3%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKD----SIDPARVLEKAHSKTKAKGSSTACIIALNSQG  509
            I++G Y+RELM  +  AI  +       SID  +VL +A SKTK KGSSTACI++L+   
Sbjct  112  IDSGMYSRELMKNAELAIHKQSNSTTTTSIDLMKVLNEAFSKTKNKGSSTACILSLSDDT  171

Query  508  LHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDV  329
            LHA+N+GDSGF V+R+G  +++S VQQ  FN  +QL + S +D P+  +  ++ V++GDV
Sbjct  172  LHAVNIGDSGFAVIREGTIVYKSKVQQSRFNCPFQLGNESTSDKPNVAEKISVPVIAGDV  231

Query  328  IVAGTDGLFDNLYKDEVAGVVRDAVNSGCN--PEATAQKIAALARQRALDRKRQTPFADA  155
            IV GTDGLFDN++  E+  +V   V+S  +  PE  A +IA  A   A + +  TPF   
Sbjct  232  IVLGTDGLFDNVHDFELETIVNAGVDSWESDVPETLAWRIAQYALDNAKNTEVYTPFTRE  291

Query  154  AQEAGYQYYGGK  119
            + +AG ++ GGK
Sbjct  292  SHKAGIEHNGGK  303



>gb|ABD93535.1| mitochondrial catalytic protein [Capsicum annuum]
Length=102

 Score =   145 bits (365),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG YARELM  S+ AI  EPK S+DPARVL+KA++ TK+KGSSTACIIAL  QGLHAI
Sbjct  15   IDAGQYARELMSNSVTAIQDEPKGSVDPARVLDKAYTSTKSKGSSTACIIALTDQGLHAI  74

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNF  413
            NLGDSGFIVVRDGCT+F SPVQQH FNF
Sbjct  75   NLGDSGFIVVRDGCTVFRSPVQQHDFNF  102



>ref|XP_006354601.1| PREDICTED: probable protein phosphatase 2C 80-like [Solanum tuberosum]
Length=340

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 120/189 (63%), Gaps = 3/189 (2%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPK-DSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHA  500
            I++G Y+RELM  +  AI  +    +ID  +VL +A S TKAKGSSTACI++L+   LHA
Sbjct  138  IDSGVYSRELMKNAELAIQKQSSITTIDLMKVLNEAFSNTKAKGSSTACILSLSDDTLHA  197

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            +N+GDSGF+V+R+G  +++S VQQ  FN  +QL +GS +D PS  +  ++ V++GDVIV 
Sbjct  198  VNVGDSGFVVIREGIIVYKSKVQQSRFNCPFQLGNGSTSDDPSVAEKISVPVIAGDVIVL  257

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCN--PEATAQKIAALARQRALDRKRQTPFADAAQE  146
            GTDGLFDN++  E+  +V   V S  +  PE  A +IA  A   A + +  TPF     +
Sbjct  258  GTDGLFDNVHDFELEAIVNSGVESWESDVPETLAWRIAQYALDNAKNTEVYTPFTRECFK  317

Query  145  AGYQYYGGK  119
             G    GGK
Sbjct  318  DGVVRNGGK  326



>gb|ADE77197.1| unknown [Picea sitchensis]
Length=238

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 114/188 (61%), Gaps = 6/188 (3%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            IN+G YA+ELM  +   ++ E   S DP +VL  +  + K+ GSST  + +L  Q LH +
Sbjct  38   INSGLYAQELME-NCRKLVSEESPSADPRQVLVMSAMEAKSAGSSTVLVASLIGQTLHVV  96

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPS-SGQVFTIAVLSGDVIVA  320
            NLGDSGFIV+R G  I +S    HGFNF YQ+E   R D PS   + + I +  GDVIV 
Sbjct  97   NLGDSGFIVIRGGSVIVKSSPMTHGFNFPYQIE---RGDDPSLLLESYDITLNDGDVIVT  153

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
             TDGLFDNLY  E+A ++++++ SG  P+  A  +A  A +R       +PF+DAA+  G
Sbjct  154  ATDGLFDNLYDHEIASIIQNSLQSGLGPKEMATLLAEKAHERGKSTSGSSPFSDAARAVG  213

Query  139  YQ-YYGGK  119
            Y  Y GGK
Sbjct  214  YNTYIGGK  221



>ref|XP_009335499.1| PREDICTED: probable protein phosphatase 2C 55 [Pyrus x bretschneideri]
Length=344

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 128/210 (61%), Gaps = 28/210 (13%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKD---------------SIDPARVLEKAHSKTKAKGSS  542
            I+AG YARELM  +  A+ H P +               +IDP +VL++ ++KTK KGSS
Sbjct  125  IDAGQYARELMNNAFIAV-HNPNNIDEQKRKRKVADMIGAIDPRKVLQETYAKTKEKGSS  183

Query  541  TACIIALNSQG--LHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSS  368
            TACI++LN +   LHA+N+GDSGF++ R+   +++SP QQ  FN  YQL +G  +D P S
Sbjct  184  TACILSLNKESGVLHAVNVGDSGFLLFRNNKVVYQSPTQQRRFNCPYQLGNGISSDRPDS  243

Query  367  GQVFTIAVLSGDVIVAGTDGLFDNLYKDEVAGVV-------RDAVNSGCNPEATAQKIAA  209
                 I  + GD++V GTDGL DN++  E+  V+       RD ++ GC   A++  IA 
Sbjct  244  AWEEWIQTVPGDIVVLGTDGLLDNMFPSEIEQVLVQGGGGDRD-LDLGCGELASS--IAN  300

