BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF042P06

Length=612
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011097825.1|  PREDICTED: syntaxin-51-like                        277   2e-90   Sesamum indicum [beniseed]
ref|XP_011095474.1|  PREDICTED: syntaxin-52-like                        277   2e-90   Sesamum indicum [beniseed]
ref|XP_009765138.1|  PREDICTED: syntaxin-51-like isoform X2             274   2e-89   Nicotiana sylvestris
ref|XP_009765136.1|  PREDICTED: syntaxin-51-like isoform X1             274   4e-89   Nicotiana sylvestris
ref|XP_009625656.1|  PREDICTED: syntaxin-51-like isoform X2             273   6e-89   Nicotiana tomentosiformis
ref|XP_009591371.1|  PREDICTED: syntaxin-51-like                        272   1e-88   Nicotiana tomentosiformis
ref|XP_009625654.1|  PREDICTED: syntaxin-51-like isoform X1             273   1e-88   Nicotiana tomentosiformis
ref|XP_010324299.1|  PREDICTED: syntaxin-51-like isoform X1             271   2e-88   Solanum lycopersicum
ref|XP_004244081.1|  PREDICTED: syntaxin-51-like isoform X2             271   2e-88   Solanum lycopersicum
ref|XP_009786725.1|  PREDICTED: syntaxin-51-like                        271   5e-88   Nicotiana sylvestris
ref|XP_006346178.1|  PREDICTED: syntaxin-51-like isoform X1             270   1e-87   
ref|XP_006346179.1|  PREDICTED: syntaxin-51-like isoform X2             269   2e-87   Solanum tuberosum [potatoes]
ref|XP_007146536.1|  hypothetical protein PHAVU_006G048900g             263   3e-85   Phaseolus vulgaris [French bean]
ref|XP_002277100.1|  PREDICTED: syntaxin-51                             262   1e-84   Vitis vinifera
ref|XP_010245902.1|  PREDICTED: syntaxin-51-like                        261   2e-84   Nelumbo nucifera [Indian lotus]
ref|XP_003600182.1|  Syntaxin-52                                        260   5e-84   
gb|AFK34675.1|  unknown                                                 260   6e-84   Medicago truncatula
ref|XP_008447706.1|  PREDICTED: syntaxin-51-like                        260   6e-84   Cucumis melo [Oriental melon]
ref|XP_010246481.1|  PREDICTED: syntaxin-52-like                        260   7e-84   Nelumbo nucifera [Indian lotus]
gb|KEH18882.1|  syntaxin of plants protein                              259   9e-84   Medicago truncatula
gb|AES70433.2|  syntaxin of plants protein                              259   2e-83   Medicago truncatula
gb|EYU27391.1|  hypothetical protein MIMGU_mgv1a013014mg                258   3e-83   Erythranthe guttata [common monkey flower]
emb|CDP13772.1|  unnamed protein product                                258   5e-83   Coffea canephora [robusta coffee]
gb|AFK35227.1|  unknown                                                 258   6e-83   Medicago truncatula
gb|KJB81690.1|  hypothetical protein B456_013G156800                    256   2e-82   Gossypium raimondii
ref|XP_007020672.1|  Syntaxin of plants 51 isoform 2                    255   2e-82   
ref|XP_007020671.1|  Syntaxin of plants 51 isoform 1                    256   3e-82   
ref|XP_004151390.1|  PREDICTED: syntaxin-51-like                        256   3e-82   Cucumis sativus [cucumbers]
ref|XP_006595709.1|  PREDICTED: syntaxin-51-like                        253   4e-81   Glycine max [soybeans]
gb|KJB11946.1|  hypothetical protein B456_002G094300                    252   7e-81   Gossypium raimondii
ref|XP_010060271.1|  PREDICTED: syntaxin-51-like isoform X2             250   5e-80   Eucalyptus grandis [rose gum]
gb|KCW66896.1|  hypothetical protein EUGRSUZ_F00647                     250   5e-80   Eucalyptus grandis [rose gum]
gb|KHG11788.1|  Syntaxin-51 -like protein                               250   8e-80   Gossypium arboreum [tree cotton]
gb|ACU19604.1|  unknown                                                 249   8e-80   Glycine max [soybeans]
ref|XP_010060270.1|  PREDICTED: syntaxin-51-like isoform X1             250   9e-80   Eucalyptus grandis [rose gum]
gb|KJB22165.1|  hypothetical protein B456_004G032900                    249   1e-79   Gossypium raimondii
gb|KDP39206.1|  hypothetical protein JCGZ_00963                         246   2e-78   Jatropha curcas
gb|EPS71742.1|  hypothetical protein M569_03017                         246   4e-78   Genlisea aurea
ref|XP_006344878.1|  PREDICTED: syntaxin-52-like                        245   5e-78   
ref|XP_008345031.1|  PREDICTED: syntaxin-52-like isoform X3             245   6e-78   
ref|XP_008345029.1|  PREDICTED: syntaxin-52-like isoform X1             245   8e-78   
ref|XP_010459159.1|  PREDICTED: syntaxin-51-like                        243   3e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010099994.1|  hypothetical protein L484_014031                   241   1e-76   
ref|XP_009361064.1|  PREDICTED: syntaxin-52-like isoform X2             241   1e-76   Pyrus x bretschneideri [bai li]
ref|XP_006452473.1|  hypothetical protein CICLE_v10009364mg             241   1e-76   Citrus clementina [clementine]
ref|XP_009361063.1|  PREDICTED: syntaxin-52-like isoform X1             241   1e-76   Pyrus x bretschneideri [bai li]
emb|CDX88551.1|  BnaC06g39950D                                          241   2e-76   
gb|KHM99515.1|  Syntaxin-51                                             241   2e-76   Glycine soja [wild soybean]
ref|XP_003532151.1|  PREDICTED: syntaxin-51-like isoform X1             241   2e-76   Glycine max [soybeans]
ref|XP_009117773.1|  PREDICTED: syntaxin-51-like                        241   3e-76   Brassica rapa
ref|XP_010476728.1|  PREDICTED: syntaxin-51                             240   3e-76   Camelina sativa [gold-of-pleasure]
gb|KHG00459.1|  Syntaxin-51 -like protein                               240   4e-76   Gossypium arboreum [tree cotton]
ref|XP_010497722.1|  PREDICTED: syntaxin-51-like                        240   5e-76   Camelina sativa [gold-of-pleasure]
ref|XP_009128371.1|  PREDICTED: syntaxin-52 isoform X1                  240   5e-76   Brassica rapa
ref|XP_009128372.1|  PREDICTED: syntaxin-52 isoform X2                  240   5e-76   Brassica rapa
emb|CDY52847.1|  BnaA09g56390D                                          239   7e-76   Brassica napus [oilseed rape]
gb|AFK40910.1|  unknown                                                 239   8e-76   Lotus japonicus
ref|XP_006302763.1|  hypothetical protein CARUB_v10020885mg             239   1e-75   Capsella rubella
ref|XP_003551745.1|  PREDICTED: syntaxin-52-like isoform X1             239   1e-75   Glycine max [soybeans]
ref|XP_004500114.1|  PREDICTED: syntaxin-52-like                        239   1e-75   Cicer arietinum [garbanzo]
gb|AFK40726.1|  unknown                                                 239   1e-75   Lotus japonicus
ref|XP_009343645.1|  PREDICTED: syntaxin-52-like isoform X2             239   1e-75   Pyrus x bretschneideri [bai li]
ref|XP_009343644.1|  PREDICTED: syntaxin-52-like isoform X1             239   2e-75   Pyrus x bretschneideri [bai li]
ref|XP_010417628.1|  PREDICTED: syntaxin-52-like                        238   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010472824.1|  PREDICTED: syntaxin-52                             238   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010429855.1|  PREDICTED: syntaxin-52-like                        238   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_011461087.1|  PREDICTED: syntaxin-52-like                        238   3e-75   Fragaria vesca subsp. vesca
ref|XP_009334172.1|  PREDICTED: syntaxin-52-like isoform X2             238   3e-75   Pyrus x bretschneideri [bai li]
ref|XP_009334173.1|  PREDICTED: syntaxin-52-like isoform X3             238   4e-75   Pyrus x bretschneideri [bai li]
gb|KHN30881.1|  Syntaxin-51                                             238   4e-75   Glycine soja [wild soybean]
ref|XP_006602182.1|  PREDICTED: syntaxin-52-like isoform X2             238   5e-75   Glycine max [soybeans]
ref|XP_010675821.1|  PREDICTED: syntaxin-52-like                        237   7e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007211870.1|  hypothetical protein PRUPE_ppa010128mg             237   8e-75   Prunus persica
ref|XP_004149588.1|  PREDICTED: syntaxin-52-like                        237   1e-74   Cucumis sativus [cucumbers]
gb|ACU23148.1|  unknown                                                 236   2e-74   Glycine max [soybeans]
ref|XP_009416129.1|  PREDICTED: syntaxin-52-like                        236   2e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004976388.1|  PREDICTED: syntaxin-52-like                        236   3e-74   Setaria italica
gb|ABR25694.1|  syntaxin 51                                             233   3e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_008449105.1|  PREDICTED: syntaxin-51-like                        235   3e-74   Cucumis melo [Oriental melon]
ref|XP_007211871.1|  hypothetical protein PRUPE_ppa010128mg             236   4e-74   
ref|XP_006389870.1|  hypothetical protein EUTSA_v10019084mg             235   4e-74   
emb|CDX81754.1|  BnaC08g38470D                                          235   5e-74   
ref|XP_009334171.1|  PREDICTED: syntaxin-52-like isoform X1             237   5e-74   
ref|NP_563994.1|  syntaxin-51                                           234   7e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008227024.1|  PREDICTED: syntaxin-52-like                        234   8e-74   Prunus mume [ume]
ref|XP_006416838.1|  hypothetical protein EUTSA_v10008662mg             234   1e-73   Eutrema salsugineum [saltwater cress]
ref|XP_009149057.1|  PREDICTED: syntaxin-51                             234   1e-73   Brassica rapa
emb|CDY33349.1|  BnaC05g12340D                                          234   1e-73   Brassica napus [oilseed rape]
ref|XP_006659260.1|  PREDICTED: syntaxin-52-like                        233   2e-73   Oryza brachyantha
ref|NP_001061436.1|  Os08g0277900                                       233   2e-73   
ref|XP_002887794.1|  hypothetical protein ARALYDRAFT_477131             233   3e-73   
ref|NP_001131944.1|  uncharacterized protein LOC100193337               233   4e-73   Zea mays [maize]
ref|XP_007142350.1|  hypothetical protein PHAVU_008G273200g             233   4e-73   Phaseolus vulgaris [French bean]
ref|NP_001136935.1|  uncharacterized protein LOC100217094               232   5e-73   Zea mays [maize]
emb|CDX87371.1|  BnaA07g35020D                                          241   6e-73   
ref|XP_010063061.1|  PREDICTED: syntaxin-52-like                        232   7e-73   Eucalyptus grandis [rose gum]
emb|CDY68585.1|  BnaAnng27700D                                          232   7e-73   Brassica napus [oilseed rape]
gb|AFW61956.1|  SNARE domain containing protein                         232   2e-72   
ref|XP_008668816.1|  PREDICTED: syntaxin-52-like                        231   2e-72   
ref|XP_004491440.1|  PREDICTED: syntaxin-52-like isoform X1             230   4e-72   Cicer arietinum [garbanzo]
gb|EEE68383.1|  hypothetical protein OsJ_26713                          233   6e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646793.1|  PREDICTED: syntaxin-52-like                        229   8e-72   Oryza brachyantha
ref|XP_010537838.1|  PREDICTED: syntaxin-51                             229   9e-72   Tarenaya hassleriana [spider flower]
gb|EAY84230.1|  hypothetical protein OsI_05611                          229   1e-71   Oryza sativa Indica Group [Indian rice]
gb|ACG31926.1|  SNARE domain containing protein                         229   1e-71   Zea mays [maize]
ref|XP_010647220.1|  PREDICTED: syntaxin-51-like                        229   1e-71   
gb|EEC83251.1|  hypothetical protein OsI_28573                          234   2e-71   Oryza sativa Indica Group [Indian rice]
ref|XP_008787642.1|  PREDICTED: syntaxin-52-like                        228   3e-71   Phoenix dactylifera
gb|KHG18509.1|  Syntaxin-51 -like protein                               228   3e-71   Gossypium arboreum [tree cotton]
ref|XP_009106789.1|  PREDICTED: syntaxin-52-like                        228   3e-71   
gb|AFK34174.1|  unknown                                                 228   3e-71   Lotus japonicus
ref|NP_001045701.1|  Os02g0119400                                       226   9e-71   
ref|XP_008784838.1|  PREDICTED: syntaxin-52-like                        226   2e-70   Phoenix dactylifera
gb|KGN56069.1|  hypothetical protein Csa_3G064180                       225   2e-70   Cucumis sativus [cucumbers]
ref|XP_010909005.1|  PREDICTED: syntaxin-52-like                        225   3e-70   Elaeis guineensis
ref|XP_010646520.1|  PREDICTED: syntaxin-52-like                        228   4e-70   Vitis vinifera
ref|NP_565213.1|  syntaxin-52                                           225   4e-70   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ85147.1|  predicted protein                                      225   4e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010940839.1|  PREDICTED: syntaxin-52-like                        223   2e-69   Elaeis guineensis
dbj|BAJ97107.1|  predicted protein                                      223   2e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAM64357.1|  unknown                                                 223   3e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009407478.1|  PREDICTED: syntaxin-52-like                        222   7e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003573428.1|  PREDICTED: syntaxin-52-like                        221   1e-68   Brachypodium distachyon [annual false brome]
ref|XP_010532045.1|  PREDICTED: syntaxin-51-like isoform X2             220   3e-68   Tarenaya hassleriana [spider flower]
gb|AHA84215.1|  syntaxin-51                                             223   1e-67   Phaseolus vulgaris [French bean]
ref|XP_010532042.1|  PREDICTED: syntaxin-51-like isoform X1             218   4e-67   Tarenaya hassleriana [spider flower]
gb|KJB62825.1|  hypothetical protein B456_009G444600                    213   2e-66   Gossypium raimondii
gb|KJB62826.1|  hypothetical protein B456_009G444600                    214   4e-66   Gossypium raimondii
ref|XP_006304162.1|  hypothetical protein CARUB_v10010186mg             213   1e-65   Capsella rubella
ref|XP_008385825.1|  PREDICTED: syntaxin-52-like                        212   4e-65   
gb|AAF68106.1|AC010793_1  F20B17.2                                      210   5e-64   Arabidopsis thaliana [mouse-ear cress]
gb|EMT28389.1|  hypothetical protein F775_28894                         210   6e-64   
ref|XP_006339244.1|  PREDICTED: syntaxin-51-like                        208   2e-63   Solanum tuberosum [potatoes]
ref|XP_008775698.1|  PREDICTED: syntaxin-52-like isoform X1             207   2e-63   Phoenix dactylifera
ref|XP_004249335.1|  PREDICTED: syntaxin-51                             206   6e-63   Solanum lycopersicum
ref|XP_009606725.1|  PREDICTED: syntaxin-52-like                        206   6e-63   Nicotiana tomentosiformis
ref|XP_009773941.1|  PREDICTED: syntaxin-52-like                        206   2e-62   Nicotiana sylvestris
ref|XP_010673197.1|  PREDICTED: syntaxin-52-like                        202   4e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008240610.1|  PREDICTED: syntaxin-51-like                        202   4e-61   Prunus mume [ume]
ref|XP_006399472.1|  hypothetical protein EUTSA_v10015786mg             199   5e-61   
gb|ACJ84463.1|  unknown                                                 199   1e-60   Medicago truncatula
gb|ACG48507.1|  SNARE domain containing protein                         200   2e-60   Zea mays [maize]
ref|XP_002531208.1|  syntaxin, putative                                 197   3e-60   
ref|XP_008775700.1|  PREDICTED: syntaxin-52-like isoform X2             198   1e-59   Phoenix dactylifera
ref|XP_007202519.1|  hypothetical protein PRUPE_ppa010912mg             196   5e-59   Prunus persica
ref|XP_006406341.1|  hypothetical protein EUTSA_v10021502mg             195   1e-58   
gb|ABK92902.1|  unknown                                                 195   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_011040715.1|  PREDICTED: syntaxin-52-like                        195   2e-58   Populus euphratica
gb|ABK23110.1|  unknown                                                 195   2e-58   Picea sitchensis
ref|XP_004491441.1|  PREDICTED: syntaxin-52-like isoform X2             193   3e-58   Cicer arietinum [garbanzo]
ref|XP_011041363.1|  PREDICTED: syntaxin-52-like                        194   3e-58   Populus euphratica
ref|XP_009377637.1|  PREDICTED: syntaxin-51-like                        193   9e-58   Pyrus x bretschneideri [bai li]
ref|XP_011040717.1|  PREDICTED: syntaxin-52-like                        193   1e-57   Populus euphratica
ref|XP_006373681.1|  hypothetical protein POPTR_0016s02990g             193   1e-57   
ref|XP_006373682.1|  hypothetical protein POPTR_0016s02990g             193   2e-57   
gb|EYU33678.1|  hypothetical protein MIMGU_mgv1a021393mg                189   4e-56   Erythranthe guttata [common monkey flower]
gb|KJB22168.1|  hypothetical protein B456_004G032900                    183   3e-54   Gossypium raimondii
gb|KJB11954.1|  hypothetical protein B456_002G094300                    182   5e-54   Gossypium raimondii
gb|KJB81691.1|  hypothetical protein B456_013G156800                    182   9e-54   Gossypium raimondii
ref|XP_006373683.1|  hypothetical protein POPTR_0016s03000g             178   8e-52   
ref|XP_002892898.1|  hypothetical protein ARALYDRAFT_471821             177   1e-51   
gb|KCW66897.1|  hypothetical protein EUGRSUZ_F00647                     176   3e-51   Eucalyptus grandis [rose gum]
ref|NP_001077546.1|  syntaxin-51                                        176   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011041367.1|  PREDICTED: syntaxin-52-like                        174   2e-50   Populus euphratica
ref|XP_008676698.1|  PREDICTED: uncharacterized protein LOC100217...    164   1e-46   Zea mays [maize]
ref|XP_002307951.1|  hypothetical protein POPTR_0006s03120g             163   4e-46   
gb|KJB22169.1|  hypothetical protein B456_004G032900                    157   4e-44   Gossypium raimondii
gb|KJB81686.1|  hypothetical protein B456_013G156800                    156   9e-44   Gossypium raimondii
gb|KCW66898.1|  hypothetical protein EUGRSUZ_F00647                     150   1e-41   Eucalyptus grandis [rose gum]
gb|AAM52319.1|AC105363_8  Hypothetical protein                          144   9e-38   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88317.1|  hypothetical protein OsI_09776                          143   1e-37   Oryza sativa Indica Group [Indian rice]
gb|ACN36591.1|  unknown                                                 139   3e-37   Zea mays [maize]
gb|AFW61961.1|  hypothetical protein ZEAMMB73_963395                    138   5e-37   
gb|EMS60104.1|  Syntaxin-51                                             138   3e-36   Triticum urartu
gb|EMT07622.1|  hypothetical protein F775_07967                         135   1e-35   
ref|XP_003562169.2|  PREDICTED: syntaxin-52-like                        133   3e-35   Brachypodium distachyon [annual false brome]
ref|XP_001778077.1|  predicted protein                                  133   1e-34   
emb|CBI25899.3|  unnamed protein product                                128   4e-34   Vitis vinifera
ref|NP_173073.2|  Target SNARE coiled-coil domain protein               126   3e-32   
ref|XP_001751913.1|  Qc-SNARE, SYP5 family                              125   1e-31   
gb|AFK42434.1|  unknown                                                 121   9e-31   Lotus japonicus
gb|EMS59036.1|  Syntaxin-51                                             118   4e-29   Triticum urartu
ref|XP_002985281.1|  hypothetical protein SELMODRAFT_446189             112   2e-26   Selaginella moellendorffii
ref|XP_010111270.1|  hypothetical protein L484_027923                   110   2e-26   
ref|XP_002970090.1|  hypothetical protein SELMODRAFT_441012             111   3e-26   Selaginella moellendorffii
ref|XP_005649717.1|  Qc-snare protein, Syn8/Syntaxin8-family            111   4e-26   Coccomyxa subellipsoidea C-169
ref|NP_683311.2|  putative syntaxin-type t-SNARE protein                105   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002465967.1|  hypothetical protein SORBIDRAFT_01g049130          103   4e-23   Sorghum bicolor [broomcorn]
gb|KJB22166.1|  hypothetical protein B456_004G032900                  98.6    3e-22   Gossypium raimondii
gb|KJB22167.1|  hypothetical protein B456_004G032900                  98.6    4e-22   Gossypium raimondii
gb|KJB81687.1|  hypothetical protein B456_013G156800                  95.9    4e-21   Gossypium raimondii
gb|KJB81689.1|  hypothetical protein B456_013G156800                  95.5    5e-21   Gossypium raimondii
ref|XP_003617659.1|  Syntaxin-51                                      95.9    5e-21   Medicago truncatula
gb|KJB11950.1|  hypothetical protein B456_002G094300                  95.1    7e-21   Gossypium raimondii
gb|KJB11948.1|  hypothetical protein B456_002G094300                  94.7    7e-21   Gossypium raimondii
gb|KJB11949.1|  hypothetical protein B456_002G094300                  95.1    8e-21   Gossypium raimondii
gb|KJB11947.1|  hypothetical protein B456_002G094300                  95.1    9e-21   Gossypium raimondii
ref|XP_006380963.1|  hypothetical protein POPTR_0006s03130g           92.0    1e-19   
gb|AAZ32890.1|  syntaxin of plants                                    88.6    1e-18   Medicago sativa [alfalfa]
gb|KCW70251.1|  hypothetical protein EUGRSUZ_F03509                   88.2    4e-18   Eucalyptus grandis [rose gum]
ref|XP_002951465.1|  Qc-SNARE, Syn8/Syntaxin8-family                  89.0    6e-18   Volvox carteri f. nagariensis
ref|XP_006836710.1|  hypothetical protein AMTR_s00088p00114030        79.0    1e-15   
gb|ABI84247.1|  syntaxin                                              80.9    1e-15   Arachis hypogaea [goober]
dbj|BAC57351.1|  unknown protein                                      82.8    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001691539.1|  Qc-SNARE protein, Syn8/Syntaxin8-family          81.6    2e-15   Chlamydomonas reinhardtii
gb|ACF80713.1|  unknown                                               78.6    8e-15   Zea mays [maize]
gb|AFW61957.1|  hypothetical protein ZEAMMB73_963395                  78.6    2e-14   
ref|XP_003064731.1|  predicted protein                                78.6    3e-14   Micromonas pusilla CCMP1545
gb|EAZ06340.1|  hypothetical protein OsI_28572                        77.0    3e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_004987204.1|  PREDICTED: syntaxin-52-like                      77.8    4e-14   
ref|XP_002504673.1|  predicted protein                                75.5    2e-13   Micromonas commoda
gb|KIZ07812.1|  Syntaxin-51                                           74.7    5e-13   Monoraphidium neglectum
ref|XP_005850452.1|  hypothetical protein CHLNCDRAFT_59611            73.2    2e-12   Chlorella variabilis
ref|XP_011398897.1|  Syntaxin-52                                      73.2    2e-12   Auxenochlorella protothecoides
gb|KDD75355.1|  hypothetical protein H632_c726p1                      72.4    2e-12   Helicosporidium sp. ATCC 50920
ref|XP_002676758.1|  predicted protein                                72.4    3e-12   Naegleria gruberi strain NEG-M
ref|XP_009050690.1|  hypothetical protein LOTGIDRAFT_205331           72.0    5e-12   Lottia gigantea
gb|ABK92777.1|  unknown                                               68.2    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_004363668.1|  hypothetical protein CAOG_03940                  66.6    3e-10   Capsaspora owczarzaki ATCC 30864
ref|XP_011109213.1|  hypothetical protein H072_3230                   67.8    4e-10   
ref|XP_011418529.1|  PREDICTED: syntaxin-8-like                       65.9    6e-10   Crassostrea gigas
ref|XP_007510233.1|  conserved hypothetical protein                   66.2    8e-10   Bathycoccus prasinos
ref|XP_007778861.1|  hypothetical protein W97_02772                   65.1    3e-09   Coniosporium apollinis CBS 100218
gb|KIL62800.1|  hypothetical protein M378DRAFT_12590                  63.5    4e-09   Amanita muscaria Koide BX008
emb|CCO30006.1|  syntaxin 8                                           62.4    5e-09   Rhizoctonia solani AG-1 IB
emb|CDS13496.1|  hypothetical protein LRAMOSA05672                    62.8    7e-09   Lichtheimia ramosa
ref|XP_007593744.1|  PX domain-containing protein                     64.3    7e-09   
gb|KIJ58063.1|  hypothetical protein HYDPIDRAFT_103340                62.8    7e-09   Hydnomerulius pinastri MD-312
emb|CCF43512.1|  SYP5 family Qc-SNARE                                 61.2    8e-09   Colletotrichum higginsianum
emb|CEL53532.1|  syntaxin-like protein                                62.4    8e-09   Rhizoctonia solani AG-1 IB
ref|XP_011027754.1|  PREDICTED: syntaxin-61                           62.8    8e-09   Populus euphratica
ref|XP_001767575.1|  predicted protein                                60.8    1e-08   
ref|XP_007583335.1|  putative snare complex subunit protein           63.2    2e-08   
ref|XP_006304138.1|  hypothetical protein CARUB_v10010122mg           62.0    2e-08   Capsella rubella
gb|KFH72613.1|  hypothetical protein MVEG_02902                       63.2    2e-08   Mortierella verticillata NRRL 6337
ref|XP_011273343.1|  Vacuolar morphogenesis protein 7                 62.8    2e-08   Wickerhamomyces ciferrii
ref|WP_027225949.1|  hypothetical protein                             59.3    2e-08   Legionella pneumophila
gb|ELQ35584.1|  v-SNARE                                               62.8    2e-08   Magnaporthe oryzae Y34
gb|EWC44037.1|  hypothetical protein DRE_01389                        62.8    2e-08   Drechslerella stenobrocha 248
ref|XP_007841269.1|  hypothetical protein PFICI_14497                 62.8    2e-08   Pestalotiopsis fici W106-1
gb|ELQ69118.1|  v-SNARE                                               62.8    2e-08   Magnaporthe oryzae P131
ref|XP_010097811.1|  hypothetical protein L484_000959                 61.6    2e-08   Morus notabilis
ref|XP_007588843.1|  putative snare complex subunit protein           62.0    3e-08   
ref|WP_042754549.1|  hypothetical protein                             58.5    4e-08   Legionella pneumophila
ref|XP_010499380.1|  PREDICTED: syntaxin-61 isoform X2                60.5    4e-08   Camelina sativa [gold-of-pleasure]
emb|CDR38347.1|  CYFA0S02e00584g1_1                                   62.0    4e-08   Cyberlindnera fabianii
emb|CEI88428.1|  hypothetical protein RMCBS344292_02818               60.5    4e-08   Rhizopus microsporus
ref|XP_003081442.1|  SNARE protein TLG1/Syntaxin 6 (ISS)              59.7    4e-08   
ref|XP_004336630.1|  syntaxin 6, putative                             59.3    4e-08   Acanthamoeba castellanii str. Neff
ref|WP_011947286.1|  hypothetical protein                             58.2    5e-08   Legionella pneumophila
ref|XP_957713.1|  V-SNARE                                             62.0    6e-08   Neurospora crassa OR74A
ref|WP_027219386.1|  hypothetical protein                             58.2    6e-08   Legionella pneumophila
ref|XP_010499379.1|  PREDICTED: syntaxin-61 isoform X1                60.5    7e-08   Camelina sativa [gold-of-pleasure]
ref|XP_001211637.1|  conserved hypothetical protein                   60.1    9e-08   Aspergillus terreus NIH2624
ref|NP_001031102.2|  syntaxin-61                                      58.9    1e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CEG64180.1|  hypothetical protein RMATCC62417_01202               60.5    1e-07   Rhizopus microsporus
ref|XP_003347819.1|  hypothetical protein SMAC_06654                  60.8    1e-07   Sordaria macrospora k-hell
gb|EFQ26986.1|  PX domain-containing protein                          60.5    1e-07   Colletotrichum graminicola M1.001
ref|XP_010478222.1|  PREDICTED: syntaxin-61-like                      59.7    1e-07   Camelina sativa [gold-of-pleasure]
gb|AAL59937.1|  unknown protein                                       59.3    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009851020.1|  hypothetical protein NEUTE1DRAFT_146434          60.8    1e-07   Neurospora tetrasperma FGSC 2508
emb|CEF99252.1|  Target SNARE coiled-coil domain                      59.3    2e-07   Ostreococcus tauri
ref|XP_001750756.1|  hypothetical protein                             58.9    2e-07   Monosiga brevicollis MX1
ref|XP_006965434.1|  v-SNARE protein                                  60.1    2e-07   Trichoderma reesei QM6a
ref|XP_007919747.1|  hypothetical protein MYCFIDRAFT_26335            59.7    2e-07   Pseudocercospora fijiensis CIRAD86
ref|NP_564310.1|  syntaxin-61                                         58.9    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001045485.1|  Os01g0963300                                     58.9    2e-07   
ref|XP_003293989.1|  hypothetical protein DICPUDRAFT_42819            58.9    2e-07   Dictyostelium purpureum
gb|KIK26202.1|  hypothetical protein PISMIDRAFT_28592                 58.5    2e-07   Pisolithus microcarpus 441
ref|XP_643701.1|  syntaxin 8                                          57.4    2e-07   Dictyostelium discoideum AX4
ref|XP_006645352.1|  PREDICTED: syntaxin-61-like                      58.5    2e-07   Oryza brachyantha
ref|XP_007331899.1|  hypothetical protein AGABI1DRAFT_93362           60.1    2e-07   Agaricus bisporus var. burnettii JB137-S8
emb|CEG84861.1|  hypothetical protein RMATCC62417_18612               59.7    2e-07   Rhizopus microsporus
ref|XP_003710288.1|  hypothetical protein MGG_05428                   59.7    3e-07   Magnaporthe oryzae 70-15
ref|NP_001141746.1|  uncharacterized protein LOC100273880             58.5    3e-07   Zea mays [maize]
ref|XP_007776580.1|  hypothetical protein W97_00476                   58.9    3e-07   Coniosporium apollinis CBS 100218
ref|XP_003856245.1|  hypothetical protein MYCGRDRAFT_65974            59.3    3e-07   Zymoseptoria tritici IPO323
ref|XP_001557128.1|  hypothetical protein BC1G_04378                  58.9    3e-07   Botrytis cinerea B05.10
gb|EQB47405.1|  hypothetical protein CGLO_13450                       59.3    3e-07   Colletotrichum gloeosporioides Cg-14
ref|WP_027268297.1|  hypothetical protein                             55.8    3e-07   
gb|AGT16573.1|  hypothetical protein SHCRBa_250_M20_R_30              58.2    4e-07   
ref|XP_002305773.2|  Syntaxin 61 family protein                       58.2    4e-07   
emb|CDH55400.1|  phox-like protein                                    58.9    5e-07   
gb|KIW01181.1|  hypothetical protein PV09_07464                       58.9    5e-07   
gb|EKG17311.1|  hypothetical protein MPH_05377                        58.9    5e-07   
gb|EHK15368.1|  hypothetical protein TRIVIDRAFT_87333                 58.5    5e-07   
gb|KIW60454.1|  hypothetical protein PV05_00669                       58.2    5e-07   
emb|CDS07615.1|  hypothetical protein LRAMOSA01564                    58.5    5e-07   
gb|KFZ12938.1|  hypothetical protein V502_06857                       58.5    6e-07   
gb|KDN60171.1|  putative PX domain-containing protein                 58.5    6e-07   
ref|WP_014844538.1|  hypothetical protein                             55.1    6e-07   
gb|KFY85141.1|  hypothetical protein V500_08671                       58.5    6e-07   
gb|KDR70265.1|  hypothetical protein GALMADRAFT_255160                57.4    7e-07   
gb|KFY52674.1|  hypothetical protein V496_08260                       58.5    8e-07   
gb|AFW89304.1|  hypothetical protein ZEAMMB73_776234                  54.7    8e-07   
ref|XP_009842820.1|  hypothetical protein H257_16166                  57.4    9e-07   
ref|XP_006456069.1|  hypothetical protein AGABI2DRAFT_77482           57.0    1e-06   
ref|XP_009222585.1|  V-SNARE                                          57.8    1e-06   
gb|KIK96619.1|  hypothetical protein PAXRUDRAFT_825765                57.0    1e-06   
ref|XP_001591719.1|  hypothetical protein SS1G_07165                  57.8    1e-06   
gb|EXX61188.1|  Vam7p                                                 57.8    1e-06   
gb|EEH18379.1|  hypothetical protein PABG_00942                       57.4    1e-06   
ref|XP_008660430.1|  PREDICTED: syntaxin-61-like                      56.6    1e-06   
gb|ESA08803.1|  hypothetical protein GLOINDRAFT_81281                 57.4    1e-06   
ref|XP_002459155.1|  hypothetical protein SORBIDRAFT_03g046820        56.6    1e-06   
gb|KDQ23319.1|  hypothetical protein PLEOSDRAFT_52938                 56.2    1e-06   
ref|XP_004363183.1|  syntaxin 8                                       55.8    1e-06   
ref|WP_014842407.1|  hypothetical protein                             54.3    1e-06   
emb|CDM33993.1|  Target SNARE coiled-coil domain                      57.4    2e-06   
gb|KFY75448.1|  hypothetical protein V499_04573                       57.4    2e-06   
ref|XP_007930811.1|  hypothetical protein MYCFIDRAFT_178564           57.0    2e-06   
ref|XP_002487191.1|  SNARE  complex subunit (Syn8), putative          56.6    2e-06   
gb|EHK41462.1|  hypothetical protein TRIATDRAFT_321677                57.0    2e-06   
gb|ELR06050.1|  hypothetical protein GMDG_07761                       57.0    2e-06   
ref|XP_001551407.1|  hypothetical protein BC1G_10233                  57.0    2e-06   
ref|XP_011001211.1|  PREDICTED: syntaxin-61-like                      56.2    2e-06   
ref|NP_956669.1|  syntaxin-8                                          56.2    2e-06   
gb|KIW40133.1|  hypothetical protein PV06_07361                       56.6    2e-06   
ref|XP_008868274.1|  hypothetical protein H310_05357                  56.2    2e-06   
ref|XP_009651958.1|  hypothetical protein VDAG_03579                  54.3    2e-06   
ref|XP_004145007.1|  PREDICTED: syntaxin-61-like                      55.8    2e-06   
gb|KIW21033.1|  hypothetical protein PV08_01612                       56.2    2e-06   
emb|CCU82222.1|  SNARE complex subunit (Syn8)                         56.2    3e-06   
ref|XP_010760450.1|  hypothetical protein PADG_04959                  56.6    3e-06   
ref|XP_003655374.1|  hypothetical protein THITE_2119033               56.6    3e-06   
ref|XP_008460099.1|  PREDICTED: syntaxin-61                           55.8    3e-06   
ref|XP_010938949.1|  PREDICTED: syntaxin-61-like                      55.8    3e-06   
ref|XP_009300622.1|  PREDICTED: syntaxin-8 isoform X1                 55.8    3e-06   
gb|ESZ98025.1|  hypothetical protein SBOR_1556                        56.6    3e-06   
ref|XP_004971361.1|  PREDICTED: syntaxin-61-like                      55.8    3e-06   
ref|XP_007886702.1|  PREDICTED: syntaxin-8 isoform X2                 55.8    3e-06   
emb|CDP31873.1|  Putative vacuolar morphogenesis protein 7            56.6    3e-06   
gb|KGK39348.1|  hypothetical protein JL09_g1589                       56.2    3e-06   
gb|EEH22350.1|  hypothetical protein PABG_04561                       56.2    3e-06   
ref|XP_005055925.1|  PREDICTED: uncharacterized protein LOC101818540  56.6    4e-06   
gb|KIY72806.1|  syntaxin                                              56.2    4e-06   
gb|KJB69576.1|  hypothetical protein B456_011G031000                  55.5    4e-06   
ref|XP_010269836.1|  PREDICTED: syntaxin-61-like isoform X2           55.8    4e-06   
ref|XP_002987597.1|  hypothetical protein SELMODRAFT_183263           55.5    4e-06   
gb|KIM43594.1|  hypothetical protein M413DRAFT_443509                 55.5    4e-06   
gb|ESZ96756.1|  hypothetical protein SBOR_2900                        55.8    4e-06   
ref|XP_010269837.1|  PREDICTED: syntaxin-61-like isoform X3           55.5    4e-06   
ref|XP_010269838.1|  PREDICTED: syntaxin-61-like isoform X4           55.5    4e-06   
ref|XP_010758855.1|  hypothetical protein PADG_03417                  55.8    4e-06   
ref|XP_007265644.1|  syntaxin                                         55.8    4e-06   
gb|KHG08114.1|  Syntaxin-61 -like protein                             55.1    4e-06   
ref|XP_006377433.1|  Syntaxin 61 family protein                       55.5    4e-06   
ref|XP_009102902.1|  PREDICTED: syntaxin-61-like isoform X2           54.7    4e-06   
dbj|GAM34833.1|  SNARE complex subunit                                55.5    5e-06   
ref|XP_002987656.1|  hypothetical protein SELMODRAFT_126511           55.1    5e-06   
ref|XP_010269839.1|  PREDICTED: syntaxin-61-like isoform X5           55.1    5e-06   
ref|XP_007798885.1|  putative snare complex subunit protein           55.1    5e-06   
ref|XP_010269835.1|  PREDICTED: syntaxin-61-like isoform X1           55.5    5e-06   
gb|KEF55470.1|  hypothetical protein A1O9_08220                       55.5    5e-06   
ref|XP_006843554.1|  hypothetical protein AMTR_s00007p00074210        54.3    6e-06   
ref|XP_009497815.1|  hypothetical protein H696_05726                  53.9    6e-06   
ref|XP_002792978.1|  v-SNARE                                          55.5    6e-06   
ref|XP_003023204.1|  hypothetical protein TRV_02667                   55.1    6e-06   
gb|KJB69575.1|  hypothetical protein B456_011G031000                  55.1    6e-06   
ref|XP_002842880.1|  V-SNARE                                          55.1    6e-06   
ref|XP_004252790.1|  PREDICTED: syntaxin-61                           54.7    6e-06   
ref|XP_002145360.1|  SNARE  complex subunit (Syn8), putative          55.1    6e-06   
ref|XP_003014858.1|  hypothetical protein ARB_07419                   55.1    6e-06   
ref|XP_006342585.1|  PREDICTED: syntaxin-61-like isoform X1           54.7    6e-06   
ref|XP_011121561.1|  hypothetical protein AOL_s00076g707              55.5    7e-06   
ref|XP_009109711.1|  PREDICTED: syntaxin-61                           54.7    7e-06   
gb|EYE98114.1|  hypothetical protein EURHEDRAFT_400263                55.5    7e-06   
gb|KFM68060.1|  Syntaxin-8                                            54.7    7e-06   
ref|XP_009113653.1|  PREDICTED: syntaxin-61-like isoform X2           55.1    8e-06   
ref|XP_009102901.1|  PREDICTED: syntaxin-61-like isoform X1           54.7    8e-06   
ref|XP_009113656.1|  PREDICTED: syntaxin-61-like isoform X4           54.7    8e-06   
ref|XP_009113652.1|  PREDICTED: syntaxin-61-like isoform X1           54.7    9e-06   
gb|KFY20159.1|  hypothetical protein V493_07735                       53.1    9e-06   
ref|XP_001762590.1|  Qc-SNARE, SYP6/Tlg1p/Syntaxin 6 family           54.3    9e-06   
dbj|GAD91743.1|  conserved hypothetical protein                       54.7    9e-06   
gb|KEQ96015.1|  hypothetical protein AUEXF2481DRAFT_656932            55.1    9e-06   
gb|KFY63045.1|  hypothetical protein V496_04250                       53.5    9e-06   
emb|CDX94628.1|  BnaC07g10300D                                        54.3    9e-06   
ref|XP_001272946.1|  SNARE complex subunit (Vam7), putative           55.1    9e-06   
ref|XP_002837830.1|  hypothetical protein                             55.1    9e-06   
gb|EZF12034.1|  hypothetical protein H100_06976                       53.9    1e-05   
ref|XP_008805691.1|  PREDICTED: syntaxin-61-like isoform X2           54.3    1e-05   
gb|KDP21907.1|  hypothetical protein JCGZ_03045                       54.3    1e-05   
ref|XP_007721647.1|  hypothetical protein A1O1_02546                  54.7    1e-05   
emb|CDY30816.1|  BnaC05g21920D                                        54.3    1e-05   
ref|XP_006415648.1|  hypothetical protein EUTSA_v10008609mg           54.3    1e-05   
gb|KFH48913.1|  Vacuolar morphogenesis protein-like protein           54.7    1e-05   
gb|KFZ10392.1|  hypothetical protein V502_08136                       53.5    1e-05   
ref|XP_008041429.1|  hypothetical protein TRAVEDRAFT_171625           54.3    1e-05   
emb|CDM86912.1|  unnamed protein product                              53.9    1e-05   
emb|CEP10513.1|  hypothetical protein                                 54.7    1e-05   
gb|EMF16539.1|  hypothetical protein SEPMUDRAFT_103908                54.7    1e-05   
dbj|BAJ92922.1|  predicted protein                                    53.9    1e-05   
ref|XP_007297340.1|  PX domain-containing protein                     54.7    1e-05   
ref|XP_008805690.1|  PREDICTED: syntaxin-61-like isoform X1           54.3    1e-05   
gb|EMS59908.1|  Syntaxin-61                                           53.9    1e-05   
gb|KJB69574.1|  hypothetical protein B456_011G031000                  53.9    1e-05   
ref|XP_009113654.1|  PREDICTED: syntaxin-61-like isoform X3           54.3    1e-05   
ref|XP_001907727.1|  hypothetical protein                             54.7    1e-05   
ref|XP_007886703.1|  PREDICTED: syntaxin-8 isoform X3                 53.9    1e-05   
gb|EGE05756.1|  V-SNARE                                               54.3    1e-05   
ref|XP_010274513.1|  PREDICTED: syntaxin-61-like                      53.9    1e-05   
gb|EYC14993.1|  hypothetical protein Y032_0038g3563                   52.0    1e-05   
gb|EGD95450.1|  SNARE complex subunit Syn8                            53.9    1e-05   
gb|EYC14992.1|  hypothetical protein Y032_0038g3563                   52.0    2e-05   
ref|XP_003172826.1|  V-SNARE                                          53.9    2e-05   
gb|KJA16160.1|  hypothetical protein HYPSUDRAFT_148166                53.9    2e-05   
ref|XP_007917370.1|  putative snare complex subunit protein           54.3    2e-05   
gb|KIW34309.1|  hypothetical protein PV07_01096                       53.9    2e-05   
gb|KIM54750.1|  hypothetical protein SCLCIDRAFT_346616                53.9    2e-05   
ref|XP_009154469.1|  syntaxin 8                                       53.9    2e-05   
dbj|GAD99760.1|  SNARE complex subunit (Vam7), putative               53.9    2e-05   
gb|KFY58716.1|  hypothetical protein V497_04692                       54.3    2e-05   
ref|XP_005783880.1|  hypothetical protein EMIHUDRAFT_468178           54.3    2e-05   
ref|XP_003237579.1|  SNARE complex subunit Syn8                       53.5    2e-05   
ref|XP_008087215.1|  PX                                               53.9    2e-05   
gb|KIW97842.1|  hypothetical protein Z519_01426                       53.5    2e-05   
gb|KIW81947.1|  hypothetical protein Z517_04973                       53.5    2e-05   
gb|EHK45502.1|  hypothetical protein TRIATDRAFT_138643                53.5    2e-05   
ref|XP_007861094.1|  syntaxin                                         53.9    2e-05   
dbj|GAM84802.1|  hypothetical protein ANO11243_028030                 53.9    2e-05   
gb|KFX93874.1|  hypothetical protein V490_04618                       53.9    2e-05   
gb|KFY40430.1|  hypothetical protein V495_05427                       53.9    2e-05   
ref|XP_006452410.1|  hypothetical protein CICLE_v10009295mg           53.1    2e-05   
ref|XP_636754.1|  hypothetical protein DDB_G0288439                   53.1    2e-05   
ref|XP_001248034.1|  hypothetical protein CIMG_01805                  53.5    3e-05   
gb|KFX90789.1|  hypothetical protein V490_06275                       51.2    3e-05   
ref|XP_003632086.1|  PREDICTED: syntaxin-61                           53.1    3e-05   
gb|KEQ84661.1|  Phox-like protein                                     53.5    3e-05   
ref|XP_008226891.1|  PREDICTED: syntaxin-61                           53.1    3e-05   
gb|KFH66682.1|  hypothetical protein MVEG_07207                       52.8    3e-05   
gb|KFZ12499.1|  hypothetical protein V501_04211                       53.5    3e-05   
ref|XP_002551155.1|  conserved hypothetical protein                   52.8    3e-05   
gb|EMG46432.1|  t-SNARE syntaxin protein, vesicular/late Golgi fu...  52.8    3e-05   
ref|XP_007740836.1|  hypothetical protein A1O5_02030                  53.1    3e-05   
ref|XP_007211922.1|  hypothetical protein PRUPE_ppa010587mg           53.1    3e-05   
gb|KFY40428.1|  hypothetical protein V494_03506                       53.1    3e-05   
gb|KFY74994.1|  hypothetical protein V499_05013                       53.5    3e-05   
ref|XP_005781618.1|  Qc-snare                                         50.8    3e-05   
gb|KFY88176.1|  hypothetical protein V500_06507                       52.0    3e-05   
gb|KFY25751.1|  hypothetical protein V493_04471                       53.5    3e-05   
gb|KIV88423.1|  hypothetical protein PV10_08109                       53.1    3e-05   
gb|EKV06954.1|  SNARE complex subunit (Vam7), putative                53.1    3e-05   
dbj|GAN11518.1|  syntaxin                                             53.1    3e-05   
gb|KIY01729.1|  hypothetical protein Z520_01867                       53.1    4e-05   
gb|KIW12793.1|  hypothetical protein PV08_07980                       53.1    4e-05   
gb|KJB34885.1|  hypothetical protein B456_006G088600                  52.8    4e-05   
ref|XP_001265830.1|  SNARE complex subunit (Vam7), putative           53.1    4e-05   
ref|XP_008030527.1|  hypothetical protein SETTUDRAFT_165691           52.8    4e-05   
gb|EPB88906.1|  hypothetical protein HMPREF1544_04296                 53.1    4e-05   
emb|CBI24703.3|  unnamed protein product                              52.8    4e-05   
gb|KEQ63817.1|  Phox-like protein                                     53.1    4e-05   
gb|EPS30435.1|  hypothetical protein PDE_05386                        53.1    4e-05   
emb|CCG81242.1|  putative SNARE complex subunit                       52.4    4e-05   
ref|XP_009404897.1|  PREDICTED: syntaxin-61-like isoform X1           52.4    4e-05   
ref|XP_007886701.1|  PREDICTED: syntaxin-8 isoform X1                 52.4    5e-05   
ref|XP_003065464.1|  SNARE domain containing protein                  52.8    5e-05   
ref|XP_007758895.1|  regulator-vacuolar morphogenesis                 52.8    5e-05   
ref|XP_002794331.1|  v-SNARE                                          52.8    5e-05   
gb|KIW91048.1|  hypothetical protein Z519_07942                       52.8    5e-05   
dbj|GAM41329.1|  hypothetical protein TCE0_042f14373                  52.8    5e-05   
gb|ACO14773.1|  Syntaxin-8                                            52.0    5e-05   
ref|XP_007261843.1|  hypothetical protein FOMMEDRAFT_130934           52.4    5e-05   
gb|KFY43001.1|  hypothetical protein V495_04226                       51.6    5e-05   
ref|XP_011340577.1|  PREDICTED: syntaxin-8                            52.4    5e-05   
ref|XP_001419650.1|  predicted protein                                52.0    5e-05   
ref|XP_007307072.1|  hypothetical protein STEHIDRAFT_148708           52.4    5e-05   
gb|ACO12656.1|  Syntaxin-8                                            52.0    5e-05   
ref|XP_006475038.1|  PREDICTED: syntaxin-61-like                      52.0    6e-05   
dbj|GAM89279.1|  hypothetical protein ANO11243_073160                 52.4    6e-05   
gb|EFW16590.1|  SNARE complex subunit                                 52.4    6e-05   
ref|XP_001889506.1|  syntaxin-like protein                            52.0    6e-05   
ref|XP_010538187.1|  PREDICTED: syntaxin-61-like                      52.0    6e-05   
emb|CCA71820.1|  related to syntaxin                                  52.4    6e-05   
gb|EPQ62872.1|  hypothetical protein BGT96224_1019                    52.4    6e-05   
ref|XP_008021981.1|  hypothetical protein SETTUDRAFT_145524           52.4    6e-05   
ref|XP_010912452.1|  PREDICTED: syntaxin-61-like isoform X3           52.0    6e-05   
ref|XP_007743844.1|  regulator-vacuolar morphogenesis                 52.4    6e-05   
ref|XP_007297487.1|  SNARE domain-containing protein                  52.4    7e-05   
gb|KIX04428.1|  hypothetical protein Z518_05296                       52.0    7e-05   
ref|XP_009156700.1|  hypothetical protein HMPREF1120_04328            52.4    7e-05   
ref|XP_002606107.1|  hypothetical protein BRAFLDRAFT_88017            51.6    7e-05   
ref|XP_002561859.1|  Pc18g00120                                       52.4    7e-05   
gb|EPZ33877.1|  hypothetical protein O9G_003985                       52.0    8e-05   
gb|KDR80137.1|  hypothetical protein GALMADRAFT_242387                52.0    8e-05   
ref|XP_007354295.1|  hypothetical protein AURDEDRAFT_116745           51.6    8e-05   
gb|KHG02101.1|  Syntaxin-61 -like protein                             52.0    8e-05   
gb|ENH80177.1|  snare complex subunit                                 52.0    9e-05   
ref|XP_007733733.1|  hypothetical protein A1O3_05420                  52.0    9e-05   
gb|EJT99665.1|  hypothetical protein DACRYDRAFT_117857                51.6    9e-05   
gb|KIK01200.1|  hypothetical protein K443DRAFT_578351                 51.6    9e-05   
ref|XP_001930523.1|  SNARE complex subunit (Vam7)                     52.4    9e-05   
gb|EMF09519.1|  hypothetical protein SEPMUDRAFT_128166                51.6    9e-05   
gb|EMD85270.1|  hypothetical protein COCHEDRAFT_1199020               52.0    9e-05   
gb|KEF52767.1|  regulator-vacuolar morphogenesis                      52.0    1e-04   
gb|KFY60872.1|  hypothetical protein V497_03294                       51.6    1e-04   
ref|XP_007803804.1|  hypothetical protein EPUS_07972                  51.6    1e-04   
gb|EDK38858.2|  hypothetical protein PGUG_02956                       51.2    1e-04   
gb|EFN74790.1|  Syntaxin-8                                            51.2    1e-04   
gb|KGQ86815.1|  hypothetical protein MEU_04355                        51.2    1e-04   



