BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF042L13

Length=841
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004236119.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    442   6e-150   
ref|XP_006345041.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    441   2e-149   Solanum tuberosum [potatoes]
ref|XP_009617290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    440   6e-149   Nicotiana tomentosiformis
ref|XP_009617291.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    440   6e-149   Nicotiana tomentosiformis
gb|KJB53134.1|  hypothetical protein B456_008G294300                    424   8e-146   Gossypium raimondii
ref|XP_002511424.1|  aldehyde dehydrogenase, putative                   429   2e-144   
gb|KCW83435.1|  hypothetical protein EUGRSUZ_B00357                     418   1e-142   Eucalyptus grandis [rose gum]
ref|XP_002321583.2|  aldehyde dehydrogenase 1 precursor family pr...    422   1e-142   
gb|KJB53131.1|  hypothetical protein B456_008G294300                    424   1e-142   Gossypium raimondii
gb|KJB53133.1|  hypothetical protein B456_008G294300                    424   1e-142   Gossypium raimondii
ref|XP_002318034.1|  aldehyde dehydrogenase 1 precursor family pr...    424   1e-142   Populus trichocarpa [western balsam poplar]
gb|KHG08400.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    424   2e-142   Gossypium arboreum [tree cotton]
emb|CDP18933.1|  unnamed protein product                                423   2e-142   Coffea canephora [robusta coffee]
ref|XP_011044321.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    422   5e-142   Populus euphratica
ref|XP_011044320.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    422   6e-142   Populus euphratica
gb|EYU42550.1|  hypothetical protein MIMGU_mgv1a004919mg                421   6e-142   Erythranthe guttata [common monkey flower]
ref|XP_010546022.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    422   6e-142   Tarenaya hassleriana [spider flower]
gb|KEH35050.1|  NAD-dependent aldehyde dehydrogenase family protein     422   8e-142   Medicago truncatula
ref|XP_010037573.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    422   1e-141   Eucalyptus grandis [rose gum]
gb|KDP31120.1|  hypothetical protein JCGZ_11496                         422   1e-141   Jatropha curcas
ref|XP_010101190.1|  Aldehyde dehydrogenase family 2 member             421   2e-141   Morus notabilis
ref|XP_008360830.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    410   3e-141   
ref|XP_008453101.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    421   4e-141   Cucumis melo [Oriental melon]
ref|XP_010028184.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    419   6e-141   Eucalyptus grandis [rose gum]
gb|KHN18468.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    419   1e-140   Glycine soja [wild soybean]
ref|XP_004138115.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    419   2e-140   Cucumis sativus [cucumbers]
ref|XP_004508854.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    414   2e-140   Cicer arietinum [garbanzo]
ref|XP_004298932.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    417   5e-140   Fragaria vesca subsp. vesca
ref|XP_008374451.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    417   6e-140   Malus domestica [apple tree]
ref|XP_007155411.1|  hypothetical protein PHAVU_003G199100g             417   9e-140   Phaseolus vulgaris [French bean]
ref|XP_008367527.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    417   1e-139   
ref|XP_008239742.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    416   1e-139   Prunus mume [ume]
ref|XP_007155410.1|  hypothetical protein PHAVU_003G199100g             416   1e-139   Phaseolus vulgaris [French bean]
ref|XP_007210569.1|  hypothetical protein PRUPE_ppa003869mg             416   2e-139   Prunus persica
gb|AAO72532.1|  aldehyde dehydrogenase 1 precursor                      416   2e-139   Lotus corniculatus
gb|AFK44278.1|  unknown                                                 410   2e-139   Medicago truncatula
ref|XP_004508853.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    415   4e-139   Cicer arietinum [garbanzo]
ref|XP_011028588.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    415   4e-139   Populus euphratica
ref|XP_006439784.1|  hypothetical protein CICLE_v10019638mg             415   4e-139   Citrus clementina [clementine]
gb|EPS72259.1|  hypothetical protein M569_02499                         405   6e-139   Genlisea aurea
gb|AEV54528.1|  aldehyde dehydrogenase ALDH2B4_V3                       414   6e-139   Vitis vinifera
ref|XP_006439785.1|  hypothetical protein CICLE_v10019638mg             412   6e-139   
gb|AEV54527.1|  aldehyde dehydrogenase ALDH2B4_V2                       412   9e-139   Vitis vinifera
ref|XP_002283132.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    414   1e-138   Vitis vinifera
emb|CAN63005.1|  hypothetical protein VITISV_013710                     414   1e-138   Vitis vinifera
gb|KDP26565.1|  hypothetical protein JCGZ_17723                         414   2e-138   Jatropha curcas
ref|XP_007044551.1|  Aldehyde dehydrogenase 2B4                         413   2e-138   
ref|XP_003527026.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    412   4e-138   
gb|EYU31278.1|  hypothetical protein MIMGU_mgv1a004311mg                412   4e-138   Erythranthe guttata [common monkey flower]
ref|XP_003608978.1|  Mitochondrial aldehyde dehydrogenase               412   8e-138   
ref|XP_009150211.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    411   1e-137   Brassica rapa
ref|XP_006476755.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    411   1e-137   Citrus sinensis [apfelsine]
emb|CDY36910.1|  BnaA06g16950D                                          411   2e-137   Brassica napus [oilseed rape]
gb|AAZ79358.1|  aldehyde dehydrogenase                                  410   2e-137   Vitis pseudoreticulata
gb|AAZ79356.1|  aldehyde dehydrogenase                                  409   2e-137   Vitis pseudoreticulata
ref|XP_011086550.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    410   2e-137   Sesamum indicum [beniseed]
gb|AAZ79355.1|  aldehyde dehydrogenase                                  410   3e-137   Vitis pseudoreticulata
ref|XP_010682578.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    410   4e-137   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK41217.1|  unknown                                                 410   5e-137   Lotus japonicus
emb|CDY44985.1|  BnaCnng12150D                                          410   5e-137   Brassica napus [oilseed rape]
ref|XP_009149853.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    410   5e-137   Brassica rapa
ref|XP_010678738.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    409   6e-137   Beta vulgaris subsp. vulgaris [field beet]
gb|ACM89738.1|  mitochondrial benzaldehyde dehydrogenase                409   9e-137   Antirrhinum majus [garden snapdragon]
ref|XP_010682577.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    408   2e-136   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011071828.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    408   2e-136   Sesamum indicum [beniseed]
ref|XP_009761724.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    408   2e-136   Nicotiana sylvestris
ref|XP_010682575.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    408   2e-136   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK44454.1|  hypothetical protein AALP_AA1G258900                    407   2e-136   Arabis alpina [alpine rockcress]
emb|CDY57318.1|  BnaA08g20300D                                          407   4e-136   Brassica napus [oilseed rape]
emb|CDX91724.1|  BnaC08g06430D                                          407   4e-136   
ref|XP_006404308.1|  hypothetical protein EUTSA_v10010271mg             407   5e-136   Eutrema salsugineum [saltwater cress]
gb|KJB50198.1|  hypothetical protein B456_008G158500                    405   6e-136   Gossypium raimondii
emb|CDY21806.1|  BnaA06g20750D                                          405   7e-136   Brassica napus [oilseed rape]
ref|XP_010503421.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    407   7e-136   Camelina sativa [gold-of-pleasure]
ref|XP_009115500.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    406   8e-136   Brassica rapa
gb|KHG27537.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    406   9e-136   Gossypium arboreum [tree cotton]
gb|EPS72983.1|  mitochondrial benzaldehyde dehydrogenase                405   9e-136   Genlisea aurea
ref|XP_010552639.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    406   1e-135   Tarenaya hassleriana [spider flower]
gb|AAC98035.1|  Strong similarity to gb|Y09876 aldehyde dehydroge...    405   2e-135   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564204.1|  aldehyde dehydrogenase 2B7                            405   2e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004155012.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    406   2e-135   
gb|KJB50197.1|  hypothetical protein B456_008G158500                    405   3e-135   Gossypium raimondii
ref|XP_010316283.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    405   3e-135   Solanum lycopersicum
ref|XP_003519638.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    405   3e-135   
gb|KHN00347.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    405   3e-135   Glycine soja [wild soybean]
ref|XP_010914166.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    406   4e-135   Elaeis guineensis
ref|XP_002893307.1|  hypothetical protein ARALYDRAFT_472641             405   4e-135   
gb|AES91175.2|  NAD-dependent aldehyde dehydrogenase family protein     405   5e-135   Medicago truncatula
ref|XP_010515110.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    404   6e-135   Camelina sativa [gold-of-pleasure]
ref|XP_009600000.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    404   6e-135   
ref|XP_003517756.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    404   6e-135   
ref|XP_006290873.1|  hypothetical protein CARUB_v10016983mg             404   8e-135   Capsella rubella
ref|XP_006416054.1|  hypothetical protein EUTSA_v10007303mg             404   8e-135   Eutrema salsugineum [saltwater cress]
emb|CDY61548.1|  BnaA09g29890D                                          404   1e-134   Brassica napus [oilseed rape]
gb|KFK34098.1|  hypothetical protein AALP_AA5G101700                    404   1e-134   Arabis alpina [alpine rockcress]
ref|XP_010426271.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    404   1e-134   Camelina sativa [gold-of-pleasure]
ref|XP_009612265.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    403   2e-134   Nicotiana tomentosiformis
ref|XP_004238676.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    403   2e-134   
gb|AFK40301.1|  unknown                                                 395   2e-134   Medicago truncatula
ref|XP_006307216.1|  hypothetical protein CARUB_v10008816mg             402   3e-134   Capsella rubella
ref|XP_009110081.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    402   5e-134   Brassica rapa
ref|XP_010653335.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    402   5e-134   Vitis vinifera
ref|XP_009759823.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    402   6e-134   Nicotiana sylvestris
emb|CAA71003.1|  aldehyde dehydrogenase (NAD+)                          402   7e-134   Nicotiana tabacum [American tobacco]
ref|XP_010251301.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    400   1e-133   Nelumbo nucifera [Indian lotus]
ref|XP_003532011.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    401   1e-133   
ref|XP_010044646.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    401   1e-133   Eucalyptus grandis [rose gum]
ref|XP_002877590.1|  ALDH2B4                                            400   2e-133   
ref|XP_008781996.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    400   2e-133   Phoenix dactylifera
emb|CDY47634.1|  BnaC05g18900D                                          400   2e-133   Brassica napus [oilseed rape]
ref|XP_010551563.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    400   2e-133   Tarenaya hassleriana [spider flower]
ref|XP_010913576.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    400   4e-133   Elaeis guineensis
ref|NP_190383.1|  aldehyde dehydrogenase 2B4                            400   4e-133   Arabidopsis thaliana [mouse-ear cress]
emb|CDP00179.1|  unnamed protein product                                399   5e-133   Coffea canephora [robusta coffee]
ref|XP_003552014.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    399   7e-133   
ref|XP_007157468.1|  hypothetical protein PHAVU_002G072100g             399   7e-133   Phaseolus vulgaris [French bean]
ref|XP_006355977.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    399   7e-133   Solanum tuberosum [potatoes]
gb|KCW56066.1|  hypothetical protein EUGRSUZ_I01821                     395   8e-133   Eucalyptus grandis [rose gum]
gb|KCW86739.1|  hypothetical protein EUGRSUZ_B03349                     399   1e-132   Eucalyptus grandis [rose gum]
ref|XP_007036177.1|  Aldehyde dehydrogenase family 2 member B4          399   1e-132   
ref|XP_007153639.1|  hypothetical protein PHAVU_003G052500g             398   1e-132   Phaseolus vulgaris [French bean]
ref|XP_010271955.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    398   1e-132   Nelumbo nucifera [Indian lotus]
ref|XP_007031425.1|  Aldehyde dehydrogenase 2B7 isoform 3               394   1e-132   
ref|XP_010477682.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    398   2e-132   Camelina sativa [gold-of-pleasure]
gb|EYU22484.1|  hypothetical protein MIMGU_mgv1a004342mg                398   2e-132   Erythranthe guttata [common monkey flower]
ref|XP_004297641.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    398   2e-132   Fragaria vesca subsp. vesca
ref|XP_011463376.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    397   2e-132   Fragaria vesca subsp. vesca
gb|AGV54428.1|  mitochondrial aldehyde dehydrogenase                    397   2e-132   Phaseolus vulgaris [French bean]
ref|XP_010100483.1|  Aldehyde dehydrogenase family 2 member             397   2e-132   Morus notabilis
ref|XP_004297642.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    397   4e-132   Fragaria vesca subsp. vesca
dbj|BAB92019.1|  mitochondrial aldehyde dehydrogenase                   397   5e-132   Sorghum bicolor [broomcorn]
ref|XP_010029206.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    396   9e-132   Eucalyptus grandis [rose gum]
gb|AAL77005.1|  aldehyde dehydrogenase                                  385   1e-131   Allium cepa
ref|XP_008221788.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    396   1e-131   Prunus mume [ume]
gb|KEH19981.1|  NAD-dependent aldehyde dehydrogenase family protein     395   1e-131   Medicago truncatula
dbj|BAB62757.1|  mitochondrial aldehyde dehydrogenase ALDH2             396   2e-131   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI32134.3|  unnamed protein product                                397   2e-131   Vitis vinifera
gb|KEH19980.1|  NAD-dependent aldehyde dehydrogenase family protein     395   2e-131   Medicago truncatula
ref|XP_006844236.1|  hypothetical protein AMTR_s00006p00268060          394   2e-131   
ref|XP_007031423.1|  Aldehyde dehydrogenase 2B4 isoform 1               394   3e-131   
ref|XP_007221800.1|  hypothetical protein PRUPE_ppa004036mg             394   3e-131   Prunus persica
gb|AFK40600.1|  unknown                                                 389   4e-131   Medicago truncatula
ref|XP_006356663.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    394   4e-131   Solanum tuberosum [potatoes]
gb|KJB11464.1|  hypothetical protein B456_001G261100                    390   6e-131   Gossypium raimondii
ref|NP_001105891.1|  mitochondrial aldehyde dehydrogenase 2             394   7e-131   Zea mays [maize]
ref|XP_010477684.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    394   7e-131   Camelina sativa [gold-of-pleasure]
gb|EMS51754.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    394   8e-131   Triticum urartu
ref|XP_010265814.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    394   8e-131   Nelumbo nucifera [Indian lotus]
gb|KJB11463.1|  hypothetical protein B456_001G261100                    390   8e-131   Gossypium raimondii
ref|XP_011071082.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    393   9e-131   
ref|XP_002301540.1|  mitochondrial aldehyde dehydrogenase family ...    393   1e-130   Populus trichocarpa [western balsam poplar]
gb|AAL99612.1|AF348416_1  mitochondrial aldehyde dehydrogenase          393   1e-130   Arabidopsis thaliana [mouse-ear cress]
gb|EMT04899.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    393   2e-130   
dbj|BAB92017.1|  mitochondrial aldehyde dehydrogenase                   393   2e-130   Secale cereale
gb|AHM26656.1|  aldehyde dehydrogenase 2-1                              393   2e-130   Zea mays subsp. mays [corn]
gb|ABK24267.1|  unknown                                                 392   3e-130   Picea sitchensis
ref|XP_004245256.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    392   4e-130   Solanum lycopersicum
ref|XP_003542700.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    392   5e-130   
ref|XP_010029207.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    391   8e-130   Eucalyptus grandis [rose gum]
ref|XP_006594290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    391   8e-130   Glycine max [soybeans]
ref|XP_006656871.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    391   9e-130   Oryza brachyantha
gb|KCW56067.1|  hypothetical protein EUGRSUZ_I01824                     390   1e-129   Eucalyptus grandis [rose gum]
gb|KDO82491.1|  hypothetical protein CISIN_1g009035mg                   383   1e-129   Citrus sinensis [apfelsine]
ref|XP_008389628.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    390   2e-129   
ref|XP_004965205.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    390   2e-129   Setaria italica
gb|AAK58370.1|AF269064_1  T-cytoplasm male sterility restorer fac...    390   2e-129   Zea mays [maize]
gb|KHG06517.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    390   2e-129   Gossypium arboreum [tree cotton]
gb|KJB11461.1|  hypothetical protein B456_001G261100                    389   3e-129   Gossypium raimondii
ref|XP_010498885.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    389   8e-129   Camelina sativa [gold-of-pleasure]
dbj|BAB92018.1|  mitochondrial aldehyde dehydrogenase                   389   9e-129   Sorghum bicolor [broomcorn]
ref|XP_003563967.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    388   1e-128   Brachypodium distachyon [annual false brome]
ref|XP_004509835.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    388   1e-128   
gb|KDO82489.1|  hypothetical protein CISIN_1g009035mg                   382   2e-128   Citrus sinensis [apfelsine]
ref|XP_004509834.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    388   2e-128   Cicer arietinum [garbanzo]
ref|XP_006647839.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    388   2e-128   
ref|XP_009363532.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    387   3e-128   Pyrus x bretschneideri [bai li]
ref|XP_011003158.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    387   4e-128   Populus euphratica
ref|XP_010460154.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    387   4e-128   Camelina sativa [gold-of-pleasure]
ref|XP_004139235.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    387   5e-128   
ref|XP_004156463.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    387   6e-128   
gb|KDO82486.1|  hypothetical protein CISIN_1g009035mg                   382   6e-128   Citrus sinensis [apfelsine]
ref|NP_001105576.1|  aldehyde dehydrogenase2                            387   6e-128   Zea mays [maize]
ref|NP_001057358.1|  Os06g0270900                                       387   7e-128   
gb|EAZ00462.1|  hypothetical protein OsI_22484                          387   7e-128   Oryza sativa Indica Group [Indian rice]
gb|AAF73828.1|AF162665_1  aldehyde dehydrogenase                        387   7e-128   Oryza sativa [red rice]
gb|ACG32898.1|  aldehyde dehydrogenase                                  387   8e-128   Zea mays [maize]
gb|AAL99614.2|AF348418_1  mitochondrial aldehyde dehydrogenase RF2B     386   1e-127   Zea mays [maize]
gb|KGN60807.1|  hypothetical protein Csa_2G010420                       387   3e-127   Cucumis sativus [cucumbers]
gb|KHN47185.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    384   4e-127   Glycine soja [wild soybean]
gb|AHM26657.1|  aldehyde dehydrogenase 2-2                              384   6e-127   Zea mays subsp. mays [corn]
ref|XP_002274863.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    384   7e-127   Vitis vinifera
ref|XP_008456004.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    384   9e-127   Cucumis melo [Oriental melon]
gb|KDO82484.1|  hypothetical protein CISIN_1g009035mg                   382   9e-127   Citrus sinensis [apfelsine]
ref|XP_009391259.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    382   4e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006438422.1|  hypothetical protein CICLE_v10031155mg             382   4e-126   Citrus clementina [clementine]
dbj|BAD15920.1|  putative mitochondrial aldehyde dehydrogenase AL...    378   4e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009391258.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    382   4e-126   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO82485.1|  hypothetical protein CISIN_1g009035mg                   382   4e-126   Citrus sinensis [apfelsine]
ref|XP_009391257.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    381   7e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391256.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    381   1e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004953799.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    381   1e-125   Setaria italica
emb|CBI16844.3|  unnamed protein product                                375   1e-125   Vitis vinifera
ref|XP_002970420.1|  hypothetical protein SELMODRAFT_231526             378   3e-125   
ref|XP_004953798.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    380   4e-125   
dbj|BAJ85552.1|  predicted protein                                      375   6e-125   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008793866.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    379   7e-125   Phoenix dactylifera
gb|EEC73936.1|  hypothetical protein OsI_08800                          379   9e-125   Oryza sativa Indica Group [Indian rice]
ref|NP_001048010.1|  Os02g0730000                                       379   1e-124   
ref|XP_002978501.1|  hypothetical protein SELMODRAFT_233128             377   1e-124   
ref|XP_009399660.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    377   2e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928601.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    377   3e-124   Elaeis guineensis
ref|XP_010928603.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    375   1e-123   Elaeis guineensis
ref|XP_009363534.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    375   2e-123   Pyrus x bretschneideri [bai li]
ref|XP_008793883.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    373   1e-122   
ref|XP_001785650.1|  predicted protein                                  372   2e-122   
gb|KHN23562.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    369   2e-121   Glycine soja [wild soybean]
gb|ABU96176.1|  aldehyde dehydrogenase                                  355   4e-118   Populus tremula x Populus alba [gray poplar]
gb|EMT22926.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    360   4e-116   
ref|XP_002961352.1|  hypothetical protein SELMODRAFT_266598             353   1e-115   
ref|XP_002983210.1|  hypothetical protein SELMODRAFT_234195             352   3e-115   
gb|AEV40467.1|  mitochondrial aldehyde dehydrogenase                    340   9e-115   Miscanthus sinensis
emb|CAN80790.1|  hypothetical protein VITISV_020547                     347   4e-113   Vitis vinifera
ref|XP_007151102.1|  hypothetical protein PHAVU_004G018000g             346   2e-112   Phaseolus vulgaris [French bean]