Query  208  LARQRALDRKRQTPFADAAQEAGYQYYGGK  119
            LA   + D+   +PF++ A++AG+++ GGK
Sbjct  301  LALYNSFDKHSPSPFSENARKAGFEHKGGK  330



>ref|XP_002284716.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
Length=247

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 114/187 (61%), Gaps = 3/187 (2%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+ G+YAR+LM   +  +  E K+ + P  VLE+A+S T  +GSSTACII L  + L+ +
Sbjct  45   IDGGEYARQLMDNCVTTLYAEDKEIVYPQMVLEEAYSNTNVEGSSTACIITLTDECLNVV  104

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            N+GDSGF++ R G  I++S +QQH FN   QL  G   D PS  +   I V +GDV+V G
Sbjct  105  NVGDSGFMIFRYGRMIYKSSIQQHFFNCPCQL--GKTCDDPSVAEELMIGVRAGDVVVVG  162

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGC-NPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            TDGLFDN++ DE+  V+R     GC  P+  A+ +A LA + +L +   +P+  AA   G
Sbjct  163  TDGLFDNVFVDEMEVVIRVLREEGCMEPQLLAKVLAELAEENSLIKSGDSPYTIAALMEG  222

Query  139  YQYYGGK  119
                GGK
Sbjct  223  KFRSGGK  229



>ref|XP_009798171.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
Length=247

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 116/185 (63%), Gaps = 6/185 (3%)
 Frame = -3

Query  661  YARELMYYSMDAI-LHEPKDSI-DPARVLEKAHSKTKAKGSSTACIIALNSQG--LHAIN  494
            YARE+M  S+ A+ ++EPK ++ +P RVL++A+  T ++GSSTACII L+S+   L A N
Sbjct  50   YAREIMRNSLIAVDINEPKGTVVNPKRVLQEAYKNTNSEGSSTACIITLDSEKNTLRAAN  109

Query  493  LGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAGT  314
            +GDSGF +VR+G  I++SP+QQ  FN  YQL  G+  D PS  Q   I V   DV+V GT
Sbjct  110  VGDSGFFLVRNGRVIYKSPIQQRRFNCPYQL--GNAKDNPSVAQEMEIIVEKDDVLVVGT  167

Query  313  DGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGYQ  134
            DGL DN+ + E+  +V+  ++    P+  A +I  +A   + DR   TPF  AA+     
Sbjct  168  DGLLDNMNESEIEELVQRGIDEKLKPKELASQIGNVALYNSFDRFADTPFGRAAEREWRS  227

Query  133  YYGGK  119
            + GGK
Sbjct  228  HKGGK  232



>ref|XP_009797174.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
Length=244

 Score =   145 bits (367),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 118/190 (62%), Gaps = 6/190 (3%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAI-LHEPKDSI-DPARVLEKAHSKTKAKGSSTACIIALNSQG--  509
            ++AG YARELM  S  A+ ++EPK ++ +P RVL++A+  T ++GSSTACII L+S+   
Sbjct  45   VDAGIYARELMRNSFIAVDINEPKGTVVNPKRVLQEAYRNTNSEGSSTACIITLDSKKNT  104

Query  508  LHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDV  329
            L A N+GDSGF ++R+   I++SP+QQ  FN  YQL  G+  D PS  Q   + V   DV
Sbjct  105  LCAANVGDSGFFLIRNRRVIYKSPIQQRRFNCPYQL--GNSKDNPSVAQELELIVEKNDV  162

Query  328  IVAGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQ  149
            ++ GTDGL DN+ + E+  +V+  +     P+  A +I  +A   + DR   TPF  AA+
Sbjct  163  LIVGTDGLLDNMNESEIEELVQRGIAEKLKPKELASQIGNIALYNSFDRYADTPFGRAAE  222

Query  148  EAGYQYYGGK  119
               + + GGK
Sbjct  223  REWFSHRGGK  232



>ref|XP_002945739.1| Serine/threonine phosphatase, family 2C [Volvox carteri f. nagariensis]
 gb|EFJ52734.1| Serine/threonine phosphatase, family 2C [Volvox carteri f. nagariensis]
Length=370

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 115/191 (60%), Gaps = 5/191 (3%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSID----PARVLEKAHSKTKAKGSSTACIIALNSQG  509
            ++AG YAR+LM  + D      + + D     + +LE+A+  T  +GSSTAC+  LN   
Sbjct  163  VDAGAYARQLMRNAADVADAATRGNGDGGAESSEILERAYGLTTVRGSSTACVAVLNGDH  222

Query  508  LHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLES-GSRADLPSSGQVFTIAVLSGD  332
            L   NLGDSG +++R G   F +P QQHGFNF YQ+ S  S +D P S Q F I V  GD
Sbjct  223  LAVSNLGDSGLLILRAGAVAFHTPQQQHGFNFPYQIGSPDSMSDPPQSAQRFEIRVQPGD  282

Query  331  VIVAGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAA  152
            +I+ GTDGL+DN + +E+A V+R   +   +    A+ +A  AR RA D K  +PFA +A
Sbjct  283  LILLGTDGLWDNCFDEELACVLRYCRDQSMDAPKMAEVVAHYARHRASDSKFASPFAYSA  342

Query  151  QEAGYQYYGGK  119
             +AG+ Y GGK
Sbjct  343  FQAGFAYMGGK  353



>ref|XP_002525008.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF37380.1| protein phosphatase 2c, putative [Ricinus communis]
Length=275