>ref|XP_011097825.1| PREDICTED: syntaxin-51-like [Sesamum indicum]
Length=235

 Score =   277 bits (708),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSK NQMASTLNMSNFANRDSLLGPEIKP DAMSRT GLDN G+V LQRQIMKE
Sbjct  85   DMVANLRSKVNQMASTLNMSNFANRDSLLGPEIKPADAMSRTTGLDNHGIVGLQRQIMKE  144

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEEL L TRLIDDLD+HV+VTDSRLQRVQ+RLAILNKR
Sbjct  145  QDEGLEKLEETVISTKHIALAVNEELDLHTRLIDDLDQHVEVTDSRLQRVQRRLAILNKR  204

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+C+L+SVIGIVVL+AVIYML K+L
Sbjct  205  TKGGCSCLCLLLSVIGIVVLVAVIYMLVKYL  235



>ref|XP_011095474.1| PREDICTED: syntaxin-52-like [Sesamum indicum]
Length=233

 Score =   277 bits (708),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSK NQMASTLNMSNFANRDSLLGPE+KPVDAMSR NGLDN GVV LQRQIM+E
Sbjct  83   DMVANLRSKVNQMASTLNMSNFANRDSLLGPEVKPVDAMSRANGLDNQGVVGLQRQIMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEEL L  RLIDDLDEHVDVTDSRLQRVQ+RLAILNKR
Sbjct  143  QDEGLEKLEETVISTKHIALAVNEELDLHARLIDDLDEHVDVTDSRLQRVQRRLAILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+C+++SVIGIVVL+A++YML K+L
Sbjct  203  TKGGCSCLCLMLSVIGIVVLVALVYMLIKYL  233



>ref|XP_009765138.1| PREDICTED: syntaxin-51-like isoform X2 [Nicotiana sylvestris]
Length=233

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA L+SKA QMASTLNMSNFANRDSLLGPE K  DAMSRT GLDN GVV LQRQIMKE
Sbjct  83   DMLANLKSKATQMASTLNMSNFANRDSLLGPEKKAADAMSRTTGLDNYGVVGLQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRV ++LA+LNKR
Sbjct  143  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVGRKLAVLNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+CML+SVIGIV+L+AVIYML K+L
Sbjct  203  TKGGCSCLCMLLSVIGIVLLVAVIYMLIKYL  233



>ref|XP_009765136.1| PREDICTED: syntaxin-51-like isoform X1 [Nicotiana sylvestris]
Length=250

 Score =   274 bits (700),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA L+SKA QMASTLNMSNFANRDSLLGPE K  DAMSRT GLDN GVV LQRQIMKE
Sbjct  100  DMLANLKSKATQMASTLNMSNFANRDSLLGPEKKAADAMSRTTGLDNYGVVGLQRQIMKE  159

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRV ++LA+LNKR
Sbjct  160  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVGRKLAVLNKR  219

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+CML+SVIGIV+L+AVIYML K+L
Sbjct  220  TKGGCSCLCMLLSVIGIVLLVAVIYMLIKYL  250



>ref|XP_009625656.1| PREDICTED: syntaxin-51-like isoform X2 [Nicotiana tomentosiformis]
Length=233

 Score =   273 bits (698),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA L+SKA QMASTLNMSNFANRDSLLGPE K  DAMSRT GLDN  VV LQRQIMKE
Sbjct  83   DMLANLKSKATQMASTLNMSNFANRDSLLGPETKAADAMSRTTGLDNYSVVGLQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRV ++LAILNKR
Sbjct  143  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVGRKLAILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            +KGGCSCMCML+SVIGIV+L+AVIYML K+L
Sbjct  203  SKGGCSCMCMLLSVIGIVLLVAVIYMLIKYL  233



>ref|XP_009591371.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591379.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591390.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591398.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591404.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
Length=233

 Score =   272 bits (696),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA L+SK  QMASTLNMS+FANRDSLLGPEIKPVDAMSR  GLDN GVV LQRQIMKE
Sbjct  83   DMLANLKSKVTQMASTLNMSSFANRDSLLGPEIKPVDAMSRATGLDNYGVVGLQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE LEETV+STKHIALAVNEELGLQTRLID+LDEHVDVTDSRLQRVQK+LAILNKR
Sbjct  143  QDEGLESLEETVMSTKHIALAVNEELGLQTRLIDNLDEHVDVTDSRLQRVQKKLAILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SV+GIVVL+  IYML K+L
Sbjct  203  TKGGCSCMCLLLSVLGIVVLVVAIYMLIKYL  233



>ref|XP_009625654.1| PREDICTED: syntaxin-51-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625655.1| PREDICTED: syntaxin-51-like isoform X1 [Nicotiana tomentosiformis]
Length=250

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA L+SKA QMASTLNMSNFANRDSLLGPE K  DAMSRT GLDN  VV LQRQIMKE
Sbjct  100  DMLANLKSKATQMASTLNMSNFANRDSLLGPETKAADAMSRTTGLDNYSVVGLQRQIMKE  159

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRV ++LAILNKR
Sbjct  160  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVGRKLAILNKR  219

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            +KGGCSCMCML+SVIGIV+L+AVIYML K+L
Sbjct  220  SKGGCSCMCMLLSVIGIVLLVAVIYMLIKYL  250



>ref|XP_010324299.1| PREDICTED: syntaxin-51-like isoform X1 [Solanum lycopersicum]
Length=238

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA L+SK +QMASTLNMS+FANRDSLLGPEIKPVDAMSR  GLDN+GVV LQRQIMKE
Sbjct  88   DMLANLKSKVSQMASTLNMSSFANRDSLLGPEIKPVDAMSRATGLDNNGVVGLQRQIMKE  147

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE LEETV+STKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQ++L ILNKR
Sbjct  148  QDEGLESLEETVMSTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQRKLGILNKR  207

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML++V+GIV+L+  IYML K+L
Sbjct  208  TKGGCSCMCMLLAVLGIVILVVAIYMLIKYL  238



>ref|XP_004244081.1| PREDICTED: syntaxin-51-like isoform X2 [Solanum lycopersicum]
Length=233

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA L+SK +QMASTLNMS+FANRDSLLGPEIKPVDAMSR  GLDN+GVV LQRQIMKE
Sbjct  83   DMLANLKSKVSQMASTLNMSSFANRDSLLGPEIKPVDAMSRATGLDNNGVVGLQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE LEETV+STKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQ++L ILNKR
Sbjct  143  QDEGLESLEETVMSTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQRKLGILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML++V+GIV+L+  IYML K+L
Sbjct  203  TKGGCSCMCMLLAVLGIVILVVAIYMLIKYL  233



>ref|XP_009786725.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
 ref|XP_009786781.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
 ref|XP_009786839.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
 ref|XP_009786902.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
Length=233

 Score =   271 bits (692),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA L+SK  QMASTLNMS+FANRDSLLGPEIKPVDAMSR  GLDN GVV LQRQIMKE
Sbjct  83   DMLANLKSKVTQMASTLNMSSFANRDSLLGPEIKPVDAMSRATGLDNYGVVGLQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE LEETV+STKHIALAVNEELGLQTRLID+LDEHVDVTDSRLQRVQK+LAILNKR
Sbjct  143  QDEGLESLEETVMSTKHIALAVNEELGLQTRLIDNLDEHVDVTDSRLQRVQKKLAILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SV+G+VVL+  IYML K+L
Sbjct  203  TKGGCSCMCLLLSVLGMVVLVVAIYMLIKYL  233



>ref|XP_006346178.1| PREDICTED: syntaxin-51-like isoform X1 [Solanum tuberosum]
Length=238

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA L+SK +QMASTLNMS+FANRDSLLGPEIKPVDAMSR  GLDN GVV LQRQIMKE
Sbjct  88   DMLANLKSKVSQMASTLNMSSFANRDSLLGPEIKPVDAMSRATGLDNYGVVGLQRQIMKE  147

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE LEETV+STKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQ++L ILNKR
Sbjct  148  QDEGLESLEETVMSTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQRKLGILNKR  207

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML++V+GIV+L+  IYML K+L
Sbjct  208  TKGGCSCMCMLLAVLGIVLLVFAIYMLIKYL  238



>ref|XP_006346179.1| PREDICTED: syntaxin-51-like isoform X2 [Solanum tuberosum]
Length=233

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA L+SK +QMASTLNMS+FANRDSLLGPEIKPVDAMSR  GLDN GVV LQRQIMKE
Sbjct  83   DMLANLKSKVSQMASTLNMSSFANRDSLLGPEIKPVDAMSRATGLDNYGVVGLQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE LEETV+STKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQ++L ILNKR
Sbjct  143  QDEGLESLEETVMSTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQRKLGILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML++V+GIV+L+  IYML K+L
Sbjct  203  TKGGCSCMCMLLAVLGIVLLVFAIYMLIKYL  233



>ref|XP_007146536.1| hypothetical protein PHAVU_006G048900g [Phaseolus vulgaris]
 gb|ESW18530.1| hypothetical protein PHAVU_006G048900g [Phaseolus vulgaris]
Length=229

 Score =   263 bits (673),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  LR+K NQMASTLNMSNFANRDSLLGPEIK  DAMSRT GLDNSG+V LQRQIMKE
Sbjct  80   DMLGNLRTKVNQMASTLNMSNFANRDSLLGPEIKS-DAMSRTVGLDNSGLVGLQRQIMKE  138

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+GLEKLEETVISTKHIALAVNEEL L TRLIDDLDEHVDVTDSRL+RVQK LA+LNKR
Sbjct  139  QDDGLEKLEETVISTKHIALAVNEELDLHTRLIDDLDEHVDVTDSRLRRVQKNLAVLNKR  198

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+CML+SVIGIVVL+AVI++L K+L
Sbjct  199  TKGGCSCLCMLLSVIGIVVLVAVIWLLIKYL  229



>ref|XP_002277100.1| PREDICTED: syntaxin-51 [Vitis vinifera]
 emb|CBI26707.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   262 bits (670),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A L+SKANQMASTLNMSNFANRDSLLGPEIKP DAM+RT GLDN G+V LQRQIMKE
Sbjct  82   DMVANLKSKANQMASTLNMSNFANRDSLLGPEIKPADAMNRTTGLDNYGLVGLQRQIMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV STKHIALAVNEEL L TRLID+LD+HVD+TDSRL+RVQK LAILNKR
Sbjct  142  QDEGLEKLEETVYSTKHIALAVNEELDLHTRLIDNLDQHVDITDSRLKRVQKNLAILNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+C+L+SV+GIV+LI  I++L K+L
Sbjct  202  TKGGCSCLCLLLSVVGIVILIVAIWLLVKYL  232



>ref|XP_010245902.1| PREDICTED: syntaxin-51-like [Nelumbo nucifera]
 ref|XP_010245903.1| PREDICTED: syntaxin-51-like [Nelumbo nucifera]
 ref|XP_010245904.1| PREDICTED: syntaxin-51-like [Nelumbo nucifera]
Length=233