gb|KJB31274.1|  hypothetical protein B456_005G183300                    340   3e-110   Gossypium raimondii
ref|XP_001690955.1|  aldehyde dehydrogenase                             326   1e-104   Chlamydomonas reinhardtii
emb|CAD10505.1|  aldehyde dehydrogenase                                 325   4e-104   Polytomella sp. Pringsheim 198.80
ref|XP_011483309.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    314   2e-101   
ref|WP_011612157.1|  betaine-aldehyde dehydrogenase                     316   3e-101   Trichodesmium erythraeum
ref|XP_003977205.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    313   3e-101   
ref|XP_010783440.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   9e-101   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005080706.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    311   2e-100   
ref|XP_004635979.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    311   2e-100   
ref|XP_004571367.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    316   2e-100   
ref|XP_009296559.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    310   2e-100   
ref|XP_005472420.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    313   3e-100   
ref|XP_003965899.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    314   4e-100   Takifugu rubripes [tiger puffer]
ref|XP_003446212.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    314   7e-100   Oreochromis niloticus
ref|XP_004595352.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   7e-100   
gb|ABR16485.1|  unknown                                                 313   7e-100   Picea sitchensis
ref|XP_005642984.1|  aldehyde dehydrogenase                             315   8e-100   Coccomyxa subellipsoidea C-169
ref|XP_006178148.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   8e-100   
ref|XP_005752934.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    313   8e-100   
ref|XP_007058380.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   8e-100   
gb|AAK57732.1|  aldehyde dehydrogenase                                  311   9e-100   Rattus norvegicus [brown rat]
ref|XP_003462991.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    312   9e-100   
ref|XP_007529029.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   1e-99    
ref|XP_005080705.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    311   1e-99    
ref|XP_006178149.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   1e-99    
ref|XP_004635978.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    311   1e-99    
ref|WP_009547631.1|  MULTISPECIES: betaine-aldehyde dehydrogenase       312   1e-99    Cyanothece
ref|XP_004691129.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   1e-99    
ref|WP_008181335.1|  betaine-aldehyde dehydrogenase                     312   2e-99    Moorea producens
ref|XP_007058379.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    310   2e-99    
ref|XP_005612652.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    310   2e-99    
ref|XP_006204899.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   2e-99    
ref|XP_006865491.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   2e-99    Chrysochloris asiatica
ref|XP_004595351.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   2e-99    Ochotona princeps [southern American pika]
ref|XP_004571368.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    313   2e-99    Maylandia zebra
gb|AGN03869.1|  retinol dehydrogenase 1                                 310   2e-99    Aurelia aurita
ref|XP_005902646.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   3e-99    
ref|XP_003462990.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    312   3e-99    Cavia porcellus [guinea pig]
sp|P81178.1|ALDH2_MESAU  RecName: Full=Aldehyde dehydrogenase, mi...    311   3e-99    Mesocricetus auratus [Syrian golden hamster]
ref|XP_004430030.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   3e-99    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_008687110.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    309   3e-99    Ursus maritimus [white bear]
ref|XP_006178147.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   3e-99    Camelus ferus
ref|XP_003796032.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    310   4e-99    
ref|XP_004635977.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    312   4e-99    Octodon degus
ref|XP_007625900.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   4e-99    Cricetulus griseus [Chinese hamsters]
gb|AAM94394.2|  mitochondrial aldehyde dehydrogenase                    311   4e-99    Rattus norvegicus [brown rat]
ref|XP_004691128.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   4e-99    Condylura cristata
ref|XP_007079670.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   4e-99    Panthera tigris altaica
ref|XP_005080704.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    311   5e-99    Mesocricetus auratus [Syrian golden hamster]
ref|NP_115792.1|  aldehyde dehydrogenase, mitochondrial precursor       311   5e-99    Rattus norvegicus [brown rat]
ref|XP_006249447.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    311   5e-99    Rattus norvegicus [brown rat]
gb|AAS75815.1|  mitochondrial aldehyde dehydrogenase precursor          311   5e-99    Rattus norvegicus [brown rat]
ref|XP_007170973.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   5e-99    Balaenoptera acutorostrata scammoni
gb|AAS75813.1|  mitochondrial aldehyde dehydrogenase precursor          311   5e-99    Rattus norvegicus [brown rat]
gb|AAS75814.1|  mitochondrial aldehyde dehydrogenase precursor          311   5e-99    Rattus norvegicus [brown rat]
ref|XP_006640511.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    311   5e-99    
ref|XP_008556898.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    311   6e-99    
gb|ABK24518.1|  unknown                                                 302   6e-99    
ref|XP_005403231.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    310   6e-99    
gb|AAI07975.1|  Aldh2b protein                                          310   6e-99    
ref|XP_008140951.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   6e-99    
ref|XP_004671034.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   7e-99    
ref|XP_003932291.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    311   7e-99    
ref|XP_005691616.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   7e-99    
ref|XP_006865490.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   7e-99    
ref|XP_007529021.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    310   9e-99    
ref|XP_003433425.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   9e-99    
ref|XP_006894735.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   1e-98    
ref|XP_004753301.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   1e-98    
ref|XP_005902645.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   1e-98    
ref|XP_009048780.1|  hypothetical protein LOTGIDRAFT_177987             310   1e-98    
ref|XP_005329686.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   1e-98    
ref|XP_005657378.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   1e-98    
ref|WP_008272605.1|  betaine-aldehyde dehydrogenase                     310   1e-98    
ref|XP_004053952.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   1e-98    
ref|XP_006204898.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   1e-98    
ref|XP_003796031.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    310   2e-98    
dbj|BAE29958.1|  unnamed protein product                                310   2e-98    
ref|NP_033786.1|  aldehyde dehydrogenase, mitochondrial precursor       310   2e-98    
gb|AGN03871.1|  retinol dehydrogenase 2                                 310   2e-98    
dbj|BAE31741.1|  unnamed protein product                                310   2e-98    
ref|XP_011450475.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    310   2e-98    
ref|XP_004671033.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   2e-98    
dbj|BAE35596.1|  unnamed protein product                                310   2e-98    
ref|XP_008140950.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   2e-98    
ref|NP_001191818.1|  aldehyde dehydrogenase, mitochondrial isofor...    308   2e-98    
ref|XP_004395896.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   2e-98    
ref|NP_998466.2|  aldehyde dehydrogenase 2 family (mitochondrial)...    310   2e-98    
gb|AAB59500.1|  aldehyde dehydrogenase 2 (EC 1.2.1.3)                   306   3e-98    
gb|AJF41243.1|  mitochondrial aldehyde dehydrogenase 2                  308   3e-98    
ref|XP_007628867.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    310   3e-98    
ref|XP_004876327.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   3e-98    
ref|XP_007529015.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    310   3e-98    
ref|XP_005403230.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    310   3e-98    
ref|XP_010994150.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    310   3e-98    
ref|XP_004379128.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   3e-98    
ref|XP_006894734.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   3e-98    
ref|XP_010602778.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   3e-98    
ref|XP_008570927.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   3e-98    
dbj|BAE27044.1|  unnamed protein product                                309   3e-98    
ref|XP_004753300.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    310   3e-98    
pdb|1O05|A  Chain A, Apo Form Of Human Mitochondrial Aldehyde Deh...    309   4e-98    
pdb|3N81|A  Chain A, T244a Mutant Of Human Mitochondrial Aldehyde...    309   4e-98    
gb|ACI33614.1|  Aldehyde dehydrogenase, mitochondrial precursor         309   4e-98    
ref|XP_853628.1|  PREDICTED: aldehyde dehydrogenase, mitochondria...    309   4e-98    
ref|XP_010967936.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   4e-98    
ref|XP_006769063.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   4e-98    
ref|XP_005329685.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   4e-98    
ref|WP_020722661.1|  betaine-aldehyde dehydrogenase                     308   4e-98    
ref|XP_005344528.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   4e-98    
ref|NP_001038076.1|  aldehyde dehydrogenase, mitochondrial precursor    309   4e-98    
ref|XP_006816163.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   5e-98    
ref|XP_006148056.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   5e-98    
ref|XP_006204897.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   5e-98    
gb|ELR51433.1|  Aldehyde dehydrogenase, mitochondrial                   308   5e-98    
gb|KFQ50915.1|  hypothetical protein N334_09435                         308   5e-98    
ref|XP_006114495.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   5e-98    
pdb|1CW3|A  Chain A, Human Mitochondrial Aldehyde Dehydrogenase C...    308   5e-98    
gb|KDR10336.1|  Retinal dehydrogenase 2                                 308   5e-98    
ref|XP_007160345.1|  hypothetical protein PHAVU_002G314000g             308   6e-98    
ref|XP_007936366.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   6e-98    
ref|XP_004017459.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   6e-98    
ref|XP_004053953.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   6e-98    
gb|EAW97974.1|  aldehyde dehydrogenase 2 family (mitochondrial), ...    305   6e-98    
ref|XP_005572337.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   6e-98    
ref|XP_004483075.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   6e-98    
ref|XP_003994722.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   6e-98    
ref|NP_956784.1|  aldehyde dehydrogenase 2                              308   6e-98    
ref|XP_006099101.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   7e-98    
gb|AAI16560.1|  Aldh2b protein                                          308   7e-98    
gb|AAA51693.1|  aldehyde dehydrogenase                                  308   7e-98    
ref|XP_002913100.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   7e-98    
ref|XP_002961274.1|  hypothetical protein SELMODRAFT_164447             308   7e-98    
ref|XP_004395895.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   7e-98    
dbj|BAD97093.1|  mitochondrial aldehyde dehydrogenase 2 precursor...    308   8e-98    
ref|XP_006099100.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   8e-98    
ref|XP_010162096.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   8e-98    
ref|NP_000681.2|  aldehyde dehydrogenase, mitochondrial isoform 1...    308   8e-98    
gb|AAT41621.1|  mitochondrial aldehyde dehydrogenase 2                  308   8e-98    
ref|XP_004843837.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   8e-98    
gb|AAP36614.1|  Homo sapiens aldehyde dehydrogenase 2 family (mit...    308   9e-98    
ref|XP_007489887.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   9e-98    
ref|XP_004315892.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   9e-98    
ref|XP_004281483.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   9e-98    
ref|XP_005298651.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   9e-98    
ref|XP_004876326.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   9e-98    
ref|XP_006053037.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   1e-97    
gb|EHH66723.1|  hypothetical protein EGM_03768                          308   1e-97    
emb|CAG33272.1|  ALDH2                                                  308   1e-97    
ref|XP_005237664.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   1e-97    
gb|EHH21190.1|  hypothetical protein EGK_04197                          308   1e-97    
ref|XP_006865489.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   1e-97    
ref|XP_008002940.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   1e-97    
ref|XP_010283913.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   1e-97    
ref|XP_003832508.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   1e-97    
ref|XP_010377208.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   1e-97    
gb|KFZ60519.1|  hypothetical protein N338_08333                         306   1e-97    
ref|XP_004379127.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   1e-97    
ref|NP_001068835.1|  aldehyde dehydrogenase, mitochondrial precursor    308   1e-97    
ref|XP_005344527.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   1e-97    
ref|XP_004483074.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   1e-97    
ref|XP_009695502.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   2e-97    
ref|XP_004017458.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   2e-97    
ref|XP_009907917.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   2e-97    
gb|ELK26353.1|  Aldehyde dehydrogenase, mitochondrial                   306   2e-97    
ref|XP_009675586.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   2e-97    
gb|AAM19352.1|AF260121_1  aldehyde dehydrogenase 2 precursor            308   2e-97    
pdb|2ONN|A  Chain A, Arg475gln Mutant Of Human Mitochondrial Alde...    307   2e-97    
ref|XP_007130063.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   2e-97    
ref|XP_005876284.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   2e-97    
ref|XP_009332689.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   2e-97    
ref|XP_008002939.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   2e-97    
ref|XP_009470890.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   2e-97    
ref|XP_005876285.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   2e-97    
ref|WP_016874813.1|  betaine-aldehyde dehydrogenase                     306   2e-97    
ref|XP_005572336.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   2e-97    
ref|XP_007653633.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   2e-97    
ref|XP_006970829.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   2e-97    
gb|KFQ73002.1|  hypothetical protein N337_02121                         305   2e-97    
gb|AJF41242.1|  mitochondrial aldehyde dehydrogenase 2                  306   2e-97    
ref|XP_001767457.1|  predicted protein                                  307   2e-97    
ref|XP_009634365.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   2e-97    
ref|XP_004053951.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   2e-97    
gb|KFV77329.1|  hypothetical protein N307_00927                         306   2e-97    
ref|XP_010883396.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   2e-97    
gb|EFB19337.1|  hypothetical protein PANDA_000873                       307   2e-97    
emb|CCQ61589.1|  Aldehyde dehydrogenase                                 306   2e-97    
ref|XP_006053036.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   2e-97    
ref|NP_001087022.1|  aldehyde dehydrogenase 2 family (mitochondrial)    307   3e-97    
ref|XP_009948983.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   3e-97    
gb|KFP63560.1|  hypothetical protein N322_11016                         306   3e-97    
ref|XP_003761072.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   3e-97    
gb|KFQ67066.1|  hypothetical protein N335_09513                         306   3e-97    
ref|XP_009907916.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   3e-97    
ref|XP_009916021.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   3e-97    
ref|XP_009510567.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   3e-97    
gb|EFX80526.1|  hypothetical protein DAPPUDRAFT_51170                   306   3e-97    
ref|XP_005237662.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   3e-97    
gb|KFP09214.1|  hypothetical protein Z169_08064                         305   4e-97    
ref|XP_010718484.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   4e-97    
ref|XP_011312780.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   4e-97    
ref|NP_001124747.1|  aldehyde dehydrogenase, mitochondrial precursor    306   4e-97    
ref|XP_009282142.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   4e-97    
gb|KFW62606.1|  hypothetical protein AS28_06355                         305   4e-97    
ref|XP_010114028.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   4e-97    
ref|XP_010303219.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   4e-97    
ref|XP_005642981.1|  aldehyde dehydrogenase                             305   4e-97    
ref|XP_005572335.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   4e-97    
ref|XP_010132992.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   4e-97    
gb|KFP98428.1|  hypothetical protein N330_00232                         305   5e-97    
ref|XP_002983288.1|  hypothetical protein SELMODRAFT_180171             306   5e-97    
gb|KFQ02971.1|  hypothetical protein N329_07724                         305   5e-97    
ref|XP_009570652.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   5e-97    
ref|XP_009877625.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   5e-97    
ref|XP_006620105.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   5e-97    
ref|XP_008845744.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   5e-97    
gb|ELW66580.1|  Aldehyde dehydrogenase, mitochondrial                   306   6e-97    
ref|XP_010150586.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   6e-97    
pdb|1NZW|A  Chain A, Cys302ser Mutant Of Human Mitochondrial Alde...    305   7e-97    
gb|KFW95044.1|  hypothetical protein N336_12440                         305   7e-97    
dbj|BAG62916.1|  unnamed protein product                                305   7e-97    
gb|EPQ13952.1|  Aldehyde dehydrogenase, mitochondrial                   307   7e-97    
gb|KFV93503.1|  hypothetical protein N326_03098                         305   7e-97    
sp|P12762.1|ALDH2_HORSE  RecName: Full=Aldehyde dehydrogenase, mi...    305   7e-97    
ref|XP_008322067.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   7e-97    
ref|XP_008270467.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   8e-97    
gb|ACN27968.1|  unknown                                                 300   8e-97    
emb|CAA28990.1|  unnamed protein product                                306   8e-97    
pdb|1AG8|A  Chain A, Aldehyde Dehydrogenase From Bovine Mitochondria    305   9e-97    
gb|AJF41241.1|  mitochondrial aldehyde dehydrogenase 2                  304   9e-97    
pdb|3N80|A  Chain A, Human Mitochondrial Aldehyde Dehydrogenase, ...    305   9e-97    
ref|XP_010155846.1|  PREDICTED: retinal dehydrogenase 1                 296   1e-96    
gb|KFV95675.1|  Retinal dehydrogenase 1                                 296   1e-96    
gb|KFO12057.1|  hypothetical protein N312_10195                         305   1e-96    
gb|ACD02422.1|  mitochondrial aldehyde dehydrogenase 2                  306   1e-96    
gb|KFM10649.1|  hypothetical protein AS27_00800                         304   1e-96    
gb|EQB77383.1|  aldehyde dehydrogenase, mitochondrial precursor         306   1e-96    
ref|WP_007312907.1|  betaine-aldehyde dehydrogenase                     305   1e-96    
emb|CCQ69085.1|  Aldehyde dehydrogenase                                 304   1e-96    
gb|KFZ54393.1|  hypothetical protein N321_09165                         304   1e-96    
gb|KFV89938.1|  hypothetical protein N327_06370                         304   1e-96    
ref|WP_041229752.1|  betaine-aldehyde dehydrogenase                     302   1e-96    
ref|XP_009470881.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   1e-96    
gb|KFV59939.1|  hypothetical protein N328_09910                         304   2e-96    
ref|XP_009939330.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   2e-96    
ref|XP_005145216.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    305   2e-96    
ref|XP_009878604.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   2e-96    
ref|XP_009817685.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   2e-96    
gb|ACK65581.1|  transposase, IS605 OrfB family                          302   2e-96    
ref|XP_005055123.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   2e-96    
emb|CAA68290.1|  unnamed protein product                                305   2e-96    
gb|KFQ57335.1|  hypothetical protein N333_07072                         304   2e-96    
gb|AJF41246.1|  mitochondrial aldehyde dehydrogenase 2                  304   2e-96    
ref|XP_003642229.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   2e-96    
gb|KFP53510.1|  hypothetical protein N323_12997                         303   2e-96    
ref|XP_006015235.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    300   2e-96    
gb|KGL89437.1|  hypothetical protein N301_08459                         303   2e-96    
ref|XP_623084.1|  PREDICTED: aldehyde dehydrogenase, mitochondria...    304   2e-96    
ref|XP_004945656.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   3e-96    
gb|KFV73366.1|  hypothetical protein N308_00184                         303   3e-96    
ref|XP_008431064.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   3e-96    
gb|KFR15788.1|  hypothetical protein N306_07931                         303   3e-96    
ref|XP_007448232.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   3e-96    
gb|KFQ91788.1|  hypothetical protein Y956_05867                         303   3e-96    
ref|XP_010724044.1|  PREDICTED: retinal dehydrogenase 1                 297   3e-96    
gb|KDR23477.1|  Aldehyde dehydrogenase, mitochondrial                   304   3e-96    
ref|XP_007448233.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   3e-96    
ref|XP_008632281.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   3e-96    
gb|ABI24013.1|  mitochondrial Aldh2                                     298   4e-96    
emb|CAF94009.1|  unnamed protein product                                304   4e-96    
ref|XP_009986764.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   4e-96    
ref|XP_007433657.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   4e-96    
ref|XP_010212198.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   4e-96    
ref|XP_010021190.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   4e-96    
ref|WP_007307870.1|  betaine-aldehyde dehydrogenase                     303   5e-96    
gb|AJF41250.1|  mitochondrial aldehyde dehydrogenase 2                  302   5e-96    
ref|XP_009558681.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   5e-96    