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 114/187 (61%), Gaps = 6/187 (3%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQG-LHA  500
            I+ G YARELM   +  +  EPK S++P RVLE+A+  T +KGSSTACI+ L     L  
Sbjct  77   IDPGKYARELMENCVMVLKDEPKGSVNPRRVLEEAYLNTLSKGSSTACIMTLGDDNFLKY  136

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            +NLGDSG +V RD   +++SPVQQ GFN  YQL  G  +D PS      +AV +GD++VA
Sbjct  137  VNLGDSGLMVFRDRRLMYKSPVQQRGFNHPYQL--GRCSDTPSLAYEDKVAVKAGDIVVA  194

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            GTDG  DN++  EV  ++     +    E  A  IA  A   A+D    +PF  AA++AG
Sbjct  195  GTDGWLDNMFPFEVLEIID---QTEMEAEILAWMIAENALCSAVDDDYTSPFGIAAEKAG  251

Query  139  YQYYGGK  119
            Y++ GGK
Sbjct  252  YKHEGGK  258



>emb|CBI18942.3| unnamed protein product [Vitis vinifera]
Length=288

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 115/187 (61%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+ G+YAR+LM   +  +  E K+ + P  VLEKA+S T  +GSSTACII L  + L+ +
Sbjct  55   IDGGEYARQLMDNCVTTLYAEEKEIVYPQIVLEKAYSNTNVEGSSTACIITLMKEYLNVV  114

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            N+GDSGF++ R+G  I++S +QQ+ FN  YQL   S  D PS  +   I V +GDV+V G
Sbjct  115  NVGDSGFMLFRNGNMIYKSSIQQYFFNCPYQLGKSSGCDDPSIAKELIIGVRAGDVVVVG  174

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGC-NPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
            TDGLFDN++  E+   +R   + GC  P+  A+ +A  A + +L +   +P+  AA + G
Sbjct  175  TDGLFDNVFVSEMEVAIRVLRDEGCLKPQLLAKLLAEQALENSLIKSGDSPYTIAASKEG  234

Query  139  YQYYGGK  119
                GGK
Sbjct  235  KFRSGGK  241



>ref|XP_009595170.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
Length=374

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 119/190 (63%), Gaps = 6/190 (3%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAI-LHEPKDS-IDPARVLEKAHSKTKAKGSSTACIIALNSQG--  509
            ++AG YARELM  S+ AI ++EPK + ++P R+L+ A+  T ++GSSTACII L+S+   
Sbjct  175  VDAGIYARELMRNSLIAIDINEPKGTAVNPKRILQAAYKNTNSEGSSTACIITLDSEKNT  234

Query  508  LHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDV  329
            L A N+GDSGF ++R+G  I++SP+QQ  FN  YQL  G+  D PS  Q   I V   DV
Sbjct  235  LCAANVGDSGFFLIRNGRVIYKSPIQQRRFNCPYQL--GNAKDNPSVAQEMEIIVEKDDV  292

Query  328  IVAGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQ  149
            +V GTDGL DN+ + E+  +V+  ++    P+  A +I  +A   + DR   TPF  AA+
Sbjct  293  LVVGTDGLLDNMNESEIEELVQRGIDVKLKPKELASQIGNVALYNSFDRFADTPFGRAAE  352

Query  148  EAGYQYYGGK  119
                 + GGK
Sbjct  353  REWLSHRGGK  362



>ref|XP_010086629.1| putative protein phosphatase 2C 55 [Morus notabilis]
 gb|EXB22348.1| putative protein phosphatase 2C 55 [Morus notabilis]
Length=266

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 108/195 (55%), Gaps = 9/195 (5%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDS-------IDPARVLEKAHSKTKAKGSSTACIIALN  518
            I+AG+YARELM  S  A+   PK+        +DP RVL  A S T++KGS TACII   
Sbjct  56   IDAGEYARELMMNSFFALHKNPKEKEPRKVEGVDPKRVLHDAFSVTESKGSCTACIITHK  115

Query  517  SQGLHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLS  338
               L A N+GDSGF++ R    ++ SP QQ GFN  YQL +   +D P       + V+ 
Sbjct  116  DGVLRAANVGDSGFMLFRKNKLVYRSPCQQRGFNCPYQLGNNKNSDKPECAIEIKVEVME  175

Query  337  GDVIVAGTDGLFDNLYKDEVAGVVRDAVNS--GCNPEATAQKIAALARQRALDRKRQTPF  164
            GDVI+ GTDG FDN++  E   V+        G  P+  A  IA LA   + DR R++PF
Sbjct  176  GDVIILGTDGFFDNVFASEAEEVLERESRKKGGIVPKNLACYIAELALYNSFDRFRESPF  235

Query  163  ADAAQEAGYQYYGGK  119
            +  A+ AG    GGK
Sbjct  236  SRNAKLAGKNRRGGK  250



>emb|CBI30073.3| unnamed protein product [Vitis vinifera]
Length=1379

 Score =   152 bits (385),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 80/180 (44%), Positives = 112/180 (62%), Gaps = 1/180 (1%)
 Frame = -3

Query  676   INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQG-LHA  500
             ++ G YARELM   + A+  E K  ++P  VL +A+ KTKA GSSTACII L     LH 
Sbjct  1084  VDEGKYARELMKNCVLALDSENKGVVNPMMVLNEAYFKTKAPGSSTACIITLTRDNYLHV  1143

Query  499   INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
             +N+GDSGF++ RDG  +++SP+QQ GFN  YQL     +D PSS +   +AV   D++V 
Sbjct  1144  VNVGDSGFMLFRDGEMVYKSPIQQRGFNCPYQLGRSKGSDRPSSAEELKVAVKERDILVV  1203