 Score =   261 bits (668),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA  RSKANQMASTLNMSNFANRDSLLGP+ KP D MSRT GLDN G V LQRQIMKE
Sbjct  83   DMLANFRSKANQMASTLNMSNFANRDSLLGPDTKPTDVMSRTTGLDNYGHVGLQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRL+D LDEHVD TDSRLQR+QKRLAILNKR
Sbjct  143  QDEGLEKLEETVLSTKHIALAVNEELSLHTRLLDTLDEHVDSTDSRLQRMQKRLAILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML++VIGIV+L  VI+ L K+L
Sbjct  203  TKGGCSCMCMLLAVIGIVILAVVIWALIKYL  233



>ref|XP_003600182.1| Syntaxin-52 [Medicago truncatula]
Length=233

 Score =   260 bits (665),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D LA LRSK NQMASTLNMSNFANRDSLLGPEIKP DAMSRT GLDN+G+V LQRQ+MKE
Sbjct  84   DNLANLRSKVNQMASTLNMSNFANRDSLLGPEIKP-DAMSRTVGLDNNGLVGLQRQVMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLDEHVDVTDSRL+RVQK LAILNKR
Sbjct  143  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLDEHVDVTDSRLRRVQKNLAILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML++VIGIV L+ VI++L K+L
Sbjct  203  TKGGCSCMCMLLAVIGIVGLVLVIWLLVKYL  233



>gb|AFK34675.1| unknown [Medicago truncatula]
Length=229

 Score =   260 bits (665),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D LA LRSK NQMASTLNMSNFANRDSLLGPEIKP DAMSRT GLDN+G+V LQRQ+MKE
Sbjct  80   DNLANLRSKVNQMASTLNMSNFANRDSLLGPEIKP-DAMSRTVGLDNNGLVGLQRQVMKE  138

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLDEHVDVTDSRL+RVQK LAILNKR
Sbjct  139  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLDEHVDVTDSRLRRVQKNLAILNKR  198

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML++VIGIV L+ VI++L K+L
Sbjct  199  TKGGCSCMCMLLAVIGIVGLVLVIWLLVKYL  229



>ref|XP_008447706.1| PREDICTED: syntaxin-51-like [Cucumis melo]
Length=233

 Score =   260 bits (665),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSKA QMAS LNMSNFANRDSLLGPEIKP D M+RT GLDN G+V  QRQIM+E
Sbjct  83   DMIGNLRSKAKQMASALNMSNFANRDSLLGPEIKPADVMNRTEGLDNRGLVGFQRQIMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLE T+ISTKHIALAVNEEL L TRLIDDLDEHVDVTDSRL+RVQKRLAILNKR
Sbjct  143  QDEGLEKLEGTIISTKHIALAVNEELNLHTRLIDDLDEHVDVTDSRLRRVQKRLAILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGC+CM M++SV+GIVVLIAVI++L K+L
Sbjct  203  TKGGCTCMSMILSVVGIVVLIAVIWLLVKYL  233



>ref|XP_010246481.1| PREDICTED: syntaxin-52-like [Nelumbo nucifera]
 ref|XP_010246482.1| PREDICTED: syntaxin-52-like [Nelumbo nucifera]
Length=233

 Score =   260 bits (664),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA L+SKANQMASTLNMSNFANRDSL+GP+ KP D MSRT GLDN G+V  QRQIMKE
Sbjct  83   DMLANLKSKANQMASTLNMSNFANRDSLIGPDKKPADVMSRTTGLDNHGLVGFQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLID LDEHV+ TDSRLQRVQKRLAILNKR
Sbjct  143  QDEGLEKLEETVLSTKHIALAVNEELSLHTRLIDTLDEHVESTDSRLQRVQKRLAILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L SVIGIV+L  V++ L K+L
Sbjct  203  TKGGCSCMCLLFSVIGIVILAVVVWALIKYL  233



>gb|KEH18882.1| syntaxin of plants protein [Medicago truncatula]
Length=229

 Score =   259 bits (663),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D LA LRSK NQMASTLNMSNFANRDSLLGPEIKP DAMSRT GLDN+G+V LQRQ+MKE
Sbjct  80   DNLANLRSKVNQMASTLNMSNFANRDSLLGPEIKP-DAMSRTVGLDNNGLVGLQRQVMKE  138

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLDEHVD+TDSRL+RVQK LAILNKR
Sbjct  139  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLDEHVDITDSRLRRVQKNLAILNKR  198

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML++VIGIV L+ VI++L K+L
Sbjct  199  TKGGCSCMCMLLAVIGIVGLVLVIWLLVKYL  229



>gb|AES70433.2| syntaxin of plants protein [Medicago truncatula]
Length=261

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D LA LRSK NQMASTLNMSNFANRDSLLGPEIKP DAMSRT GLDN+G+V LQRQ+MKE
Sbjct  112  DNLANLRSKVNQMASTLNMSNFANRDSLLGPEIKP-DAMSRTVGLDNNGLVGLQRQVMKE  170

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLDEHVDVTDSRL+RVQK LAILNKR
Sbjct  171  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLDEHVDVTDSRLRRVQKNLAILNKR  230

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML++VIGIV L+ VI++L K+L
Sbjct  231  TKGGCSCMCMLLAVIGIVGLVLVIWLLVKYL  261



>gb|EYU27391.1| hypothetical protein MIMGU_mgv1a013014mg [Erythranthe guttata]
Length=233

 Score =   258 bits (660),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSK  QMAS LNMSNFA RDSLLGPEIK  DAMSR  GLDN GVV LQRQIMKE
Sbjct  83   DMVANLRSKVTQMASALNMSNFAIRDSLLGPEIKQADAMSRATGLDNHGVVGLQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE+LEETV+STKHIALAVNEEL L TRLID+LDEHV+VTDSRLQRVQ++LAILNKR
Sbjct  143  QDEGLERLEETVLSTKHIALAVNEELDLHTRLIDNLDEHVEVTDSRLQRVQRKLAILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SVIGI++L+AVIYML K+L
Sbjct  203  TKGGCSCMCLLISVIGIILLVAVIYMLIKYL  233



>emb|CDP13772.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   258 bits (658),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 135/151 (89%), Gaps = 8/151 (5%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA LRSK NQMASTLNMSNFANRDSLLGPEIKPVDAM+R  GLDN GVV        E
Sbjct  82   DMLANLRSKVNQMASTLNMSNFANRDSLLGPEIKPVDAMTRAKGLDNYGVV--------E  133

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEEL L TRLID+LDEHVDVTDSRLQRVQKRLAILNK+
Sbjct  134  QDEGLEKLEETVISTKHIALAVNEELDLHTRLIDNLDEHVDVTDSRLQRVQKRLAILNKK  193

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SVIGIVVL+AVIY+L K+L
Sbjct  194  TKGGCSCMCLLLSVIGIVVLVAVIYLLVKYL  224



>gb|AFK35227.1| unknown [Medicago truncatula]
Length=229

 Score =   258 bits (658),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 138/151 (91%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D LA LRSK NQMASTLNMSNFANRDSLLGPEIKP DAM RT GLDN+G+V LQRQ+MKE
Sbjct  80   DNLANLRSKVNQMASTLNMSNFANRDSLLGPEIKP-DAMGRTVGLDNNGLVGLQRQVMKE  138

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLDEHVD+TDSRL+RVQK LAILNKR
Sbjct  139  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLDEHVDITDSRLRRVQKNLAILNKR  198

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML++VIGIV L+ VI++L K+L
Sbjct  199  TKGGCSCMCMLLAVIGIVGLVLVIWLLVKYL  229



>gb|KJB81690.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
 gb|KJB81692.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=231

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSKANQMAS  NMSNFANRDSLLGPE K  DAMSRT G DNSG+V LQRQIMKE
Sbjct  82   DMVANLRSKANQMASAFNMSNFANRDSLLGPETK-ADAMSRTVGSDNSGLVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEEL L TRLIDDLD+HV+VTDSRL+RVQK LAILNKR
Sbjct  141  QDEGLEKLEETVISTKHIALAVNEELDLHTRLIDDLDQHVEVTDSRLRRVQKNLAILNKR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML++VIGIVVL+  IY+L K+L
Sbjct  201  TKGGCSCMCMLLAVIGIVVLVVAIYLLIKYL  231



>ref|XP_007020672.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
 ref|XP_007020674.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
 gb|EOY12197.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
 gb|EOY12199.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
Length=207

 Score =   255 bits (652),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 135/151 (89%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSKANQMAS  NMSNFA+RDSLLGPEIKP DAMSRT GLDNSG+V LQRQIMKE
Sbjct  58   DMVANLRSKANQMASAFNMSNFASRDSLLGPEIKP-DAMSRTVGLDNSGLVGLQRQIMKE  116

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLE TV+STKHIALAVNEEL L T LIDDLD HVDVTDSRL RVQK LAILNKR
Sbjct  117  QDEGLEKLEGTVVSTKHIALAVNEELDLHTSLIDDLDRHVDVTDSRLARVQKNLAILNKR  176

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML++VIGIV+L+  IY+L K+L
Sbjct  177  TKGGCSCMCMLLAVIGIVILVVAIYLLIKYL  207



>ref|XP_007020671.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
 ref|XP_007020673.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
 gb|EOY12196.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
 gb|EOY12198.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
Length=231

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 135/151 (89%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSKANQMAS  NMSNFA+RDSLLGPEIKP DAMSRT GLDNSG+V LQRQIMKE
Sbjct  82   DMVANLRSKANQMASAFNMSNFASRDSLLGPEIKP-DAMSRTVGLDNSGLVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLE TV+STKHIALAVNEEL L T LIDDLD HVDVTDSRL RVQK LAILNKR
Sbjct  141  QDEGLEKLEGTVVSTKHIALAVNEELDLHTSLIDDLDRHVDVTDSRLARVQKNLAILNKR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML++VIGIV+L+  IY+L K+L
Sbjct  201  TKGGCSCMCMLLAVIGIVILVVAIYLLIKYL  231



>ref|XP_004151390.1| PREDICTED: syntaxin-51-like [Cucumis sativus]
 ref|XP_004156357.1| PREDICTED: syntaxin-51-like [Cucumis sativus]
 gb|KGN43995.1| hypothetical protein Csa_7G084710 [Cucumis sativus]
Length=233

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSKA QMASTLNMSNFANRDSLLGPEIKP D ++RT GLDN G+V  QRQIM+E
Sbjct  83   DMIGNLRSKAKQMASTLNMSNFANRDSLLGPEIKPADVVNRTEGLDNRGLVGFQRQIMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLE T+ISTKHIALAVNEEL L TRLIDDLDEHVDVTDSRL+RVQKRLAILNK+
Sbjct  143  QDEGLEKLEGTIISTKHIALAVNEELNLHTRLIDDLDEHVDVTDSRLRRVQKRLAILNKQ  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KGGC+CM M++SV+GIVVLIAVI++L K+L
Sbjct  203  IKGGCTCMSMILSVVGIVVLIAVIWLLVKYL  233



>ref|XP_006595709.1| PREDICTED: syntaxin-51-like [Glycine max]
 gb|KHN23883.1| Syntaxin-51 [Glycine soja]
Length=232

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 137/151 (91%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ LRSK NQMASTLNMSNFANRDSLLGPE KP DAM+R  GLDN+G+V LQRQIMKE
Sbjct  83   DMLSNLRSKVNQMASTLNMSNFANRDSLLGPERKP-DAMTRMVGLDNNGLVGLQRQIMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+GLE+LEETV STKHIALAVNEEL L TRLIDDLD+HVDVTDSRL+RVQK LA+LNKR
Sbjct  142  QDDGLEQLEETVASTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLRRVQKNLAVLNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+SV+GIV LI VI++L K+L
Sbjct  202  TKGGCSCMCMLLSVVGIVALIVVIWLLVKYL  232



>gb|KJB11946.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
 gb|KJB11951.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
 gb|KJB11952.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
 gb|KJB11953.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=230

 Score =   252 bits (644),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 135/151 (89%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSKANQMAS  NMSNFANR+SLLGPE K  DAMSRT GLDNSG+V LQRQIMKE
Sbjct  81   DMVANLRSKANQMASAFNMSNFANRESLLGPETKQ-DAMSRTVGLDNSGLVGLQRQIMKE  139

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLDEHVDVTDSRL+RVQK LAILNKR
Sbjct  140  QDEGLEKLEETVMSTKHIALAVNEELDLHTRLIDDLDEHVDVTDSRLRRVQKNLAILNKR  199

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KG CSCMCML++V+GIV+L+  IY+L K+L
Sbjct  200  AKGSCSCMCMLLAVVGIVILVVAIYLLVKYL  230



>ref|XP_010060271.1| PREDICTED: syntaxin-51-like isoform X2 [Eucalyptus grandis]
Length=232

 Score =   250 bits (639),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D+L+ LR++ NQM STL MS+ A RDSLLGPEIKP DAMSRT GLDN G+V LQRQ+M+E
Sbjct  82   DLLSNLRTRVNQMDSTLKMSHSATRDSLLGPEIKPADAMSRTAGLDNQGIVVLQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLID+LD+HVDVTDSRL+RVQK LAILNKR
Sbjct  142  QDEGLEKLEETVVSTKHIALAVNEELDLHTRLIDNLDQHVDVTDSRLRRVQKNLAILNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGC+CMCM++SVIGIV+L+  +Y+L KFL
Sbjct  202  TKGGCTCMCMILSVIGIVILVVAVYLLIKFL  232



>gb|KCW66896.1| hypothetical protein EUGRSUZ_F00647 [Eucalyptus grandis]
Length=234

 Score =   250 bits (639),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D+L+ LR++ NQM STL MS+ A RDSLLGPEIKP DAMSRT GLDN G+V LQRQ+M+E
Sbjct  84   DLLSNLRTRVNQMDSTLKMSHSATRDSLLGPEIKPADAMSRTAGLDNQGIVVLQRQVMRE  143

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLID+LD+HVDVTDSRL+RVQK LAILNKR
Sbjct  144  QDEGLEKLEETVVSTKHIALAVNEELDLHTRLIDNLDQHVDVTDSRLRRVQKNLAILNKR  203

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGC+CMCM++SVIGIV+L+  +Y+L KFL
Sbjct  204  TKGGCTCMCMILSVIGIVILVVAVYLLIKFL  234



>gb|KHG11788.1| Syntaxin-51 -like protein [Gossypium arboreum]
Length=238

 Score =   250 bits (638),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 136/158 (86%), Gaps = 8/158 (5%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK-  435
            DM+A LRSKANQMAS  NMSNFANRDSLLGPE K  DAMSRT GLDNSG+V LQRQIMK 
Sbjct  82   DMVANLRSKANQMASAFNMSNFANRDSLLGPETKE-DAMSRTVGLDNSGLVGLQRQIMKG  140

Query  434  ------EQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKR  273
                  EQDEGLEKLEETV STKHIALAVNEEL L TRLIDDLD+HVDVTDSRL+RVQK 
Sbjct  141  KCLFEAEQDEGLEKLEETVTSTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLRRVQKN  200

Query  272  LAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            LAILNKRTKGGCSCMCML++VIGIV+L+  IY+L K+L
Sbjct  201  LAILNKRTKGGCSCMCMLLAVIGIVILVVAIYLLIKYL  238



>gb|ACU19604.1| unknown [Glycine max]
Length=232

 Score =   249 bits (637),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ LRSK NQMASTLNMSNFANRDSLLGPE KP DA +R  GLDN+G+V LQRQIMKE
Sbjct  83   DMLSNLRSKVNQMASTLNMSNFANRDSLLGPERKP-DATTRMVGLDNNGLVGLQRQIMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+GLE+LEETV STKHIA+AVNEEL L TRLIDDLD+HVDVTDSRL+RVQK LA+LNKR
Sbjct  142  QDDGLEQLEETVASTKHIAVAVNEELDLHTRLIDDLDQHVDVTDSRLRRVQKNLAVLNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+SV+GIV LI VI++L K+L
Sbjct  202  TKGGCSCMCMLLSVVGIVALIVVIWLLVKYL  232



>ref|XP_010060270.1| PREDICTED: syntaxin-51-like isoform X1 [Eucalyptus grandis]
Length=242

 Score =   250 bits (638),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D+L+ LR++ NQM STL MS+ A RDSLLGPEIKP DAMSRT GLDN G+V LQRQ+M+E
Sbjct  92   DLLSNLRTRVNQMDSTLKMSHSATRDSLLGPEIKPADAMSRTAGLDNQGIVVLQRQVMRE  151

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLID+LD+HVDVTDSRL+RVQK LAILNKR
Sbjct  152  QDEGLEKLEETVVSTKHIALAVNEELDLHTRLIDNLDQHVDVTDSRLRRVQKNLAILNKR  211

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGC+CMCM++SVIGIV+L+  +Y+L KFL
Sbjct  212  TKGGCTCMCMILSVIGIVILVVAVYLLIKFL  242



>gb|KJB22165.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=231

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSK NQMAS  NMSNFANRDSLLGPE KP DAMSRT GLDNSG+V LQRQIMKE
Sbjct  82   DMVANLRSKVNQMASAFNMSNFANRDSLLGPESKP-DAMSRTVGLDNSGLVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDE LEKLEET++STKHIALAVNEEL LQTRLIDDLD+HVDV+DSRL+RVQK LA+LN+R
Sbjct  141  QDEDLEKLEETIVSTKHIALAVNEELDLQTRLIDDLDQHVDVSDSRLRRVQKNLAVLNRR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            T+  CSCMCML++VIGIV+L  +IY+L K+L
Sbjct  201  TRDSCSCMCMLLAVIGIVILAVIIYLLIKYL  231



>gb|KDP39206.1| hypothetical protein JCGZ_00963 [Jatropha curcas]
Length=233

 Score =   246 bits (629),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LR+K NQMAS+LNMSNFA+RDSL GPEIKP DAM RT GLDN GVV LQRQIMKE
Sbjct  83   DMVANLRTKVNQMASSLNMSNFAHRDSLFGPEIKPADAMRRTEGLDNHGVVGLQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEEL L +RLIDDLD+HVDVTDSRL+RVQK LAILNKR
Sbjct  143  QDEGLEKLEETVISTKHIALAVNEELDLHSRLIDDLDQHVDVTDSRLRRVQKNLAILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+CML+S +G+V L+ VIY+L K+L
Sbjct  203  TKGGCSCLCMLLSFVGVVGLVVVIYLLIKYL  233



>gb|EPS71742.1| hypothetical protein M569_03017, partial [Genlisea aurea]
Length=245

 Score =   246 bits (627),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 136/164 (83%), Gaps = 13/164 (8%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK-  435
            D+++ LRSK NQMA++LNMSNFANRDSLLGPE K  DA+ R NGLDN G+V+LQRQIM+ 
Sbjct  82   DLVSGLRSKVNQMAASLNMSNFANRDSLLGPETKSADAIGRANGLDNHGIVSLQRQIMRG  141

Query  434  ------------EQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRL  291
                        EQDEGLEKLEETV+STKHIALAVNEEL L TRLID+LDEHVDVTDSRL
Sbjct  142  KFPNFVFTISTAEQDEGLEKLEETVMSTKHIALAVNEELDLHTRLIDNLDEHVDVTDSRL  201

Query  290  QRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            +RVQKRLAILNKRTK GCSC CM++SVIGIV LI VIY+L K+L
Sbjct  202  KRVQKRLAILNKRTKAGCSCFCMMLSVIGIVALIGVIYLLVKYL  245



>ref|XP_006344878.1| PREDICTED: syntaxin-52-like [Solanum tuberosum]
Length=238

 Score =   245 bits (626),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA L+SKA +MASTLNMSNFANRDSLLGPE K  DA SRT GLDN GVV LQRQIMKE
Sbjct  88   DMLANLKSKAAEMASTLNMSNFANRDSLLGPETKAADATSRTTGLDNYGVVGLQRQIMKE  147

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEE+++S KHIALAVNEEL LQTRLI  LDEHVDVTDSRLQRV +++ ILNKR
Sbjct  148  QDEGLEKLEESMMSFKHIALAVNEELDLQTRLIATLDEHVDVTDSRLQRVGRKVGILNKR  207

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TK GCSC+CML+SVIGIV+L+A+IYML K+L
Sbjct  208  TKCGCSCLCMLLSVIGIVLLVALIYMLIKYL  238



>ref|XP_008345031.1| PREDICTED: syntaxin-52-like isoform X3 [Malus domestica]
 ref|XP_008355319.1| PREDICTED: syntaxin-52-like isoform X2 [Malus domestica]
Length=231

 Score =   245 bits (625),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK  QMASTL  SN +NRDSLLGPEI   DAM RT GLDN G+V LQRQIMKE
Sbjct  82   DMIGNLRSKVKQMASTLT-SNSSNRDSLLGPEINKTDAMGRTVGLDNYGLVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEEL L TRLIDDLD+HV+VTDSRL+RVQK LA+LNKR
Sbjct  141  QDEGLEKLEETVISTKHIALAVNEELDLHTRLIDDLDDHVEVTDSRLRRVQKNLAVLNKR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  201  TKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  231



>ref|XP_008345029.1| PREDICTED: syntaxin-52-like isoform X1 [Malus domestica]
 ref|XP_008345030.1| PREDICTED: syntaxin-52-like isoform X2 [Malus domestica]
 ref|XP_008355318.1| PREDICTED: syntaxin-52-like isoform X1 [Malus domestica]
Length=240

 Score =   245 bits (625),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK  QMASTL  SN +NRDSLLGPEI   DAM RT GLDN G+V LQRQIMKE
Sbjct  91   DMIGNLRSKVKQMASTLT-SNSSNRDSLLGPEINKTDAMGRTVGLDNYGLVGLQRQIMKE  149

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEEL L TRLIDDLD+HV+VTDSRL+RVQK LA+LNKR
Sbjct  150  QDEGLEKLEETVISTKHIALAVNEELDLHTRLIDDLDDHVEVTDSRLRRVQKNLAVLNKR  209

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  210  TKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  240



>ref|XP_010459159.1| PREDICTED: syntaxin-51-like [Camelina sativa]
Length=232

 Score =   243 bits (620),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSKANQMA+ LNMSNFANRDSLLGPEIKP D+MSR  G+DN G+V  QRQ+M+E
Sbjct  82   DMVGNLRSKANQMANALNMSNFANRDSLLGPEIKPDDSMSRVTGMDNQGIVGYQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIA+AV EEL LQTRLIDDLD HVDVTDSRLQRVQK+LA++NK 
Sbjct  142  QDEGLEKLEETVMSTKHIAMAVGEELDLQTRLIDDLDYHVDVTDSRLQRVQKQLAVMNKN  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  202  MKSGCSCMAMLLSVLGIVGLAVVIWLLVKYL  232



>ref|XP_010099994.1| hypothetical protein L484_014031 [Morus notabilis]
 gb|EXB81099.1| hypothetical protein L484_014031 [Morus notabilis]
Length=223

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 129/151 (85%), Gaps = 8/151 (5%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA LRSK NQMAS LNMSNFANRDSLLGPEIKP DAMSRT GL+NSGVV        E
Sbjct  81   DMLANLRSKVNQMASALNMSNFANRDSLLGPEIKPADAMSRTVGLENSGVV--------E  132

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L  RLIDDLD HVDVTDSRL+RVQK LA LNKR
Sbjct  133  QDEGLEKLEETVVSTKHIALAVNEELDLHARLIDDLDYHVDVTDSRLRRVQKSLAFLNKR  192

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML SV+GIV L+AVI++L K+L
Sbjct  193  TKGGCSCMCMLSSVLGIVGLVAVIFLLVKYL  223



>ref|XP_009361064.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
Length=231

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK  QMASTL  SN +NRDSLLG EI   DAM RT GLDN G+V LQRQIMKE
Sbjct  82   DMIGNLRSKVKQMASTLT-SNSSNRDSLLGSEINKTDAMGRTVGLDNYGLVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEEL L TRLIDDLD+HV+VTDSRL+RVQK LA+LNKR
Sbjct  141  QDEGLEKLEETVISTKHIALAVNEELDLHTRLIDDLDDHVEVTDSRLRRVQKNLAVLNKR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  201  TKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  231



>ref|XP_006452473.1| hypothetical protein CICLE_v10009364mg [Citrus clementina]
 ref|XP_006474986.1| PREDICTED: syntaxin-51-like [Citrus sinensis]
 gb|ESR65713.1| hypothetical protein CICLE_v10009364mg [Citrus clementina]
 gb|KDO62148.1| hypothetical protein CISIN_1g026774mg [Citrus sinensis]
Length=233

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA LRSK NQMASTLNMSNFANRDSLLGPEIK  D M+R  GLDN G+V  QRQIM+E
Sbjct  83   DMLANLRSKVNQMASTLNMSNFANRDSLLGPEIKSADVMNRATGLDNQGLVGFQRQIMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLD+HVDVTDSRL+RVQK LAILNKR
Sbjct  143  QDEGLEKLEETVVSTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLRRVQKNLAILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGC+CMCML++VIGIVVL+ VIYML K+L
Sbjct  203  TKGGCTCMCMLLAVIGIVVLVVVIYMLIKYL  233



>ref|XP_009361063.1| PREDICTED: syntaxin-52-like isoform X1 [Pyrus x bretschneideri]
Length=240

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK  QMASTL  SN +NRDSLLG EI   DAM RT GLDN G+V LQRQIMKE
Sbjct  91   DMIGNLRSKVKQMASTLT-SNSSNRDSLLGSEINKTDAMGRTVGLDNYGLVGLQRQIMKE  149

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEEL L TRLIDDLD+HV+VTDSRL+RVQK LA+LNKR
Sbjct  150  QDEGLEKLEETVISTKHIALAVNEELDLHTRLIDDLDDHVEVTDSRLRRVQKNLAVLNKR  209

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  210  TKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  240



>emb|CDX88551.1| BnaC06g39950D [Brassica napus]
Length=233

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSKANQ+AS LNMSNFANRDSLLGPE KP DAM+R +G+DN G+V  QRQ+M+E
Sbjct  83   DMVGNLRSKANQVASALNMSNFANRDSLLGPETKPDDAMNRVSGMDNQGIVGFQRQVMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLI+DLD HVDVTDSRL+RVQK LA++NK 
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELTLQTRLIEDLDYHVDVTDSRLRRVQKSLAVMNKN  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KGGCSCM ML+SV+GIV L  VI++L K+L
Sbjct  203  MKGGCSCMSMLLSVLGIVGLALVIWLLVKYL  233



>gb|KHM99515.1| Syntaxin-51 [Glycine soja]
Length=234

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA LR+K NQMASTLNMSNFANRDSLLGPEIK  DAMSRT GLDNSG+V LQRQIMKE
Sbjct  85   DMLANLRTKVNQMASTLNMSNFANRDSLLGPEIKS-DAMSRTVGLDNSGLVGLQRQIMKE  143

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+GLEKLEETVISTKHIALAVNEEL L TRLIDDLD+HVDVTDSRL+RVQK LA+LNKR
Sbjct  144  QDDGLEKLEETVISTKHIALAVNEELNLHTRLIDDLDQHVDVTDSRLRRVQKNLAVLNKR  203

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+CML+SVIGIV L+ VI++L K+L
Sbjct  204  TKGGCSCLCMLLSVIGIVGLVVVIWLLVKYL  234



>ref|XP_003532151.1| PREDICTED: syntaxin-51-like isoform X1 [Glycine max]
 ref|XP_006586106.1| PREDICTED: syntaxin-51-like isoform X2 [Glycine max]
Length=228

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA LR+K NQMASTLNMSNFANRDSLLGPEIK  DAMSRT GLDNSG+V LQRQIMKE
Sbjct  79   DMLANLRTKVNQMASTLNMSNFANRDSLLGPEIKS-DAMSRTVGLDNSGLVGLQRQIMKE  137

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+GLEKLEETVISTKHIALAVNEEL L TRLIDDLD+HVDVTDSRL+RVQK LA+LNKR
Sbjct  138  QDDGLEKLEETVISTKHIALAVNEELNLHTRLIDDLDQHVDVTDSRLRRVQKNLAVLNKR  197

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+CML+SVIGIV L+ VI++L K+L
Sbjct  198  TKGGCSCLCMLLSVIGIVGLVVVIWLLVKYL  228



>ref|XP_009117773.1| PREDICTED: syntaxin-51-like [Brassica rapa]
Length=233

 Score =   241 bits (614),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRS+ANQMA+TLNMSNFANRDSLLG EIKP D MSR + +DN G+V  QRQ+MKE
Sbjct  83   DMIGNLRSQANQMANTLNMSNFANRDSLLGSEIKPDDTMSRVSSMDNQGIVGFQRQVMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEELGLQTRLIDDLD HVDVTDSRL+RVQK LA++NK 
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELGLQTRLIDDLDYHVDVTDSRLRRVQKNLAVMNKN  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             + GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  203  MRSGCSCMSMLLSVLGIVGLAVVIWLLVKYL  233



>ref|XP_010476728.1| PREDICTED: syntaxin-51 [Camelina sativa]
Length=232

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK+NQMA+ LNMSNFANRDSLLGPEIKP D+MSR  G+DN G+V  QRQ+M+E
Sbjct  82   DMVGNLRSKSNQMANALNMSNFANRDSLLGPEIKPDDSMSRVTGMDNQGIVGYQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIA+AV EEL LQTRLIDDLD HVDVTDSRLQRVQK LA++NK 
Sbjct  142  QDEGLEKLEETVMSTKHIAMAVGEELDLQTRLIDDLDYHVDVTDSRLQRVQKNLAVMNKN  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  202  MKSGCSCMSMLLSVLGIVGLAVVIWLLVKYL  232



>gb|KHG00459.1| Syntaxin-51 -like protein [Gossypium arboreum]
Length=237

 Score =   240 bits (613),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 134/158 (85%), Gaps = 8/158 (5%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK-  435
            DM+A LRSKANQMAS  NMSNFANR+SLLGPE K  DAMSRT GLDNSG+V LQRQIMK 
Sbjct  81   DMVANLRSKANQMASAFNMSNFANRESLLGPETKQ-DAMSRTVGLDNSGLVGLQRQIMKG  139

Query  434  ------EQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKR  273
                  EQDEGLEKLEETV+S KHIALAVNEEL L TRLIDDLD+HVDVTDSRL+RVQK 
Sbjct  140  KVCFQAEQDEGLEKLEETVMSAKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLRRVQKN  199

Query  272  LAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            LAILNKR KG CSCMCML++V+GIV+L+  IY++ K+L
Sbjct  200  LAILNKRAKGSCSCMCMLLAVVGIVILVVAIYLVVKYL  237



>ref|XP_010497722.1| PREDICTED: syntaxin-51-like [Camelina sativa]
 ref|XP_010497725.1| PREDICTED: syntaxin-51-like [Camelina sativa]
Length=232