>ref|XP_004236119.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Solanum lycopersicum]
Length=535

 Score =   442 bits (1138),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 204/231 (88%), Positives = 219/231 (95%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA+ID AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARAMRRV
Sbjct  305  GKSPFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARAMRRV  364

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDSEQF+K+LRYIR G++S ATLECGGDRIGSKGYFIQPT+FS+VK
Sbjct  365  VGDPFKKGVEQGPQIDSEQFQKILRYIREGRDSSATLECGGDRIGSKGYFIQPTVFSNVK  424

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            EDM IAQDEIFGPVQCV KFKDI EVIKRANNT YGLAAGV+T +ID ANTL RGLRAGT
Sbjct  425  EDMSIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNIDTANTLTRGLRAGT  484

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYD+FDA IPFGGYKMSG+GREKG+YSLNNYLQVKAVVTPLKNPAWI
Sbjct  485  VWVNCYDIFDAGIPFGGYKMSGMGREKGIYSLNNYLQVKAVVTPLKNPAWI  535



>ref|XP_006345041.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Solanum tuberosum]
Length=535

 Score =   441 bits (1134),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 204/231 (88%), Positives = 218/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA++D AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARAMRRV
Sbjct  305  GKSPFIICEDADVDHAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARAMRRV  364

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDSEQF+K+LRYIR G++S ATLECGGDRIGSKGYFIQPT+FS+VK
Sbjct  365  VGDPFKKGVEQGPQIDSEQFKKILRYIREGRDSSATLECGGDRIGSKGYFIQPTVFSNVK  424

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            EDM IAQDEIFGPVQCV KFKDI EVIKRANNT YGLAAGV+T +ID ANTL RGLRAGT
Sbjct  425  EDMSIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNIDTANTLTRGLRAGT  484

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYD+FDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPLKNPAWI
Sbjct  485  VWINCYDIFDAGIPFGGYKMSGTGREKGIYSLNNYLQVKAVVTPLKNPAWI  535



>ref|XP_009617290.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Nicotiana tomentosiformis]
Length=536

 Score =   440 bits (1131),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 202/231 (87%), Positives = 219/231 (95%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA+ID AVE AHFALFFNQGQCCCAGSRTYVHER+YDEF+EKAK RAMRRV
Sbjct  306  GKSPFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFIEKAKTRAMRRV  365

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDSEQF+K+LRYIRSG++S ATLECGGDR GSKGYFIQPT+FS+VK
Sbjct  366  VGDPFKKGVEQGPQIDSEQFQKILRYIRSGRDSSATLECGGDRFGSKGYFIQPTVFSNVK  425

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            EDM+IAQDEIFGPVQCV KFKDI EVIKRANNT YGLAAGV+T +ID ANTL RGLRAGT
Sbjct  426  EDMLIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNIDTANTLTRGLRAGT  485

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYDVFDA IPFGGYKMSG+GREKG+YSL+NYLQVKAVVTPLKNPAWI
Sbjct  486  VWVNCYDVFDAGIPFGGYKMSGMGREKGIYSLSNYLQVKAVVTPLKNPAWI  536



>ref|XP_009617291.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Nicotiana tomentosiformis]
Length=535

 Score =   440 bits (1131),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 202/231 (87%), Positives = 219/231 (95%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA+ID AVE AHFALFFNQGQCCCAGSRTYVHER+YDEF+EKAK RAMRRV
Sbjct  305  GKSPFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFIEKAKTRAMRRV  364

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDSEQF+K+LRYIRSG++S ATLECGGDR GSKGYFIQPT+FS+VK
Sbjct  365  VGDPFKKGVEQGPQIDSEQFQKILRYIRSGRDSSATLECGGDRFGSKGYFIQPTVFSNVK  424

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            EDM+IAQDEIFGPVQCV KFKDI EVIKRANNT YGLAAGV+T +ID ANTL RGLRAGT
Sbjct  425  EDMLIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNIDTANTLTRGLRAGT  484

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYDVFDA IPFGGYKMSG+GREKG+YSL+NYLQVKAVVTPLKNPAWI
Sbjct  485  VWVNCYDVFDAGIPFGGYKMSGMGREKGIYSLSNYLQVKAVVTPLKNPAWI  535



>gb|KJB53134.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=328

 Score =   424 bits (1091),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 190/231 (82%), Positives = 219/231 (95%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA+RRV
Sbjct  98   GKSPFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKAKARALRRV  157

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID+EQFEKVLRYIR+G ES ATLECGGDR+G+KGYF+QPT+FS+V 
Sbjct  158  VGDPFRKGVEQGPQIDTEQFEKVLRYIRAGIESNATLECGGDRLGTKGYFVQPTVFSNVM  217