Query  319   GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
             GTDGLFDN++  E+  ++ +    G  P+  A  +A LA   +LD+   TPFA A + AG
Sbjct  1204  GTDGLFDNMFVSEMKEIIGNVEKEGLTPKELAWTLAELASYNSLDKDGDTPFAQAKRFAG  1263



>ref|XP_005647282.1| protein serine/threonine phosphatase 2C [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22738.1| protein serine/threonine phosphatase 2C [Coccomyxa subellipsoidea 
C-169]
Length=249

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 104/188 (55%), Gaps = 2/188 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++ G YARELM    +A    P     P  +L  A   T   GS TAC++ L    LHA 
Sbjct  45   VDPGIYARELMSKCKEAAARVPPSKTAPLNILTNAFYDTNKIGSCTACVVVLEGNMLHAA  104

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRA--DLPSSGQVFTIAVLSGDVIV  323
            NLGDSGF+V+R    +F+S  QQH FNF YQL  G     D P +  + ++ V SGD++V
Sbjct  105  NLGDSGFMVIRGDSIVFKSRTQQHSFNFPYQLGRGGNGVFDPPIAADLSSVQVKSGDILV  164

Query  322  AGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEA  143
            A TDG++DN+Y  ++A +V  A   G +P   A+ +A  A  RA D    +PFA  A+  
Sbjct  165  AATDGVWDNMYSPDIASLVTTASTQGQSPAQVAENLARFAHMRAADPTYVSPFALGARAL  224

Query  142  GYQYYGGK  119
            G+   GGK
Sbjct  225  GHMDIGGK  232



>gb|EYU18666.1| hypothetical protein MIMGU_mgv1a011411mg [Erythranthe guttata]
Length=282

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 117/190 (62%), Gaps = 8/190 (4%)
 Frame = -3

Query  676  INAGDYARELM----YYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQG  509
            I++G+YARELM    +Y  D     P D +DP +VL KA++ T AKGSSTACII+L    
Sbjct  57   IDSGEYARELMKNAEHYVRDC---RPAD-VDPKKVLGKAYTNTAAKGSSTACIISLAGNL  112

Query  508  LHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDV  329
            L A N+GDSGF+VVR G   + SPVQQ+GFN+ YQL+  ++           + V SGDV
Sbjct  113  LTAANVGDSGFMVVRGGKIFYRSPVQQYGFNWPYQLKKAAKNRGMEQAAELAVEVRSGDV  172

Query  328  IVAGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQ  149
            ++AGTDGLFDN++  E+  +V +           ++ +A  A  ++LD+   +PF  AA+
Sbjct  173  VIAGTDGLFDNMFAGEIERIVMEYCLGTYGKLPPSEILAMAALGKSLDKTTVSPFELAAR  232

Query  148  EAGYQYYGGK  119
            +A  ++ GGK
Sbjct  233  KARKKHSGGK  242



>gb|EYU18663.1| hypothetical protein MIMGU_mgv1a026339mg [Erythranthe guttata]
Length=283

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 117/189 (62%), Gaps = 6/189 (3%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPK--DSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLH  503
            I+AG Y+R+LM  S+ ++   P+    ++P RVL+ A+ +T A+GSSTACI+ L+   L 
Sbjct  86   IDAGKYSRQLMMNSVRSLRRLPRCAGGVNPKRVLQHAYKRTTAQGSSTACIVTLSGDKLR  145

Query  502  AINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIV  323
            A N+GDSGF+V+R+G  ++ SP QQ GFN  YQL  G   D PS       +V SGDV+V
Sbjct  146  AANVGDSGFLVIRNGGVVYRSPTQQRGFNCPYQLGIGK--DNPSICDEIEFSVKSGDVVV  203

Query  322  AGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDR-KRQTPFADAAQE  146
            AGTDGLFDN+ + EV  ++      G +       +A +A   ++D    +TPF+ A+++
Sbjct  204  AGTDGLFDNVGESEVVEIITKTCRDG-DLNRQVSYLANIALYNSMDAYTEETPFSIASRK  262

Query  145  AGYQYYGGK  119
            AG  + GGK
Sbjct  263  AGRPHKGGK  271



>ref|XP_008359355.1| PREDICTED: probable protein phosphatase 2C 55 [Malus domestica]
Length=343

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 122/206 (59%), Gaps = 21/206 (10%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKD---------------SIDPARVLEKAHSKTKAKGSS  542
            I+AG+YARELM  +  A+ H P +               ++DP +VL++A++KTK KGSS
Sbjct  125  IDAGEYARELMNNAFIAV-HNPNNINEQKRKXKAADMIGAVDPRKVLQEAYAKTKEKGSS  183

Query  541  TACIIALNSQG--LHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSS  368
            TACI++LN +   LHA+N+GDSGF++ R+   +++SP QQ  FN  YQL +   +D P  
Sbjct  184  TACILSLNKESGVLHAVNVGDSGFLLFRNNKVVYQSPTQQRRFNCPYQLGNSISSDRPDC  243

Query  367  GQVFTIAVLSGDVIVAGTDGLFDNLYKDEVAGVV---RDAVNSGCNPEATAQKIAALARQ  197
                 I  + GD++V GTDGL DN++  E+  V+       +   +    A  IA LA  
Sbjct  244  AWEEWIQTVPGDMLVLGTDGLLDNMFPSEIEKVLVQGGGGGDLDLDCGTLASSIANLALY  303