 Score =   240 bits (612),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK+NQMA+ LNMSNFANRDSLLGPEIKP D+MSR  G+DN G+V  QRQ+M+E
Sbjct  82   DMVGNLRSKSNQMANALNMSNFANRDSLLGPEIKPDDSMSRVTGMDNQGIVGYQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE+LEETV+STKHIA+AV EEL LQTRLIDDLD HVDVTDSRLQRVQK LA++NK 
Sbjct  142  QDEGLERLEETVMSTKHIAMAVGEELDLQTRLIDDLDYHVDVTDSRLQRVQKHLAVMNKN  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  202  MKSGCSCMSMLLSVLGIVGLAVVIWLLVKYL  232



>ref|XP_009128371.1| PREDICTED: syntaxin-52 isoform X1 [Brassica rapa]
 ref|XP_009128374.1| PREDICTED: syntaxin-52 isoform X3 [Brassica rapa]
Length=236

 Score =   240 bits (612),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSKANQ+AS LNMSNFANRDSLLGP+ KP DA++R +G+DN G+V  QRQIM+E
Sbjct  86   DMVGNLRSKANQVASALNMSNFANRDSLLGPDTKPDDAINRVSGMDNQGIVGFQRQIMRE  145

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLIDDLD HVDVTDSRL+RVQK LA++NK 
Sbjct  146  QDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDDLDYHVDVTDSRLRRVQKSLAVMNKN  205

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KGGCSCM ML+SV+GIV L  VI++L K+L
Sbjct  206  MKGGCSCMSMLLSVLGIVGLALVIWLLVKYL  236



>ref|XP_009128372.1| PREDICTED: syntaxin-52 isoform X2 [Brassica rapa]
 ref|XP_009128373.1| PREDICTED: syntaxin-52 isoform X2 [Brassica rapa]
 emb|CDY49743.1| BnaA02g19290D [Brassica napus]
Length=234

 Score =   240 bits (612),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSKANQ+AS LNMSNFANRDSLLGP+ KP DA++R +G+DN G+V  QRQIM+E
Sbjct  84   DMVGNLRSKANQVASALNMSNFANRDSLLGPDTKPDDAINRVSGMDNQGIVGFQRQIMRE  143

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLIDDLD HVDVTDSRL+RVQK LA++NK 
Sbjct  144  QDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDDLDYHVDVTDSRLRRVQKSLAVMNKN  203

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KGGCSCM ML+SV+GIV L  VI++L K+L
Sbjct  204  MKGGCSCMSMLLSVLGIVGLALVIWLLVKYL  234



>emb|CDY52847.1| BnaA09g56390D [Brassica napus]
Length=233

 Score =   239 bits (611),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRS+ANQMA+TLNMSNFANRDSLLG EIKP D MSR + +DN G+V  QRQ+M+E
Sbjct  83   DMIGNLRSQANQMANTLNMSNFANRDSLLGSEIKPDDTMSRVSSMDNQGIVGFQRQVMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEELGLQTRLIDDLD HVDVTDSRL+RVQK LA++NK 
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELGLQTRLIDDLDYHVDVTDSRLRRVQKNLAVMNKN  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             + GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  203  MRSGCSCMSMLLSVLGIVGLAVVIWLLVKYL  233



>gb|AFK40910.1| unknown [Lotus japonicus]
Length=229

 Score =   239 bits (610),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 140/151 (93%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D LA LRSK NQMASTLNMSNFANRDSLLGPEIKP DAMSRT GLDNSG+V LQRQIMKE
Sbjct  80   DTLANLRSKVNQMASTLNMSNFANRDSLLGPEIKP-DAMSRTAGLDNSGLVGLQRQIMKE  138

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+GLEKLEETVISTKHIALAVNEEL L TRLIDDLDEHVDVTDSRL+RVQK LA+LNKR
Sbjct  139  QDDGLEKLEETVISTKHIALAVNEELTLHTRLIDDLDEHVDVTDSRLRRVQKHLAVLNKR  198

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+CML++V+GIV+L+ VI++L K+L
Sbjct  199  TKGGCSCLCMLLAVVGIVILVVVIWLLVKYL  229



>ref|XP_006302763.1| hypothetical protein CARUB_v10020885mg [Capsella rubella]
 gb|EOA35661.1| hypothetical protein CARUB_v10020885mg [Capsella rubella]
Length=233

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSK NQ+ASTLNMSNFANRDSLLGP+IKP DA++R +G+DN G+V  QRQ+M+E
Sbjct  83   DMVANLRSKTNQVASTLNMSNFANRDSLLGPDIKPDDALNRVSGMDNQGIVVFQRQVMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLIDDLD HVD TDSRL+RVQK LA++NK 
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDDLDYHVDATDSRLRRVQKSLAVMNKS  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  203  MKSGCSCMSMLLSVLGIVGLALVIWLLVKYL  233



>ref|XP_003551745.1| PREDICTED: syntaxin-52-like isoform X1 [Glycine max]
Length=229

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 138/151 (91%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ LR+K NQMASTLNMSNFANRDSL GPEIK  DAMSRT GLDNSG+V LQRQIMKE
Sbjct  80   DMLSNLRTKVNQMASTLNMSNFANRDSLFGPEIKS-DAMSRTVGLDNSGLVGLQRQIMKE  138

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+GLEKLEETVISTKHIALAVNEEL L TRLIDDLD+HVDVTDSRL+RVQK LA+LNKR
Sbjct  139  QDDGLEKLEETVISTKHIALAVNEELNLHTRLIDDLDQHVDVTDSRLRRVQKNLAVLNKR  198

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+CML+SVIGIV L+ VI++L K+L
Sbjct  199  TKGGCSCLCMLLSVIGIVGLVVVIWLLVKYL  229



>ref|XP_004500114.1| PREDICTED: syntaxin-52-like [Cicer arietinum]
Length=229

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 140/151 (93%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D LA LRSK NQMASTLNMSNFANRDSLLGPEIKP DAMSRT GLDNSG+V LQRQ+MKE
Sbjct  80   DNLANLRSKVNQMASTLNMSNFANRDSLLGPEIKP-DAMSRTVGLDNSGLVGLQRQVMKE  138

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLDEHVDVTDSRL+RVQK LAILNKR
Sbjct  139  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLDEHVDVTDSRLRRVQKNLAILNKR  198

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+CML+SVIGIVVL+ VI++L K+L
Sbjct  199  TKGGCSCLCMLLSVIGIVVLVVVIWLLVKYL  229



>gb|AFK40726.1| unknown [Lotus japonicus]
Length=233

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 135/151 (89%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA+LRS+ N+MASTL+M NF+NRDSL GPEIKP DAMSRTNGLDN GV+ LQRQIMKE
Sbjct  84   DMLASLRSRVNEMASTLSMPNFSNRDSLFGPEIKP-DAMSRTNGLDNKGVIGLQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEE+V STKHIALAVNEEL L T LIDDLD+HVDVTDSRL+RVQK LA+LNKR
Sbjct  143  QDEGLEKLEESVTSTKHIALAVNEELDLHTSLIDDLDQHVDVTDSRLRRVQKNLAVLNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            T GGCSC+CML+SVIGI VL+ VI +L K+L
Sbjct  203  TNGGCSCLCMLLSVIGIAVLVVVIGLLVKYL  233



>ref|XP_009343645.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343646.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
Length=231

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LR K  QMASTL  SN ANRDSLLG EI   DAM RT GLDN G+V LQRQIMKE
Sbjct  82   DMIGNLRLKVKQMASTLT-SNTANRDSLLGSEINKADAMGRTVGLDNYGLVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLD+HV+VTDSRL+RVQK LA+LNKR
Sbjct  141  QDEGLEKLEETVVSTKHIALAVNEELDLHTRLIDDLDDHVEVTDSRLRRVQKNLAVLNKR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  201  TKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  231



>ref|XP_009343644.1| PREDICTED: syntaxin-52-like isoform X1 [Pyrus x bretschneideri]
Length=240

 Score =   239 bits (609),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LR K  QMASTL  SN ANRDSLLG EI   DAM RT GLDN G+V LQRQIMKE
Sbjct  91   DMIGNLRLKVKQMASTLT-SNTANRDSLLGSEINKADAMGRTVGLDNYGLVGLQRQIMKE  149

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLD+HV+VTDSRL+RVQK LA+LNKR
Sbjct  150  QDEGLEKLEETVVSTKHIALAVNEELDLHTRLIDDLDDHVEVTDSRLRRVQKNLAVLNKR  209

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  210  TKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  240



>ref|XP_010417628.1| PREDICTED: syntaxin-52-like [Camelina sativa]
Length=233

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK NQ+AS LNMSNFANRDSLLGP+IKP DAM R +G+DN G+V  QRQ+M+E
Sbjct  83   DMVGNLRSKTNQVASALNMSNFANRDSLLGPDIKPDDAMKRVSGMDNQGIVGFQRQVMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLIDDLD HVDVTDSRL+RVQK LA++NK 
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDDLDYHVDVTDSRLRRVQKSLAVMNKS  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  203  MKSGCSCMSMLLSVLGIVGLALVIWLLVKYL  233



>ref|XP_010472824.1| PREDICTED: syntaxin-52 [Camelina sativa]
Length=233

 Score =   238 bits (608),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK NQ+AS LNMSNFANRDSLLGP+IKP DAM R +G+DN G+V  QRQ+M+E
Sbjct  83   DMVGNLRSKTNQVASALNMSNFANRDSLLGPDIKPDDAMKRVSGMDNQGIVGFQRQVMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLIDDLD HVDVTDSRL+RVQK LA++NK 
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDDLDYHVDVTDSRLRRVQKSLAVMNKS  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  203  MKSGCSCMSMLISVLGIVGLALVIWLLVKYL  233



>ref|XP_010429855.1| PREDICTED: syntaxin-52-like [Camelina sativa]
Length=233

 Score =   238 bits (607),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK NQ+AS LNMSNFANRDSLLGP+IKP DAM R +G+DN G+V  QRQ+M+E
Sbjct  83   DMVGNLRSKTNQVASALNMSNFANRDSLLGPDIKPDDAMKRVSGMDNQGIVGFQRQVMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLIDDLD HVDVTDSRL+RVQK LA++NK 
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDDLDYHVDVTDSRLRRVQKSLAVMNKS  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  203  MKSGCSCMSMLISVLGIVGLALVIWLLVKYL  233



>ref|XP_011461087.1| PREDICTED: syntaxin-52-like [Fragaria vesca subsp. vesca]
Length=232

 Score =   238 bits (607),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A L+SK +QM+STL  S+  NRDSLLGPEI   DAM RT GLDN G+V LQRQ+MKE
Sbjct  83   DMIANLKSKVSQMSSTLT-SHSGNRDSLLGPEISKADAMGRTAGLDNYGLVGLQRQVMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGL++LEETV+STKHIALAVNEEL L TRLIDDLDEHVDVTDSRLQRVQK LA LNKR
Sbjct  142  QDEGLDRLEETVVSTKHIALAVNEELTLHTRLIDDLDEHVDVTDSRLQRVQKNLAALNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML++V+GIV L+AVI++L K+L
Sbjct  202  TKGGCSCMCMLLAVLGIVGLVAVIFLLIKYL  232



>ref|XP_009334172.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
Length=240

 Score =   238 bits (607),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LR K  QMASTL  SN ANRDSLLG EI   DAM RT GLDN G+V LQRQIMKE
Sbjct  91   DMIGNLRLKVKQMASTLT-SNTANRDSLLGSEINKADAMGRTVGLDNYGLVGLQRQIMKE  149

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEE+ L TRLIDDLD+HV+VTDSRL+RVQK LA+LNKR
Sbjct  150  QDEGLEKLEETVVSTKHIALAVNEEIDLHTRLIDDLDDHVEVTDSRLRRVQKNLAVLNKR  209

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  210  TKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  240



>ref|XP_009334173.1| PREDICTED: syntaxin-52-like isoform X3 [Pyrus x bretschneideri]
Length=231

 Score =   238 bits (606),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LR K  QMASTL  SN ANRDSLLG EI   DAM RT GLDN G+V LQRQIMKE
Sbjct  82   DMIGNLRLKVKQMASTLT-SNTANRDSLLGSEINKADAMGRTVGLDNYGLVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEE+ L TRLIDDLD+HV+VTDSRL+RVQK LA+LNKR
Sbjct  141  QDEGLEKLEETVVSTKHIALAVNEEIDLHTRLIDDLDDHVEVTDSRLRRVQKNLAVLNKR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  201  TKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  231



>gb|KHN30881.1| Syntaxin-51 [Glycine soja]
Length=229

 Score =   238 bits (606),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 137/151 (91%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  LR+K NQMASTLNMSNFANRDSL GPEIK  DAMSRT GLDNSG+V LQRQIMKE
Sbjct  80   DMLLNLRTKVNQMASTLNMSNFANRDSLFGPEIKS-DAMSRTVGLDNSGLVGLQRQIMKE  138

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+GLEKLEETVISTKHIALAVNEEL L TRLIDDLD+HVDVTDSRL+RVQK LA+LNKR
Sbjct  139  QDDGLEKLEETVISTKHIALAVNEELNLHTRLIDDLDQHVDVTDSRLRRVQKNLAVLNKR  198

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+CML+SVIGIV L+ VI++L K+L
Sbjct  199  TKGGCSCLCMLLSVIGIVGLVVVIWLLVKYL  229



>ref|XP_006602182.1| PREDICTED: syntaxin-52-like isoform X2 [Glycine max]
Length=251

 Score =   238 bits (607),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 138/151 (91%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ LR+K NQMASTLNMSNFANRDSL GPEIK  DAMSRT GLDNSG+V LQRQIMKE
Sbjct  102  DMLSNLRTKVNQMASTLNMSNFANRDSLFGPEIKS-DAMSRTVGLDNSGLVGLQRQIMKE  160

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+GLEKLEETVISTKHIALAVNEEL L TRLIDDLD+HVDVTDSRL+RVQK LA+LNKR
Sbjct  161  QDDGLEKLEETVISTKHIALAVNEELNLHTRLIDDLDQHVDVTDSRLRRVQKNLAVLNKR  220

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+CML+SVIGIV L+ VI++L K+L
Sbjct  221  TKGGCSCLCMLLSVIGIVGLVVVIWLLVKYL  251



>ref|XP_010675821.1| PREDICTED: syntaxin-52-like [Beta vulgaris subsp. vulgaris]
Length=234

 Score =   237 bits (605),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ LR+K NQMA+TLNMSNFANRDSLLGPE KPVDAM+R  GLDN G+V+LQRQIM+E
Sbjct  84   DMLSNLRTKTNQMATTLNMSNFANRDSLLGPESKPVDAMTRVAGLDNQGIVSLQRQIMRE  143

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE+LEETV+STKHIAL VNEEL L TRLID+LD+HV+ T SRLQR+ + LA LNK+
Sbjct  144  QDEGLEQLEETVMSTKHIALTVNEELELHTRLIDNLDQHVEFTGSRLQRISRSLANLNKK  203

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+C+L++V GIV+LI  I++L K+L
Sbjct  204  TKGGCSCLCLLVAVAGIVILILAIFVLIKYL  234



>ref|XP_007211870.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
 gb|EMJ13069.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
Length=232

 Score =   237 bits (604),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+ TLRSK  QM++TL  S+ ANRDSLLGPEI   DAM RT GLDN G+V LQRQ+MKE
Sbjct  83   DMIGTLRSKVLQMSTTLT-SHSANRDSLLGPEINKADAMGRTVGLDNYGLVGLQRQVMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L  RLIDDLDEHV+VTDSRL+RVQK LA+LNKR
Sbjct  142  QDEGLEKLEETVVSTKHIALAVNEELDLHARLIDDLDEHVEVTDSRLRRVQKNLAVLNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+ V+GIVVL+AVI++L K+L
Sbjct  202  TKGGCSCMCMLLCVVGIVVLLAVIFLLIKYL  232



>ref|XP_004149588.1| PREDICTED: syntaxin-52-like [Cucumis sativus]
 ref|XP_004161879.1| PREDICTED: syntaxin-52-like [Cucumis sativus]
Length=233

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  +RSK  QMASTLNMSNFANRDSLLGPE+K  D MS+T  LDN G+V  QR+IMKE
Sbjct  83   DMLVQMRSKVKQMASTLNMSNFANRDSLLGPEMKSADVMSKTAELDNQGLVGFQRKIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEET+ STKHIALAVNEEL L TRLIDDLD+HVDVTDS+L RVQKRL I+NKR
Sbjct  143  QDEGLEKLEETITSTKHIALAVNEELSLHTRLIDDLDQHVDVTDSQLARVQKRLGIMNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KG CSC  ML+SV+GIVVLI VI++L ++L
Sbjct  203  AKGSCSCFGMLLSVVGIVVLITVIWLLVQYL  233



>gb|ACU23148.1| unknown [Glycine max]
Length=229

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 137/151 (91%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ LR+K NQMASTLNMSNFANRDSL GPEIK  DAMSRT GLDNSG+V LQRQIMKE
Sbjct  80   DMLSNLRTKVNQMASTLNMSNFANRDSLFGPEIKS-DAMSRTVGLDNSGLVGLQRQIMKE  138

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+GLEKLEETVISTKHIALAVNEEL L TRLIDDLD+HVDVTD RL+RVQK LA+LNKR
Sbjct  139  QDDGLEKLEETVISTKHIALAVNEELNLHTRLIDDLDQHVDVTDFRLRRVQKNLAVLNKR  198

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+CML+SVIGIV L+ VI++L K+L
Sbjct  199  TKGGCSCLCMLLSVIGIVGLVVVIWLLVKYL  229



>ref|XP_009416129.1| PREDICTED: syntaxin-52-like [Musa acuminata subsp. malaccensis]
 ref|XP_009416130.1| PREDICTED: syntaxin-52-like [Musa acuminata subsp. malaccensis]
Length=233

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            +MLA ++SKANQMASTLNMSNF NR+ L G  IK  D MSRT+GLDN G+VALQRQ+M+E
Sbjct  83   EMLANMKSKANQMASTLNMSNFGNREDLFGDGIKSADVMSRTSGLDNQGIVALQRQVMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLDEHVDVTDSRLQRVQKRLAILNKR
Sbjct  143  QDEGLEKLEETVLSTKHIALAVNEELDLHTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SV+ IV+L+ V ++L K+L
Sbjct  203  TKGGCSCMCLLLSVVAIVILVIVAWLLIKYL  233



>ref|XP_004976388.1| PREDICTED: syntaxin-52-like [Setaria italica]
Length=231

 Score =   236 bits (601),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ L+SKA QMA++ NMSNFANR+ LLG + K  D MSR  GLDN G+V LQRQIMKE
Sbjct  82   DMLSNLKSKAKQMATSFNMSNFANREDLLG-QSKKADDMSRVAGLDNQGIVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDL++HVDVT+SRLQRVQKRLAILNKR
Sbjct  141  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLEDHVDVTNSRLQRVQKRLAILNKR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SVI IV+L  ++++L K+L
Sbjct  201  TKGGCSCMCLLLSVIAIVILAVIVWLLVKYL  231



>gb|ABR25694.1| syntaxin 51 [Oryza sativa Indica Group]
Length=174

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D L+ L+SK  QMA++ NMSNFANR+ LLG   K  D MSR  GLDN G+V LQRQIMKE
Sbjct  24   DTLSNLKSKTKQMATSFNMSNFANREDLLGQNKKAADDMSRVAGLDNQGIVGLQRQIMKE  83

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDL++HVDVT+SRLQRVQKRLAILNKR
Sbjct  84   QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLEDHVDVTNSRLQRVQKRLAILNKR  143

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SV+ IV+L  ++++L K++
Sbjct  144  TKGGCSCMCLLLSVVAIVILAVIVWLLIKYM  174



>ref|XP_008449105.1| PREDICTED: syntaxin-51-like [Cucumis melo]
 ref|XP_008449106.1| PREDICTED: syntaxin-51-like [Cucumis melo]
 ref|XP_008449108.1| PREDICTED: syntaxin-51-like [Cucumis melo]
 ref|XP_008449109.1| PREDICTED: syntaxin-51-like [Cucumis melo]
Length=231

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  +RS+  QMASTLNMSNFANRDSLLGPE+K VD MS+T  LDN G+V  QRQIMKE
Sbjct  82   DMLIQMRSEVKQMASTLNMSNFANRDSLLGPEMKSVDVMSKTAELDNQGLVGFQRQIMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEET+ISTKHIALAVNEEL L TRLIDDLD+HVDV DSRL RVQKRL I+NKR
Sbjct  142  QDEGLEKLEETIISTKHIALAVNEELDLHTRLIDDLDQHVDVIDSRLARVQKRLGIMNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYML  171
             KG CSC  ML+SV+GIVVLI VI++L
Sbjct  202  AKGSCSCFGMLLSVVGIVVLITVIWLL  228



>ref|XP_007211871.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
 gb|EMJ13070.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
Length=262

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+ TLRSK  QM++TL  S+ ANRDSLLGPEI   DAM RT GLDN G+V LQRQ+MKE
Sbjct  113  DMIGTLRSKVLQMSTTLT-SHSANRDSLLGPEINKADAMGRTVGLDNYGLVGLQRQVMKE  171

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L  RLIDDLDEHV+VTDSRL+RVQK LA+LNKR
Sbjct  172  QDEGLEKLEETVVSTKHIALAVNEELDLHARLIDDLDEHVEVTDSRLRRVQKNLAVLNKR  231

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+ V+GIVVL+AVI++L K+L
Sbjct  232  TKGGCSCMCMLLCVVGIVVLLAVIFLLIKYL  262



>ref|XP_006389870.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
 ref|XP_006389871.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
 gb|ESQ27156.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
 gb|ESQ27157.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
Length=233

 Score =   235 bits (599),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LR KANQ+AS LNMSNFANRDSL GPE+KP DAM+R +G+DN G+V  QRQ+M+E
Sbjct  83   DMVGNLRIKANQVASALNMSNFANRDSLFGPEMKPDDAMNRVSGMDNQGIVGFQRQVMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLID+LD HVDVTDSRL+RVQK LA++NK 
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDELDYHVDVTDSRLRRVQKSLAVMNKS  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  203  MKSGCSCMSMLLSVLGIVGLALVIWLLVKYL  233



>emb|CDX81754.1| BnaC08g38470D [Brassica napus]
Length=233

 Score =   235 bits (599),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRS+ANQMA+TLNMSNFANRDSLLG EIKP D +SR + +DN G+V  QRQ+M+E
Sbjct  83   DMIGNLRSQANQMANTLNMSNFANRDSLLGSEIKPDDTLSRVSSMDNQGIVGFQRQVMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEELGLQTRLIDDLD HV+VTDSRL+RVQK LA++NK 
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELGLQTRLIDDLDYHVEVTDSRLRRVQKNLAVMNKN  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             + GCSCM ML+S++GIV L  VI++L K+L
Sbjct  203  MRSGCSCMSMLLSMLGIVGLAVVIWLLVKYL  233



>ref|XP_009334171.1| PREDICTED: syntaxin-52-like isoform X1 [Pyrus x bretschneideri]
Length=287

 Score =   237 bits (604),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LR K  QMASTL  SN ANRDSLLG EI   DAM RT GLDN G+V LQRQIMKE
Sbjct  138  DMIGNLRLKVKQMASTLT-SNTANRDSLLGSEINKADAMGRTVGLDNYGLVGLQRQIMKE  196

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEE+ L TRLIDDLD+HV+VTDSRL+RVQK LA+LNKR
Sbjct  197  QDEGLEKLEETVVSTKHIALAVNEEIDLHTRLIDDLDDHVEVTDSRLRRVQKNLAVLNKR  256

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  257  TKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  287



>ref|NP_563994.1| syntaxin-51 [Arabidopsis thaliana]
 ref|NP_001031054.1| syntaxin-51 [Arabidopsis thaliana]
 sp|Q9SA23.1|SYP51_ARATH RecName: Full=Syntaxin-51; Short=AtSYP51 [Arabidopsis thaliana]
 gb|AAD34675.1|AC006341_3 ESTs gb|F15498, gb|H37515, gb|T41906, gb|T22448, gb|W43356 and 
gb|T20739 come from this gene [Arabidopsis thaliana]
 gb|AAK40223.1|AF355755_1 syntaxin of plants 51 [Arabidopsis thaliana]
 gb|AAL75885.1| At1g16240/F3O9_4 [Arabidopsis thaliana]
 gb|AAM19898.1| At1g16240/F3O9_4 [Arabidopsis thaliana]
 gb|AAM62551.1| unknown [Arabidopsis thaliana]
 dbj|BAH20194.1| AT1G16240 [Arabidopsis thaliana]
 gb|AEE29423.1| syntaxin-51 [Arabidopsis thaliana]
 gb|AEE29424.1| syntaxin-51 [Arabidopsis thaliana]
Length=232

 Score =   234 bits (598),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSKANQMA+ LNMSNFANRDSLLGP+IKP D+MSR  G+DN G+V  QRQ+M+E
Sbjct  82   DMVGNLRSKANQMANALNMSNFANRDSLLGPDIKPDDSMSRVTGMDNQGIVGYQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE+LE TV+STKHIALAV+EEL LQTRLIDDLD HVDVTDSRL+RVQK LA++NK 
Sbjct  142  QDEGLEQLEGTVMSTKHIALAVSEELDLQTRLIDDLDYHVDVTDSRLRRVQKSLAVMNKN  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             + GCSCM ML+SV+GIV L  VI+ML K++
Sbjct  202  MRSGCSCMSMLLSVLGIVGLAVVIWMLVKYM  232



>ref|XP_008227024.1| PREDICTED: syntaxin-52-like [Prunus mume]
Length=232

 Score =   234 bits (597),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+ TLRSK  QM+STL  S+ ANRDSLLGPEI   DAM RT GLDN G+V LQRQ+MKE
Sbjct  83   DMIGTLRSKVVQMSSTLT-SHSANRDSLLGPEINKADAMGRTVGLDNYGLVGLQRQVMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L   LIDDLD+HV+VTDSRL+RVQK LA+LNKR
Sbjct  142  QDEGLEKLEETVVSTKHIALAVNEELDLHAALIDDLDQHVEVTDSRLRRVQKNLAVLNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+ V+GIVVL+AVI++L K+L
Sbjct  202  TKGGCSCMCMLLCVVGIVVLLAVIFLLIKYL  232



>ref|XP_006416838.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
 ref|XP_006416839.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
 gb|ESQ35191.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
 gb|ESQ35192.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
Length=232

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRS+ANQMA+ LNMSN ANRDSLLG EIKP D M + +G+DN G+V  QRQ+M+E
Sbjct  82   DMIGNLRSQANQMANALNMSNLANRDSLLGSEIKPDDTMRQVSGMDNQGIVGFQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEELGLQTRLIDDLD HVD+TDSRL+RVQK LA++NK 
Sbjct  142  QDEGLEKLEETVMSTKHIALAVNEELGLQTRLIDDLDYHVDITDSRLRRVQKNLAVMNKN  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             + GCSCM ML+SV GIV L  VIY+L K+L
Sbjct  202  MRSGCSCMSMLLSVFGIVGLAVVIYLLVKYL  232



>ref|XP_009149057.1| PREDICTED: syntaxin-51 [Brassica rapa]
 emb|CDY35073.1| BnaA06g10830D [Brassica napus]
Length=232

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRS+ANQMAS LNMSNFANRDSLLG EIK  D+MSR   +DN G+V  QRQ+M+E
Sbjct  82   DMIGNLRSQANQMASALNMSNFANRDSLLGSEIKADDSMSRVASMDNQGIVGFQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEELGLQTRLIDDLD HVDVTDSRL+RVQK LA++NK 
Sbjct  142  QDEGLEKLEETVMSTKHIALAVNEELGLQTRLIDDLDYHVDVTDSRLRRVQKNLAVMNKN  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             + GCSCM ML+S++GIV L  VI++L K+L
Sbjct  202  MRSGCSCMSMLLSMLGIVGLAVVIWLLVKYL  232



>emb|CDY33349.1| BnaC05g12340D [Brassica napus]
Length=232

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRS+ANQMAS LNMSNFANRDSLLG EIK  D+MSR   +DN G+V  QRQ+M+E
Sbjct  82   DMIGNLRSQANQMASVLNMSNFANRDSLLGSEIKADDSMSRVASMDNQGIVGFQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEELGLQTRLIDDLD HVDVTDSRL+RVQK LA++NK 
Sbjct  142  QDEGLEKLEETVMSTKHIALAVNEELGLQTRLIDDLDYHVDVTDSRLRRVQKNLAVMNKN  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             + GCSCM ML+S++GIV L  VI++L K+L
Sbjct  202  MRSGCSCMSMLLSMLGIVGLAVVIWLLVKYL  232



>ref|XP_006659260.1| PREDICTED: syntaxin-52-like [Oryza brachyantha]
Length=232

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D L+ L+SKA QMA++ NMSNFANR+ LLG   K  D MSR  GLDN G+V LQRQ MKE
Sbjct  82   DTLSNLKSKAKQMATSFNMSNFANREDLLGQSKKAADDMSRVAGLDNQGIVGLQRQTMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDL++HVDVT+SRLQRVQKRLAILNKR
Sbjct  142  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLEDHVDVTNSRLQRVQKRLAILNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SV+ IV+L  ++++L ++L
Sbjct  202  TKGGCSCMCLLLSVVAIVILAVIVWLLIRYL  232



>ref|NP_001061436.1| Os08g0277900 [Oryza sativa Japonica Group]
 dbj|BAC99744.1| putative syntaxin of plants 52 [Oryza sativa Japonica Group]
 dbj|BAF23350.1| Os08g0277900 [Oryza sativa Japonica Group]
 dbj|BAG93077.1| unnamed protein product [Oryza sativa Japonica Group]
Length=232

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D L+ L+SK  QMA++ NMSNFANR+ LLG   K  D MSR  GLDN G+V LQRQIMKE
Sbjct  82   DTLSNLKSKTKQMATSFNMSNFANREDLLGQNKKAADDMSRVAGLDNQGIVGLQRQIMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDL++HVDVT+SRLQRVQKRLAILNKR
Sbjct  142  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLEDHVDVTNSRLQRVQKRLAILNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SV+ IV+L  ++++L K++
Sbjct  202  TKGGCSCMCLLLSVVAIVILAVIVWLLIKYM  232



>ref|XP_002887794.1| hypothetical protein ARALYDRAFT_477131 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64053.1| hypothetical protein ARALYDRAFT_477131 [Arabidopsis lyrata subsp. 
lyrata]
Length=233

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK NQ+AS LNMSNFANRDSLLGP+IKP DA++R +G+DN G+V  QRQIM+E
Sbjct  83   DMVGNLRSKTNQVASALNMSNFANRDSLLGPDIKPDDAINRVSGMDNQGIVGFQRQIMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLIDDLD  VDVTDSRL+RVQK LA++NK 
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDDLDYQVDVTDSRLRRVQKSLAVMNKS  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             K GCSCM M++SV+GIV L  VI++L K+L
Sbjct  203  MKSGCSCMSMVLSVLGIVGLALVIWLLVKYL  233



>ref|NP_001131944.1| uncharacterized protein LOC100193337 [Zea mays]
 gb|ACF80577.1| unknown [Zea mays]
Length=231