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKDIDEVI+RANNT YGLAAGV+T  ++ ANTL R LRAGT
Sbjct  218  DDMLIAKDEIFGPVQSILKFKDIDEVIRRANNTRYGLAAGVFTKSVETANTLTRALRAGT  277

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  278  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  328



>ref|XP_002511424.1| aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF52026.1| aldehyde dehydrogenase, putative [Ricinus communis]
Length=534

 Score =   429 bits (1102),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 192/231 (83%), Positives = 220/231 (95%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPF++C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEF+EKAKARAMRRV
Sbjct  304  GKSPFVVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFLEKAKARAMRRV  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQIDSEQF+KVLRYI+SG ES ATLECGGDR G +GYFIQPT+FS+V+
Sbjct  364  VGDPFRKGVEQGPQIDSEQFQKVLRYIKSGIESNATLECGGDRFGPRGYFIQPTVFSNVQ  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFKD+DEVI+RAN T YGLAAGV+T++ID ANTL+R LRAGT
Sbjct  424  DDMLIAQDEIFGPVQSILKFKDLDEVIRRANTTRYGLAAGVFTNNIDTANTLSRALRAGT  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNPAW+
Sbjct  484  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL  534



>gb|KCW83435.1| hypothetical protein EUGRSUZ_B00357 [Eucalyptus grandis]
Length=378

 Score =   418 bits (1075),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 188/231 (81%), Positives = 218/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARA++R 
Sbjct  148  GKSPFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARALKRS  207

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQID EQF+KVLRYIR+G +S ATLECGGDR+GSKG+F+QPT+FS+V+
Sbjct  208  VGDPFKKGIEQGPQIDVEQFQKVLRYIRAGIDSNATLECGGDRLGSKGFFVQPTVFSNVQ  267

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKD+DEV++RAN+T YGLAAGV+T DID AN L+R LR GT
Sbjct  268  DDMLIAKDEIFGPVQSILKFKDLDEVVRRANSTRYGLAAGVFTKDIDVANALSRALRVGT  327

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNPAW+
Sbjct  328  VWINCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL  378



>ref|XP_002321583.2| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
 gb|EEF05710.2| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
Length=497

 Score =   422 bits (1086),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 189/231 (82%), Positives = 218/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARA+RRV
Sbjct  267  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARALRRV  326

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDSEQFEK+LRYI+SG ES ATLECGG R GSKGYFIQPT+FS+V+
Sbjct  327  VGDPFKKGVEQGPQIDSEQFEKILRYIKSGVESNATLECGGQRFGSKGYFIQPTVFSNVQ  386

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFK+IDEVI+RAN T YGLAAG++T ++D ANTL+R LR G+
Sbjct  387  DDMLIAKDEIFGPVQSILKFKNIDEVIQRANTTRYGLAAGIFTKNVDTANTLSRALRVGS  446

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  447  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  497



>gb|KJB53131.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=541

 Score =   424 bits (1090),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 190/231 (82%), Positives = 219/231 (95%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA+RRV
Sbjct  311  GKSPFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKAKARALRRV  370

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID+EQFEKVLRYIR+G ES ATLECGGDR+G+KGYF+QPT+FS+V 
Sbjct  371  VGDPFRKGVEQGPQIDTEQFEKVLRYIRAGIESNATLECGGDRLGTKGYFVQPTVFSNVM  430

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKDIDEVI+RANNT YGLAAGV+T  ++ ANTL R LRAGT
Sbjct  431  DDMLIAKDEIFGPVQSILKFKDIDEVIRRANNTRYGLAAGVFTKSVETANTLTRALRAGT  490

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  491  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  541



>gb|KJB53133.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=530

 Score =   424 bits (1089),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 190/231 (82%), Positives = 219/231 (95%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA+RRV
Sbjct  300  GKSPFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKAKARALRRV  359

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID+EQFEKVLRYIR+G ES ATLECGGDR+G+KGYF+QPT+FS+V 
Sbjct  360  VGDPFRKGVEQGPQIDTEQFEKVLRYIRAGIESNATLECGGDRLGTKGYFVQPTVFSNVM  419

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKDIDEVI+RANNT YGLAAGV+T  ++ ANTL R LRAGT
Sbjct  420  DDMLIAKDEIFGPVQSILKFKDIDEVIRRANNTRYGLAAGVFTKSVETANTLTRALRAGT  479

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  480  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  530



>ref|XP_002318034.1| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
 gb|EEE96254.1| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
Length=536

 Score =   424 bits (1089),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 189/231 (82%), Positives = 218/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AH ALFFNQGQCCCAGSRTYVHER+YDEF+EKAKARA+RRV
Sbjct  306  GKSPFIVCEDADVDKAVELAHHALFFNQGQCCCAGSRTYVHERVYDEFIEKAKARALRRV  365

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDS+QFEKVLRYIRSG ES ATLECGG R GSKGYFIQPT+FS+V+
Sbjct  366  VGDPFKKGVEQGPQIDSDQFEKVLRYIRSGVESNATLECGGQRFGSKGYFIQPTVFSNVE  425

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFK++DEVI+R+N+T YGLAAG++T ++D ANTL+R LR GT
Sbjct  426  DDMLIAQDEIFGPVQSILKFKNVDEVIRRSNSTRYGLAAGIFTKNVDTANTLSRALRVGT  485

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNPAW+
Sbjct  486  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL  536



>gb|KHG08400.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Gossypium 
arboreum]
Length=540

 Score =   424 bits (1089),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 189/231 (82%), Positives = 219/231 (95%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RV
Sbjct  310  GKSPFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARALKRV  369

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID+EQFEKVLRYIR+G ES ATLECGGDR+G+KGYF+QPT+FS+V 
Sbjct  370  VGDPFRKGVEQGPQIDTEQFEKVLRYIRAGIESNATLECGGDRLGTKGYFVQPTVFSNVM  429

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKDIDEVI+RANNT YGLAAGV+T  ++ ANTL R LRAGT
Sbjct  430  DDMLIAKDEIFGPVQSILKFKDIDEVIRRANNTRYGLAAGVFTKSVETANTLTRALRAGT  489

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  490  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  540



>emb|CDP18933.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   423 bits (1088),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 191/231 (83%), Positives = 219/231 (95%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE+AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA+RR 
Sbjct  304  GKSPFIVCEDADIDKAVEEAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKAKARALRRT  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQIDSEQF+KVLRYI+SG +S ATLECGG+RIGSKG+FIQPT+FS+V+
Sbjct  364  VGDPFRKGVEQGPQIDSEQFDKVLRYIKSGVDSNATLECGGERIGSKGFFIQPTVFSNVQ  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IA+DEIFGPVQ +LKFKD+DEVIKRAN T YGLAAGVYT +ID ANTL+RGLRAGT
Sbjct  424  DNMLIAKDEIFGPVQSILKFKDLDEVIKRANATRYGLAAGVYTKNIDTANTLSRGLRAGT  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  484  VWINCFDVFDAAIPFGGYKMSGHGREKGFYSLQNYLQVKAVVTPLKNPAWL  534



>ref|XP_011044321.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=539

 Score =   422 bits (1086),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 190/231 (82%), Positives = 217/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AH ALFFNQGQ CCAGSRTYVHER+YDEF+EKAKARA+RRV
Sbjct  309  GKSPFIVCEDADVDKAVELAHHALFFNQGQSCCAGSRTYVHERVYDEFIEKAKARALRRV  368

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDS+QFEKVLRYIRSG ES ATLECGG R GSKGYFIQPT+FS+V+
Sbjct  369  VGDPFKKGVEQGPQIDSDQFEKVLRYIRSGVESNATLECGGQRFGSKGYFIQPTVFSNVQ  428

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFK+IDEVI+R+NNT YGLAAG++T ++D ANTL+R LR GT
Sbjct  429  DDMLIAQDEIFGPVQSILKFKNIDEVIRRSNNTRYGLAAGIFTKNVDTANTLSRALRVGT  488

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNPAW+
Sbjct  489  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL  539



>ref|XP_011044320.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=538

 Score =   422 bits (1085),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 188/231 (81%), Positives = 218/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AH ALFFNQGQCCCAGSRTYVHER+YDEF+EKAKARA+RRV
Sbjct  308  GKSPFIVCEDADVDKAVELAHHALFFNQGQCCCAGSRTYVHERVYDEFIEKAKARALRRV  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDS+QFEKVLRYIRSG ES ATLECGG R GSKGYFIQPT+FS+V+
Sbjct  368  VGDPFKKGVEQGPQIDSDQFEKVLRYIRSGVESNATLECGGQRFGSKGYFIQPTVFSNVQ  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFK++DEVI+R+N+T YGLAAG++T ++D ANTL+R LR GT
Sbjct  428  DDMLIAQDEIFGPVQSILKFKNVDEVIRRSNSTRYGLAAGIFTRNLDTANTLSRALRVGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKA+VTPLKNPAW+
Sbjct  488  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAIVTPLKNPAWL  538



>gb|EYU42550.1| hypothetical protein MIMGU_mgv1a004919mg [Erythranthe guttata]
Length=504

 Score =   421 bits (1082),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 190/231 (82%), Positives = 218/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+CDDA++D AVE AHFALFFNQGQCCCAGSRTYVHERIYDEFV+KAKARA+ R 
Sbjct  274  GKSPFIVCDDADVDHAVELAHFALFFNQGQCCCAGSRTYVHERIYDEFVDKAKARALGRT  333

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQID +QFEKVLRYI+SG +S ATLECGGDR GSKGYF+QPT+FS+VK
Sbjct  334  VGDPFKNGIEQGPQIDLKQFEKVLRYIKSGIDSDATLECGGDRFGSKGYFVQPTVFSNVK  393

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFKD+D+VIKRAN T YGLAAGV+T++IDKANT++RGL+AGT
Sbjct  394  DDMLIAQDEIFGPVQSILKFKDVDKVIKRANATRYGLAAGVFTTNIDKANTISRGLKAGT  453

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYD+FDA IPFGGYKMSGIGREKGVYSLNNYLQVK+V++PLKNPAW+
Sbjct  454  VWINCYDIFDAAIPFGGYKMSGIGREKGVYSLNNYLQVKSVISPLKNPAWL  504



>ref|XP_010546022.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Tarenaya hassleriana]
Length=539

 Score =   422 bits (1085),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 190/231 (82%), Positives = 216/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARA+RR 
Sbjct  309  GKSPFIVCEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARALRRA  368

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQ+DSEQFEKV+RYIRSG ES A LECGG+RIG+KGYFIQPT+FS+VK
Sbjct  369  VGDPFKKGIEQGPQVDSEQFEKVMRYIRSGLESDAVLECGGERIGNKGYFIQPTVFSNVK  428

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            EDM+IA+DEIFGPVQ +LKFKD+DEVI+RANNT YGLAAGV+T  ++ AN + R LRAGT
Sbjct  429  EDMLIARDEIFGPVQSILKFKDLDEVIQRANNTRYGLAAGVFTRSLETANRMTRALRAGT  488

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV PLKNPAWI
Sbjct  489  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVAPLKNPAWI  539



>gb|KEH35050.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=542

 Score =   422 bits (1085),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 188/231 (81%), Positives = 220/231 (95%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHERIYDEF+EKAKA A+RRV
Sbjct  312  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERIYDEFLEKAKAAALRRV  371

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQ+DS+QFEK+L+YI+SG ES ATLECGGDRIG+KG+F+QPT+FS+V+
Sbjct  372  VGDPFKKGVEQGPQVDSQQFEKILKYIKSGVESNATLECGGDRIGTKGFFVQPTVFSNVQ  431

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA+DEIFGPVQ +LKFKD DEVI+RANNT YGLAAGV+T+++D ANTL RGL+AGT
Sbjct  432  DDMSIAKDEIFGPVQTILKFKDTDEVIRRANNTRYGLAAGVFTNNLDTANTLMRGLKAGT  491

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG+GREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  492  VWINCFDVFDAAIPFGGYKMSGVGREKGIYSLHNYLQVKAVVTPLKNPAWL  542



>ref|XP_010037573.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW49300.1| hypothetical protein EUGRSUZ_K02858 [Eucalyptus grandis]
 gb|KCW49301.1| hypothetical protein EUGRSUZ_K02858 [Eucalyptus grandis]
Length=542

 Score =   422 bits (1084),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 193/231 (84%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA+ID AVE AHFA+FFNQGQCCCAGSRTYVHERIYDEF+EKAKARAM+RV
Sbjct  312  GKSPFIICEDADIDEAVEAAHFAIFFNQGQCCCAGSRTYVHERIYDEFLEKAKARAMKRV  371

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID EQFEK+LRYI+ G ES ATLECGG+R GSKG+FIQPT+FS+VK
Sbjct  372  VGDPFKKGVEQGPQIDVEQFEKILRYIKLGVESNATLECGGERFGSKGFFIQPTVFSNVK  431

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IAQDEIFGPVQ +LKFKD+DEV++RAN T YGLAAGVYT +ID ANTL R LRAGT
Sbjct  432  DDMTIAQDEIFGPVQSILKFKDLDEVVRRANATAYGLAAGVYTKNIDTANTLTRALRAGT  491

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYDVFDA IPFGGYKMSGIGREKG+Y LN+YLQVKAVVTPLKNPAW+
Sbjct  492  VWVNCYDVFDAAIPFGGYKMSGIGREKGIYGLNSYLQVKAVVTPLKNPAWL  542



>gb|KDP31120.1| hypothetical protein JCGZ_11496 [Jatropha curcas]
Length=541

 Score =   422 bits (1084),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 191/231 (83%), Positives = 218/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARA+RRV
Sbjct  311  GKSPFIVCEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARAVRRV  370

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID EQF+KVLRYI+SG ES   LECGG+R+GSKGYFIQPT+FS+V+
Sbjct  371  VGDPFKKGVEQGPQIDDEQFQKVLRYIKSGIESNGKLECGGERLGSKGYFIQPTVFSNVQ  430

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            EDM+IA+DEIFGPVQ +LKFKD+DEVI+RAN++ YGLAAGV+T +ID ANTL+R LRAGT
Sbjct  431  EDMLIAKDEIFGPVQSILKFKDVDEVIRRANSSRYGLAAGVFTKNIDTANTLSRALRAGT  490

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPLKNPAW+
Sbjct  491  VWVNCFDVFDAAIPFGGYKMSGFGREKGIYSLNNYLQVKAVVTPLKNPAWL  541



>ref|XP_010101190.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
 gb|EXB87864.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
Length=546

 Score =   421 bits (1083),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 194/231 (84%), Positives = 216/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARA+ R 
Sbjct  316  GKSPFIVCEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARAVNRS  375

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDSEQF K+L+YIRSG +S ATLECGGDRIGSKGYFIQPT+FS+V+
Sbjct  376  VGDPFKKGVEQGPQIDSEQFRKILKYIRSGIDSNATLECGGDRIGSKGYFIQPTVFSNVQ  435