Query  196  RALDRKRQTPFADAAQEAGYQYYGGK  119
             + D+   +PF++ A++AG+++ GGK
Sbjct  304  NSFDKYNPSPFSENARKAGFEHKGGK  329



>ref|XP_008366514.1| PREDICTED: probable protein phosphatase 2C 55 [Malus domestica]
Length=343

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 122/206 (59%), Gaps = 21/206 (10%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKD---------------SIDPARVLEKAHSKTKAKGSS  542
            I+AG+YARELM  +  A+ H P +               ++DP +VL++A++KTK KGSS
Sbjct  125  IDAGEYARELMNNAFIAV-HNPNNINEQKRKRKAADMIGAVDPRKVLQEAYAKTKEKGSS  183

Query  541  TACIIALNSQG--LHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSS  368
            TACI++LN +   LHA+N+GDSGF++ R+   +++SP QQ  FN  YQL +   +D P  
Sbjct  184  TACILSLNKESGVLHAVNVGDSGFLLFRNNKVVYQSPTQQRRFNCPYQLGNSISSDRPDC  243

Query  367  GQVFTIAVLSGDVIVAGTDGLFDNLYKDEVAGVV---RDAVNSGCNPEATAQKIAALARQ  197
                 I  + GD++V GTDGL DN++  E+  V+       +   +    A  IA LA  
Sbjct  244  AWEEWIQTVPGDMLVLGTDGLLDNMFPSEIEKVLVQGGGGGDLDLDCGTLASSIANLALY  303

Query  196  RALDRKRQTPFADAAQEAGYQYYGGK  119
             + D+   +PF++ A++AG+++ GGK
Sbjct  304  NSFDKYNPSPFSENARKAGFEHKGGK  329



>ref|XP_009622463.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
Length=337

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 119/194 (61%), Gaps = 8/194 (4%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDS------IDPARVLEKAHSKTKAKGSSTACIIALNS  515
            I++G Y+RELM  +  +I  + +        ID  +VL +A   TKA GSSTAC+++L +
Sbjct  130  IDSGKYSRELMENAESSIQKQKQQDKSSTADIDLMKVLNEAFLNTKAMGSSTACMLSLAN  189

Query  514  QGLHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSG  335
              LHA+N+GDSGF+V+RDG  +++S +QQ  FN  +QL +   ++ PS  +  +  V  G
Sbjct  190  DTLHAVNVGDSGFVVIRDGVIVYKSEIQQSRFNCPFQLGNSKNSNDPSVAEKISFPVKPG  249

Query  334  DVIVAGTDGLFDNLYKDEVAGVVRDAVNSGCN--PEATAQKIAALARQRALDRKRQTPFA  161
            D+IV GTDGLFDN++  E+  VV + V+S  +  P   A +IA  A + + + +  TPFA
Sbjct  250  DIIVMGTDGLFDNVHDFELELVVNNGVDSWESDAPHTLAWRIAQYALENSKNTELYTPFA  309

Query  160  DAAQEAGYQYYGGK  119
                +AG++  GGK
Sbjct  310  RECSKAGFEQRGGK  323



>ref|XP_004249735.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
 gb|ABO36624.1| hypothetical protein LYC_68t000008 [Solanum lycopersicum]
Length=318

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 119/189 (63%), Gaps = 8/189 (4%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEP-KDSIDPARVLEKAHSKTKAKGSSTACIIALNSQ--GL  506
            I+AG YARELM  S  A   E  K  ++P RVLE+A+  T ++GSSTACII+LNS+   +
Sbjct  123  IDAGIYARELMKNSRIATDSEAMKGHVNPKRVLEEAYRNTHSRGSSTACIISLNSERSSI  182

Query  505  HAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVI  326
             A N+GDSGF+++R G  I++SP+QQ G+   YQL  G+  D PS      + V   D++
Sbjct  183  VAANVGDSGFLLIRKGKIIYKSPIQQRGYGCPYQL--GNCKDNPSVAHEMELNVEMDDIL  240

Query  325  VAGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQE  146
            +AGTDG+ DN+   E+  +V+ A+N    P+  A+KIA +A   + DR   TP+A A++ 
Sbjct  241  MAGTDGMLDNMNDSEIEEIVQRAINDKLKPKELAKKIANIALYNSFDRYADTPYARASKG  300

Query  145  AGYQYYGGK  119
               ++ GGK
Sbjct  301  ---RHRGGK  306



>ref|XP_008463803.1| PREDICTED: probable protein phosphatase 2C 55 [Cucumis melo]
Length=256

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 116/186 (62%), Gaps = 3/186 (2%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I+AG+YAR+LM   + +++   +  +DP RVL +AHS+T A GSSTAC+I+ +   L A 
Sbjct  55   IDAGEYARDLMRNCVASVVGA-EGVVDPKRVLTEAHSRTTAVGSSTACLISFDGWYLRAA  113

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVAG  317
            NLGDSGF++ R+G  ++ SP+Q+ GFN  YQ+  G + D P +     I + +GD+IV G
Sbjct  114  NLGDSGFMIFREGKLVYRSPMQRRGFNCPYQMGKGEQFDEPIAAWSGKIPMAAGDIIVVG  173

Query  316  TDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAGY  137
            TDGL+DN++  E+  V+   V         A+ +A LA   +LD  +  PFA  A++AG 
Sbjct  174  TDGLWDNVFGREIVEVLAAEVAE--TAAELAKMMAELAWYNSLDLVKDGPFAVEARKAGR  231