 Score =   233 bits (593),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML++L+SKA QMA++ NMSNFANR+ LLG    P D MSR  GLDN G+V LQRQIMKE
Sbjct  82   DMLSSLKSKAKQMATSFNMSNFANREDLLGQSKMP-DDMSRVAGLDNQGIVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDL++HVDVT+SRLQRVQKRLAILNKR
Sbjct  141  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLEDHVDVTNSRLQRVQKRLAILNKR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC C+L+SV+ IV+L  ++++L K+L
Sbjct  201  TKGGCSCTCLLLSVVAIVILAVIVWLLVKYL  231



>ref|XP_007142350.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
 ref|XP_007142351.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
 gb|ESW14344.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
 gb|ESW14345.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
Length=232

 Score =   233 bits (593),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA+LRS+ NQMASTLNMSNF+NRDSLLGPE KP DAM+RT G+DN+G+V  QRQ+MKE
Sbjct  83   DMLASLRSRVNQMASTLNMSNFSNRDSLLGPEGKP-DAMARTVGMDNNGLVGFQRQLMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE+LEET+ STKHIALAVNEELGL TRLID LD+HVDVTDSRL+RVQK LA+LNKR
Sbjct  142  QDEGLEQLEETIASTKHIALAVNEELGLHTRLIDGLDQHVDVTDSRLRRVQKNLAVLNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+CML+SV+GIV+L+ VI++L K+L
Sbjct  202  TKGGCSCLCMLLSVVGIVLLVIVIWLLVKYL  232



>ref|NP_001136935.1| uncharacterized protein LOC100217094 [Zea mays]
 gb|ACF82924.1| unknown [Zea mays]
 gb|AFW61960.1| SNARE domain containing protein [Zea mays]
Length=231

 Score =   232 bits (592),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM ++L+SKA QMA++ NMSNFANR+ LLG + K  D MSR  GLDN G+V LQRQIMKE
Sbjct  82   DMFSSLKSKAKQMATSFNMSNFANREDLLG-QSKKADDMSRVAGLDNQGIVVLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDL++HVDVT+SRLQRVQKRLAIL+KR
Sbjct  141  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLEDHVDVTNSRLQRVQKRLAILSKR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SV+ IV+L  ++++L K+L
Sbjct  201  TKGGCSCMCLLLSVVAIVILAVIVWLLVKYL  231



>emb|CDX87371.1| BnaA07g35020D [Brassica napus]
Length=526

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSKANQ+AS LNMSNFANRDSLLGPE KP DAM+R +G+DN G+V  QRQ+M+E
Sbjct  83   DMVGNLRSKANQVASALNMSNFANRDSLLGPETKPDDAMNRVSGMDNQGIVGFQRQVMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLI+DLD HVDVTDSRL+RVQK LA++NK 
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELTLQTRLIEDLDYHVDVTDSRLRRVQKSLAVMNKN  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KGGCSCM ML+SV+GIV L  VI++L K+L
Sbjct  203  MKGGCSCMSMLLSVLGIVGLALVIWLLVKYL  233



>ref|XP_010063061.1| PREDICTED: syntaxin-52-like [Eucalyptus grandis]
 ref|XP_010063062.1| PREDICTED: syntaxin-52-like [Eucalyptus grandis]
 gb|KCW70249.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
 gb|KCW70250.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
Length=233

 Score =   232 bits (591),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML++LR+K +QMAS LNMSN   RDSLLGP+ KP DAMSRT GLDN G+V LQRQ+MKE
Sbjct  83   DMLSSLRTKKDQMASALNMSNSRIRDSLLGPDAKPADAMSRTVGLDNQGIVGLQRQVMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEEL L TRLID LD+ VDVTDSRL+RVQK LAILNKR
Sbjct  143  QDEGLEKLEETVISTKHIALAVNEELDLHTRLIDSLDQQVDVTDSRLRRVQKNLAILNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KG C+CM ML++VI IV+L+  IY++ K++
Sbjct  203  MKGSCTCMSMLLAVIAIVILVVAIYLVIKYV  233



>emb|CDY68585.1| BnaAnng27700D [Brassica napus]
Length=236

 Score =   232 bits (592),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK-  435
            DM+  LRSKANQ+AS LNMSNFANRDSLLGP+ KP DA++R +G+DN G+V  QRQIM+ 
Sbjct  85   DMVGNLRSKANQVASALNMSNFANRDSLLGPDTKPDDAINRVSGMDNQGIVGFQRQIMRV  144

Query  434  EQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNK  255
            EQDEGLEKLEETV+S+KHIALAVNEEL LQTRLIDDLD HVDVTDSRL+RVQK LA++NK
Sbjct  145  EQDEGLEKLEETVMSSKHIALAVNEELTLQTRLIDDLDYHVDVTDSRLRRVQKSLAVMNK  204

Query  254  RTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
              KGGCSCM ML+SV+GI  L  VI++L K++
Sbjct  205  NMKGGCSCMSMLLSVLGIAGLALVIWLLVKYM  236



>gb|AFW61956.1| SNARE domain containing protein [Zea mays]
Length=275

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM ++L+SKA QMA++ NMSNFANR+ LLG + K  D MSR  GLDN G+V LQRQIMKE
Sbjct  126  DMFSSLKSKAKQMATSFNMSNFANREDLLG-QSKKADDMSRVAGLDNQGIVVLQRQIMKE  184

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDL++HVDVT+SRLQRVQKRLAIL+KR
Sbjct  185  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLEDHVDVTNSRLQRVQKRLAILSKR  244

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SV+ IV+L  ++++L K+L
Sbjct  245  TKGGCSCMCLLLSVVAIVILAVIVWLLVKYL  275



>ref|XP_008668816.1| PREDICTED: syntaxin-52-like [Zea mays]
Length=231

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 130/151 (86%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML++L+SKA QMA++ NMSNF NR+ LLG    P D MSR  GLDN G+V LQRQIMKE
Sbjct  82   DMLSSLKSKAKQMATSFNMSNFTNREDLLGQSKMP-DDMSRVAGLDNQGIVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDL++HVDVT+SRLQRVQKRLAILNKR
Sbjct  141  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLEDHVDVTNSRLQRVQKRLAILNKR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC C+L+SV+ IV+L  ++++L K+L
Sbjct  201  TKGGCSCTCLLLSVVAIVILAVIVWLLVKYL  231



>ref|XP_004491440.1| PREDICTED: syntaxin-52-like isoform X1 [Cicer arietinum]
Length=232

 Score =   230 bits (586),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 121/133 (91%), Gaps = 1/133 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA LRSK NQMAS+LNMSNFANRDSLLGPE+KP D M+R  GLDN+G+V  QRQ+MKE
Sbjct  83   DMLANLRSKVNQMASSLNMSNFANRDSLLGPEVKP-DVMNRIVGLDNNGLVGFQRQVMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE LE+TVISTKHIALAVNEELGL TRLIDDLD+HVDVTDSRL+RVQK LAILNKR
Sbjct  142  QDEGLESLEQTVISTKHIALAVNEELGLHTRLIDDLDQHVDVTDSRLRRVQKNLAILNKR  201

Query  251  TKGGCSCMCMLMS  213
            TKGGCSC CML+S
Sbjct  202  TKGGCSCFCMLLS  214



>gb|EEE68383.1| hypothetical protein OsJ_26713 [Oryza sativa Japonica Group]
Length=346

 Score =   233 bits (595),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D L+ L+SK  QMA++ NMSNFANR+ LLG   K  D MSR  GLDN G+V LQRQIMKE
Sbjct  196  DTLSNLKSKTKQMATSFNMSNFANREDLLGQNKKAADDMSRVAGLDNQGIVGLQRQIMKE  255

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDL++HVDVT+SRLQRVQKRLAILNKR
Sbjct  256  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLEDHVDVTNSRLQRVQKRLAILNKR  315

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SV+ IV+L  ++++L K++
Sbjct  316  TKGGCSCMCLLLSVVAIVILAVIVWLLIKYM  346



>ref|XP_006646793.1| PREDICTED: syntaxin-52-like [Oryza brachyantha]
Length=232

 Score =   229 bits (584),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ L+S+A QMA++ NMSNFANR+ LLG   K  D MSR  GLDN G+V LQRQ+MKE
Sbjct  82   DMLSNLKSRAKQMATSFNMSNFANREDLLGQSKKSADDMSRVAGLDNQGIVTLQRQVMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLD+HVDVT+SRLQRVQK LAILNKR
Sbjct  142  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLDDHVDVTNSRLQRVQKTLAILNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCM +++SV+ IV L  ++++L K++
Sbjct  202  TKGGCSCMSLMLSVVAIVFLTVIVWLLIKYM  232



>ref|XP_010537838.1| PREDICTED: syntaxin-51 [Tarenaya hassleriana]
 ref|XP_010537839.1| PREDICTED: syntaxin-51 [Tarenaya hassleriana]
Length=233

 Score =   229 bits (584),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSKANQMAS LNMSNFANRDSLLGPEIKP DAMSR +G+DN G+V  QRQ+M+E
Sbjct  83   DMIGNLRSKANQMASALNMSNFANRDSLLGPEIKPADAMSRVSGMDNQGIVGFQRQVMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLIDDLD HVDVTDSRL+RVQK LA +NKR
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELDLQTRLIDDLDYHVDVTDSRLRRVQKSLAFMNKR  202

Query  251  TKGGCSCMCMLMS  213
             +GGCSC+ ML+S
Sbjct  203  MRGGCSCISMLLS  215



>gb|EAY84230.1| hypothetical protein OsI_05611 [Oryza sativa Indica Group]
Length=232

 Score =   229 bits (584),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ L+S+A QMA++ NMSNFANR+ LLG   K  D MSR  GLDN G+V+LQRQ+MKE
Sbjct  82   DMLSNLKSRAKQMATSFNMSNFANREDLLGQSKKAADDMSRVAGLDNQGIVSLQRQVMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLD+HVDVT+SRLQRVQKRLAILNKR
Sbjct  142  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLDDHVDVTNSRLQRVQKRLAILNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KGGCSCM +L+SV+ IV L  + ++L K L
Sbjct  202  VKGGCSCMALLISVVAIVFLAVIAWLLIKHL  232



>gb|ACG31926.1| SNARE domain containing protein [Zea mays]
Length=231

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML++ +SKA QMA++ NMSNFANR+ LLG    P D MSR  GLDN G+V LQRQIMKE
Sbjct  82   DMLSSFKSKAKQMATSFNMSNFANREDLLGQSKMP-DDMSRVAGLDNQGIVXLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE LEETV+STKHIALAVNEEL L TRLIDDL++HVDVT+SRLQRVQKRLAILNKR
Sbjct  141  QDEGLEXLEETVLSTKHIALAVNEELTLHTRLIDDLEDHVDVTNSRLQRVQKRLAILNKR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC C+L+SV+ IV+L  ++++L K+L
Sbjct  201  TKGGCSCTCLLLSVVAIVILAVIVWLLVKYL  231



>ref|XP_010647220.1| PREDICTED: syntaxin-51-like [Vitis vinifera]
Length=233

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ LRSK +QMASTLNMSNFANRDSLLGPEIKP DAMSRT GLDN G+V LQRQIMKE
Sbjct  83   DMLSNLRSKVSQMASTLNMSNFANRDSLLGPEIKPADAMSRTTGLDNQGLVGLQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGL+ LEETVISTKHIALAVNEEL L TRLID LD+HVD TDSRL RVQK LAILNKR
Sbjct  143  QDEGLDNLEETVISTKHIALAVNEELDLHTRLIDTLDQHVDTTDSRLGRVQKNLAILNKR  202

Query  251  TKGGCSCMCM  222
            TKGGC+C CM
Sbjct  203  TKGGCTCFCM  212



>gb|EEC83251.1| hypothetical protein OsI_28573 [Oryza sativa Indica Group]
Length=396

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D L+ L+SK  QMA++ NMSNFANR+ LLG   K  D MSR  GLDN G+V LQRQIMKE
Sbjct  246  DTLSNLKSKTKQMATSFNMSNFANREDLLGQNKKAADDMSRVAGLDNQGIVGLQRQIMKE  305

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDL++HVDVT+SRLQRVQKRLAILNKR
Sbjct  306  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLEDHVDVTNSRLQRVQKRLAILNKR  365

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SV+ IV+L  ++++L K++
Sbjct  366  TKGGCSCMCLLLSVVAIVILAVIVWLLIKYM  396



>ref|XP_008787642.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
Length=232

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ LRSKA QMASTLNMSNFA R+ LLG + K  D ++RT GLDN GVV LQRQIM+E
Sbjct  83   DMLSNLRSKAKQMASTLNMSNFAKREDLLG-QSKSTDEINRTAGLDNHGVVGLQRQIMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE+LEETV+STKHIAL VNEEL L TRLID+LD HVD+T SRLQRVQ+RLAILNKR
Sbjct  142  QDEGLERLEETVLSTKHIALTVNEELDLHTRLIDNLDHHVDLTGSRLQRVQRRLAILNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SV+ +V+L  +++ L K+L
Sbjct  202  TKGGCSCMCLLLSVVAMVILAVIVWALIKYL  232



>gb|KHG18509.1| Syntaxin-51 -like protein [Gossypium arboreum]
Length=223

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 128/151 (85%), Gaps = 9/151 (6%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSK NQMAS  NMSNFANRDSLLGPE KP DAMSRT G+DNSG+V        E
Sbjct  82   DMVANLRSKVNQMASAFNMSNFANRDSLLGPESKP-DAMSRTVGVDNSGLV--------E  132

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDE LEKLEET++STKHIALAVNEEL LQTRLIDDLD+HVDV+DSRL+RVQK LA+LN+R
Sbjct  133  QDEDLEKLEETIVSTKHIALAVNEELDLQTRLIDDLDQHVDVSDSRLRRVQKNLAVLNRR  192

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            T+  CSCMCML++VIGIV+L  VIY+L K+L
Sbjct  193  TRDSCSCMCMLLAVIGIVILAVVIYLLIKYL  223



>ref|XP_009106789.1| PREDICTED: syntaxin-52-like [Brassica rapa]
Length=232

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+ +LRSKAN++AS LNMSNFANRDSLLGPE KP DAM+R +G+DN G+V  QRQ+M+E
Sbjct  82   DMVGSLRSKANKVASALNMSNFANRDSLLGPETKPDDAMNRVSGMDNQGIVGFQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLI+DLD HVDVTDSRL+RVQK LA++NK 
Sbjct  142  QDEGLEKLEETVMSTKHIALAVNEELTLQTRLIEDLDYHVDVTDSRLRRVQKSLAVMNKN  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAV  183
             KGGCSCM ML+SV+GIV L  V
Sbjct  202  MKGGCSCMSMLLSVLGIVGLALV  224



>gb|AFK34174.1| unknown [Lotus japonicus]
Length=233

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 135/151 (89%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA+LRS+ N+MASTL+M NF+NRDSL GPEIKP DAMSRTNGLDN GV+ LQRQIMKE
Sbjct  84   DMLASLRSRVNEMASTLSMPNFSNRDSLFGPEIKP-DAMSRTNGLDNKGVIGLQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEE+V STKHIALAVNEEL L T LIDDLD+HVD TDSRL+RVQK LA+LNKR
Sbjct  143  QDEGLEKLEESVTSTKHIALAVNEELDLHTSLIDDLDQHVDATDSRLRRVQKNLAVLNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            T GGCSC+CML+SVIGIVVL+ VI +L K+L
Sbjct  203  TNGGCSCLCMLLSVIGIVVLVVVIGLLVKYL  233



>ref|NP_001045701.1| Os02g0119400 [Oryza sativa Japonica Group]
 dbj|BAD08125.1| putative syntaxin of plants 52 [Oryza sativa Japonica Group]
 dbj|BAD07621.1| putative syntaxin of plants 52 [Oryza sativa Japonica Group]
 dbj|BAF07615.1| Os02g0119400 [Oryza sativa Japonica Group]
 gb|EAZ21521.1| hypothetical protein OsJ_05145 [Oryza sativa Japonica Group]
 dbj|BAG95712.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87292.1| unnamed protein product [Oryza sativa Japonica Group]
Length=232

 Score =   226 bits (577),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ L+S+A QMA++ NMSNFANR+ LLG   K  D MSR  GLDN G+V+LQRQ+MKE
Sbjct  82   DMLSNLKSRAKQMATSFNMSNFANREDLLGQSKKAADDMSRVAGLDNQGIVSLQRQVMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLD++VDVT+SRLQRVQKRLAILNKR
Sbjct  142  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLDDYVDVTNSRLQRVQKRLAILNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KGGCSCM +L+SV+ IV L  + ++L K L
Sbjct  202  VKGGCSCMALLISVVAIVFLAVIAWLLIKHL  232



>ref|XP_008784838.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
 ref|XP_008784839.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
 ref|XP_008784840.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
 ref|XP_008784841.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
Length=233

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A L+SKANQMAS LNMS+F+ R+ LLGP  K VD + RT+GLDN GVV LQRQIMKE
Sbjct  83   DMVANLKSKANQMASALNMSSFSKREDLLGPSKKSVDEIERTSGLDNYGVVHLQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDE LEKLEETVISTKHIALAVNEEL L TRLIDDLD+HVD T+SRLQRVQKRLA+ N+R
Sbjct  143  QDESLEKLEETVISTKHIALAVNEELDLHTRLIDDLDQHVDSTNSRLQRVQKRLAVFNRR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             K  CSC C+L+SV  IV+L A+ ++L K+L
Sbjct  203  VKRSCSCKCLLLSVGAIVILAAIAFILIKYL  233



>gb|KGN56069.1| hypothetical protein Csa_3G064180 [Cucumis sativus]
Length=230

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 125/151 (83%), Gaps = 3/151 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  +RSK  QMASTLNMSNFANRDSLLGPE+K  D MS+T  LDN G+V  QR+IMKE
Sbjct  83   DMLVQMRSKVKQMASTLNMSNFANRDSLLGPEMKSADVMSKTAELDNQGLVGFQRKIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEET+ STKHIALAVNEEL L TRLIDDLD+HVDVTDS+L    KRL I+NKR
Sbjct  143  QDEGLEKLEETITSTKHIALAVNEELSLHTRLIDDLDQHVDVTDSQL---AKRLGIMNKR  199

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KG CSC  ML+SV+GIVVLI VI++L ++L
Sbjct  200  AKGSCSCFGMLLSVVGIVVLITVIWLLVQYL  230



>ref|XP_010909005.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
Length=232

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ LRSKA QMASTLNMSNFANR+ LLG + K  D ++RT GLDN GVV LQRQIM+E
Sbjct  83   DMLSNLRSKAKQMASTLNMSNFANREDLLG-QSKSTDEINRTAGLDNYGVVGLQRQIMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGL +LEETV+STKHIAL VNEEL L T+LID+LD H D+T+SRLQRVQ+RLAILNKR
Sbjct  142  QDEGLGRLEETVLSTKHIALTVNEELDLHTKLIDNLDHHADLTNSRLQRVQRRLAILNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L SV+ IV+L  +++ L K+L
Sbjct  202  TKGGCSCMCLLSSVVAIVILAVIVWALIKYL  232



>ref|XP_010646520.1| PREDICTED: syntaxin-52-like [Vitis vinifera]
Length=334

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ LRSK +QMASTLNMSNFANRDSLLGPEIKP DAMSRT GLDN G+V LQRQIMKE
Sbjct  184  DMLSNLRSKVSQMASTLNMSNFANRDSLLGPEIKPADAMSRTTGLDNQGLVGLQRQIMKE  243

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGL+ LEETVISTKHIALAVNEEL L TRLID LD+HVD TDSRL RVQK LAILNKR
Sbjct  244  QDEGLDNLEETVISTKHIALAVNEELDLHTRLIDTLDQHVDTTDSRLGRVQKNLAILNKR  303

Query  251  TKGGCSCMCM  222
            TKGGC+C CM
Sbjct  304  TKGGCTCFCM  313



>ref|NP_565213.1| syntaxin-52 [Arabidopsis thaliana]
 ref|NP_001031301.1| syntaxin-52 [Arabidopsis thaliana]
 sp|Q94KK7.1|SYP52_ARATH RecName: Full=Syntaxin-52; Short=AtSYP52 [Arabidopsis thaliana]
 gb|AAK40224.1|AF355756_1 syntaxin of plants 52 [Arabidopsis thaliana]
 gb|AAO41986.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04091.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36269.1| syntaxin-52 [Arabidopsis thaliana]
 gb|AEE36270.1| syntaxin-52 [Arabidopsis thaliana]
Length=233

 Score =   225 bits (573),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK NQ+AS LNMSNFANRDSL G ++KP DA++R +G+DN G+V  QRQ+M+E
Sbjct  83   DMVGNLRSKTNQVASALNMSNFANRDSLFGTDLKPDDAINRVSGMDNQGIVVFQRQVMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLIDDLD  VD+TDSRL+RVQK LA++NK 
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDDLDYDVDITDSRLRRVQKSLALMNKS  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  203  MKSGCSCMSMLLSVLGIVGLALVIWLLVKYL  233



>dbj|BAJ85147.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95155.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS45154.1| Syntaxin-52 [Triticum urartu]
Length=232

 Score =   225 bits (573),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D L+ L+SKA QM ++ N+SNFANR+ LLG   K  D MSR  GLDN G+V LQRQ+M+E
Sbjct  82   DALSNLKSKAKQMGTSFNVSNFANREDLLGQSKKAADDMSRVAGLDNQGIVGLQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE+LEETV+STKHIALAVNEEL L TRLIDDL++HVDVT+SRLQRVQKRLAILNKR
Sbjct  142  QDEGLERLEETVLSTKHIALAVNEELTLHTRLIDDLEDHVDVTNSRLQRVQKRLAILNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KGGCSCMC+++SV  IV+L  ++++L K+L
Sbjct  202  AKGGCSCMCLMLSVAAIVLLAVIVWLLIKYL  232



>ref|XP_010940839.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
 ref|XP_010940848.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
 ref|XP_010940854.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
Length=233

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A L+SKA QMASTLNMSNF+ R+ LLGP  K VD + RT+GLDN GVV +QRQIMKE
Sbjct  83   DMVANLKSKAKQMASTLNMSNFSKREDLLGPSKKSVDEIDRTSGLDNYGVVHVQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDE LEKLEETVISTKHIALAVNEEL L TRLIDDLD+HVD T+SRLQRVQ RLA+LN+R
Sbjct  143  QDESLEKLEETVISTKHIALAVNEELDLHTRLIDDLDQHVDSTNSRLQRVQMRLAVLNRR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             K  CSC C+L+S+  IV+L AV ++L K+L
Sbjct  203  VKRSCSCKCLLLSMGAIVILAAVAFILIKYL  233



>dbj|BAJ97107.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=232

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ L+S+A QMA + NMS FANR+ LLG   K  D MSR  GLDN G+V LQRQIMKE
Sbjct  82   DMLSNLKSRAKQMAESFNMSTFANREDLLGQSKKAADDMSRVAGLDNQGIVGLQRQIMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLE+TV+S KH+ALAVNEEL L  RLIDDLD+HVD T+SRLQRVQKRLA+LNKR
Sbjct  142  QDEGLEKLEQTVLSAKHVALAVNEELDLHARLIDDLDDHVDGTNSRLQRVQKRLAVLNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KGGCSCM +L+S +GIV+L+ ++++L K+L
Sbjct  202  AKGGCSCMSLLLSTVGIVMLVVIVWLLIKYL  232



>gb|AAM64357.1| unknown [Arabidopsis thaliana]
Length=233

 Score =   223 bits (567),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK NQ+AS LNMSNFANRDSL G ++KP DA++R +G+DN G+V  QRQ+M+ 
Sbjct  83   DMVGNLRSKTNQVASALNMSNFANRDSLFGTDLKPDDAINRVSGMDNQGIVVFQRQVMRX  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLIDDLD  VD+TDSRL+RVQK LA++NK 
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDDLDYDVDITDSRLRRVQKSLALMNKS  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  203  MKSGCSCMSMLLSVLGIVGLALVIWLLVKYL  233



>ref|XP_009407478.1| PREDICTED: syntaxin-52-like [Musa acuminata subsp. malaccensis]
Length=233

 Score =   222 bits (565),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            +MLA L+SKA+QMAS LNMSNF+NR  L G   K  D +SRT GLDN G+V LQRQIM+E
Sbjct  83   EMLANLKSKADQMASELNMSNFSNRKDLFGDGKKSADVVSRTAGLDNQGIVGLQRQIMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLDEHVD+TD+RLQRVQKRLAIL+KR
Sbjct  143  QDEGLEKLEETVLSTKHIALAVNEELDLHTRLIDDLDEHVDITDTRLQRVQKRLAILSKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+SV+ IV+LI + ++L K+L
Sbjct  203  TKGGCSCMCLLLSVVAIVILIVIAWVLIKYL  233



>ref|XP_003573428.1| PREDICTED: syntaxin-52-like [Brachypodium distachyon]
 ref|XP_010233716.1| PREDICTED: syntaxin-52-like [Brachypodium distachyon]
 ref|XP_010233717.1| PREDICTED: syntaxin-52-like [Brachypodium distachyon]
Length=231

 Score =   221 bits (564),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ LRS+A QMAS+ NMS  ANR+ LLG   KP D MSR   LD+ G+V LQRQIMKE
Sbjct  81   DMLSNLRSRAKQMASSFNMSTSANREDLLGQTKKPADDMSRVAALDSQGIVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLE+TV+STKHIALAVNEEL L T+LI+DLD+HVD T+SRLQRVQK+LA+LNKR
Sbjct  141  QDEGLEKLEQTVLSTKHIALAVNEELDLHTKLIEDLDDHVDGTNSRLQRVQKKLAVLNKR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KGGCSCM +L+SV+ IV+L+ ++++L KFL
Sbjct  201  AKGGCSCMSLLLSVVSIVMLVVIVWLLMKFL  231



>ref|XP_010532045.1| PREDICTED: syntaxin-51-like isoform X2 [Tarenaya hassleriana]
Length=234

 Score =   220 bits (561),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM++ LRSKA+QMAS LN+SNFANRDSLLGPE K  D+MSR  G+DN G+V  QRQ+M+E
Sbjct  84   DMISNLRSKASQMASALNVSNFANRDSLLGPETKQTDSMSRVAGMDNQGIVGFQRQVMRE  143

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEEL LQTRLIDDLD HVDVTDSRL+RVQK LA++NKR
Sbjct  144  QDEGLEKLEETVISTKHIALAVNEELNLQTRLIDDLDYHVDVTDSRLRRVQKSLAVMNKR  203

Query  251  TKGGCSCMCMLMS  213
             +GGCSC+ ML+S
Sbjct  204  MRGGCSCVSMLLS  216



>gb|AHA84215.1| syntaxin-51 [Phaseolus vulgaris]
Length=359

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA+LRS+ NQMASTLNMSNF+NRDSLLGPE KP DAM+RT G+DN+G+V  QR +MKE
Sbjct  210  DMLASLRSRVNQMASTLNMSNFSNRDSLLGPEGKP-DAMARTVGMDNNGLVGFQRLLMKE  268

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE+LEET+ STKHIALAVNEELGL  RLID LD+HV+VTDS L+RVQK LA+LNKR
Sbjct  269  QDEGLEQLEETIASTKHIALAVNEELGLPPRLIDGLDQHVEVTDSPLRRVQKNLAVLNKR  328

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSC+CML+SV+GIV+L+ VI++L K+L
Sbjct  329  TKGGCSCLCMLLSVVGIVLLVIVIWLLVKYL  359



>ref|XP_010532042.1| PREDICTED: syntaxin-51-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010532044.1| PREDICTED: syntaxin-51-like isoform X1 [Tarenaya hassleriana]
Length=235

 Score =   218 bits (554),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 118/134 (88%), Gaps = 1/134 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM++ LRSKA+QMAS LN+SNFANRDSLLGPE K  D+MSR  G+DN G+V  QRQ+M+E
Sbjct  84   DMISNLRSKASQMASALNVSNFANRDSLLGPETKQTDSMSRVAGMDNQGIVGFQRQVMRE  143

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRL-QRVQKRLAILNK  255
            QDEGLEKLEETVISTKHIALAVNEEL LQTRLIDDLD HVDVTDSRL QRVQK LA++NK
Sbjct  144  QDEGLEKLEETVISTKHIALAVNEELNLQTRLIDDLDYHVDVTDSRLRQRVQKSLAVMNK  203

Query  254  RTKGGCSCMCMLMS  213
            R +GGCSC+ ML+S
Sbjct  204  RMRGGCSCVSMLLS  217



>gb|KJB62825.1| hypothetical protein B456_009G444600 [Gossypium raimondii]
Length=155

 Score =   213 bits (542),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK+NQMAS  NMSNFANRDSLLGPE KP D MSRT GLDNSG++ LQRQIMKE
Sbjct  6    DMVTNLRSKSNQMASAFNMSNFANRDSLLGPETKP-DTMSRTIGLDNSGLIGLQRQIMKE  64

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEET++STKHIALAV+EEL L T LIDDL +HVDVTDS LQRVQK + ILNK 
Sbjct  65   QDEGLEKLEETLVSTKHIALAVSEELDLHTTLIDDLGQHVDVTDSHLQRVQKNMGILNKH  124

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
              GG SCMCM ++VIGIVVL+ +IY+L K+L
Sbjct  125  INGGWSCMCMPLAVIGIVVLLVLIYLLIKYL  155



>gb|KJB62826.1| hypothetical protein B456_009G444600 [Gossypium raimondii]
Length=218

 Score =   214 bits (545),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK+NQMAS  NMSNFANRDSLLGPE KP D MSRT GLDNSG++ LQRQIMKE
Sbjct  69   DMVTNLRSKSNQMASAFNMSNFANRDSLLGPETKP-DTMSRTIGLDNSGLIGLQRQIMKE  127

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEET++STKHIALAV+EEL L T LIDDL +HVDVTDS LQRVQK + ILNK 
Sbjct  128  QDEGLEKLEETLVSTKHIALAVSEELDLHTTLIDDLGQHVDVTDSHLQRVQKNMGILNKH  187

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
              GG SCMCM ++VIGIVVL+ +IY+L K+L
Sbjct  188  INGGWSCMCMPLAVIGIVVLLVLIYLLIKYL  218



>ref|XP_006304162.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
 ref|XP_006304163.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
 gb|EOA37060.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
 gb|EOA37061.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
Length=232

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSKANQMA+ LNMSNFANRDSLLGPE KP D+MSR   +DN G+V  QR++MKE
Sbjct  82   DMVGNLRSKANQMATALNMSNFANRDSLLGPETKPDDSMSRVASMDNQGIVGYQRKVMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLE+LE TV+STKHIAL V+EELGLQTRLIDDLD HVDVTDSRL+RVQK LA+++K 
Sbjct  142  QDEGLEELEGTVMSTKHIALTVSEELGLQTRLIDDLDYHVDVTDSRLRRVQKNLAVMSKN  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             + GCSCM ML+SV+GIV L+ VI++L K++
Sbjct  202  MRSGCSCMSMLLSVLGIVGLVVVIWLLVKYM  232