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFK+IDEVIKRAN T YGLAAGV+T +ID ANTL R L+AGT
Sbjct  436  DDMLIAQDEIFGPVQSILKFKEIDEVIKRANATRYGLAAGVFTKNIDTANTLTRALKAGT  495

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKGVYSLNNYLQVKAVVT LKNPAW+
Sbjct  496  VWVNCFDVFDAAIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTRLKNPAWL  546



>ref|XP_008360830.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like, 
partial [Malus domestica]
Length=253

 Score =   410 bits (1053),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 188/231 (81%), Positives = 216/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKS FIIC+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RV
Sbjct  23   GKSXFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAVKRV  82

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID+EQFEKVLRYIR+G +S ATLECGG R+GSKGYFIQPT+FS+VK
Sbjct  83   VGDPFKKGVEQGPQIDNEQFEKVLRYIRAGIDSDATLECGGGRLGSKGYFIQPTVFSNVK  142

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFK++DEV++RAN T YGLAAGV+T +ID AN L R LRAGT
Sbjct  143  DDMLIAKDEIFGPVQSILKFKELDEVVRRANXTRYGLAAGVFTKNIDTANYLTRALRAGT  202

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  203  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  253



>ref|XP_008453101.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis melo]
Length=554

 Score =   421 bits (1081),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 190/231 (82%), Positives = 217/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+Y+EFVEK+KARA RRV
Sbjct  324  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYEEFVEKSKARAQRRV  383

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID EQFEKVLRYI+SG ES ATLECGG R+GSKGYFI+PT+FS+VK
Sbjct  384  VGDPFKKGVEQGPQIDLEQFEKVLRYIKSGIESNATLECGGGRLGSKGYFIEPTVFSNVK  443

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKDIDEVI RAN+T YGLA+GV+TS+ID ANTL RGLR GT
Sbjct  444  DDMLIAKDEIFGPVQSILKFKDIDEVIHRANSTRYGLASGVFTSNIDTANTLTRGLRTGT  503

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D+FDA IPFGGYKMSGIGREKG+YSL NYLQVKAVVTPLKNPAW+
Sbjct  504  VWVNCFDIFDAAIPFGGYKMSGIGREKGIYSLQNYLQVKAVVTPLKNPAWL  554



>ref|XP_010028184.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW83434.1| hypothetical protein EUGRSUZ_B00357 [Eucalyptus grandis]
Length=534

 Score =   419 bits (1078),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 188/231 (81%), Positives = 218/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARA++R 
Sbjct  304  GKSPFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARALKRS  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQID EQF+KVLRYIR+G +S ATLECGGDR+GSKG+F+QPT+FS+V+
Sbjct  364  VGDPFKKGIEQGPQIDVEQFQKVLRYIRAGIDSNATLECGGDRLGSKGFFVQPTVFSNVQ  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKD+DEV++RAN+T YGLAAGV+T DID AN L+R LR GT
Sbjct  424  DDMLIAKDEIFGPVQSILKFKDLDEVVRRANSTRYGLAAGVFTKDIDVANALSRALRVGT  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNPAW+
Sbjct  484  VWINCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL  534



>gb|KHN18468.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=542

 Score =   419 bits (1077),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 189/231 (82%), Positives = 217/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EK+K RA+RRV
Sbjct  312  GKSPFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKSKKRALRRV  371

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID EQFEKVLRYIRSG ES ATLECGGDR+GSKG+F+QPT+FS+V+
Sbjct  372  VGDPFKKGVEQGPQIDVEQFEKVLRYIRSGIESHATLECGGDRLGSKGFFVQPTVFSNVQ  431

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFKDIDEVI+RAN T YGLAAGV+T ++  ANTL R LRAGT
Sbjct  432  DDMLIAQDEIFGPVQSILKFKDIDEVIRRANKTRYGLAAGVFTKNVSTANTLMRALRAGT  491

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+P+KNPAW+
Sbjct  492  VWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPVKNPAWL  542



>ref|XP_004138115.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
 gb|KGN63591.1| hypothetical protein Csa_1G005520 [Cucumis sativus]
Length=548

 Score =   419 bits (1077),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 188/231 (81%), Positives = 218/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+++EFVEK+KARA RRV
Sbjct  318  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVHEEFVEKSKARAQRRV  377

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDS+QFEKVLRYI+SG ES ATLECGG R+GSKGYFI+PT+FS+VK
Sbjct  378  VGDPFKKGVEQGPQIDSDQFEKVLRYIKSGIESNATLECGGGRLGSKGYFIEPTVFSNVK  437

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKDIDEVI RAN+T YGLA+G++TS+ID ANTL RGLR GT
Sbjct  438  DDMLIAKDEIFGPVQSILKFKDIDEVIHRANSTRYGLASGIFTSNIDTANTLIRGLRTGT  497

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D+FDA IPFGGYKMSGIGREKG+YSL NYLQVKAVVTPLKNPAW+
Sbjct  498  VWVNCFDIFDAAIPFGGYKMSGIGREKGIYSLQNYLQVKAVVTPLKNPAWL  548



>ref|XP_004508854.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=423

 Score =   414 bits (1065),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 187/231 (81%), Positives = 217/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EK+K RA+RRV
Sbjct  193  GKSPFIVCEDADVDKAVEIAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKSKERALRRV  252

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDSEQFEKVLRYIRSG +S ATLECGG+R GSKG+FIQPT+FS+V+
Sbjct  253  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGIDSNATLECGGERFGSKGFFIQPTVFSNVQ  312

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFK+IDEVI+RAN T YGLAAGV+T ++  ANTL R LRAGT
Sbjct  313  DDMLIAKDEIFGPVQSILKFKEIDEVIRRANATRYGLAAGVFTKNLSTANTLMRALRAGT  372

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PLKNPAW+
Sbjct  373  VWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLKNPAWL  423



>ref|XP_004298932.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=532

 Score =   417 bits (1072),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 187/231 (81%), Positives = 216/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC DA+ID AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA++R 
Sbjct  302  GKSPFIICKDADIDHAVELAHFALFFNQGQCCCAGSRTFVHEHVYDEFLEKAKARALKRT  361

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQIDSEQF+KVL+YI+SG ES ATLECGG+R GSKGYFIQPT+FS+V+
Sbjct  362  VGDPFKKGIEQGPQIDSEQFQKVLKYIKSGVESDATLECGGERFGSKGYFIQPTVFSNVQ  421

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFK+IDEV++RAN+T +GLAAGV+T +ID ANTL R LRAGT
Sbjct  422  DDMLIAQDEIFGPVQSILKFKEIDEVVRRANSTRFGLAAGVFTKNIDTANTLTRALRAGT  481

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  482  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  532



>ref|XP_008374451.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Malus domestica]
Length=539

 Score =   417 bits (1072),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 188/231 (81%), Positives = 218/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA+I+ AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RV
Sbjct  309  GKSPFIICEDADINHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAVKRV  368

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID+EQFEKVLRYIRSG +S ATLECGG+R+GSKGYFIQPT+FS+V+
Sbjct  369  VGDPFKKGVEQGPQIDNEQFEKVLRYIRSGIDSNATLECGGERLGSKGYFIQPTVFSNVE  428

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFK++DEV++RAN T YGLAAGV+T +I+ AN L R LRAGT
Sbjct  429  DDMLIAQDEIFGPVQSILKFKELDEVVRRANATRYGLAAGVFTKNINTANYLTRALRAGT  488

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  489  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  539



>ref|XP_007155411.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
 gb|ESW27405.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
Length=536

 Score =   417 bits (1071),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 190/231 (82%), Positives = 215/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EK+K RA+RRV
Sbjct  306  GKSPFIVFEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKSKKRALRRV  365

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID EQFEKVL YIRSG ES ATLECGG+R+GSKG+FIQPT+FS+V+
Sbjct  366  VGDPFKKGVEQGPQIDGEQFEKVLSYIRSGIESNATLECGGNRLGSKGFFIQPTVFSNVQ  425

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DMVIAQDEIFGPVQ +LKFKDIDEVI+RAN T YGLAAGV+T ++D AN L R LRAGT
Sbjct  426  DDMVIAQDEIFGPVQSILKFKDIDEVIQRANRTRYGLAAGVFTKNVDTANRLMRALRAGT  485

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAWI
Sbjct  486  VWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWI  536



>ref|XP_008367527.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Malus domestica]
Length=541

 Score =   417 bits (1071),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 189/231 (82%), Positives = 217/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RV
Sbjct  311  GKSPFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAVKRV  370

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID+EQFEKVLRYIR+G +S ATLECGG R+GSKGYFIQPT+FS+VK
Sbjct  371  VGDPFKKGVEQGPQIDNEQFEKVLRYIRAGIDSBATLECGGGRLGSKGYFIQPTVFSNVK  430

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFK++DEV++RAN T YGLAAGV+T +ID AN L R LRAGT
Sbjct  431  DDMLIAKDEIFGPVQSILKFKELDEVVRRANATRYGLAAGVFTKNIDTANYLTRALRAGT  490

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  491  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  541



>ref|XP_008239742.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Prunus mume]
Length=537

 Score =   416 bits (1070),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 189/231 (82%), Positives = 217/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RV
Sbjct  307  GKSPFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAVKRV  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID+EQFEKVLRYIR+G +S ATLECGG R+GSKGYFI+PT+FS+VK
Sbjct  367  VGDPFKKGVEQGPQIDNEQFEKVLRYIRAGIDSDATLECGGGRLGSKGYFIEPTVFSNVK  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKD+DEV++RAN T YGLAAGV+T +ID AN L R LRAGT
Sbjct  427  DDMLIAKDEIFGPVQSILKFKDLDEVVRRANATRYGLAAGVFTRNIDTANYLTRALRAGT  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  487  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  537



>ref|XP_007155410.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
 gb|ESW27404.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
Length=535

 Score =   416 bits (1069),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 190/231 (82%), Positives = 215/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EK+K RA+RRV
Sbjct  305  GKSPFIVFEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKSKKRALRRV  364

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID EQFEKVL YIRSG ES ATLECGG+R+GSKG+FIQPT+FS+V+
Sbjct  365  VGDPFKKGVEQGPQIDGEQFEKVLSYIRSGIESNATLECGGNRLGSKGFFIQPTVFSNVQ  424

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DMVIAQDEIFGPVQ +LKFKDIDEVI+RAN T YGLAAGV+T ++D AN L R LRAGT
Sbjct  425  DDMVIAQDEIFGPVQSILKFKDIDEVIQRANRTRYGLAAGVFTKNVDTANRLMRALRAGT  484

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAWI
Sbjct  485  VWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWI  535



>ref|XP_007210569.1| hypothetical protein PRUPE_ppa003869mg [Prunus persica]
 gb|EMJ11768.1| hypothetical protein PRUPE_ppa003869mg [Prunus persica]
Length=543

 Score =   416 bits (1070),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 189/231 (82%), Positives = 216/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RV
Sbjct  313  GKSPFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAVKRV  372

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID+EQFEKVLRYIR+G +S ATLECGG R+GSKGYFI+PT+FS+VK
Sbjct  373  VGDPFKKGVEQGPQIDNEQFEKVLRYIRAGIDSDATLECGGGRLGSKGYFIEPTVFSNVK  432

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKD+DEV++RAN T YGLAAGV+T +ID AN   R LRAGT
Sbjct  433  DDMLIAKDEIFGPVQSILKFKDLDEVVRRANATRYGLAAGVFTRNIDTANYFTRALRAGT  492

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNPAW+
Sbjct  493  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL  543



>gb|AAO72532.1| aldehyde dehydrogenase 1 precursor [Lotus corniculatus]
Length=542

 Score =   416 bits (1069),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 218/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EK+K RA+RRV
Sbjct  312  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKSKKRALRRV  371

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID+EQFEK+LRYI+SG ES ATLECGGDR+GSKG+++QPT+FS+V+
Sbjct  372  VGDPFKKGVEQGPQIDTEQFEKILRYIKSGIESNATLECGGDRLGSKGFYVQPTVFSNVQ  431

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ + KFK+IDEVI+RAN+T YGLAAGV+T ++  ANTL R LRAGT
Sbjct  432  DDMLIAQDEIFGPVQTIFKFKEIDEVIRRANSTRYGLAAGVFTQNLATANTLMRALRAGT  491

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  492  VWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  542



>gb|AFK44278.1| unknown [Medicago truncatula]
Length=378

 Score =   410 bits (1054),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 217/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHERIYDEF+EK+K RA+RRV
Sbjct  148  GKSPFIVCEDADIDKAVEIAHFALFFNQGQCCCAGSRTFVHERIYDEFLEKSKERALRRV  207

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDS+QFEKVLRYI+SG +S ATLECGG R+GSKG+F+QPT+FS+V+
Sbjct  208  VGDPFKKGVEQGPQIDSKQFEKVLRYIKSGIDSNATLECGGGRLGSKGFFVQPTVFSNVQ  267

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKDI+EVI+RAN T YGLAAGV+T+++  ANTL R LRAGT
Sbjct  268  DDMLIAKDEIFGPVQTILKFKDINEVIRRANATRYGLAAGVFTNNVSTANTLMRALRAGT  327

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PL NPAW+
Sbjct  328  VWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLNNPAWL  378



>ref|XP_004508853.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=536

 Score =   415 bits (1067),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 187/231 (81%), Positives = 217/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EK+K RA+RRV
Sbjct  306  GKSPFIVCEDADVDKAVEIAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKSKERALRRV  365

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDSEQFEKVLRYIRSG +S ATLECGG+R GSKG+FIQPT+FS+V+
Sbjct  366  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGIDSNATLECGGERFGSKGFFIQPTVFSNVQ  425

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFK+IDEVI+RAN T YGLAAGV+T ++  ANTL R LRAGT
Sbjct  426  DDMLIAKDEIFGPVQSILKFKEIDEVIRRANATRYGLAAGVFTKNLSTANTLMRALRAGT  485

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PLKNPAW+
Sbjct  486  VWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLKNPAWL  536



>ref|XP_011028588.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=539

 Score =   415 bits (1066),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 186/231 (81%), Positives = 215/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALF+NQGQCCCAGSRTYVHER+YDEF+EKAKARA+RRV
Sbjct  309  GKSPFIVCEDADVDKAVELAHFALFYNQGQCCCAGSRTYVHERVYDEFIEKAKARALRRV  368

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDSEQFEKVLRYI+SG ES ATLECGG R GSKGYFIQPT+FS+V+
Sbjct  369  VGDPFKKGVEQGPQIDSEQFEKVLRYIKSGVESNATLECGGQRFGSKGYFIQPTVFSNVQ  428

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFK+IDEVI+RAN T YGLAAG +T ++D ANTL+R LR G+
Sbjct  429  DDMLIAKDEIFGPVQSILKFKNIDEVIQRANTTRYGLAAGSFTKNVDTANTLSRALRVGS  488