Query  136  QYYGGK  119
             + GGK
Sbjct  232  SHRGGK  237



>gb|EYU20627.1| hypothetical protein MIMGU_mgv1a021452mg, partial [Erythranthe 
guttata]
Length=266

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 110/195 (56%), Gaps = 11/195 (6%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAIL----HEPKDSIDPARVLEKAHSKTKAKGSSTACIIA-----  524
            I+AG+YAR+LM  +  A +    H P   +DP  VL  A   T   GSSTACII+     
Sbjct  43   IDAGEYARQLMRNAYAAAVKEYRHRPIFQVDPKEVLRHAFLNTAEMGSSTACIISFAAAP  102

Query  523  LNSQGLHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAV  344
            +    L A N+GDSGF+V+R G T++ SPVQQH FNF YQLE  S            + V
Sbjct  103  VGKMILRAANVGDSGFMVIRGGGTVYRSPVQQHSFNFPYQLEYSSEKHSHRQAAELAVEV  162

Query  343  LSGDVIVAGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPF  164
             SGDV+VAGTDGLFDNL+  ++  +V D         + ++ +A  A  R+ +    +PF
Sbjct  163  ESGDVVVAGTDGLFDNLFAGDIERIVGDYCMDSMF--SLSETLARAAHGRSRETTTVSPF  220

Query  163  ADAAQEAGYQYYGGK  119
              AA EAG +Y GGK
Sbjct  221  QVAANEAGIRYVGGK  235



>ref|XP_006351386.1| PREDICTED: probable protein phosphatase 2C 55-like [Solanum tuberosum]
Length=314

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 114/189 (60%), Gaps = 7/189 (4%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEP-KDSIDPARVLEKAHSKTKAKGSSTACIIALNS--QGL  506
            I+AG YARELM  S  A   E  K  ++P RVLE+A+  T +KGSSTACII LNS    +
Sbjct  118  IDAGIYARELMKNSFIATYDESMKGHVNPKRVLEEAYKNTNSKGSSTACIITLNSVKNTI  177

Query  505  HAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVI  326
             A N+GDSGF ++R G  I++SP+QQ GF   YQL     +D PS  Q   + V   D++
Sbjct  178  VAANVGDSGFFLIRKGKIIYKSPIQQRGFGCPYQL-GKCNSDNPSVAQEMELNVEKDDIL  236

Query  325  VAGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQE  146
            + GTDG+ DN+++ E+  +VR A++     E  A +I  +A   + DR   TPF+ A++ 
Sbjct  237  MVGTDGMLDNIFESEIEEIVRRAIDQNLKAEELASQIGNIALYNSFDRFADTPFSRASEG  296

Query  145  AGYQYYGGK  119
               ++ GGK
Sbjct  297  ---RHKGGK  302



>ref|XP_004244352.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
Length=255

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 113/192 (59%), Gaps = 6/192 (3%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEP--KDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLH  503
            I+ G+Y+R+L+  +  +I  +   ++ IDP  VL +A+  TK +GSSTACI+ L+   +H
Sbjct  50   IDPGEYSRQLVRNAELSIQKQKDQRNKIDPMEVLNEAYLNTKCQGSSTACILTLSCDTIH  109

Query  502  AINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIV  323
            A N+GDS F+V+RDG  +++S +QQ GFN+ +QL +G   D PS  Q     V  GDVIV
Sbjct  110  AANVGDSRFVVIRDGVIVYKSEIQQRGFNYPFQLGNGVELDDPSVAQEINATVRIGDVIV  169

Query  322  AGTDGLFDNLYKDEVAGVVRDAVNSGCNPEA----TAQKIAALARQRALDRKRQTPFADA  155
              TDGLFDN+   E+  +V D V      E      AQKIA  A Q++  +   TP+A+ 
Sbjct  170  MATDGLFDNVRNHELEKLVHDGVGDLHKLETFSKMLAQKIAEYALQKSESKTVYTPYAEE  229

Query  154  AQEAGYQYYGGK  119
              +A     GGK
Sbjct  230  CSKAQIYRPGGK  241



>ref|XP_011397842.1| putative protein phosphatase 2C 80 [Auxenochlorella protothecoides]
 gb|KFM24954.1| putative protein phosphatase 2C 80 [Auxenochlorella protothecoides]
Length=344

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 112/187 (60%), Gaps = 1/187 (1%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++ G Y+RELM ++  A          PA +L  AH+ T A+GS TACI+ +    LHA 
Sbjct  125  VDPGLYSRELMGHAQVACNSVKAGPSAPAEILTLAHAATAARGSCTACILVIEGNELHAA  184

Query  496  NLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESG-SRADLPSSGQVFTIAVLSGDVIVA  320
            NLGDSGF++VR     F SP QQH FNF +Q+ S  S +D PS+ Q F++    GDV+V 
Sbjct  185  NLGDSGFMIVRGDELAFMSPQQQHDFNFPFQIGSPDSMSDFPSAAQRFSLKTYEGDVLVL  244

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEAG  140
             TDG+FDN+Y DE   +V      G  P   A  +A  ARQRA D+   +PFA  AQ+ G
Sbjct  245  ATDGVFDNVYPDEAVSLVAAQRKRGATPGEAAAALAQFARQRAGDQTHLSPFAYGAQQRG  304

Query  139  YQYYGGK  119
            Y+++GGK
Sbjct  305  YRFFGGK  311



>ref|XP_009341188.1| PREDICTED: probable protein phosphatase 2C 55 [Pyrus x bretschneideri]
Length=346