>ref|XP_008385825.1| PREDICTED: syntaxin-52-like [Malus domestica]
 ref|XP_008385826.1| PREDICTED: syntaxin-52-like [Malus domestica]
 ref|XP_008385827.1| PREDICTED: syntaxin-52-like [Malus domestica]
 ref|XP_008359248.1| PREDICTED: syntaxin-52-like [Malus domestica]
Length=231

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LR K  QMASTL  SN ANRD LLG EI   DAM RT GLDN G+V LQRQIMKE
Sbjct  82   DMIGNLRLKVKQMASTLT-SNTANRDILLGSEINKADAMGRTVGLDNYGLVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLD+ V+VTDSRL+RVQK LA+LNKR
Sbjct  141  QDEGLEKLEETVVSTKHIALAVNEELDLHTRLIDDLDDQVEVTDSRLRRVQKNLAVLNKR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMCML+SV+G+VVL+AVI++L K+L
Sbjct  201  TKGGCSCMCMLLSVVGMVVLVAVIFLLIKYL  231



>gb|AAF68106.1|AC010793_1 F20B17.2 [Arabidopsis thaliana]
Length=260

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 128/178 (72%), Gaps = 27/178 (15%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSK NQ+AS LNMSNFANRDSL G ++KP DA++R +G+DN G+V  QRQ+M+E
Sbjct  83   DMVGNLRSKTNQVASALNMSNFANRDSLFGTDLKPDDAINRVSGMDNQGIVVFQRQVMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLI---------------------------  333
            QDEGLEKLEETV+STKHIALAVNEEL LQTRLI                           
Sbjct  143  QDEGLEKLEETVMSTKHIALAVNEELTLQTRLIVCLRCCSLLFLLILISYSNEMGLSSMQ  202

Query  332  DDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            DDLD  VD+TDSRL+RVQK LA++NK  K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  203  DDLDYDVDITDSRLRRVQKSLALMNKSMKSGCSCMSMLLSVLGIVGLALVIWLLVKYL  260



>gb|EMT28389.1| hypothetical protein F775_28894 [Aegilops tauschii]
Length=258

 Score =   210 bits (534),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 127/177 (72%), Gaps = 26/177 (15%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D L+ L+SKA QM ++ N+SNFANR+ LLG   K  D MSR  GLDN G+V LQRQ+M+E
Sbjct  82   DALSNLKSKAKQMGTSFNVSNFANREDLLGQSKKAADDMSRVAGLDNQGIVGLQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRL-------------  291
            QDEGLE+LEETV+STKHIALAVNEEL L TRLIDDL++HVDVT+SRL             
Sbjct  142  QDEGLERLEETVLSTKHIALAVNEELTLHTRLIDDLEDHVDVTNSRLQVDILLLLFDIEV  201

Query  290  -------------QRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
                         QRVQKRLAILNKR KGGCSCMC+++SV  IV+L  ++++L K+L
Sbjct  202  PFTWMCTDVTLLIQRVQKRLAILNKRAKGGCSCMCLMLSVAAIVLLAVIVWLLIKYL  258



>ref|XP_006339244.1| PREDICTED: syntaxin-51-like [Solanum tuberosum]
Length=231

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 123/151 (81%), Gaps = 2/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  + +KANQ+A+TLNM+N ANRDSLLGPE K  D +SR  GLDN  +V  QRQ++KE
Sbjct  83   DMLDNMITKANQLATTLNMNNLANRDSLLGPETKRPDVISRATGLDNQDLVGFQRQVIKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDE L+KLEETVISTKH+ALA+NEEL L T L+D+LD HVD T+SRLQRVQ++LA LNKR
Sbjct  143  QDEDLDKLEETVISTKHVALAINEELNLHTALLDNLDYHVDTTNSRLQRVQRKLAFLNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGC+ +C+L  VI IV+L  VI++L KFL
Sbjct  203  TKGGCTWLCLL--VIFIVILAVVIFLLVKFL  231



>ref|XP_008775698.1| PREDICTED: syntaxin-52-like isoform X1 [Phoenix dactylifera]
 ref|XP_008775699.1| PREDICTED: syntaxin-52-like isoform X1 [Phoenix dactylifera]
Length=232

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 130/151 (86%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ LRSKA QMASTLNMS+FANR+ LLG + K  D ++RT GLDN G+V LQRQIMKE
Sbjct  83   DMLSNLRSKAKQMASTLNMSSFANREDLLG-QSKSTDEVNRTVGLDNYGIVGLQRQIMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKL+ETV+STKHIAL VNEEL L TRLID+LD HVD+T SRLQRVQ+RLAILNKR
Sbjct  142  QDEGLEKLKETVLSTKHIALTVNEELDLHTRLIDNLDHHVDLTGSRLQRVQRRLAILNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCSCMC+L+ V+ IV+L+ +++ L K+L
Sbjct  202  TKGGCSCMCLLLLVVAIVILVVIVWALIKYL  232



>ref|XP_004249335.1| PREDICTED: syntaxin-51 [Solanum lycopersicum]
Length=231

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  + +KANQMASTLNM+N ANRDSLLGPE K  D +SR  GLDN  +V  QRQ++KE
Sbjct  83   DMLDNMITKANQMASTLNMNNLANRDSLLGPETKRPDVISRATGLDNQDLVGFQRQVIKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDE L+KLEETV+STKH+ALA+NEEL L T L+D+LD HVD T+SRLQRVQ++LA LNKR
Sbjct  143  QDEDLDKLEETVVSTKHVALAINEELNLHTALLDNLDYHVDTTNSRLQRVQRKLAFLNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGC+ +C+L  +I IV+L   I++L K+L
Sbjct  203  TKGGCTWLCLL--IIFIVILAVAIFLLVKYL  231



>ref|XP_009606725.1| PREDICTED: syntaxin-52-like [Nicotiana tomentosiformis]
 ref|XP_009606726.1| PREDICTED: syntaxin-52-like [Nicotiana tomentosiformis]
Length=231

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  + +KANQMA+TLNM+N ANRDSLLGPE K  D +SR  GLDN G+V  QRQ++KE
Sbjct  83   DMLDNMITKANQMATTLNMNNLANRDSLLGPETKRPDVISRATGLDNQGLVGFQRQVIKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDE L+KLEETV STKH+ALA+NEEL L T L+D+LD HVD T+SRL RVQ++LA LNKR
Sbjct  143  QDEDLDKLEETVTSTKHVALAINEELNLHTALLDNLDYHVDTTNSRLLRVQRKLAFLNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGC+ +C+L  VI IV+L  VI++L KFL
Sbjct  203  TKGGCTWLCLL--VIFIVILAVVIFLLVKFL  231



>ref|XP_009773941.1| PREDICTED: syntaxin-52-like [Nicotiana sylvestris]
Length=231

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  + +KANQMA+TLNM+N ANRDSLLGPE K  D +SR  GLDN G+V  QRQ++KE
Sbjct  83   DMLDNMITKANQMATTLNMNNLANRDSLLGPETKRPDVISRATGLDNQGLVGFQRQVIKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDE L+KLEETV STKH+ALA+NEEL L T L+D+LD HVD T+SRL RVQ++LA LNKR
Sbjct  143  QDEDLDKLEETVTSTKHVALAINEELNLHTALLDNLDYHVDTTNSRLLRVQRKLAFLNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGC+ +C+L  VI IV+L  VI++L K+L
Sbjct  203  TKGGCTWLCLL--VIFIVILAVVIFLLVKYL  231



>ref|XP_010673197.1| PREDICTED: syntaxin-52-like [Beta vulgaris subsp. vulgaris]
Length=231

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 120/151 (79%), Gaps = 2/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D+L  ++SK NQMA+TLN  + A RD LLGP++K  D + R + +DN G+V  QRQIM+E
Sbjct  83   DLLTNMKSKVNQMANTLNSYSAAYRDRLLGPDLKSDDVIKRASNMDNQGIVGFQRQIMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEEL L TRL+D LD+HV+ T+SRLQR+Q+RLA+ NKR
Sbjct  143  QDEGLEKLEETVISTKHIALAVNEELNLHTRLLDTLDDHVESTNSRLQRIQRRLAVFNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGC+C+C+L  VI IV LI V+  L K+ 
Sbjct  203  TKGGCTCLCLL--VILIVFLILVVLALIKYF  231



>ref|XP_008240610.1| PREDICTED: syntaxin-51-like [Prunus mume]
Length=230

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 121/151 (80%), Gaps = 2/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  L SKA+QMA  LNMS+ ANR +LLGP+ K  D MSRT  LDN G+V+ QRQIMKE
Sbjct  82   DMLKNLSSKADQMAIALNMSSLANRQNLLGPDKKMDDIMSRTADLDNHGLVSFQRQIMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEEL L T L+D+LD+HVD T+S LQRVQK+LA+LNKR
Sbjct  142  QDEGLEKLEETVISTKHIALAVNEELDLHTMLLDNLDQHVDSTNSNLQRVQKKLAVLNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCS + +L  V+ +V+L  V + L K+L
Sbjct  202  TKGGCSSLILL--VLAVVILTIVTWALIKYL  230



>ref|XP_006399472.1| hypothetical protein EUTSA_v10015786mg [Eutrema salsugineum]
 gb|ESQ40925.1| hypothetical protein EUTSA_v10015786mg [Eutrema salsugineum]
Length=169

 Score =   199 bits (507),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 116/151 (77%), Gaps = 17/151 (11%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRS+ANQMA+ LNMSN ANRDSLLG EIKP + MS+                  E
Sbjct  36   DMIGNLRSQANQMANALNMSNLANRDSLLGSEIKPDNTMSQL-----------------E  78

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEELGLQTRLIDDLD HVDVTDSRL+RVQK LA++NK 
Sbjct  79   QDEGLEKLEETVMSTKHIALAVNEELGLQTRLIDDLDYHVDVTDSRLRRVQKNLAVMNKN  138

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             + GCSCM ML+SV+GIV L  VIY+L K+L
Sbjct  139  MRSGCSCMSMLLSVLGIVGLAVVIYLLVKYL  169



>gb|ACJ84463.1| unknown [Medicago truncatula]
Length=194

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 106/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D LA LRSK NQMASTLNMSNFANRDSLLGPEIKP DAMSRT GLDN+G+V LQRQ+MKE
Sbjct  80   DNLANLRSKVNQMASTLNMSNFANRDSLLGPEIKP-DAMSRTVGLDNNGLVGLQRQVMKE  138

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAI  264
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLDEHVD+TDSRL+RVQK LA 
Sbjct  139  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLDEHVDITDSRLRRVQKNLAF  194



>gb|ACG48507.1| SNARE domain containing protein [Zea mays]
Length=231

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML++L+SKA QMA++ NMSNFANR+ LLG    P D MSR  GLDN G+V LQRQIMKE
Sbjct  82   DMLSSLKSKAKQMATSFNMSNFANREDLLGQSKMP-DDMSRVAGLDNQGIVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLE TV+S KHIALAVNEEL L  RLIDDL++HVDVT+SR Q VQKRLAILNKR
Sbjct  141  QDEGLEKLEXTVLSXKHIALAVNEELTLHXRLIDDLEDHVDVTNSRXQXVQKRLAILNKR  200

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             KGGCS  C+L+SV+ IV+   ++++L K+L
Sbjct  201  XKGGCSXTCLLLSVVAIVIXAVIVWLLVKYL  231



>ref|XP_002531208.1| syntaxin, putative [Ricinus communis]
 gb|EEF31185.1| syntaxin, putative [Ricinus communis]
Length=147

 Score =   197 bits (500),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 106/133 (80%), Gaps = 16/133 (12%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LR+K NQMA+TLNMSNFANRDSL GPEIKP DAM RT                +E
Sbjct  6    DMVTNLRTKVNQMATTLNMSNFANRDSLFGPEIKPADAMRRT----------------EE  49

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV STKHIALAVNEEL L TRLIDDLD+HVDVTDSRL+RVQK LAILNKR
Sbjct  50   QDEGLEKLEETVTSTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLRRVQKNLAILNKR  109

Query  251  TKGGCSCMCMLMS  213
            TKGGCSC+CM +S
Sbjct  110  TKGGCSCLCMTLS  122



>ref|XP_008775700.1| PREDICTED: syntaxin-52-like isoform X2 [Phoenix dactylifera]
Length=222

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML+ LRSKA QMASTLNMS+FANR+ LLG + K  D ++RT GLDN G+V LQRQIMKE
Sbjct  83   DMLSNLRSKAKQMASTLNMSSFANREDLLG-QSKSTDEVNRTVGLDNYGIVGLQRQIMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKL+ETV+STKHIAL VNEEL L TRLID+LD HVD+T SRLQRVQ+RLAILNKR
Sbjct  142  QDEGLEKLKETVLSTKHIALTVNEELDLHTRLIDNLDHHVDLTGSRLQRVQRRLAILNKR  201

Query  251  TKGGCSCMCMLMSVIG  204
            TKGGCSC       +G
Sbjct  202  TKGGCSCQIKFEDNVG  217



>ref|XP_007202519.1| hypothetical protein PRUPE_ppa010912mg [Prunus persica]
 gb|EMJ03718.1| hypothetical protein PRUPE_ppa010912mg [Prunus persica]
Length=230

 Score =   196 bits (499),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 119/151 (79%), Gaps = 2/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  L SKA+QMA  LNMS+ AN+ +LLGP+ K  D M RT  LDN G+V+ QRQIMKE
Sbjct  82   DMLTNLSSKADQMAIALNMSSLANKQNLLGPDKKMDDIMRRTEDLDNHGLVSFQRQIMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGL KLEETVISTKHIALAVNEEL L T L+D+LD+HVD T+S LQRVQK+ A+LNKR
Sbjct  142  QDEGLGKLEETVISTKHIALAVNEELDLHTMLLDNLDQHVDSTNSNLQRVQKKFAVLNKR  201

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCS + +L  V+ +V+LI V + L K+L
Sbjct  202  TKGGCSSLILL--VLAVVILIIVTWALIKYL  230



>ref|XP_006406341.1| hypothetical protein EUTSA_v10021502mg [Eutrema salsugineum]
 gb|ESQ47794.1| hypothetical protein EUTSA_v10021502mg [Eutrema salsugineum]
Length=215

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 114/151 (75%), Gaps = 17/151 (11%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRS+ANQM + LNMSN ANRDSLLG EIKP + MS+                  E
Sbjct  82   DMIGNLRSQANQMVNALNMSNLANRDSLLGSEIKPDNTMSQL-----------------E  124

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV+STKHIALAVNEELGLQTRLIDDLD HV VTDSRL+RVQK LA++NK 
Sbjct  125  QDEGLEKLEETVMSTKHIALAVNEELGLQTRLIDDLDYHVYVTDSRLRRVQKNLAVMNKN  184

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             + GCSCM ML+SV+GIV L  VIY+L K+L
Sbjct  185  MRSGCSCMSMLLSVLGIVGLAVVIYLLVKYL  215



>gb|ABK92902.1| unknown [Populus trichocarpa]
Length=231

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            +ML  L +K NQMAS LNM + ANR++LLGP+ K  D ++R +G DN G+V  QRQIM+E
Sbjct  83   EMLKNLSTKVNQMASALNMFSAANRENLLGPDSKTDDVINRASGFDNQGLVGFQRQIMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETVISTKHIALAVNEEL L TRL+DDLDEHVDVT+SRLQRVQK LAILNKR
Sbjct  143  QDEGLEKLEETVISTKHIALAVNEELTLHTRLLDDLDEHVDVTNSRLQRVQKNLAILNKR  202

Query  251  TKGGCSCMCM  222
            TKGGC+C   
Sbjct  203  TKGGCACWVF  212



>ref|XP_011040715.1| PREDICTED: syntaxin-52-like [Populus euphratica]
 ref|XP_011040716.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 126/151 (83%), Gaps = 2/151 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  L +K NQMA+TLNMS+ ANR++LLGP+ K  D + R +GLDN G+V  QRQIMKE
Sbjct  83   DMLKNLSTKVNQMATTLNMSSAANRENLLGPDKKTDDIVDRASGLDNHGLVGFQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV STKHIALAVNEEL L T+L+DDLDEHVDVT+SRLQ VQ++LA+LNKR
Sbjct  143  QDEGLEKLEETVTSTKHIALAVNEELTLHTKLLDDLDEHVDVTNSRLQTVQRKLALLNKR  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            TKGGCS  C+++ VI IV+LI VI  LFK+L
Sbjct  203  TKGGCS--CVILPVIAIVILIVVIRGLFKYL  231



>gb|ABK23110.1| unknown [Picea sitchensis]
Length=233

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  LRSK+NQMAS LNMS F NR  LLG + KPV  ++RT GLDN G+V LQRQIMKE
Sbjct  83   DMLVNLRSKSNQMASALNMSRFGNRSDLLGQDNKPVSEINRTTGLDNYGLVGLQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGL KLEETVISTKHIALAVNEEL L +RL+D LD+ VD T+SRLQR QKRLA+L+K+
Sbjct  143  QDEGLGKLEETVISTKHIALAVNEELDLHSRLLDSLDQDVDGTNSRLQRAQKRLAMLSKK  202

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
             K  CSCMC L+ VI +V+L  VI+ L KFL
Sbjct  203  AKSSCSCMCSLVMVIVLVILAVVIWALIKFL  233



>ref|XP_004491441.1| PREDICTED: syntaxin-52-like isoform X2 [Cicer arietinum]
Length=198

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 1/117 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA LRSK NQMAS+LNMSNFANRDSLLGPE+KP D M+R  GLDN+G+V  QRQ+MKE
Sbjct  83   DMLANLRSKVNQMASSLNMSNFANRDSLLGPEVKP-DVMNRIVGLDNNGLVGFQRQVMKE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAIL  261
            QDEGLE LE+TVISTKHIALAVNEELGL TRLIDDLD+HVDVTDSRL+RVQK L  L
Sbjct  142  QDEGLESLEQTVISTKHIALAVNEELGLHTRLIDDLDQHVDVTDSRLRRVQKNLTFL  198



>ref|XP_011041363.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  L +K NQMAS LNMS+ ANR++LLGP+ K  D + R +GLDN G+V  QRQ+MKE
Sbjct  83   DMLKNLSTKVNQMASILNMSSVANRENLLGPDKKTDDIVDRASGLDNHGLVGFQRQVMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+GLEKLEETVISTKHIALAVNEEL L TRL+DDLDEHVDVT+SRLQ VQ++LA LNKR
Sbjct  143  QDQGLEKLEETVISTKHIALAVNEELSLHTRLLDDLDEHVDVTNSRLQMVQRKLAFLNKR  202

Query  251  TKGGCSC  231
            TKGGCSC
Sbjct  203  TKGGCSC  209



>ref|XP_009377637.1| PREDICTED: syntaxin-51-like [Pyrus x bretschneideri]
 ref|XP_009377638.1| PREDICTED: syntaxin-51-like [Pyrus x bretschneideri]
Length=234

 Score =   193 bits (491),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DMLA+L SKA+QMA+TLNMS+ ANR++LLGP+ K  D MSRT GLDN G+V  QRQI+KE
Sbjct  86   DMLASLSSKADQMATTLNMSSLANRNNLLGPDKKMDDIMSRTTGLDNHGLVGFQRQIIKE  145

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGL+KLEETVISTKHIALAVNEEL L TRL+D+LD+ V+ T+S LQRVQK+LA+LNKR
Sbjct  146  QDEGLDKLEETVISTKHIALAVNEELDLHTRLLDNLDQQVESTNSNLQRVQKKLAVLNKR  205

Query  251  TKGGCSC  231
             KGGCSC
Sbjct  206  NKGGCSC  212



>ref|XP_011040717.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            +ML  L +K NQMAS LNM + ANR++LLGP+ K  D ++R +G DN G+V  QRQIM+E
Sbjct  83   EMLKNLSTKVNQMASALNMFSAANRENLLGPDSKTDDVINRASGFDNQGLVGFQRQIMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKLEETV STKHIALAVNEEL L TRL+DDLDEHVDVT+SRLQRVQK LAILNKR
Sbjct  143  QDEGLEKLEETVTSTKHIALAVNEELTLHTRLLDDLDEHVDVTNSRLQRVQKNLAILNKR  202

Query  251  TKGGCSCMCM  222
            TKGGC+C   
Sbjct  203  TKGGCACWVF  212



>ref|XP_006373681.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
 gb|ERP51478.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
Length=231

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  L +K NQMAS LNMS+ ANR++LLGP+ K  D M+R  GL+N G+V  QRQIMKE
Sbjct  83   DMLKNLSTKVNQMASILNMSSAANRENLLGPDKKTDDIMNRATGLNNHGLVGFQRQIMKE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+GLEKLEETVISTKHIALAVNEEL L TRL+DDLDEHVDVT+SRLQ VQ++LA LNK 
Sbjct  143  QDQGLEKLEETVISTKHIALAVNEELSLHTRLLDDLDEHVDVTNSRLQMVQRKLAFLNKS  202

Query  251  TKGGCSCM  228
            TKGGCSC 
Sbjct  203  TKGGCSCW  210



>ref|XP_006373682.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
 gb|ERP51479.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
Length=243

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  L +K NQMAS LNMS+ ANR++LLGP+ K  D M+R  GL+N G+V  QRQIMKE
Sbjct  95   DMLKNLSTKVNQMASILNMSSAANRENLLGPDKKTDDIMNRATGLNNHGLVGFQRQIMKE  154

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+GLEKLEETVISTKHIALAVNEEL L TRL+DDLDEHVDVT+SRLQ VQ++LA LNK 
Sbjct  155  QDQGLEKLEETVISTKHIALAVNEELSLHTRLLDDLDEHVDVTNSRLQMVQRKLAFLNKS  214

Query  251  TKGGCSCM  228
            TKGGCSC 
Sbjct  215  TKGGCSCW  222



>gb|EYU33678.1| hypothetical protein MIMGU_mgv1a021393mg [Erythranthe guttata]
Length=230

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 120/152 (79%), Gaps = 4/152 (3%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LR   N++   LNMSNFANRD  L P+    DA+SRT GLDN G+V LQRQIM+E
Sbjct  82   DMVTKLRLNVNEINYALNMSNFANRDRSLEPD---SDAISRTIGLDNQGIVDLQRQIMRE  138

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLID-DLDEHVDVTDSRLQRVQKRLAILNK  255
            QDEGL KL  T+IST+HIALAVNEEL L TRL+D   +EHV+VT+SRLQ+VQ++LA+LNK
Sbjct  139  QDEGLGKLAATMISTRHIALAVNEELSLHTRLVDYTANEHVEVTNSRLQQVQRKLALLNK  198

Query  254  RTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            R    CSC C+++SVIGI+VLIA++Y++ K+L
Sbjct  199  RNTDRCSCPCLVLSVIGIIVLIAIVYIMKKYL  230



>gb|KJB22168.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=190

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 98/108 (91%), Gaps = 1/108 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSK NQMAS  NMSNFANRDSLLGPE KP DAMSRT GLDNSG+V LQRQIMKE
Sbjct  82   DMVANLRSKVNQMASAFNMSNFANRDSLLGPESKP-DAMSRTVGLDNSGLVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQ  288
            QDE LEKLEET++STKHIALAVNEEL LQTRLIDDLD+HVDV+DSRL+
Sbjct  141  QDEDLEKLEETIVSTKHIALAVNEELDLQTRLIDDLDQHVDVSDSRLR  188



>gb|KJB11954.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=192

 Score =   182 bits (463),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 98/108 (91%), Gaps = 1/108 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSKANQMAS  NMSNFANR+SLLGPE K  DAMSRT GLDNSG+V LQRQIMKE
Sbjct  81   DMVANLRSKANQMASAFNMSNFANRESLLGPETKQ-DAMSRTVGLDNSGLVGLQRQIMKE  139

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQ  288
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLDEHVDVTDSRL+
Sbjct  140  QDEGLEKLEETVMSTKHIALAVNEELDLHTRLIDDLDEHVDVTDSRLR  187



>gb|KJB81691.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=195

 Score =   182 bits (461),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 97/108 (90%), Gaps = 1/108 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSKANQMAS  NMSNFANRDSLLGPE K  DAMSRT G DNSG+V LQRQIMKE
Sbjct  82   DMVANLRSKANQMASAFNMSNFANRDSLLGPETK-ADAMSRTVGSDNSGLVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQ  288
            QDEGLEKLEETVISTKHIALAVNEEL L TRLIDDLD+HV+VTDSRL+
Sbjct  141  QDEGLEKLEETVISTKHIALAVNEELDLHTRLIDDLDQHVEVTDSRLR  188



>ref|XP_006373683.1| hypothetical protein POPTR_0016s03000g [Populus trichocarpa]
 gb|ERP51480.1| hypothetical protein POPTR_0016s03000g [Populus trichocarpa]
Length=231

 Score =   178 bits (451),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            +ML  L +K NQM++ LNM+  ANR++LLG + K  D + R +GLDN G+V  QRQ M+E
Sbjct  83   EMLKNLSTKVNQMSTALNMAGAANRENLLGSDSKTDDIIYRASGLDNQGLVGFQRQTMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKL+ETV STKHIALAVNEEL L TRL+DDLDEHVDVT+SR+QRVQ+ LA LNKR
Sbjct  143  QDEGLEKLDETVTSTKHIALAVNEELTLHTRLLDDLDEHVDVTNSRMQRVQRNLAFLNKR  202

Query  251  TKGGCSCM  228
            TK GC+C 
Sbjct  203  TKSGCACW  210



>ref|XP_002892898.1| hypothetical protein ARALYDRAFT_471821 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69157.1| hypothetical protein ARALYDRAFT_471821 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSKANQMA+ LNMSNFANRDSLLGPEIKP D+MSR  G+DN G+V  QRQ+M+E
Sbjct  82   DMVGNLRSKANQMANALNMSNFANRDSLLGPEIKPDDSMSRVTGMDNQGIVGYQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQK  276
            QDEGLE+LE TV+STKHIALAV+EEL LQTRLIDDLD HVDVTDSRL+  ++
Sbjct  142  QDEGLEQLEGTVMSTKHIALAVSEELDLQTRLIDDLDYHVDVTDSRLRSAEE  193



>gb|KCW66897.1| hypothetical protein EUGRSUZ_F00647 [Eucalyptus grandis]
Length=200

 Score =   176 bits (445),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D+L+ LR++ NQM STL MS+ A RDSLLGPEIKP DAMSRT GLDN G+V LQRQ+M+E
Sbjct  82   DLLSNLRTRVNQMDSTLKMSHSATRDSLLGPEIKPADAMSRTAGLDNQGIVVLQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQ  288
            QDEGLEKLEETV+STKHIALAVNEEL L TRLID+LD+HVDVTDSRL+
Sbjct  142  QDEGLEKLEETVVSTKHIALAVNEELDLHTRLIDNLDQHVDVTDSRLR  189



>ref|NP_001077546.1| syntaxin-51 [Arabidopsis thaliana]
 gb|AEE29425.1| syntaxin-51 [Arabidopsis thaliana]
Length=228

 Score =   176 bits (446),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSKANQMA+ LNMSNFANRDSLLGP+IKP D+MSR  G+DN G+V  QRQ+M+E
Sbjct  82   DMVGNLRSKANQMANALNMSNFANRDSLLGPDIKPDDSMSRVTGMDNQGIVGYQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQK  276
            QDEGLE+LE TV+STKHIALAV+EEL LQTRLIDDLD HVDVTDSRL+  ++
Sbjct  142  QDEGLEQLEGTVMSTKHIALAVSEELDLQTRLIDDLDYHVDVTDSRLRSAEE  193



>ref|XP_011041367.1| PREDICTED: syntaxin-52-like [Populus euphratica]
 ref|XP_011041368.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            +ML  L +K NQM++ L M+  ANR++LLG + K  D ++R +GLD+ G+V  QRQ M+E
Sbjct  83   EMLKNLSTKVNQMSTALKMAGAANRENLLGSDSKTDDIINRASGLDSQGLVGFQRQTMRE  142

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QDEGLEKL+ETV STKHIALAVNEEL L TRL+DDLDEHVDVT+SR+QRVQ+ LA LNKR
Sbjct  143  QDEGLEKLDETVTSTKHIALAVNEELTLHTRLLDDLDEHVDVTNSRMQRVQRNLAFLNKR  202

Query  251  TKGGCSCM  228
            TK GC+C 
Sbjct  203  TKSGCACW  210



>ref|XP_008676698.1| PREDICTED: uncharacterized protein LOC100217094 isoform X1 [Zea 
mays]
 gb|ACN34822.1| unknown [Zea mays]
 gb|AFW61959.1| hypothetical protein ZEAMMB73_963395 [Zea mays]
Length=196

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM ++L+SKA QMA++ NMSNFANR+ LLG + K  D MSR  GLDN G+V LQRQIMKE
Sbjct  82   DMFSSLKSKAKQMATSFNMSNFANREDLLG-QSKKADDMSRVAGLDNQGIVVLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRV  282
            QDEGLEKLEETV+STKHIALAVNEEL L TRLIDDL++HVDVT+SRLQ V
Sbjct  141  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLEDHVDVTNSRLQIV  190



>ref|XP_002307951.1| hypothetical protein POPTR_0006s03120g [Populus trichocarpa]
 gb|EEE91474.1| hypothetical protein POPTR_0006s03120g [Populus trichocarpa]
Length=221

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 101/128 (79%), Gaps = 12/128 (9%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVD-AMSRTNGLDNSGVVALQRQIMK  435
            DML  L +K NQMA+TLN+S+ ANR++LLGP+ K  D  ++R +GLDN            
Sbjct  83   DMLKNLSTKVNQMATTLNISSAANRENLLGPDKKTDDDVVNRASGLDN-----------H  131

Query  434  EQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNK  255
            EQDEGLEKLEETV STKHIALAVNEEL L T+L+DDLDEHVDVT+SRLQ VQ++LA+LNK
Sbjct  132  EQDEGLEKLEETVTSTKHIALAVNEELTLHTKLLDDLDEHVDVTNSRLQTVQRKLALLNK  191

Query  254  RTKGGCSC  231
            RTKGGCSC
Sbjct  192  RTKGGCSC  199



>gb|KJB22169.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=196

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSK NQMAS  NMSNFANRDSLLGPE KP DAMSRT GLDNSG+V LQRQIMKE
Sbjct  82   DMVANLRSKVNQMASAFNMSNFANRDSLLGPESKP-DAMSRTVGLDNSGLVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLI  333
            QDE LEKLEET++STKHIALAVNEEL LQTRLI
Sbjct  141  QDEDLEKLEETIVSTKHIALAVNEELDLQTRLI  173



>gb|KJB81686.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=190

 Score =   156 bits (394),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+A LRSKANQMAS  NMSNFANRDSLLGPE K  DAMSRT G DNSG+V LQRQIMKE
Sbjct  82   DMVANLRSKANQMASAFNMSNFANRDSLLGPETK-ADAMSRTVGSDNSGLVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLI  333
            QDEGLEKLEETVISTKHIALAVNEEL L TRLI
Sbjct  141  QDEGLEKLEETVISTKHIALAVNEELDLHTRLI  173



>gb|KCW66898.1| hypothetical protein EUGRSUZ_F00647 [Eucalyptus grandis]
Length=175