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IP GGYKMSGIGR KG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  489  VWVNCFDVFDAAIPLGGYKMSGIGRGKGIYSLHNYLQVKAVVTPLKNPAWL  539



>ref|XP_006439784.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
 gb|ESR53024.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
Length=538

 Score =   415 bits (1066),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 188/231 (81%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFII DDA++D+AVE AHFALF+NQGQCCCAGSRTYVHER+YDEFVEKAKARAMRR+
Sbjct  308  GKSPFIIFDDADVDQAVELAHFALFYNQGQCCCAGSRTYVHERVYDEFVEKAKARAMRRI  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQID EQFEKVLRYIRSG ES ATLECGGDR+G++GYF+QPT+FSDVK
Sbjct  368  VGDPFKSGVEQGPQIDPEQFEKVLRYIRSGIESNATLECGGDRLGNRGYFVQPTVFSDVK  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFK+ D+VI+RAN T +GLAAGV+T   D ANT+ R LRAGT
Sbjct  428  DDMLIAQDEIFGPVQSILKFKETDDVIRRANKTRFGLAAGVFTKSADTANTMMRALRAGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYK+SGIGREKG+YSLN YLQVKAVV P+KNPAW+
Sbjct  488  VWINCYDVFDAAIPFGGYKLSGIGREKGIYSLNAYLQVKAVVQPVKNPAWL  538



>gb|EPS72259.1| hypothetical protein M569_02499, partial [Genlisea aurea]
Length=291

 Score =   405 bits (1042),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHE IY EFVEKAKARAM+R 
Sbjct  61   GKSPFIVCEDADIDLAVELAHFALFFNQGQCCCAGSRTFVHESIYHEFVEKAKARAMKRT  120

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK+G+EQGPQID EQF+K+LRYIRSG E+ A LECGG+ +GSKGY+IQPT+FS+V+
Sbjct  121  VGDPFKRGIEQGPQIDDEQFQKILRYIRSGTETKAVLECGGESLGSKGYYIQPTVFSNVE  180

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +L+FK+IDEVIKRAN T YGLAAGV+T +ID ANTL RGLRAGT
Sbjct  181  DDMLIAKDEIFGPVQSILRFKNIDEVIKRANATRYGLAAGVFTRNIDTANTLTRGLRAGT  240

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYDVFDA IPFGGYKMSGIGREKG++SLNNYLQVK++++PL NPAW+
Sbjct  241  VWVNCYDVFDAAIPFGGYKMSGIGREKGIHSLNNYLQVKSIISPLSNPAWL  291



>gb|AEV54528.1| aldehyde dehydrogenase ALDH2B4_V3 [Vitis vinifera]
Length=524

 Score =   414 bits (1064),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA+ R 
Sbjct  294  GKSPFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRT  353

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQID EQF KVLRYIRSG ES ATLECGG RIGSKGYF+QPT+FS+V+
Sbjct  354  VGDPFKKGIEQGPQIDPEQFAKVLRYIRSGIESNATLECGGGRIGSKGYFVQPTVFSNVQ  413

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ ANTL R LR GT
Sbjct  414  DDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINTANTLTRALRVGT  473

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG+GREKG+YSLNNYLQVKAV+TPLKNPAW+
Sbjct  474  VWVNCFDVFDAAIPFGGYKMSGVGREKGIYSLNNYLQVKAVITPLKNPAWL  524



>ref|XP_006439785.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
 gb|ESR53025.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
Length=478

 Score =   412 bits (1060),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 188/231 (81%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFII DDA++D+AVE AHFALF+NQGQCCCAGSRTYVHER+YDEFVEKAKARAMRR+
Sbjct  248  GKSPFIIFDDADVDQAVELAHFALFYNQGQCCCAGSRTYVHERVYDEFVEKAKARAMRRI  307

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQID EQFEKVLRYIRSG ES ATLECGGDR+G++GYF+QPT+FSDVK
Sbjct  308  VGDPFKSGVEQGPQIDPEQFEKVLRYIRSGIESNATLECGGDRLGNRGYFVQPTVFSDVK  367

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFK+ D+VI+RAN T +GLAAGV+T   D ANT+ R LRAGT
Sbjct  368  DDMLIAQDEIFGPVQSILKFKETDDVIRRANKTRFGLAAGVFTKSADTANTMMRALRAGT  427

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYK+SGIGREKG+YSLN YLQVKAVV P+KNPAW+
Sbjct  428  VWINCYDVFDAAIPFGGYKLSGIGREKGIYSLNAYLQVKAVVQPVKNPAWL  478



>gb|AEV54527.1| aldehyde dehydrogenase ALDH2B4_V2 [Vitis vinifera]
Length=477

 Score =   412 bits (1059),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA+ R 
Sbjct  247  GKSPFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRT  306

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQID EQF KVLRYIRSG ES ATLECGG RIGSKGYF+QPT+FS+V+
Sbjct  307  VGDPFKKGIEQGPQIDPEQFAKVLRYIRSGIESNATLECGGGRIGSKGYFVQPTVFSNVQ  366

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ ANTL R LR GT
Sbjct  367  DDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINTANTLTRALRVGT  426

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG+GREKG+YSLNNYLQVKAV+TPLKNPAW+
Sbjct  427  VWVNCFDVFDAAIPFGGYKMSGVGREKGIYSLNNYLQVKAVITPLKNPAWL  477



>ref|XP_002283132.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Vitis vinifera]
 emb|CBI15054.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   414 bits (1064),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA+ R 
Sbjct  308  GKSPFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRT  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQID EQF KVLRYIRSG ES ATLECGG RIGSKGYF+QPT+FS+V+
Sbjct  368  VGDPFKKGIEQGPQIDPEQFAKVLRYIRSGIESNATLECGGGRIGSKGYFVQPTVFSNVQ  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ ANTL R LR GT
Sbjct  428  DDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINTANTLTRALRVGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG+GREKG+YSLNNYLQVKAV+TPLKNPAW+
Sbjct  488  VWVNCFDVFDAAIPFGGYKMSGVGREKGIYSLNNYLQVKAVITPLKNPAWL  538



>emb|CAN63005.1| hypothetical protein VITISV_013710 [Vitis vinifera]
Length=538

 Score =   414 bits (1063),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA+ R 
Sbjct  308  GKSPFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRT  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQID EQF KVLRYIRSG ES ATLECGG RIGSKGYF+QPT+FS+V+
Sbjct  368  VGDPFKKGIEQGPQIDPEQFAKVLRYIRSGIESNATLECGGGRIGSKGYFVQPTVFSNVQ  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ ANTL R LR GT
Sbjct  428  DDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINTANTLTRALRVGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG+GREKG+YSLNNYLQVKAV+TPLKNPAW+
Sbjct  488  VWVNCFDVFDAAIPFGGYKMSGVGREKGIYSLNNYLQVKAVITPLKNPAWL  538



>gb|KDP26565.1| hypothetical protein JCGZ_17723 [Jatropha curcas]
Length=537

 Score =   414 bits (1063),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 186/231 (81%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHERIYDEF+EKAKARA++RV
Sbjct  307  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTYVHERIYDEFIEKAKARAIKRV  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+ G+EQGPQ+DSEQFEK+LRYIRSG ESGATLE GGDR G+KGY+IQPT+FS+VK
Sbjct  367  VGDPFRGGIEQGPQVDSEQFEKILRYIRSGIESGATLEAGGDRFGTKGYYIQPTVFSNVK  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKD+ EVI RAN+T YGLAAGV+T +ID AN L R LR GT
Sbjct  427  DDMLIAKDEIFGPVQSILKFKDLGEVIHRANSTRYGLAAGVFTQNIDTANILTRALRVGT  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  487  VWINCFDVFDAAIPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLKNPAWL  537



>ref|XP_007044551.1| Aldehyde dehydrogenase 2B4 [Theobroma cacao]
 gb|EOY00383.1| Aldehyde dehydrogenase 2B4 [Theobroma cacao]
Length=538

 Score =   413 bits (1062),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/231 (82%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA++D A E AHFALFFNQGQCCCAGSRTYVHE +YDEFVEKAKARA+ R 
Sbjct  308  GKSPFIVCKDADVDEAAELAHFALFFNQGQCCCAGSRTYVHESVYDEFVEKAKARALNRT  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDSEQFEK+LRYIRSG ESGATLE GG+RIGSKGY+IQPT+FS+VK
Sbjct  368  VGDPFKAGIEQGPQIDSEQFEKILRYIRSGIESGATLETGGERIGSKGYYIQPTVFSNVK  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            EDM+IAQDEIFGPVQ +LKFKDI EVI+RAN+T YGLAAGV+T DID ANT+ R L+ GT
Sbjct  428  EDMLIAQDEIFGPVQSILKFKDIKEVIRRANSTSYGLAAGVFTKDIDTANTVTRALKVGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYKMSG GREKG+ SL+NYLQVKAVVTPLKNPAW+
Sbjct  488  VWINCYDVFDAAIPFGGYKMSGQGREKGIQSLSNYLQVKAVVTPLKNPAWM  538



>ref|XP_003527026.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Glycine max]
 gb|KHN19318.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=540

 Score =   412 bits (1060),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 216/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE IYDEF+EKAKARA++RV
Sbjct  310  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHEHIYDEFLEKAKARALKRV  369

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID EQF+KVLRYI+SG ES ATLECGGD+IGSKG+F+QPT+FS+V+
Sbjct  370  VGDPFKKGVEQGPQIDVEQFQKVLRYIKSGIESKATLECGGDQIGSKGFFVQPTVFSNVQ  429

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKDIDEVI+R+N THYGLAAGV+T ++  ANTL R LR GT
Sbjct  430  DDMLIAKDEIFGPVQTILKFKDIDEVIRRSNATHYGLAAGVFTKNVHTANTLMRALRVGT  489

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVV+P+K PAW+
Sbjct  490  VWINCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVSPVKKPAWL  540



>gb|EYU31278.1| hypothetical protein MIMGU_mgv1a004311mg [Erythranthe guttata]
 gb|EYU31279.1| hypothetical protein MIMGU_mgv1a004311mg [Erythranthe guttata]
Length=533

 Score =   412 bits (1059),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 216/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEF+EKAKARA++R 
Sbjct  303  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFLEKAKARALQRA  362

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDSEQFEK+L+YIRSG ESGATLE GGDR+G+KGY++QPT+FS+VK
Sbjct  363  VGDPFKSGMEQGPQIDSEQFEKILKYIRSGTESGATLETGGDRLGTKGYYVQPTVFSNVK  422

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKF ++++VIKRANNT YGLAAGV+TS++D ANTL R LRAGT
Sbjct  423  DDMLIAKDEIFGPVQTILKFNELNDVIKRANNTRYGLAAGVFTSNLDTANTLTRALRAGT  482

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D FDATIPFGGYKMSGIGREKG YSL NYLQVKAVVT LKNPAW+
Sbjct  483  VWINCFDTFDATIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTALKNPAWL  533



>ref|XP_003608978.1| Mitochondrial aldehyde dehydrogenase [Medicago truncatula]
Length=544

 Score =   412 bits (1058),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 217/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHERIYDEF+EK+K RA+RRV
Sbjct  314  GKSPFIVCEDADIDKAVEIAHFALFFNQGQCCCAGSRTFVHERIYDEFLEKSKERALRRV  373

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDS+QFEKVLRYI+SG +S ATLECGG R+GSKG+F+QPT+FS+V+
Sbjct  374  VGDPFKKGVEQGPQIDSKQFEKVLRYIKSGIDSNATLECGGGRLGSKGFFVQPTVFSNVQ  433

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKDI+EVI+RAN T YGLAAGV+T+++  ANTL R LRAGT
Sbjct  434  DDMLIAKDEIFGPVQTILKFKDINEVIRRANATRYGLAAGVFTNNVSTANTLMRALRAGT  493

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PL NPAW+
Sbjct  494  VWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLNNPAWL  544



>ref|XP_009150211.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Brassica rapa]
Length=538

 Score =   411 bits (1057),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 216/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DANI++AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++RV
Sbjct  308  GKSPFIVFEDANINKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRV  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQIDS+QFEKV+RYIRSG ES ATLECGGD+IG+KGYFIQPT+FS+VK
Sbjct  368  VGDPFKKGIEQGPQIDSKQFEKVMRYIRSGVESNATLECGGDQIGNKGYFIQPTVFSNVK  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKF+D+DEVI+RAN T YGLAAGV+T+ +D AN ++R L+AGT
Sbjct  428  DDMLIAQDEIFGPVQSILKFRDVDEVIRRANETRYGLAAGVFTNSLDTANRVSRALKAGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L NPAWI
Sbjct  488  VWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNNPAWI  538



>ref|XP_006476755.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Citrus sinensis]
Length=538

 Score =   411 bits (1057),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 186/231 (81%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFII DDA++D+AVE AHFALF+NQGQCCCAGSRTYVHER+YDEFVEKAKARAMRR+
Sbjct  308  GKSPFIIFDDADVDQAVELAHFALFYNQGQCCCAGSRTYVHERVYDEFVEKAKARAMRRI  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQID EQF+KVLRYIRSG ES ATLECGGDR+G++GYF+QPT+FSDV 
Sbjct  368  VGDPFKNGVEQGPQIDPEQFQKVLRYIRSGIESNATLECGGDRLGNRGYFVQPTVFSDVT  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFK+ D+VI+RAN T +GLAAGV+T   D ANT+ R LRAGT
Sbjct  428  DDMLIAQDEIFGPVQSILKFKETDDVIRRANKTRFGLAAGVFTKSADTANTMMRALRAGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYK+SGIGREKG+YSLN YLQVKAVV P+KNPAW+
Sbjct  488  VWINCYDVFDAAIPFGGYKLSGIGREKGIYSLNAYLQVKAVVQPVKNPAWL  538



>emb|CDY36910.1| BnaA06g16950D [Brassica napus]
Length=539

 Score =   411 bits (1056),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++RV
Sbjct  309  GKSPFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRV  368

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQIDS+QFEKV++YIRSG ES ATLECGG ++G KGYFIQPT+FS+VK
Sbjct  369  VGDPFKKGIEQGPQIDSKQFEKVMKYIRSGVESNATLECGGGQVGDKGYFIQPTVFSNVK  428

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKF D+DEVIKRAN+T YGLAAGV+T  +D AN ++R L+AGT
Sbjct  429  DDMLIAQDEIFGPVQSILKFSDVDEVIKRANDTRYGLAAGVFTKSLDTANRVSRALKAGT  488

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NPAWI
Sbjct  489  VWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTPLNNPAWI  539



>gb|AAZ79358.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=524

 Score =   410 bits (1054),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA+ R 
Sbjct  294  GKSPFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRT  353

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQID EQF KVLRYI+SG ES ATLECGG RIGSKGYF+QPT+FS+V+
Sbjct  354  VGDPFKKGIEQGPQIDPEQFAKVLRYIKSGVESNATLECGGGRIGSKGYFVQPTVFSNVQ  413