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 123/206 (60%), Gaps = 21/206 (10%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKD---------------SIDPARVLEKAHSKTKAKGSS  542
            I+AG+Y+R+LM  +  A+ H P +               ++DP +VL++A++KTK KGSS
Sbjct  125  IDAGEYSRKLMNNAFIAV-HNPNNINEQKGKRKAADMIGAVDPRKVLQEAYAKTKEKGSS  183

Query  541  TACIIALNSQG--LHAINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSS  368
            TACI++LN +   LHA+N+GDSGF++ R+   +++SP QQ  FN  YQL +   +D P  
Sbjct  184  TACILSLNKESGVLHAVNVGDSGFLLFRNHKVVYQSPTQQRRFNCPYQLGNSISSDRPDC  243

Query  367  GQVFTIAVLSGDVIVAGTDGLFDNLYKDEVAGVV---RDAVNSGCNPEATAQKIAALARQ  197
                 I  + GD++V GTDGL DN++  E+  V+       +   +  A A  IA LA  
Sbjct  244  AWEEWIQTVPGDLLVLGTDGLLDNMFPSEIEKVLVQGGGGGDLDLDCGALASSIANLALY  303

Query  196  RALDRKRQTPFADAAQEAGYQYYGGK  119
             + D+   +PF++ A++AG+++ GGK
Sbjct  304  NSFDKYNPSPFSENARKAGFEHNGGK  329



>gb|ABD93534.1| mitochondrial catalytic protein [Nicotiana tomentosiformis]
Length=104

 Score =   134 bits (336),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            ++AG YARELM  S+ AI  EPK S+DPARVL+KA++ TKAKGSSTACIIAL  QGLHAI
Sbjct  22   VDAGQYARELMSNSVTAIQDEPKRSVDPARVLDKAYTCTKAKGSSTACIIALTDQGLHAI  81

Query  496  NLGDSGFIVVRDGCTIFESPVQQ  428
            NLGDSGF+VVRDGCT+F SPVQQ
Sbjct  82   NLGDSGFMVVRDGCTVFRSPVQQ  104



>ref|XP_007212931.1| hypothetical protein PRUPE_ppa021890mg, partial [Prunus persica]
 gb|EMJ14130.1| hypothetical protein PRUPE_ppa021890mg, partial [Prunus persica]
Length=245

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 117/189 (62%), Gaps = 5/189 (3%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQG-LHA  500
            ++AG YAREL   S+ ++  + +  +DP RVL +A++ TK +GSSTACI+ L   G LH 
Sbjct  47   VDAGQYARELTCNSIMSV--QKQTIVDPRRVLNEAYADTKCEGSSTACIVTLRETGVLHF  104

Query  499  INLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIVA  320
            +N+GDSG +V R+   ++ SP +Q  FN  YQL +   +D P S     I V  GD++V 
Sbjct  105  VNVGDSGLMVFRNYKLLYMSPREQRSFNCPYQLGNSRGSDNPCSATEIEIRVFPGDIVVL  164

Query  319  GTDGLFDNLYKDEVAGVVRDAVNSG--CNPEATAQKIAALARQRALDRKRQTPFADAAQE  146
            GTDGL+DN+Y +E+  VV   +       P+A A  +A LA  R+LD+   +P++ AAQ+
Sbjct  165  GTDGLWDNMYPNEIEQVVLGNMRESRVMKPQALACLLADLAWLRSLDKDSFSPYSKAAQD  224

Query  145  AGYQYYGGK  119
            AG  + GGK
Sbjct  225  AGKNHPGGK  233



>gb|ETK87262.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=235

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 111/204 (54%), Gaps = 21/204 (10%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I++G+Y+R LM  +   +    K +  P +VL  AH   +  GSSTACI+ L    L AI
Sbjct  19   IDSGEYSRTLMNSAKRTVTASDK-TPTPLQVLTVAHRSAQCPGSSTACIVQLKDLSLQAI  77

Query  496  NLGDSGFIVVR-----------DGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTI  350
            NLGDSGF++ R               + E+P Q H FN  YQL  G+  D P  G+V+ +
Sbjct  78   NLGDSGFLLCRLQPDKAEGGALRWQVVHETPNQCHYFNCPYQLGFGANGDKPEMGEVYDL  137

Query  349  AVLSGDVIVAGTDGLFDNLYKDEVAGVVRDAVNSGCNP-------EATAQKIAALARQRA  191
                GDVIV GTDGLFDNL+  ++A ++   + S   P       E  A  IA  A + A
Sbjct  138  ETQEGDVIVLGTDGLFDNLFPKQIASLLDTVLPS--TPELDHHSMEKVASCIAHTAHKAA  195

Query  190  LDRKRQTPFADAAQEAGYQYYGGK  119
               K +TPFA AAQ+AGY+Y GGK
Sbjct  196  KGTKSKTPFAVAAQQAGYEYLGGK  219



>ref|XP_002297969.2| hypothetical protein POPTR_0001s10840g [Populus trichocarpa]
 gb|EEE82774.2| hypothetical protein POPTR_0001s10840g [Populus trichocarpa]
Length=263

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 109/188 (58%), Gaps = 32/188 (17%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILH-EPKDSIDPARVLEKAHSKTKAKGSSTACIIALNS-QGLH  503
            I+AG+YAR+LM  +  A+++ EP   +DP +VL+ A+SKTK KGSSTACI+ L+  +GL 
Sbjct  90   IDAGEYARQLMSNAEYAVVNGEPNSKVDPRKVLDAAYSKTKVKGSSTACILTLDQDEGLT  149

Query  502  AINLGDSGFIVVRDGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTIAVLSGDVIV  323
             +N+GDSGF+V+R                                G V T+ V +GDVIV
Sbjct  150  TVNMGDSGFLVIR------------------------------KDGDVTTLPVEAGDVIV  179

Query  322  AGTDGLFDNLYKDEVAGVVRDAVNSGCNPEATAQKIAALARQRALDRKRQTPFADAAQEA  143
            AGTDGLFDNLY  ++  +VR  +  G +P+  A  +A  A   ++DR+  TPF + + EA
Sbjct  180  AGTDGLFDNLYPRQIEELVRTKIEGGSDPQDVAWAVAGQAYCTSMDREAFTPFTEGSLEA  239

Query  142  GYQYYGGK  119
            G    GGK
Sbjct  240  GKSSVGGK  247



>ref|XP_008905224.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETI47280.1| hypothetical protein, variant 3 [Phytophthora parasitica P1569]
 gb|ETK87261.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETM47058.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETN09391.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
Length=292

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 111/204 (54%), Gaps = 21/204 (10%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I++G+Y+R LM  +   +    K +  P +VL  AH   +  GSSTACI+ L    L AI
Sbjct  76   IDSGEYSRTLMNSAKRTVTASDK-TPTPLQVLTVAHRSAQCPGSSTACIVQLKDLSLQAI  134

Query  496  NLGDSGFIVVR-----------DGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTI  350
            NLGDSGF++ R               + E+P Q H FN  YQL  G+  D P  G+V+ +
Sbjct  135  NLGDSGFLLCRLQPDKAEGGALRWQVVHETPNQCHYFNCPYQLGFGANGDKPEMGEVYDL  194

Query  349  AVLSGDVIVAGTDGLFDNLYKDEVAGVVRDAVNSGCNP-------EATAQKIAALARQRA  191
                GDVIV GTDGLFDNL+  ++A ++   + S   P       E  A  IA  A + A
Sbjct  195  ETQEGDVIVLGTDGLFDNLFPKQIASLLDTVLPS--TPELDHHSMEKVASCIAHTAHKAA  252

Query  190  LDRKRQTPFADAAQEAGYQYYGGK  119
               K +TPFA AAQ+AGY+Y GGK
Sbjct  253  KGTKSKTPFAVAAQQAGYEYLGGK  276



>gb|ETL40689.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETO76031.1| hypothetical protein, variant [Phytophthora parasitica P1976]
 gb|ETP17119.1| hypothetical protein, variant 3 [Phytophthora parasitica CJ01A1]
 gb|ETP45158.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=292

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 111/204 (54%), Gaps = 21/204 (10%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I++G+Y+R LM  +   +    K +  P +VL  AH   +  GSSTACI+ L    L AI
Sbjct  76   IDSGEYSRTLMNSAKRTVTASDK-TPTPLQVLTVAHRSAQCPGSSTACIVQLKDLSLQAI  134

Query  496  NLGDSGFIVVR-----------DGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTI  350
            NLGDSGF++ R               + E+P Q H FN  YQL  G+  D P  G+V+ +
Sbjct  135  NLGDSGFLLCRLQPDKAEGGALRWQVVHETPNQCHYFNCPYQLGFGANGDKPEMGEVYDL  194

Query  349  AVLSGDVIVAGTDGLFDNLYKDEVAGVVRDAVNSGCNP-------EATAQKIAALARQRA  191
                GDVIV GTDGLFDNL+  ++A ++   + S   P       E  A  IA  A + A
Sbjct  195  ETQEGDVIVLGTDGLFDNLFPKQIASLLDTVLPS--TPELDHHSMEKVASCIAHTAHKAA  252

Query  190  LDRKRQTPFADAAQEAGYQYYGGK  119
               K +TPFA AAQ+AGY+Y GGK
Sbjct  253  KGTKSKTPFAVAAQQAGYEYLGGK  276



>gb|ETL93829.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=292

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 110/204 (54%), Gaps = 21/204 (10%)
 Frame = -3

Query  676  INAGDYARELMYYSMDAILHEPKDSIDPARVLEKAHSKTKAKGSSTACIIALNSQGLHAI  497
            I++G+Y+R LM  +   +    K    P +VL  AH   +  GSSTACI+ L    L AI
Sbjct  76   IDSGEYSRTLMNSAKRTVTASDKPPT-PLQVLTVAHRSAQCPGSSTACIVQLKDLSLQAI  134

Query  496  NLGDSGFIVVR-----------DGCTIFESPVQQHGFNFTYQLESGSRADLPSSGQVFTI  350
            NLGDSGF++ R               + E+P Q H FN  YQL  G+  D P  G+V+ +
Sbjct  135  NLGDSGFLLCRLQPDKAEGGALRWQVVHETPNQCHYFNCPYQLGFGANGDKPEMGEVYDL  194

Query  349  AVLSGDVIVAGTDGLFDNLYKDEVAGVVRDAVNSGCNP-------EATAQKIAALARQRA  191
                GDVIV GTDGLFDNL+  ++A ++   + S   P       E  A  IA  A + A
Sbjct  195  ETQEGDVIVLGTDGLFDNLFPKQIASLLDTVLPS--TPELDHHSMEKVASCIAHTAHKAA  252

Query  190  LDRKRQTPFADAAQEAGYQYYGGK  119
               K +TPFA AAQ+AGY+Y GGK
Sbjct  253  KGTKSKTPFAVAAQQAGYEYLGGK  276



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395