 Score =   150 bits (378),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D+L+ LR++ NQM STL MS+ A RDSLLGPEIKP DAMSRT GLDN G+V LQRQ+M+E
Sbjct  82   DLLSNLRTRVNQMDSTLKMSHSATRDSLLGPEIKPADAMSRTAGLDNQGIVVLQRQVMRE  141

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLI  333
            QDEGLEKLEETV+STKHIALAVNEEL L TRLI
Sbjct  142  QDEGLEKLEETVVSTKHIALAVNEELDLHTRLI  174



>gb|AAM52319.1|AC105363_8 Hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ25394.1| hypothetical protein OsJ_09212 [Oryza sativa Japonica Group]
Length=324

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 102/149 (68%), Gaps = 3/149 (2%)
 Frame = -2

Query  602  ATLRSKANQMASTLNMSNFANRDSLLGPE--IKPVDAMSRTNGLDNSGVVALQRQIMKEQ  429
            +TL SK  ++ +      F+NR  LLGP+     +D  S  N +DN  ++ LQR ++KEQ
Sbjct  177  STLSSKVKEVGAPFTRKRFSNRSDLLGPDDNHAKIDVSSIAN-MDNREIIELQRNVIKEQ  235

Query  428  DEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRT  249
            D+ L+KLEET++STKHIALA+NEEL L TRLIDDLDE  + T ++LQR QK+L  +  R 
Sbjct  236  DDELDKLEETIVSTKHIALAINEELDLHTRLIDDLDEKTEETSNQLQRAQKKLKSVTTRM  295

Query  248  KGGCSCMCMLMSVIGIVVLIAVIYMLFKF  162
            +   SC C+L+SVI +V+L+A+++ L  +
Sbjct  296  RKSASCSCLLLSVIAVVILVALLWALIMY  324



>gb|EAY88317.1| hypothetical protein OsI_09776 [Oryza sativa Indica Group]
Length=325

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 102/149 (68%), Gaps = 3/149 (2%)
 Frame = -2

Query  602  ATLRSKANQMASTLNMSNFANRDSLLGPE--IKPVDAMSRTNGLDNSGVVALQRQIMKEQ  429
            +TL SK  ++ +      F+NR  LLGP+     +D  S  N +DN  ++ LQR ++KEQ
Sbjct  178  STLSSKVKEVGAPFTRKRFSNRSDLLGPDDNHAKIDVSSIAN-MDNREIIELQRNVIKEQ  236

Query  428  DEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRT  249
            D+ L+KLEET++STKHIALA+NEEL L TRLIDDLDE  + T ++LQR QK+L  +  R 
Sbjct  237  DDELDKLEETIVSTKHIALAINEELDLHTRLIDDLDEKTEETSNQLQRAQKKLKSVTTRM  296

Query  248  KGGCSCMCMLMSVIGIVVLIAVIYMLFKF  162
            +   SC C+L+SVI +V+L+A+++ L  +
Sbjct  297  RKSASCSCLLLSVIAVVILVALLWALIMY  325



>gb|ACN36591.1| unknown [Zea mays]
Length=177

 Score =   139 bits (349),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML++L+SKA QMA++ NMSNFANR+ LLG    P D MSR  GLDN G+V LQRQIMKE
Sbjct  82   DMLSSLKSKAKQMATSFNMSNFANREDLLGQSKMP-DDMSRVAGLDNQGIVGLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLI  333
            QDEGLEKLEETV+STKHIALAVNEEL L TRLI
Sbjct  141  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLI  173



>gb|AFW61961.1| hypothetical protein ZEAMMB73_963395 [Zea mays]
Length=177

 Score =   138 bits (347),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM ++L+SKA QMA++ NMSNFANR+ LLG + K  D MSR  GLDN G+V LQRQIMKE
Sbjct  82   DMFSSLKSKAKQMATSFNMSNFANREDLLG-QSKKADDMSRVAGLDNQGIVVLQRQIMKE  140

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLI  333
            QDEGLEKLEETV+STKHIALAVNEEL L TRLI
Sbjct  141  QDEGLEKLEETVLSTKHIALAVNEELTLHTRLI  173



>gb|EMS60104.1| Syntaxin-51 [Triticum urartu]
Length=241

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 88/144 (61%), Gaps = 34/144 (24%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK-  435
            D L+ L+S+A QMA + NMS FANR+ LLG   K  D MSR  GLDN G+V LQRQIMK 
Sbjct  82   DTLSNLKSRAKQMAESFNMSTFANREDLLGQSKKAADDMSRVAGLDNQGIVGLQRQIMKG  141

Query  434  ---------------------------------EQDEGLEKLEETVISTKHIALAVNEEL  354
                                             EQDEGLEKLE+TV+STKHIALAVNEEL
Sbjct  142  IDSGWLLDVMAGLSPSISTTLRQIRQCGRDMWGEQDEGLEKLEQTVLSTKHIALAVNEEL  201

Query  353  GLQTRLIDDLDEHVDVTDSRLQRV  282
             L  RLIDDLD+HVD T+SRLQ V
Sbjct  202  DLHARLIDDLDDHVDGTNSRLQVV  225



>gb|EMT07622.1| hypothetical protein F775_07967 [Aegilops tauschii]
Length=203

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 99/149 (66%), Gaps = 5/149 (3%)
 Frame = -2

Query  596  LRSKANQMASTLNMSNFA-NRDSLLGP---EIKPVDAMSRTNGLDNSGVVALQRQIMKEQ  429
            L  K  ++A+   M   + NR+ LLGP       VD  S  N ++N  +V LQR IMKEQ
Sbjct  56   LELKVREVAAPFTMKKHSSNRNELLGPNDDRCTVVDIKSTAN-MENQEIVQLQRNIMKEQ  114

Query  428  DEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRT  249
            DE L++LEET++STKHIALA+NEEL L  RLIDDLDE V+ T ++LQR QK+L  LN R 
Sbjct  115  DECLDRLEETIVSTKHIALAINEELDLHVRLIDDLDERVEDTSTQLQRAQKKLKSLNTRM  174

Query  248  KGGCSCMCMLMSVIGIVVLIAVIYMLFKF  162
            +   SC  +L+S+I  V+ +AV++ L KF
Sbjct  175  RKSGSCTGILVSIIAGVIFVAVVWTLIKF  203



>ref|XP_003562169.2| PREDICTED: syntaxin-52-like [Brachypodium distachyon]
Length=180

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 102/153 (67%), Gaps = 6/153 (4%)
 Frame = -2

Query  605  LATLRSKANQMASTLNMSNFAN-RDSLLGP----EIKPVDAMSRTNGLDNSGVVALQRQI  441
             + L  K  Q A+   M + +N R+ LLGP    +   +D +S T  +++  +V LQR +
Sbjct  29   FSALSDKVKQAAAPFTMKHSSNNRNDLLGPSDLDKCAAID-VSSTANMEDREIVELQRTV  87

Query  440  MKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAIL  261
            MK+QDE L++LEE++ STKHIALA+NEEL L T+LIDDLD+  + T  +LQR QK+L  L
Sbjct  88   MKKQDESLDRLEESIASTKHIALAINEELDLHTKLIDDLDDRTEETAHQLQRAQKKLKSL  147

Query  260  NKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKF  162
            N+R +   SC C+L++VI  V+ +AV++ L +F
Sbjct  148  NRRMRESGSCSCILLAVIAAVICVAVVWALIQF  180



>ref|XP_001778077.1| predicted protein [Physcomitrella patens]
 gb|EDQ57083.1| predicted protein [Physcomitrella patens]
Length=223

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 94/131 (72%), Gaps = 4/131 (3%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            +ML  +R K+ QM+++L+    A  +SL+   I PV+   RT GLDNSG+V LQRQIMKE
Sbjct  80   NMLVDIRYKSKQMSASLS---SAQDNSLMEGGIAPVET-GRTQGLDNSGLVKLQRQIMKE  135

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+ LE LE+TV+STKHIALAVNEEL L TRL+DD+D+  DVT+++L   Q+RL  LNK 
Sbjct  136  QDQDLESLEKTVMSTKHIALAVNEELNLHTRLLDDMDQSADVTNNKLLAAQRRLGFLNKN  195

Query  251  TKGGCSCMCML  219
               G S M M+
Sbjct  196  LGQGWSLMTMI  206



>emb|CBI25899.3| unnamed protein product [Vitis vinifera]
 emb|CBI25683.3| unnamed protein product [Vitis vinifera]
Length=94

 Score =   128 bits (321),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -2

Query  440  MKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAIL  261
            MKEQDEGL+ LEETVISTKHIALAVNEEL L TRLID LD+HVD TDSRL RVQK LAIL
Sbjct  1    MKEQDEGLDNLEETVISTKHIALAVNEELDLHTRLIDTLDQHVDTTDSRLGRVQKNLAIL  60

Query  260  NKRTKGGCSCMCM  222
            NKRTKGGC+C CM
Sbjct  61   NKRTKGGCTCFCM  73



>ref|NP_173073.2| Target SNARE coiled-coil domain protein [Arabidopsis thaliana]
 gb|AEE29422.1| Target SNARE coiled-coil domain protein [Arabidopsis thaliana]
Length=193

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = -2

Query  596  LRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGL  417
            LRSKANQMAS L+M  F+N D LL PE    D MSR  GLDN G+V L RQ+MKE DE L
Sbjct  87   LRSKANQMASALDMLKFSNIDILLRPE--KDDIMSRVIGLDNQGIVGLHRQVMKEHDEAL  144

Query  416  EKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKR  273
            + LEETV+  KH AL +NE++GLQTRLID LD HVDV+DS ++ +  R
Sbjct  145  DMLEETVMRVKHNALVMNEQIGLQTRLIDGLDHHVDVSDSGVRVIHIR  192



>ref|XP_001751913.1| Qc-SNARE, SYP5 family [Physcomitrella patens]
 gb|EDQ83348.1| Qc-SNARE, SYP5 family [Physcomitrella patens]
Length=225

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 92/132 (70%), Gaps = 2/132 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            +ML  +R K  QM+ +L+ S   NR SL+   I PV+  SRT  LDN+G+V LQRQIMKE
Sbjct  80   NMLVDIRFKFKQMSESLS-STRDNRASLMEGGIAPVET-SRTQDLDNTGLVKLQRQIMKE  137

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+ LE LE+TV+ST HIALAVNEEL L TRL+DD+D+  DVT++++   QKRL  LNK 
Sbjct  138  QDQDLESLEKTVLSTHHIALAVNEELDLHTRLLDDMDQDADVTNNKILAAQKRLGYLNKN  197

Query  251  TKGGCSCMCMLM  216
                 S + M++
Sbjct  198  LGQEWSLLTMII  209



>gb|AFK42434.1| unknown [Lotus japonicus]
Length=149

 Score =   121 bits (303),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 63/69 (91%), Gaps = 1/69 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            D LA LRSK NQMASTLNMSNFANRDSLLGPEIKP DAMSRT GLDNSG+V LQRQIMKE
Sbjct  80   DTLANLRSKVNQMASTLNMSNFANRDSLLGPEIKP-DAMSRTVGLDNSGLVGLQRQIMKE  138

Query  431  QDEGLEKLE  405
            QD+GLEKLE
Sbjct  139  QDDGLEKLE  147



>gb|EMS59036.1| Syntaxin-51 [Triticum urartu]
Length=207

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 88/132 (67%), Gaps = 5/132 (4%)
 Frame = -2

Query  587  KANQMASTLNMSNFA-NRDSLLGP---EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEG  420
            K  ++A+   M   + NR+ LLGP       VD  S  N ++N  +V LQR IMKEQDE 
Sbjct  41   KVKEVAAPFTMKKHSSNRNELLGPSDDRCTVVDIKSTAN-MENQEIVQLQRNIMKEQDEC  99

Query  419  LEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGG  240
            L++LEET++STKHIALA+NEEL L  RLIDDLDE V+ T ++LQR QK+L  LN R +  
Sbjct  100  LDRLEETIVSTKHIALAINEELDLHVRLIDDLDERVEDTSNQLQRAQKKLKSLNTRMRKS  159

Query  239  CSCMCMLMSVIG  204
             SC  +L+S+I 
Sbjct  160  GSCTGILVSIIA  171



>ref|XP_002985281.1| hypothetical protein SELMODRAFT_446189 [Selaginella moellendorffii]
 gb|EFJ13775.1| hypothetical protein SELMODRAFT_446189 [Selaginella moellendorffii]
Length=227

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 84/132 (64%), Gaps = 5/132 (4%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLL--GPEIKPVDAMSRTNGLDNSGVVALQRQIM  438
            D + +L  +  Q+ S+   S  A RD LL  G    PV+   +T GLDN G++A QRQ M
Sbjct  78   DAIISLGLRVKQLDSSYKSSQNA-RDDLLADGTRGPPVET-DKTTGLDNYGLIAFQRQTM  135

Query  437  KEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILN  258
            K+QD  LE LE++VISTKHIAL VNEEL LQ  L+DD+D H D T++ LQ V KRL +L+
Sbjct  136  KDQDVDLEDLEKSVISTKHIALTVNEELDLQAHLLDDMDRHADRTNTVLQNVHKRLVVLS  195

Query  257  KRT-KGGCSCMC  225
            KR       C+C
Sbjct  196  KRAGSSALGCLC  207



>ref|XP_010111270.1| hypothetical protein L484_027923 [Morus notabilis]
 gb|EXC30748.1| hypothetical protein L484_027923 [Morus notabilis]
Length=182

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 73/108 (68%), Gaps = 11/108 (10%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DML  L  +A +MA TLNMS  A+RD+L G   K  D M + N LDN            E
Sbjct  83   DMLDKLSVQAGEMAPTLNMSMSADRDNLFGLNRKQDDMMKKANDLDN-----------HE  131

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQ  288
            QDE   +LEETV+STKHIALAVNEEL LQTRL+D+LDEHVD T+SRLQ
Sbjct  132  QDEDFAQLEETVVSTKHIALAVNEELDLQTRLLDNLDEHVDSTNSRLQ  179



>ref|XP_002970090.1| hypothetical protein SELMODRAFT_441012 [Selaginella moellendorffii]
 gb|EFJ29214.1| hypothetical protein SELMODRAFT_441012 [Selaginella moellendorffii]
Length=227

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 84/132 (64%), Gaps = 5/132 (4%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLL--GPEIKPVDAMSRTNGLDNSGVVALQRQIM  438
            D + +L  +  Q+ S+   S  A RD LL  G    PV+   +T GLDN G++A QRQ M
Sbjct  78   DAIISLGLRVKQLDSSYKSSQNA-RDDLLADGTRGPPVET-DKTTGLDNYGLIAFQRQTM  135

Query  437  KEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILN  258
            K+QD  LE LE++V+STKHIAL VNEEL LQ  L+DD+D H D T++ LQ V KRL +L+
Sbjct  136  KDQDVDLEDLEKSVVSTKHIALTVNEELDLQAHLLDDMDRHADRTNTVLQNVHKRLVVLS  195

Query  257  KRT-KGGCSCMC  225
            KR       C+C
Sbjct  196  KRAGSSALGCLC  207



>ref|XP_005649717.1| Qc-snare protein, Syn8/Syntaxin8-family [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25173.1| Qc-snare protein, Syn8/Syntaxin8-family [Coccomyxa subellipsoidea 
C-169]
Length=236

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 94/155 (61%), Gaps = 9/155 (6%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNM-SNFANRDSLLG---PEIKPVDAMSRTNGLDNSGVVALQRQ  444
            D++  L+S+  QM  +L    N ANR +L+    P+  P     +T  LDN G++ LQ Q
Sbjct  82   DLVNALKSRREQMLQSLRRDQNSANRTALMEMNRPKA-PASETLQTADLDNRGILQLQDQ  140

Query  443  IMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAI  264
             M++QD  LE+LE TV STKHIAL VNEEL L  RL+DDLDE V+VT SR++  QK+L  
Sbjct  141  SMRQQDAELEELERTVTSTKHIALTVNEELDLHRRLLDDLDEDVEVTHSRMRTAQKKLKH  200

Query  263  LNKRTKGGCSCMC---MLMSVIGIVVLIAVIYMLF  168
            +  R+ G C  MC   +LM  + +VV+I      F
Sbjct  201  VLARS-GNCRSMCVTMLLMIALAVVVIIGFKLAAF  234



>ref|NP_683311.2| putative syntaxin-type t-SNARE protein [Arabidopsis thaliana]
 gb|AEE29421.1| putative syntaxin-type t-SNARE protein [Arabidopsis thaliana]
Length=199

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 82/133 (62%), Gaps = 12/133 (9%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            DM+  LRSKA QMAS L+M  F+N  SLLG +    D MSR   +DN  +V  QR  MK 
Sbjct  58   DMVEDLRSKAYQMASALDMLKFSNIGSLLGQD----DIMSRVIDMDNQEIVGFQRTTMKV  113

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD+ LE LE+ V+  K  ALA+N ELGLQTRLID LD HVDV+ S ++ +Q        R
Sbjct  114  QDKALEMLEKGVMHLKREALAMNMELGLQTRLIDRLDHHVDVSASDVEELQ--------R  165

Query  251  TKGGCSCMCMLMS  213
            +     CM +L+S
Sbjct  166  SIDTGVCMTLLLS  178



>ref|XP_002465967.1| hypothetical protein SORBIDRAFT_01g049130 [Sorghum bicolor]
 gb|EER92965.1| hypothetical protein SORBIDRAFT_01g049130 [Sorghum bicolor]
Length=251

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 95/148 (64%), Gaps = 2/148 (1%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            + LA + SKA ++     M   ++R+ L G   K +D  S  N +DN  +V LQR++MKE
Sbjct  104  EKLAGVCSKAQEVGGQFTMKYSSDRNDLCGWSAK-IDVNSIAN-MDNHEMVKLQRKVMKE  161

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            QD  L+ LEETV STKHIALA+N EL L T+LI+ LDE V+ T ++LQR  KRL  LN R
Sbjct  162  QDAELKILEETVTSTKHIALAINGELDLHTKLIEKLDEDVEETSNQLQRALKRLKALNTR  221

Query  251  TKGGCSCMCMLMSVIGIVVLIAVIYMLF  168
             +   SC  +++SV+ +V+ +AV + L 
Sbjct  222  MRKSRSCWGIVLSVVAVVICVAVFWALI  249



>gb|KJB22166.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=141

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  435
            DM+A LRSK NQMAS  NMSNFANRDSLLGPE KP DAMSRT GLDNSG+V LQRQIMK
Sbjct  82   DMVANLRSKVNQMASAFNMSNFANRDSLLGPESKP-DAMSRTVGLDNSGLVGLQRQIMK  139



>gb|KJB22167.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=152

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  435
            DM+A LRSK NQMAS  NMSNFANRDSLLGPE KP DAMSRT GLDNSG+V LQRQIMK
Sbjct  82   DMVANLRSKVNQMASAFNMSNFANRDSLLGPESKP-DAMSRTVGLDNSGLVGLQRQIMK  139



>gb|KJB81687.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
 gb|KJB81688.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=150

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  435
            DM+A LRSKANQMAS  NMSNFANRDSLLGPE K  DAMSRT G DNSG+V LQRQIMK
Sbjct  82   DMVANLRSKANQMASAFNMSNFANRDSLLGPETK-ADAMSRTVGSDNSGLVGLQRQIMK  139



>gb|KJB81689.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=141

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  435
            DM+A LRSKANQMAS  NMSNFANRDSLLGPE K  DAMSRT G DNSG+V LQRQIMK
Sbjct  82   DMVANLRSKANQMASAFNMSNFANRDSLLGPETK-ADAMSRTVGSDNSGLVGLQRQIMK  139



>ref|XP_003617659.1| Syntaxin-51 [Medicago truncatula]
 gb|AET00618.1| syntaxin of plants protein [Medicago truncatula]
Length=167

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  435
            DMLA LRSK NQMASTLNMSNFAN+D L+GPE+KP D MSRT GLDN+G+V  QRQIMK
Sbjct  82   DMLANLRSKVNQMASTLNMSNFANKDRLVGPEVKP-DVMSRTVGLDNNGLVGFQRQIMK  139



>gb|KJB11950.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=140

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  435
            DM+A LRSKANQMAS  NMSNFANR+SLLGPE K  DAMSRT GLDNSG+V LQRQIMK
Sbjct  81   DMVANLRSKANQMASAFNMSNFANRESLLGPETK-QDAMSRTVGLDNSGLVGLQRQIMK  138



>gb|KJB11948.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=142

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  435
            DM+A LRSKANQMAS  NMSNFANR+SLLGPE K  DAMSRT GLDNSG+V LQRQIMK
Sbjct  81   DMVANLRSKANQMASAFNMSNFANRESLLGPETK-QDAMSRTVGLDNSGLVGLQRQIMK  138



>gb|KJB11949.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=149

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  435
            DM+A LRSKANQMAS  NMSNFANR+SLLGPE K  DAMSRT GLDNSG+V LQRQIMK
Sbjct  81   DMVANLRSKANQMASAFNMSNFANRESLLGPETK-QDAMSRTVGLDNSGLVGLQRQIMK  138



>gb|KJB11947.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=151

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  435
            DM+A LRSKANQMAS  NMSNFANR+SLLGPE K  DAMSRT GLDNSG+V LQRQIMK
Sbjct  81   DMVANLRSKANQMASAFNMSNFANRESLLGPETK-QDAMSRTVGLDNSGLVGLQRQIMK  138



>ref|XP_006380963.1| hypothetical protein POPTR_0006s03130g [Populus trichocarpa]
 gb|ERP58760.1| hypothetical protein POPTR_0006s03130g [Populus trichocarpa]
Length=164

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 55/83 (66%), Gaps = 15/83 (18%)
 Frame = -2

Query  476  DNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDS  297
            D S     ++   K+QDEGLEKLEETVISTKHIALAVNEEL L TRL+            
Sbjct  76   DESASRNAEKFEYKKQDEGLEKLEETVISTKHIALAVNEELTLHTRLL------------  123

Query  296  RLQRVQKRLAILNKRTKGGCSCM  228
               RVQK LAILNKRTKGGC+C 
Sbjct  124  ---RVQKNLAILNKRTKGGCACW  143



>gb|AAZ32890.1| syntaxin of plants [Medicago sativa]
Length=133

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQ  450
            D LA LRSK NQMASTLNMSNFANRDSLLGPEIKP DAMSRT GLDN+G+V L 
Sbjct  80   DNLANLRSKVNQMASTLNMSNFANRDSLLGPEIKP-DAMSRTVGLDNNGLVGLH  132



>gb|KCW70251.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
 gb|KCW70252.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
Length=177

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  435
            DML++LR+K +QMAS LNMSN   RDSLLGP+ KP DAMSRT GLDN G+V LQRQ+MK
Sbjct  83   DMLSSLRTKKDQMASALNMSNSRIRDSLLGPDAKPADAMSRTVGLDNQGIVGLQRQVMK  141



>ref|XP_002951465.1| Qc-SNARE, Syn8/Syntaxin8-family [Volvox carteri f. nagariensis]
 gb|EFJ47641.1| Qc-SNARE, Syn8/Syntaxin8-family [Volvox carteri f. nagariensis]
Length=234

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 95/159 (60%), Gaps = 9/159 (6%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNF-ANRDSLLG-------PEIKPVDAMSRTNGLDNSGVVA  456
            D+L  LR++  QM   +  S   ++RD+L G       P   P +  S T GLDN G++ 
Sbjct  77   DLLYDLRNRREQMQLAIKRSQGQSDRDALFGGPSASGGPAAPPRETES-TAGLDNRGLLG  135

Query  455  LQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQK  276
            LQ+Q+M++QDE LE +E+ V +TKHIALA+ EE+ LQTRL+DDL + VDVT +RL+    
Sbjct  136  LQQQVMRQQDEELEAMEKVVHNTKHIALAIGEEVDLQTRLLDDLADDVDVTHNRLRAATA  195

Query  275  RLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            R+  + K +      MC  + VI +V +I +   L KF 
Sbjct  196  RVRHVLKSSSNWRLGMCAFLLVITLVAVILLTVKLSKFF  234



>ref|XP_006836710.1| hypothetical protein AMTR_s00088p00114030 [Amborella trichopoda]
 gb|ERM99563.1| hypothetical protein AMTR_s00088p00114030 [Amborella trichopoda]
Length=63

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -2

Query  608  MLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  435
            M   LRSKA+QMASTLNMSNF NR++LL  + KPV  ++RT GLDN G+V LQRQIM+
Sbjct  1    MFVNLRSKASQMASTLNMSNFGNRNNLLEQDSKPVAEINRTTGLDNYGLVGLQRQIMR  58



>gb|ABI84247.1| syntaxin [Arachis hypogaea]
Length=152

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKE  432
            + L TLRSK NQMASTLNMSNFANRDSL GPEIKP DAMSR  G      + L R IMKE
Sbjct  80   ETLTTLRSKVNQMASTLNMSNFANRDSLFGPEIKP-DAMSRNVGWITVDSLGLSRPIMKE  138

Query  431  QD  426
             +
Sbjct  139  PE  140



>dbj|BAC57351.1| unknown protein [Oryza sativa Japonica Group]
Length=355

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 48/65 (74%), Gaps = 11/65 (17%)
 Frame = -2

Query  458  ALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQ  279
            A+  Q+ KEQDEGLEKLEETV+STKHIA           RLIDDLD+HVDVT+SRLQRVQ
Sbjct  302  AVDSQVTKEQDEGLEKLEETVLSTKHIA-----------RLIDDLDDHVDVTNSRLQRVQ  350

Query  278  KRLAI  264
            + L  
Sbjct  351  RGLPF  355



>ref|XP_001691539.1| Qc-SNARE protein, Syn8/Syntaxin8-family [Chlamydomonas reinhardtii]
 gb|EDP04647.1| Qc-SNARE protein, Syn8/Syntaxin8-family [Chlamydomonas reinhardtii]
Length=243

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 94/158 (59%), Gaps = 8/158 (5%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMS-NFANRDSLL---GPEIKPVDA--MSRTNGLDNSGVVALQ  450
            D++  LR +   M  ++  S   A+RD+L    GP   P+       T  LDN G++ LQ
Sbjct  87   DLIHDLRGRREGMQMSIKRSTGAADRDALFSGAGPSSGPLPPRETEATAELDNRGLLGLQ  146

Query  449  RQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRL  270
            + +M+ QDE L  +E+TV STKHIALA+ EE+ LQTRL+DDL + VDVT SRL+    ++
Sbjct  147  QAVMRRQDEELAAMEKTVASTKHIALAIGEEVDLQTRLLDDLADDVDVTQSRLKAATAKV  206

Query  269  AILNKRTKGGCSC-MCMLMSVIGIVVLIAVIYMLFKFL  159
              L  R  G C   +C+ + ++ +VV+I +   L +FL
Sbjct  207  KQL-MRDSGNCRLGVCVFILIVTLVVVIILTVKLARFL  243



>gb|ACF80713.1| unknown [Zea mays]
Length=148

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  435
            DML++L+SKA QMA++ NMSNFANR+ LLG    P D MSR  GLDN G+V LQRQIMK
Sbjct  82   DMLSSLKSKAKQMATSFNMSNFANREDLLGQSKMP-DDMSRVAGLDNQGIVGLQRQIMK  139



>gb|AFW61957.1| hypothetical protein ZEAMMB73_963395 [Zea mays]
Length=192

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  435
            DM ++L+SKA QMA++ NMSNFANR+ LLG + K  D MSR  GLDN G+V LQRQIMK
Sbjct  126  DMFSSLKSKAKQMATSFNMSNFANREDLLG-QSKKADDMSRVAGLDNQGIVVLQRQIMK  183



>ref|XP_003064731.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51065.1| predicted protein [Micromonas pusilla CCMP1545]
Length=246

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = -2

Query  494  SRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEH  315
            +RT GLD+  ++ LQR  M+EQD+ L+ L   V STKHI LAV EE+ LQ+RL+D+LDE 
Sbjct  137  ARTAGLDDDSLLQLQRNTMREQDDDLDDLSRIVTSTKHIGLAVGEEIDLQSRLLDELDED  196

Query  314  VDVTDSRLQRVQKRLAILNKRTKGGCSC-MCMLMSVIGIVVLIAVIYML  171
            V  T S L+R    L I  +      +C + + MSV+  ++L A++ +L
Sbjct  197  VSRTGSALRRA---LRIAKRVFSKAENCKLLVYMSVLVAILLAALVIVL  242



>gb|EAZ06340.1| hypothetical protein OsI_28572 [Oryza sativa Indica Group]
Length=146

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  435
            D L+ L+SK  QMA++ NMSNFANR+ LLG   K  D MSR  GLDN G+V LQRQIMK
Sbjct  82   DTLSNLKSKTKQMATSFNMSNFANREDLLGQNKKAADDMSRVAGLDNQGIVGLQRQIMK  140



>ref|XP_004987204.1| PREDICTED: syntaxin-52-like [Setaria italica]
Length=221

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = -2

Query  605  LATLRSKANQMASTLNMSNFANRDSLLGPEIKP--VDAMSRTNGLDNSGVVALQRQIMKE  432
            L+ L SKA ++     M++ ++ + L G   K   +D  S  + +DN  +V LQR++MKE
Sbjct  104  LSGLSSKAKEVGGQFTMNHSSDGNDLCGSSEKSTKIDVNSIAD-MDNRDMVNLQRKVMKE  162

Query  431  QDEGLEKLEETVISTKHIALAVNEELGLQTRLI  333
            QD  LE LEETV+STKHIALA+NEEL LQTRLI
Sbjct  163  QDSQLEILEETVVSTKHIALAINEELDLQTRLI  195



>ref|XP_002504673.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65931.1| predicted protein [Micromonas sp. RCC299]
Length=222

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = -2

Query  521  PEIKPVDA-MSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQ  345
            P + PV+  +     LDN  ++ LQR +M+EQDE LE+L   V STKHI LAV EEL L 
Sbjct  102  PVVMPVETRVDVEEELDNRSILQLQRNLMREQDEELEELSRVVTSTKHIGLAVGEELDLH  161

Query  344  TRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGC  237
             RL+DDL++ V+ + S ++R       + + + GGC
Sbjct  162  ARLLDDLEDDVERSGSMIRRAHALAKAVYENSGGGC  197



>gb|KIZ07812.1| Syntaxin-51 [Monoraphidium neglectum]
Length=239

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 91/161 (57%), Gaps = 16/161 (10%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLN-MSNFANRDSLLGPEIK------PVDAMSRTNGLDNSGVVAL  453
            D+L  L+++  Q+  +L      ++R+SL+           P      T  LD+ G++ L
Sbjct  81   DLLHVLKNRREQIQESLKRQQQHSDRESLMAGGSSGRGGGGPARETEVTAQLDSRGMLQL  140

Query  452  QRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKR  273
            Q Q+M++QD  LE++E+TV STKHIA+ + EEL L TRL+ DL+E VDVT SRL+   KR
Sbjct  141  QEQVMQQQDRELEQMEKTVTSTKHIAVTIGEELDLHTRLLGDLEEDVDVTHSRLRAATKR  200

Query  272  LAILNKRT---KGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            +  + K +   KGG     +      IVVL  ++ + FK +
Sbjct  201  VRHIIKHSSNWKGGLFIFGL------IVVLTLLMLVAFKVI  235