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ ANTL R LR GT
Sbjct  414  DDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINTANTLTRALRVGT  473

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG+GREKG+Y+LNNYLQVKAV+TPL+NPAW+
Sbjct  474  VWVNCFDVFDAAIPFGGYKMSGVGREKGIYNLNNYLQVKAVITPLRNPAWL  524



>gb|AAZ79356.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=477

 Score =   409 bits (1050),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA+ R 
Sbjct  247  GKSPFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRT  306

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQID EQF KVLRYI+SG ES ATLECGG RIGSKGYF+QPT+FS+V+
Sbjct  307  VGDPFKKGIEQGPQIDPEQFAKVLRYIKSGVESNATLECGGGRIGSKGYFVQPTVFSNVQ  366

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ ANTL R LR GT
Sbjct  367  DDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINTANTLTRALRVGT  426

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG+GREKG+Y+LNNYLQVKAV+TPL+NPAW+
Sbjct  427  VWVNCFDVFDAAIPFGGYKMSGVGREKGIYNLNNYLQVKAVITPLRNPAWL  477



>ref|XP_011086550.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Sesamum indicum]
Length=532

 Score =   410 bits (1054),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHF+LFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++R 
Sbjct  302  GKSPFIVCEDADIDQAVELAHFSLFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRA  361

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+ G+EQGPQIDSEQFEK+L+YIR G+ESGAT+E GGDR GSKGY+IQPT+FS+VK
Sbjct  362  VGDPFRAGMEQGPQIDSEQFEKILKYIRWGRESGATVEAGGDRFGSKGYYIQPTVFSNVK  421

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA DEIFGPVQ +LK+K++DEVI+RANNT YGLAAGV+T ++D ANTL R LRAGT
Sbjct  422  DDMRIATDEIFGPVQTILKYKELDEVIRRANNTRYGLAAGVFTHNLDTANTLMRALRAGT  481

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D FDATIPFGGYKMSGIGREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  482  VWINCFDTFDATIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTPLKNPAWL  532



>gb|AAZ79355.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=537

 Score =   410 bits (1054),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA+ R 
Sbjct  307  GKSPFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRT  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQID EQF KVLRYI+SG ES ATLECGG RIGSKGYF+QPT+FS+V+
Sbjct  367  VGDPFKKGIEQGPQIDPEQFAKVLRYIKSGVESNATLECGGGRIGSKGYFVQPTVFSNVQ  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ ANTL R LR GT
Sbjct  427  DDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINTANTLTRALRVGT  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG+GREKG+Y+LNNYLQVKAV+TPL+NPAW+
Sbjct  487  VWVNCFDVFDAAIPFGGYKMSGVGREKGIYNLNNYLQVKAVITPLRNPAWL  537



>ref|XP_010682578.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=550

 Score =   410 bits (1055),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE +YDEFVEKAKARA++RV
Sbjct  320  GKSPFIVCKDADIDKAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFVEKAKARAIQRV  379

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+K +EQGPQIDSEQFEKV++YI+SG ESGA LE GG+R+GSKG++IQPT+FS+V 
Sbjct  380  VGDPFRKDIEQGPQIDSEQFEKVMQYIKSGIESGAKLETGGERLGSKGFYIQPTVFSNVN  439

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            EDM+IAQDEIFGPVQ + KFKD+ EV +RANNTHYGLAAGV+T DID ANTLAR LR GT
Sbjct  440  EDMLIAQDEIFGPVQSIFKFKDLQEVARRANNTHYGLAAGVFTQDIDTANTLARALRVGT  499

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYDVFDA IPFGGYKMSG GREKG+Y L NYLQVK+VVTPLKNPAW+
Sbjct  500  VWVNCYDVFDAAIPFGGYKMSGQGREKGIYCLMNYLQVKSVVTPLKNPAWL  550



>gb|AFK41217.1| unknown [Lotus japonicus]
Length=543

 Score =   410 bits (1053),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 216/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT++HER+YDEF+EK+K RA+R V
Sbjct  313  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFIHERVYDEFLEKSKKRALRCV  372

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID+EQFEK+LRYI+SG ES ATLECGGDR+GSKG+++QPT+FS+V+
Sbjct  373  VGDPFKKGVEQGPQIDTEQFEKILRYIKSGIESNATLECGGDRLGSKGFYVQPTVFSNVQ  432

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ + KFK+IDEVI+RAN+T YGLAAGV+T ++  ANTL R LRAGT
Sbjct  433  DDMLIAQDEIFGPVQTIFKFKEIDEVIRRANSTRYGLAAGVFTQNLATANTLMRALRAGT  492

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSGIGREKG+YSL NYLQVKAVVTPLKNPAW+
Sbjct  493  VWINCFDVFDAAIPFGGYKMSGIGREKGIYSLLNYLQVKAVVTPLKNPAWL  543



>emb|CDY44985.1| BnaCnng12150D [Brassica napus]
Length=538

 Score =   410 bits (1053),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++RV
Sbjct  308  GKSPFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRV  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQ+DS+QFEKV++YIRSG ES ATLECGG ++G +GYFIQPT+FS+VK
Sbjct  368  VGDPFKKGIEQGPQVDSKQFEKVMKYIRSGVESNATLECGGGQVGDRGYFIQPTVFSNVK  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKF D+DEVIKRAN+T YGLAAGV+T  +D AN ++R L+AGT
Sbjct  428  DDMLIAQDEIFGPVQSILKFSDVDEVIKRANDTRYGLAAGVFTKSLDTANRVSRALKAGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NPAWI
Sbjct  488  VWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTPLNNPAWI  538



>ref|XP_009149853.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Brassica rapa]
Length=539

 Score =   410 bits (1053),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++RV
Sbjct  309  GKSPFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRV  368

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQIDS+QFEKV++YIRSG ES ATLECGG ++G +GYFIQPT+FS+VK
Sbjct  369  VGDPFKKGIEQGPQIDSKQFEKVMKYIRSGVESNATLECGGGQVGDRGYFIQPTVFSNVK  428

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKF D+DEVIKRAN+T YGLAAGV+T  +D AN ++R L+AGT
Sbjct  429  DDMLIAQDEIFGPVQSILKFSDVDEVIKRANDTRYGLAAGVFTKSLDTANRVSRALKAGT  488

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NPAWI
Sbjct  489  VWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTPLNNPAWI  539



>ref|XP_010678738.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=534

 Score =   409 bits (1052),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKA  RA RR 
Sbjct  304  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKATQRAKRRT  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQID+EQFEKVLRYI+SG ES A LECGG R GS+G FIQPT+FS+V+
Sbjct  364  VGDPFKSGIEQGPQIDTEQFEKVLRYIKSGSESNAKLECGGQRFGSRGLFIQPTVFSNVQ  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFK++D+V+ RAN T YGLAAGV+T++++ ANTL+R LRAGT
Sbjct  424  DDMLIAQDEIFGPVQSILKFKELDDVVHRANTTQYGLAAGVFTNNLNTANTLSRALRAGT  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKGVYSL+NYLQVKAVVTPLKNPAW+
Sbjct  484  VWVNCFDVFDAAIPFGGYKMSGIGREKGVYSLSNYLQVKAVVTPLKNPAWL  534



>gb|ACM89738.1| mitochondrial benzaldehyde dehydrogenase [Antirrhinum majus]
Length=534

 Score =   409 bits (1050),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 215/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFVEKAKARA++R 
Sbjct  304  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKAKARALKRT  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+D++QFEK+L+YIRSG ESGATLE GGDR+G+KGY+IQPT+FSDVK
Sbjct  364  VGDPFKAGMEQGPQVDADQFEKILKYIRSGAESGATLETGGDRLGTKGYYIQPTVFSDVK  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFK++DEVI+RANN+ YGLAAGV+T ++D ANT+ R LRAGT
Sbjct  424  DDMLIAKDEIFGPVQTILKFKELDEVIRRANNSSYGLAAGVFTQNLDTANTMMRALRAGT  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D FDA IPFGGYKMSGIGREKG YSL NYLQVKAVVT LKNPAW+
Sbjct  484  VWINCFDTFDAAIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTALKNPAWL  534



>ref|XP_010682577.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=535

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE +YDEFV KAKARAM+RV
Sbjct  305  GKSPFIVCKDADIDKAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFVAKAKARAMQRV  364

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+K +EQGPQIDSEQFEKV+RYIRSG E+GA LE GG++ GSKGY+IQPT+FS+V 
Sbjct  365  VGDPFRKDIEQGPQIDSEQFEKVMRYIRSGIENGAKLETGGEQFGSKGYYIQPTVFSNVN  424

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            EDM+IAQDEIFGPVQ + KFKD++EV++RANNT YGLAAGV+T DID ANTL+R LR GT
Sbjct  425  EDMLIAQDEIFGPVQSIFKFKDLEEVVRRANNTRYGLAAGVFTQDIDTANTLSRALRVGT  484

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D+FDA IPFGGYKMSG GREKG+YSL NYLQVKAVVTPLKNPAW+
Sbjct  485  VWVNCFDIFDAGIPFGGYKMSGQGREKGIYSLMNYLQVKAVVTPLKNPAWL  535



>ref|XP_011071828.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Sesamum indicum]
Length=536

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 215/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA+IDRAVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA RR 
Sbjct  306  GKSPFIVFEDADIDRAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAARRT  365

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQIDS+QF+KVLRYIRSG +  A LECGG+R+GSKG++IQPT+FS+V+
Sbjct  366  VGDPFKKGIEQGPQIDSDQFDKVLRYIRSGIDGNAKLECGGERVGSKGFYIQPTVFSNVE  425

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IAQDEIFGPVQ +LKFKD+DEVIKRAN T YGLAAGV+T +ID ANT++RGLRAGT
Sbjct  426  DNMLIAQDEIFGPVQSILKFKDVDEVIKRANATRYGLAAGVFTKNIDIANTVSRGLRAGT  485

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL NYLQVKAV++PL NPAW+
Sbjct  486  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLKNYLQVKAVISPLTNPAWL  536



>ref|XP_009761724.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana sylvestris]
Length=540

 Score =   408 bits (1049),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 219/231 (95%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA+ID+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RV
Sbjct  310  GKSPFIICEDADIDKAVELAHSAVFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRV  369

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID+EQFEK+L+YI SG ESGATLE GG+++GSKG+++QPT+FS+V+
Sbjct  370  VGDPFKKGVEQGPQIDTEQFEKILKYIESGIESGATLESGGEKLGSKGFYVQPTVFSNVQ  429

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IA+DEIFGPVQ +LKFKD++EVI+RAN+THYGLAAGV+T +ID ANT++R LR GT
Sbjct  430  DNMLIAKDEIFGPVQSLLKFKDLEEVIRRANSTHYGLAAGVFTQNIDVANTISRALRVGT  489

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+++FDA IPFGGYKMSG GREKGVYSLNNYLQVKAVVTPLKNPAW+
Sbjct  490  VWVNCFNIFDAAIPFGGYKMSGHGREKGVYSLNNYLQVKAVVTPLKNPAWM  540



>ref|XP_010682575.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=534

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 186/231 (81%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHE +YDEFVEKAK RA  R 
Sbjct  304  GKSPFIICEDADIDEAVETAHFALFFNQGQCCCAGSRTFVHENVYDEFVEKAKLRAANRS  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK+G+EQGPQID EQF K+LRYI+SG ESGATLE GGD+IGSKGY+I+PT+FS+V 
Sbjct  364  VGDPFKQGIEQGPQIDPEQFNKILRYIKSGVESGATLETGGDKIGSKGYYIKPTVFSNVT  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFK IDEVI+RAN + YGLAAGV+T +ID ANT++R L+AGT
Sbjct  424  DDMLIAQDEIFGPVQSILKFKSIDEVIRRANASDYGLAAGVFTKNIDTANTISRALKAGT  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYKMSGIGREKGVYSLNNYLQVKA+VTPLKNPAW+
Sbjct  484  VWINCYDVFDAAIPFGGYKMSGIGREKGVYSLNNYLQVKAIVTPLKNPAWL  534



>gb|KFK44454.1| hypothetical protein AALP_AA1G258900 [Arabis alpina]
Length=524

 Score =   407 bits (1047),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFVEKAKARA+ R 
Sbjct  294  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKAKARAINRS  353

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+DSEQF+K+L+YI+ G +SGATL+ GGDR+GSKGY+IQPT+FSDVK
Sbjct  354  VGDPFKSGIEQGPQVDSEQFKKILKYIKHGVDSGATLQAGGDRLGSKGYYIQPTVFSDVK  413

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D AN L+R LR GT
Sbjct  414  DDMLIAQDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTANRLSRALRVGT  473

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDV D TIPFGGYKMSGIGREKG+YSL+NYLQVKAVVT LKNPAW+
Sbjct  474  VWINCYDVLDITIPFGGYKMSGIGREKGIYSLSNYLQVKAVVTALKNPAWL  524



>emb|CDY57318.1| BnaA08g20300D [Brassica napus]
Length=537

 Score =   407 bits (1047),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA+ R 
Sbjct  307  GKSPFIVCEDADVDQAVEMAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAINRA  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+DSEQFEK+L+YIR G +SGATL+ GGDR GSKGY+IQPT+FSDVK
Sbjct  367  VGDPFKSGIEQGPQVDSEQFEKILKYIRHGVDSGATLQAGGDRHGSKGYYIQPTVFSDVK  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D AN L R LR G+
Sbjct  427  DDMLIAKDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDTANRLMRALRVGS  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNPAW+
Sbjct  487  VWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNPAWL  537



>emb|CDX91724.1| BnaC08g06430D [Brassica napus]
Length=537

 Score =   407 bits (1047),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA+ R 
Sbjct  307  GKSPFIVCEDADVDQAVEMAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAINRA  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+DSEQFEK+L+YIR G +SGATL+ GGDR GSKGY+IQPT+FSDVK
Sbjct  367  VGDPFKSGIEQGPQVDSEQFEKILKYIRHGVDSGATLQAGGDRHGSKGYYIQPTVFSDVK  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D AN L R LR G+
Sbjct  427  DDMLIAKDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDTANRLMRALRVGS  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNPAW+
Sbjct  487  VWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSIKNPAWL  537



>ref|XP_006404308.1| hypothetical protein EUTSA_v10010271mg [Eutrema salsugineum]
 dbj|BAJ34644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45761.1| hypothetical protein EUTSA_v10010271mg [Eutrema salsugineum]
Length=538

 Score =   407 bits (1046),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA+I++AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++RV
Sbjct  308  GKSPFIVFEDADINKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRV  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG EQGPQID +QFEKV++YIRSG ES ATLECGGD+ G KGYFIQPT+FS+VK
Sbjct  368  VGDPFKKGTEQGPQIDLKQFEKVMKYIRSGVESNATLECGGDQFGKKGYFIQPTVFSNVK  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKF+D+DEVIKRAN T YGLAAGV+T  +D AN ++R L+AGT
Sbjct  428  DDMLIAQDEIFGPVQSILKFRDVDEVIKRANETRYGLAAGVFTKSLDTANRVSRALKAGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NPAWI
Sbjct  488  VWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTPLNNPAWI  538