>ref|XP_005850452.1| hypothetical protein CHLNCDRAFT_59611 [Chlorella variabilis]
 gb|EFN58350.1| hypothetical protein CHLNCDRAFT_59611 [Chlorella variabilis]
Length=242

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 19/140 (14%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSN-FANRDSLL------------GPEIKPVDAMSRTNGLDN  471
            D++A+LR +  QM ++L      A RD+LL                +  DA +  +   +
Sbjct  82   DLVASLRMRREQMLASLKREQPRAARDTLLGGGPGSGSSGSMATAGRETDATAERS---S  138

Query  470  SGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRL  291
             G++ +Q+Q+M++QD  LE LE TV+ TKHIAL +NEE  L  RL+DDLDE VD T SRL
Sbjct  139  QGLLQMQQQVMQQQDRDLESLERTVVGTKHIALQINEEADLHNRLLDDLDEEVDGTRSRL  198

Query  290  QRVQKRLAILNKRTKGGCSC  231
               Q+RL ++ +R   G SC
Sbjct  199  AAAQRRLKLVMRR---GGSC  215



>ref|XP_011398897.1| Syntaxin-52 [Auxenochlorella protothecoides]
 gb|KFM26001.1| Syntaxin-52 [Auxenochlorella protothecoides]
Length=240

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 3/86 (3%)
 Frame = -2

Query  488  TNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVD  309
            T  L ++G++ LQR +M +QD  LE+LE  V STKH+AL +NEE  L  RL++ L+E VD
Sbjct  130  TAPLTSAGLMELQRDVMSQQDRELEQLERGVASTKHVALRINEEATLHNRLLEGLEEDVD  189

Query  308  VTDSRLQRVQKRLAILNKRTKGGCSC  231
            V+ SRL   Q+RL  +  R +   SC
Sbjct  190  VSRSRLAAAQRRLKGVMHRAR---SC  212



>gb|KDD75355.1| hypothetical protein H632_c726p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=191

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 64/113 (57%), Gaps = 5/113 (4%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKPVDAMS-----RTNGLDNSGVVALQR  447
            D+++ LR +  QM   L     A +   L        A S     +T  L+ +G+++LQ+
Sbjct  77   DLISALRGRREQMLQALKRDGAAAQRGALFAGSSGQGAPSGQETIQTAELNATGLLSLQQ  136

Query  446  QIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQ  288
            +IM +QD  LE LE +V  TKHIAL +NEE  L  RL++DLDE V  T SR++
Sbjct  137  EIMSQQDRDLESLEHSVAGTKHIALQINEETTLHNRLLEDLDEEVSATSSRMK  189



>ref|XP_002676758.1| predicted protein [Naegleria gruberi]
 gb|EFC44014.1| predicted protein [Naegleria gruberi]
Length=243

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 74/115 (64%), Gaps = 6/115 (5%)
 Frame = -2

Query  479  LDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTD  300
            L+   +++ Q+++M +QD+ L+ L   +  TK I L++++EL   TRL++D+ E+VD+T+
Sbjct  134  LEGHQILSYQKKVMDDQDKSLDALSNALSRTKQIGLSIDDELDEHTRLLEDIHENVDITE  193

Query  299  SRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL*CRSLYFT  135
            S+++   K++  L K  K   +C  ++++VI  V++IA++ +LF      + YFT
Sbjct  194  SKIKVQTKKMVNLAK--KNSFTCWGIIIAVILFVIIIALLIVLF----TTTKYFT  242



>ref|XP_009050690.1| hypothetical protein LOTGIDRAFT_205331 [Lottia gigantea]
 gb|ESO98633.1| hypothetical protein LOTGIDRAFT_205331 [Lottia gigantea]
Length=246

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 74/130 (57%), Gaps = 7/130 (5%)
 Frame = -2

Query  545  ANRDSLLGPEI----KPV---DAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVIST  387
             +R SLLG E      P    +   +  G+ NSG+ A Q+ +++EQD GL+ L   +   
Sbjct  113  GDRSSLLGGETFGANDPWGIGEEPDQFQGVTNSGLQAQQQSVIQEQDRGLDALSSVIARQ  172

Query  386  KHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVI  207
            K +AL + +E+  Q  LIDD+ +HVD T  RL +  + + I++K++   C  + +++  I
Sbjct  173  KQMALDIGDEVDQQNILIDDITDHVDRTGERLIKETRHVNIVDKKSNTCCYWVIIVVLFI  232

Query  206  GIVVLIAVIY  177
             ++V++AV Y
Sbjct  233  TMIVIVAVPY  242



>gb|ABK92777.1| unknown [Populus trichocarpa]
Length=146

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPEIKP-VDAMSRTNGLDNSGVVALQRQIMK  435
            DML  L +K NQMA+TLN+S+ ANR++LLGP+ K   D ++R +GLDN G+V  QRQIMK
Sbjct  83   DMLKNLSTKVNQMATTLNISSAANRENLLGPDKKTDDDVVNRASGLDNHGLVGFQRQIMK  142



>ref|XP_004363668.1| hypothetical protein CAOG_03940 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93100.1| hypothetical protein CAOG_003940 [Capsaspora owczarzaki ATCC 
30864]
Length=250

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 78/136 (57%), Gaps = 14/136 (10%)
 Frame = -2

Query  608  MLATLRSKANQMASTLNMS-----NFANRDSLL--------GPEIKPVDAMSRTNGLDNS  468
            + + LRS+ +Q+ S  N +       A+RD+LL        G    PV+    T GLDN+
Sbjct  95   LTSALRSRRDQLNSMFNKNMEPGQAEASRDTLLYGAPGRAFGQGAAPVE-REDTQGLDNA  153

Query  467  GVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQ  288
             +++ Q+QIM++QD GL+ L+  +   KHI +A+ +E+  Q +L+DDL++ +D T  +L+
Sbjct  154  TLLSRQQQIMQDQDRGLDALQAAIARQKHIGVAIGDEVDSQNQLLDDLEDGMDHTHGKLR  213

Query  287  RVQKRLAILNKRTKGG  240
            +    +  + ++ K G
Sbjct  214  QETLHVMTITEKAKTG  229



>ref|XP_011109213.1| hypothetical protein H072_3230 [Dactylellina haptotyla CBS 200.50]
 gb|EPS42860.1| hypothetical protein H072_3230 [Dactylellina haptotyla CBS 200.50]
Length=364

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -2

Query  509  PVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLID  330
            P     RT  LDN+GV+ LQ+QIMK QDE LE L +TV   KH+ + + +EL  Q  L++
Sbjct  281  PAPETDRTRQLDNAGVLQLQQQIMKSQDEDLETLLKTVGRQKHMGIEIGQELDDQNELLN  340

Query  329  DLDEHVDVTDSRLQRVQKRLAILN  258
             L   VD  D +L+ V+KRL  +N
Sbjct  341  SLGVDVDRVDDKLRVVKKRLKNIN  364



>ref|XP_011418529.1| PREDICTED: syntaxin-8-like [Crassostrea gigas]
Length=239

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/153 (25%), Positives = 75/153 (49%), Gaps = 9/153 (6%)
 Frame = -2

Query  608  MLATLRSKANQMASTLNMSNFANRDSLLGPEIKPV---------DAMSRTNGLDNSGVVA  456
            M+  L +K  Q+       N  +R SL+G               D      G DN  +  
Sbjct  82   MMDNLITKEKQLDQAFKNENTESRSSLMGAGASGFGGRDPWGVRDEPEEFEGFDNQAIAQ  141

Query  455  LQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQK  276
             Q+ I++EQD+GL+ L + +   K +A+ +  E+  Q  LIDD+ +H+D T  RL +  +
Sbjct  142  QQKTIIQEQDKGLDSLSKVISRQKQMAIDIGNEVDGQNDLIDDIGDHMDQTKERLVKETR  201

Query  275  RLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIY  177
             + I+++++      + +++  + I+V++ V +
Sbjct  202  HIRIVDRKSATCGYWVAIILIFVAIIVILIVPF  234



>ref|XP_007510233.1| conserved hypothetical protein [Bathycoccus prasinos]
 emb|CCO18578.1| conserved hypothetical protein [Bathycoccus prasinos]
Length=288

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = -2

Query  464  VVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQR  285
            ++  Q Q+++EQDE L  L   V  TKHIA+AV EEL L TRL+DD D+ V+ T   L+R
Sbjct  179  LLQFQHQLLREQDEELTDLSNHVTRTKHIAIAVGEELDLHTRLLDDFDDDVEHTAGNLKR  238

Query  284  VQKRLAILNKRT-KGGCSCMCMLMS-VIGIVVLIAV  183
            +      L +R  K   S  C L + V  ++VLIA+
Sbjct  239  IASSARRLFERIGKSNFSLGCCLAALVFMLIVLIAL  274



>ref|XP_007778861.1| hypothetical protein W97_02772 [Coniosporium apollinis CBS 100218]
 gb|EON63544.1| hypothetical protein W97_02772 [Coniosporium apollinis CBS 100218]
Length=373

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 56/98 (57%), Gaps = 10/98 (10%)
 Frame = -2

Query  545  ANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAV  366
              R  +LG    P     RT  LDN GV+ LQRQIM+EQDE ++ L + V   + + +A+
Sbjct  281  GGRGRVLGA---PAKETERTRELDNEGVLQLQRQIMQEQDEDVQDLTKVVRRMREMGVAI  337

Query  365  NEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  252
            NEEL LQ +++D LD  VD       RVQ ++ +  KR
Sbjct  338  NEELVLQNQMLDLLDNDVD-------RVQGKIDVARKR  368



>gb|KIL62800.1| hypothetical protein M378DRAFT_12590 [Amanita muscaria Koide 
BX008]
Length=238

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -2

Query  464  VVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQR  285
            ++ +QRQ++ EQDE L++L  ++    HI+L +N+ELG+ T L+++LD  VD+T SRL  
Sbjct  142  ILQVQRQLLGEQDEHLDQLSRSINRQHHISLQINDELGVHTGLLEELDTEVDMTGSRLSS  201

Query  284  VQKRLAILNKRTKGGCSCMCM  222
             ++RL  L K  +   S + +
Sbjct  202  ARRRLDKLAKGARENSSTVTI  222



>emb|CCO30006.1| syntaxin 8 [Rhizoctonia solani AG-1 IB]
Length=187

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 66/119 (55%), Gaps = 1/119 (1%)
 Frame = -2

Query  536  DSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEE  357
            D++  P  K   A    +G  + G++  QRQ+M EQD  L++L  ++ +   I+L +NEE
Sbjct  68   DAIFRP-YKDEPAAYEDDGPSHDGILLQQRQMMDEQDTHLDRLSHSIRNQHDISLQINEE  126

Query  356  LGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVI  180
            L + T L++ LD  +D T  RL R ++RL  + +  +   S + + + +  +++LI V 
Sbjct  127  LEVHTGLLEALDHELDSTGDRLSRARRRLDHVARGARDNGSAVAIGVLIFVLLILIVVF  185



>emb|CDS13496.1| hypothetical protein LRAMOSA05672 [Absidia idahoensis var. thermophila]
Length=224

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/158 (28%), Positives = 87/158 (55%), Gaps = 15/158 (9%)
 Frame = -2

Query  611  DMLATLRSKANQMASTLNMSNFANRDSLLGPE------IKPVDAMS-RTNGLDNSGVVAL  453
            D L  L+ K +++ + +  ++ A R++LLG +        P + M    + L+N  ++ L
Sbjct  74   DKLVELQVKVDKLDALMGDADQA-REALLGNKRGKSVRFSPANQMEVDPSDLENGQILQL  132

Query  452  QRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKR  273
            Q++I+++QD  L+ L + +   + + L + +EL    +LID+  E VD TD+RLQ+ +K+
Sbjct  133  QQRIIEDQDTNLDHLSDAIRRQRELGLLIGDELDTHAQLIDETHEMVDRTDARLQKARKK  192

Query  272  LAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  159
            L  + ++ K   S +C+      ++VLI V ++L    
Sbjct  193  LNYVGRKVKDNRS-ICI------VIVLIFVFFVLLALF  223



>ref|XP_007593744.1| PX domain-containing protein [Colletotrichum fioriniae PJ7]
 gb|EXF82612.1| PX domain-containing protein [Colletotrichum fioriniae PJ7]
Length=374

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = -2

Query  509  PVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLID  330
            P+    RT  LDN+GVV LQRQ+M EQDE +  L   V   K I L +NEE+  QT+++D
Sbjct  292  PLPETERTRELDNNGVVQLQRQMMSEQDEQVNTLAAIVRRQKEIGLQINEEVTEQTKMLD  351

Query  329  DLDEHVDVTDSRLQRVQKRL  270
             L+E  D    ++   +KR+
Sbjct  352  RLNEDADRVGGKIDVAKKRI  371



>gb|KIJ58063.1| hypothetical protein HYDPIDRAFT_103340 [Hydnomerulius pinastri 
MD-312]
Length=228

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = -2

Query  479  LDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTD  300
            +D  G++  QRQ+M  QD  L+ L  ++    HI+L +N+EL + T L+D LD  +D TD
Sbjct  127  MDEGGIMLQQRQLMDAQDARLDHLSSSIGRQHHISLQINDELEVHTGLLDSLDTELDGTD  186

Query  299  SRLQRVQKRLAILNKRTKGGCSCMCM  222
            +R+ R +KRLA + +  K   S + +
Sbjct  187  ARMTRARKRLARVARGAKDNGSTVTI  212



>emb|CCF43512.1| SYP5 family Qc-SNARE [Colletotrichum higginsianum]
Length=129

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = -2

Query  509  PVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLID  330
            P+    RT  LDNSGVV LQRQ+M EQDE +  L   V   K + L +N+E+  QT+++D
Sbjct  47   PLPENERTRELDNSGVVQLQRQMMSEQDEQVNTLAAIVRRQKEMGLRINDEVQEQTKMLD  106

Query  329  DLDEHVDVTDSRLQRVQKRL  270
             L+E  D    ++   +KR+
Sbjct  107  RLNEDADRVGGKMDVAKKRI  126



>emb|CEL53532.1| syntaxin-like protein [Rhizoctonia solani AG-1 IB]
Length=230

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 66/119 (55%), Gaps = 1/119 (1%)
 Frame = -2

Query  536  DSLLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEE  357
            D++  P  K   A    +G  + G++  QRQ+M EQD  L++L  ++ +   I+L +NEE
Sbjct  111  DAIFRP-YKDEPAAYEDDGPSHDGILLQQRQMMDEQDTHLDRLSHSIRNQHDISLQINEE  169

Query  356  LGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVI  180
            L + T L++ LD  +D T  RL R ++RL  + +  +   S + + + +  +++LI V 
Sbjct  170  LEVHTGLLEALDHELDSTGDRLSRARRRLDHVARGARDNGSAVAIGVLIFVLLILIVVF  228



>ref|XP_011027754.1| PREDICTED: syntaxin-61 [Populus euphratica]
Length=246

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -2

Query  443  IMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAI  264
            ++K+QDE L++L  +V     + L ++EEL  Q R+IDDLD  +D T +RL  VQK++A+
Sbjct  156  LIKQQDEELDELSASVERIGGVGLTIHEELLAQERIIDDLDTEMDTTSNRLDFVQKKVAM  215

Query  263  LNKRTKGGCSCMCMLMSVIGIVVLIAVIYM  174
            + K+       M +L  V+  ++L  ++++
Sbjct  216  VMKKASAKGQLMMILFLVVLFIILFVLVFL  245



>ref|XP_001767575.1| predicted protein [Physcomitrella patens]
 gb|EDQ67534.1| predicted protein [Physcomitrella patens]
Length=131

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  563  LNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQRQ--IMKEQDEGLEKLEETVIS  390
            +N       D  + P   P  + S +NG  NS    ++    + KEQDE LE L E+V  
Sbjct  1    MNGKELCQEDKSIRPHSSP--SYSVSNGHSNSQGFEIENYALLFKEQDEDLEGLRESVER  58

Query  389  TKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAIL  261
              ++  ++NEE+ +Q RLI D++ ++D T +RL  VQK++ I+
Sbjct  59   LGNMGKSINEEISIQERLIGDVEHNIDTTTTRLHFVQKKMEIM  101



>ref|XP_007583335.1| putative snare complex subunit protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD49185.1| putative snare complex subunit protein [Neofusicoccum parvum 
UCRNP2]
Length=385

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -2

Query  509  PVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLID  330
            P     RT  LDN GVV LQRQIM+EQDE +  L + V   + + + +N+EL LQ  ++ 
Sbjct  302  PAPETQRTRELDNGGVVQLQRQIMREQDEDVADLGKAVRRMREMGVEINDELQLQNEMLR  361

Query  329  DLDEHVDVTDSRLQRVQKRLAILN  258
             LD+ VD   S++   +KR+A ++
Sbjct  362  MLDDDVDRVGSKIDVAKKRIAKIH  385



>ref|XP_006304138.1| hypothetical protein CARUB_v10010122mg [Capsella rubella]
 ref|XP_006304139.1| hypothetical protein CARUB_v10010122mg [Capsella rubella]
 gb|EOA37036.1| hypothetical protein CARUB_v10010122mg [Capsella rubella]
 gb|EOA37037.1| hypothetical protein CARUB_v10010122mg [Capsella rubella]
Length=245

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 79/141 (56%), Gaps = 7/141 (5%)
 Frame = -2

Query  584  ANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQ--RQIM--KEQDEGL  417
            A +++S    +N   R+ +  P     +   +  G D+ G V  +  RQ++  K+QDE L
Sbjct  104  AGKVSSGAGHANEVRRELMRMPNSNEANKYDQYGGRDDDGFVQSESDRQMLLIKQQDEEL  163

Query  416  EKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR--TKG  243
            ++L ++V     + L +++EL  Q R+ID+LD  +D T +RL+ VQK++ ++ K+   KG
Sbjct  164  DELSKSVQRIGGVGLTIHDELIAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKG  223

Query  242  GCSCMCMLMSVIGIVVLIAVI  180
                +C L+ V+ I++ + V 
Sbjct  224  QMMMICFLL-VLFIILFVLVF  243



>gb|KFH72613.1| hypothetical protein MVEG_02902 [Mortierella verticillata NRRL 
6337]
Length=469

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -2

Query  494  SRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEH  315
            S+T GLDN G++ LQ++ MK+QD+ +E+    +   KHI LA+ +EL  Q +L+D+LD  
Sbjct  391  SQTRGLDNEGLLLLQQEQMKQQDDHIEQFNAILQRQKHIGLAIGQELDNQIQLLDELDRD  450

Query  314  VDVTDSRLQRVQKRLAILN  258
            VD T  +L  V K++  +N
Sbjct  451  VDRTTLKLGLVNKKIGKIN  469



>ref|XP_011273343.1| Vacuolar morphogenesis protein 7 [Wickerhamomyces ciferrii]
 emb|CCH44795.1| Vacuolar morphogenesis protein 7 [Wickerhamomyces ciferrii]
Length=341

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = -2

Query  491  RTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHV  312
            RT G++N  ++ +Q+  +++QD+ LE+L   +   K + +A+NEEL LQ  L+D+LD  V
Sbjct  264  RTRGIENQQLLQMQKNDIQDQDQELERLSAVINRQKELGIAINEELALQNELLDELDTEV  323

Query  311  DVTDSRLQRVQKRLAILN  258
            D T ++L+  QK++  +N
Sbjct  324  DRTSAKLKYAQKKVGKIN  341



>ref|WP_027225949.1| hypothetical protein [Legionella pneumophila]
Length=97

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = -2

Query  485  NGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDV  306
            + L N+ ++  Q  +M+EQDE L+ L +TV  T  IA A+ EEL  Q +LID L+EHV+ 
Sbjct  12   SSLSNTELLEKQELMMREQDEQLDILLKTVTRTHEIAEAIQEELTSQNKLIDGLNEHVEK  71

Query  305  TDSRLQRVQKRLAILNKRTKGGCSCM  228
            TD ++    KR+  L    +  C  M
Sbjct  72   TDGKVGNTTKRVETLIPEVRSSCFLM  97



>gb|ELQ35584.1| v-SNARE [Magnaporthe oryzae Y34]
Length=336

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 66/128 (52%), Gaps = 16/128 (13%)
 Frame = -2

Query  602  ATLRSKANQMASTLNMSNFANRDSLLG---PEI------KPVDAMSRTNGLDNSGVVALQ  450
            ATL   A     T  +++ A+R +L+G   P         P+    RT  LDN+GV+ LQ
Sbjct  212  ATLSGGAPTSGGTGGVASAADRAALVGKGKPRQGGRVLGAPLQETERTRELDNAGVLQLQ  271

Query  449  RQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRL  270
            RQ  +EQDE LE L   +   K + LA+ EE+  QT ++D ++E VD       RV  ++
Sbjct  272  RQTREEQDEDLEVLTRVIRRQKEMGLAIEEEVKQQTEMLDRMNEDVD-------RVGGKI  324

Query  269  AILNKRTK  246
             +   RT+
Sbjct  325  KVAKDRTR  332



>gb|EWC44037.1| hypothetical protein DRE_01389 [Drechslerella stenobrocha 248]
Length=363

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = -2

Query  509  PVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLID  330
            PV   SRT  LDN GV+ LQ+QI+K QDE LE L + V   K + L + +E+  Q + +D
Sbjct  280  PVPETSRTRQLDNVGVLQLQQQIIKSQDEDLETLLKAVSRQKQMGLEIGQEIDEQNKFLD  339

Query  329  DLDEHVDVTDSRLQRVQKRL  270
             LD   D    +L+ V+KR+
Sbjct  340  SLDADTDRVTDKLRVVKKRM  359



>ref|XP_007841269.1| hypothetical protein PFICI_14497 [Pestalotiopsis fici W106-1]
 gb|ETS73551.1| hypothetical protein PFICI_14497 [Pestalotiopsis fici W106-1]
Length=366

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 61/112 (54%), Gaps = 15/112 (13%)
 Frame = -2

Query  557  MSNFANRDSLLGPEIK--------PVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEE  402
            M + A++ +LLG   +        P+    RT  LDN GVV LQ+Q+MKEQDE +E L +
Sbjct  259  MPSAADKAALLGHAPRHGGRVLGAPLPETERTRELDNQGVVQLQQQMMKEQDEDVESLAK  318

Query  401  TVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTK  246
             +   K +AL +N E+  QT ++D+L+   D       R+Q +  I  KR K
Sbjct  319  IIRRQKEMALEINREVEEQTSMLDNLNSDAD-------RLQTKADIAKKRIK  363



>gb|ELQ69118.1| v-SNARE [Magnaporthe oryzae P131]
Length=375

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 66/128 (52%), Gaps = 16/128 (13%)
 Frame = -2

Query  602  ATLRSKANQMASTLNMSNFANRDSLLG---PEI------KPVDAMSRTNGLDNSGVVALQ  450
            ATL   A     T  +++ A+R +L+G   P         P+    RT  LDN+GV+ LQ
Sbjct  251  ATLSGGAPTSGGTGGVASAADRAALVGKGKPRQGGRVLGAPLQETERTRELDNAGVLQLQ  310

Query  449  RQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRL  270
            RQ  +EQDE LE L   +   K + LA+ EE+  QT ++D ++E VD       RV  ++
Sbjct  311  RQTREEQDEDLEVLTRVIRRQKEMGLAIEEEVKQQTEMLDRMNEDVD-------RVGGKI  363

Query  269  AILNKRTK  246
             +   RT+
Sbjct  364  KVAKDRTR  371



>ref|XP_010097811.1| hypothetical protein L484_000959 [Morus notabilis]
 gb|EXB72069.1| hypothetical protein L484_000959 [Morus notabilis]
Length=247

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 74/131 (56%), Gaps = 4/131 (3%)
 Frame = -2

Query  554  SNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQ--RQIM--KEQDEGLEKLEETVIST  387
            +N  +R+ +  P +   D  +  +  DN   +A +  RQ++  K+QDE L++L  +V   
Sbjct  116  ANAMHRELMRLPNLHETDRSNPYSAHDNDDFIASESDRQLLLIKQQDEELDELSASVQRI  175

Query  386  KHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVI  207
              + L ++EEL  Q ++ID+LD  +D T +RL  VQK+++++ K+       M +L  V+
Sbjct  176  GGVGLTIHEELLAQEKIIDELDMEMDSTSNRLDFVQKKVSMVMKKAGAKGQIMMILFLVV  235

Query  206  GIVVLIAVIYM  174
              ++L  ++++
Sbjct  236  LFIILFVLVFL  246



>ref|XP_007588843.1| putative snare complex subunit protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD43687.1| putative snare complex subunit protein [Neofusicoccum parvum 
UCRNP2]
Length=281

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 61/105 (58%), Gaps = 1/105 (1%)
 Frame = -2

Query  545  ANRDSLLGPEIKP-VDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALA  369
            ANR +L      P  D++   +GLDN  + A  RQ++++QDE L++L E++   + +++ 
Sbjct  158  ANRAALFPYRDDPDEDSVPDQSGLDNQQIHAYHRQVIEQQDEQLDRLGESIGRQRELSIQ  217

Query  368  VNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCS  234
            + +EL     L+D++DE VD   S+L R  KRL  + +R +   S
Sbjct  218  IGDELEGHVMLLDEVDESVDRHQSQLDRAGKRLQRVGRRARENWS  262



>ref|WP_042754549.1| hypothetical protein [Legionella pneumophila]
Length=97

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -2

Query  485  NGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDV  306
            + L N+ ++  Q  +M EQDE L+ L +TV  T  IA A+ EEL  Q +LID L+EHV+ 
Sbjct  12   SSLSNTELLEKQELMMSEQDEQLDILLKTVTRTHEIAEAIQEELTSQNKLIDGLNEHVEK  71

Query  305  TDSRLQRVQKRLAILNKRTKGGCSCM  228
            TD ++    KR+  L    +  C  M
Sbjct  72   TDGKVGNTTKRVETLIPEVRSSCFLM  97



>ref|XP_010499380.1| PREDICTED: syntaxin-61 isoform X2 [Camelina sativa]
Length=206

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 79/141 (56%), Gaps = 7/141 (5%)
 Frame = -2

Query  584  ANQMASTLNMSNFANRDSLLGPEIKPVDAMSRTNGLDNSGVVALQ--RQIM--KEQDEGL  417
            A +++S    ++   R+ +  P     +   +  G D+ G V  +  RQ++  K+QDE L
Sbjct  65   AGKVSSGAGHASEVRRELMRMPNANEANRYDQYGGRDDDGFVQSESDRQMLLIKQQDEEL  124

Query  416  EKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR--TKG  243
            ++L ++V     + L +++EL  Q R+ID+LD  +D T +RL+ VQK++ ++ K+   KG
Sbjct  125  DELSKSVQRIGGVGLTIHDELVAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKG  184

Query  242  GCSCMCMLMSVIGIVVLIAVI  180
                +C L+ V+ I++ + V 
Sbjct  185  QMMMICFLL-VLFIILFVLVF  204



>emb|CDR38347.1| CYFA0S02e00584g1_1 [Cyberlindnera fabianii]
Length=342

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -2

Query  491  RTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHV  312
            RT G DN  ++ +Q+Q  K QD+ LE+L   +   K +A+A+NEEL LQ  L+D+LD  V
Sbjct  265  RTRGQDNQQLLQMQKQDFKNQDQELEQLGSVIRKQKELAVAINEELQLQNELLDELDGEV  324

Query  311  DVTDSRLQRVQKRLA  267
            D   ++L   QKR+ 
Sbjct  325  DRVGNKLHYAQKRVG  339



>emb|CEI88428.1| hypothetical protein RMCBS344292_02818 [Rhizopus microsporus]
Length=222

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 89/152 (59%), Gaps = 12/152 (8%)
 Frame = -2

Query  611  DMLATLRSKANQMASTL-NMSNFANRDSLLG------PEIKPVDAMSRTNGLDNSGVVAL  453
            D L  L+ K +++ + L N ++ A RD LLG      P   P+D    T+ ++NS ++ L
Sbjct  75   DKLIQLQLKVDKLEALLGNQTDPAARDLLLGNNHKKSPRFTPID----TSQMENSQILQL  130

Query  452  QRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKR  273
            Q++I+ +QD+ L+ L E +   + + L + +EL     LID+ +E VD TD RL+R +K+
Sbjct  131  QQRIIDDQDQDLDHLSEAIRRQRELGLMIGDELETHAILIDETEEMVDRTDERLRRAKKK  190

Query  272  LAILNKRTKGGCSCMCMLMSVIGIVVLIAVIY  177
            L  + ++ K   S +C+++++I I  ++  ++
Sbjct  191  LDYVGRKVKDNKS-ICIVIALILIFFILVALF  221



>ref|XP_003081442.1| SNARE protein TLG1/Syntaxin 6 (ISS) [Ostreococcus tauri]
Length=161

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 59/109 (54%), Gaps = 3/109 (3%)
 Frame = -2

Query  488  TNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVD  309
            T   D   V+ +QR +++EQD+ L+ L       K I++AVN+EL L  +L+D LD+ + 
Sbjct  54   TRQRDKGEVLQIQRAMLEEQDDALDDLSRAAGRAKEISIAVNDELDLHAKLLDSLDDEMA  113

Query  308  VTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKF  162
             T  RL R  + +  + +R   G SC    ++V+  V+   V+ ++ K 
Sbjct  114  DTSGRLTRASRAVQNMMRR---GSSCRSATIAVLVFVLCFLVLALIIKL  159



>ref|XP_004336630.1| syntaxin 6, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR14617.1| syntaxin 6, putative [Acanthamoeba castellanii str. Neff]
Length=144

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 61/108 (56%), Gaps = 0/108 (0%)
 Frame = -2

Query  494  SRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEH  315
            S T  LDN GV  L  Q ++EQD+ L+ L E++   K+IAL +  E+  Q  LI DLD  
Sbjct  36   SETKDLDNRGVHDLSSQKIQEQDKLLDILGESIERQKNIALHIGHEVDEQIDLIADLDHE  95

Query  314  VDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYML  171
            V  T +R+ +    +  +++++  GC    +L   + ++ +IA+ ++L
Sbjct  96   VQSTQTRVSKATMAIRKIDEKSSAGCMWTVILALFLVLIGVIALAFLL  143



>ref|WP_011947286.1| hypothetical protein [Legionella pneumophila]
 gb|ABQ56040.1| hypothetical protein LPC_2110 [Legionella pneumophila str. Corby]
 gb|ADG25747.1| hypothetical protein lpa_03441 [Legionella pneumophila 2300/99 
Alcoy]
Length=97

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = -2

Query  485  NGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDV  306
            + L N+ +   Q  +M+EQDE L+ L +TV  T  IA A+ EEL  Q +LID L+EHV+ 
Sbjct  12   SSLSNTELQEKQELMMREQDEQLDILLKTVTRTYEIAEAIQEELTSQNKLIDGLNEHVEK  71

Query  305  TDSRLQRVQKRLAILNKRTKGGCSCM  228
            TD +++   K++  L    +  C  M
Sbjct  72   TDGKVENTTKKVEALIPEVRSSCFLM  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660