>gb|KJB50198.1| hypothetical protein B456_008G158500 [Gossypium raimondii]
Length=492

 Score =   405 bits (1041),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE +YDEF+EKAKARA++R 
Sbjct  262  GKSPFIVCKDADVDKAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFLEKAKARALKRS  321

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF  G+EQGPQIDSEQFEK++RYIRSG ESGATLE GG+RIG+KG++IQPT+FS+VK
Sbjct  322  VGDPFVAGIEQGPQIDSEQFEKIMRYIRSGVESGATLETGGERIGNKGFYIQPTVFSNVK  381

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            EDM+IA+DEIFGPVQ +LKFKDI+E I+RAN T YGLAAGV+T DID ANTL R L+ GT
Sbjct  382  EDMLIAKDEIFGPVQSILKFKDINEAIRRANTTSYGLAAGVFTQDIDTANTLTRALKVGT  441

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYKMSG GREKG++ L+NYLQVKAVVTPLK+PAWI
Sbjct  442  VWINCYDVFDAAIPFGGYKMSGQGREKGIHCLSNYLQVKAVVTPLKDPAWI  492



>emb|CDY21806.1| BnaA06g20750D [Brassica napus]
Length=496

 Score =   405 bits (1041),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DANI++AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++RV
Sbjct  266  GKSPFIVFEDANINKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRV  325

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQIDS QFEKV+RYIRSG ES ATLECGG +IG+KGYFIQPT+FS+VK
Sbjct  326  VGDPFKKGIEQGPQIDSRQFEKVMRYIRSGVESNATLECGGHQIGNKGYFIQPTVFSNVK  385

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M+IAQDEIFGPVQ +LKF+D+DEVIKRAN T YGLAAGV+T  +D AN ++R L+AGT
Sbjct  386  DYMLIAQDEIFGPVQSILKFRDVDEVIKRANETRYGLAAGVFTKSLDTANRVSRALKAGT  445

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L NPAWI
Sbjct  446  VWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNNPAWI  496



>ref|XP_010503421.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Camelina sativa]
Length=537

 Score =   407 bits (1045),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEK+KARA++RV
Sbjct  307  GKSPFIVFEDADIDKAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKSKARALKRV  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQIDS+QFEKV+ YIRSG ES ATLECGGD+IG KGYFIQPT+FS+VK
Sbjct  367  VGDPFKKGIEQGPQIDSKQFEKVMNYIRSGVESNATLECGGDQIGDKGYFIQPTVFSNVK  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IAQDEIFGPVQ +LKF+D+DEVIKRAN+T YGLAAGV+T  +D AN ++RGL+AGT
Sbjct  427  DNMLIAQDEIFGPVQSILKFRDVDEVIKRANDTRYGLAAGVFTKSLDTANRVSRGLKAGT  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  PAWI
Sbjct  487  VWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI  537



>ref|XP_009115500.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Brassica rapa]
Length=536

 Score =   406 bits (1044),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R 
Sbjct  306  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAIKRA  365

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+DSEQF+K+L++I+ G ESGATL+ GGDR GSKGY+IQPT+FSDVK
Sbjct  366  VGDPFKSGIEQGPQVDSEQFKKILKFIKHGVESGATLQAGGDRFGSKGYYIQPTVFSDVK  425

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D AN L R LR G+
Sbjct  426  DDMLIATDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDTANRLMRALRVGS  485

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNPAW+
Sbjct  486  VWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNPAWL  536



>gb|KHG27537.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Gossypium 
arboreum]
Length=531

 Score =   406 bits (1044),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE +YDEF+EKAKARA++R 
Sbjct  301  GKSPFIVCKDADVDKAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFLEKAKARALKRS  360

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF  G+EQGPQIDSEQFEK++RYIRSG ESGATLE GG+RIG KG++IQPT+FS+VK
Sbjct  361  VGDPFVAGIEQGPQIDSEQFEKIMRYIRSGVESGATLETGGERIGDKGFYIQPTVFSNVK  420

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            EDM+IA+DEIFGPVQ +LKFKDI+EVI+RAN T YGLAAGV+T DID ANTL R L+ GT
Sbjct  421  EDMLIAKDEIFGPVQSILKFKDINEVIRRANTTSYGLAAGVFTQDIDTANTLTRALKVGT  480

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYKMSG GREKG++ L+NYLQVKAVVTPLK+PAWI
Sbjct  481  VWINCYDVFDAAIPFGGYKMSGQGREKGIHCLSNYLQVKAVVTPLKDPAWI  531



>gb|EPS72983.1| mitochondrial benzaldehyde dehydrogenase, partial [Genlisea aurea]
Length=512

 Score =   405 bits (1042),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEF+EKAK RA++R 
Sbjct  282  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFLEKAKVRALKRT  341

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQID +QF K+L YIRSG+ESGA LE GG+R G KGY+IQPT+FSDVK
Sbjct  342  VGDPFKSGIEQGPQIDQDQFNKILHYIRSGQESGARLETGGERFGEKGYYIQPTVFSDVK  401

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ VLKFK++DEVIKRAN T YGLAAGV+T +ID ANTL R LRAGT
Sbjct  402  DDMLIAQDEIFGPVQSVLKFKELDEVIKRANRTRYGLAAGVFTHNIDTANTLTRALRAGT  461

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D FDA IPFGGYKMSGIGREKG YSL NYLQVKAVVTP+KNPAW+
Sbjct  462  VWINCFDTFDAAIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTPIKNPAWL  512



>ref|XP_010552639.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Tarenaya hassleriana]
Length=533

 Score =   406 bits (1044),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R 
Sbjct  303  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAIKRA  362

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+DSEQF+K+L+YIRSG ESGATL+ GGD++GSKGY+IQPT+FSDVK
Sbjct  363  VGDPFKAGIEQGPQVDSEQFQKILKYIRSGIESGATLQAGGDQLGSKGYYIQPTVFSDVK  422

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IA DEIFGPVQ +LKFKD+DE I+RAN + YGLAAGV+T ++D AN L R LR G+
Sbjct  423  DEMLIANDEIFGPVQSILKFKDLDEAIRRANKSRYGLAAGVFTQNLDTANRLMRALRVGS  482

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA++PFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NPAW+
Sbjct  483  VWINCFDVFDASVPFGGYKMSGFGREKGIYSLNNYLQVKAVVTPLTNPAWL  533



>gb|AAC98035.1| Strong similarity to gb|Y09876 aldehyde dehydrogenase (NAD+) 
from Nicotiana tabacum and a member of the aldehyde dehydrogenase 
family PF|00171. ESTs gb|F15117, gb|R83958 and gb|586262 
come from this gene [Arabidopsis thaliana]
Length=519

 Score =   405 bits (1041),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R 
Sbjct  289  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRN  348

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK
Sbjct  349  VGDPFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKGYYIQPTVFSDVK  408

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D A+ L R LR GT
Sbjct  409  DDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALRVGT  468

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct  469  VWINCFDVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNPAWL  519



>ref|NP_564204.1| aldehyde dehydrogenase 2B7 [Arabidopsis thaliana]
 sp|Q8S528.2|AL2B7_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member B7, mitochondrial; 
Short=ALDH2b; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59643.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAM44960.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE30433.1| aldehyde dehydrogenase 2B7 [Arabidopsis thaliana]
Length=534

 Score =   405 bits (1042),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R 
Sbjct  304  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRN  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK
Sbjct  364  VGDPFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKGYYIQPTVFSDVK  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D A+ L R LR GT
Sbjct  424  DDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALRVGT  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct  484  VWINCFDVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNPAWL  534



>ref|XP_004155012.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=549

 Score =   406 bits (1043),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 185/232 (80%), Positives = 215/232 (93%), Gaps = 1/232 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALF-FNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRR  663
            GKSPFI+C+DA++D+AVE AHFALF    GQCCCAGSRT+VHER+++EFVEK+KARA RR
Sbjct  318  GKSPFIVCEDADVDKAVELAHFALFSIRFGQCCCAGSRTFVHERVHEEFVEKSKARAQRR  377

Query  662  VVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDV  483
            VVGDPFKKGVEQGPQIDS+QFEKVLRYI+SG ES ATLECGG R+GSKGYFI+PT+FS+V
Sbjct  378  VVGDPFKKGVEQGPQIDSDQFEKVLRYIKSGIESNATLECGGGRLGSKGYFIEPTVFSNV  437

Query  482  KEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAG  303
            K+DM+IA+DEIFGPVQ +LKFKDIDEVI RAN+T YGLA+G++TS+ID ANTL RGLR G
Sbjct  438  KDDMLIAKDEIFGPVQSILKFKDIDEVIHRANSTRYGLASGIFTSNIDTANTLIRGLRTG  497

Query  302  TVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            TVW+NC+D+FDA IPFGGYKMSGIGREKG+YSL NYLQVKAVVTPLKNPAW+
Sbjct  498  TVWVNCFDIFDAAIPFGGYKMSGIGREKGIYSLQNYLQVKAVVTPLKNPAWL  549



>gb|KJB50197.1| hypothetical protein B456_008G158500 [Gossypium raimondii]
Length=531

 Score =   405 bits (1041),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE +YDEF+EKAKARA++R 
Sbjct  301  GKSPFIVCKDADVDKAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFLEKAKARALKRS  360

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF  G+EQGPQIDSEQFEK++RYIRSG ESGATLE GG+RIG+KG++IQPT+FS+VK
Sbjct  361  VGDPFVAGIEQGPQIDSEQFEKIMRYIRSGVESGATLETGGERIGNKGFYIQPTVFSNVK  420

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            EDM+IA+DEIFGPVQ +LKFKDI+E I+RAN T YGLAAGV+T DID ANTL R L+ GT
Sbjct  421  EDMLIAKDEIFGPVQSILKFKDINEAIRRANTTSYGLAAGVFTQDIDTANTLTRALKVGT  480

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYKMSG GREKG++ L+NYLQVKAVVTPLK+PAWI
Sbjct  481  VWINCYDVFDAAIPFGGYKMSGQGREKGIHCLSNYLQVKAVVTPLKDPAWI  531



>ref|XP_010316283.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum lycopersicum]
Length=528

 Score =   405 bits (1040),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 220/231 (95%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R+
Sbjct  298  GKSPFIICEDADVDKAVELAHSAVFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRI  357

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID+EQFEK+L+YI+SG ESGATLE GG+++GSKG+++QPT+FS+V+
Sbjct  358  VGDPFKKGVEQGPQIDTEQFEKILKYIKSGTESGATLESGGEKLGSKGFYVQPTVFSNVQ  417

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IA+DEIFGPVQ +LKFKD++EVI+RAN++HYGLAAGV+T +ID ANT++R LR GT
Sbjct  418  DNMLIARDEIFGPVQSLLKFKDVEEVIRRANSSHYGLAAGVFTQNIDAANTISRALRVGT  477

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+++FDA IPFGGYKMSG GREKGVYSL+NYLQVKA+VTPLKNPAW+
Sbjct  478  VWVNCFNIFDAAIPFGGYKMSGHGREKGVYSLSNYLQVKAIVTPLKNPAWL  528



>ref|XP_003519638.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
Length=539

 Score =   405 bits (1041),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++R 
Sbjct  309  GKSPFIVCEDADVDEAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARALKRA  368

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDSEQF+K+L+YIRSG ESGATLE GGDR G+ G++IQPT+FS+VK
Sbjct  369  VGDPFKGGIEQGPQIDSEQFQKILKYIRSGVESGATLETGGDRFGNSGFYIQPTVFSNVK  428

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA++EIFGPVQ +LKFKD+D+VI+RANNTHYGLAAGV+T +I+ ANTL R LRAGT
Sbjct  429  DDMLIAKEEIFGPVQSILKFKDLDDVIQRANNTHYGLAAGVFTKNINTANTLTRALRAGT  488

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVT LKNPAW+
Sbjct  489  VWVNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTSLKNPAWL  539



>gb|KHN00347.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=539

 Score =   405 bits (1041),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++R 
Sbjct  309  GKSPFIVCEDADVDEAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARALKRA  368

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDSEQF+K+L+YIRSG ESGATLE GGDR G+ G++IQPT+FS+VK
Sbjct  369  VGDPFKGGIEQGPQIDSEQFQKILKYIRSGVESGATLETGGDRFGNSGFYIQPTVFSNVK  428

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA++EIFGPVQ +LKFKD+D+VI+RANNTHYGLAAGV+T +I+ ANTL R LRAGT
Sbjct  429  DDMLIAKEEIFGPVQSILKFKDLDDVIQRANNTHYGLAAGVFTKNINTANTLTRALRAGT  488

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVT LKNPAW+
Sbjct  489  VWVNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTSLKNPAWL  539



>ref|XP_010914166.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=571

 Score =   406 bits (1043),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II DDA++D AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++RV
Sbjct  341  GKSPMIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRV  400

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID EQF K++RYIRSG +SGATL+ GGDR+GSKGYFIQPTIFSDVK
Sbjct  401  VGDPFRKGVEQGPQIDEEQFNKIMRYIRSGVDSGATLQAGGDRLGSKGYFIQPTIFSDVK  460

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ +LKF D++EVI+RAN T YGLAAGV+T+++D ANTL R LRAGT
Sbjct  461  DGMPIAQEEIFGPVQSILKFNDLNEVIQRANTTRYGLAAGVFTNNLDTANTLTRALRAGT  520

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+ SL NYLQVKAVVTPLKNPAW+
Sbjct  521  VWINCFDVFDAAIPFGGYKMSGHGREKGIDSLKNYLQVKAVVTPLKNPAWL  571



>ref|XP_002893307.1| hypothetical protein ARALYDRAFT_472641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69566.1| hypothetical protein ARALYDRAFT_472641 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   405 bits (1040),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R 
Sbjct  304  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRN  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+DSEQF+K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK
Sbjct  364  VGDPFKSGIEQGPQVDSEQFKKILKYIKYGVEAGATLQAGGDRLGSKGYYIQPTVFSDVK  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D A+ L R LR GT
Sbjct  424  DDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALRVGT  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct  484  VWINCFDVLDASIPFGGYKMSGIGREKGLYSLNNYLQVKAVVTSLKNPAWL  534



>gb|AES91175.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=544

 Score =   405 bits (1040),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 215/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ ++A+ID+ VE AHFALFFNQGQCCCAGSRT+VHERIYDEF+EK+K RA+RRV
Sbjct  314  GKSPFIVFEEADIDKVVEIAHFALFFNQGQCCCAGSRTFVHERIYDEFLEKSKERALRRV  373

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDS+QFEKVLRYI+SG +S ATLECGG R+GSKG+F+QPT+FS+V+
Sbjct  374  VGDPFKKGVEQGPQIDSKQFEKVLRYIKSGIDSNATLECGGGRLGSKGFFVQPTVFSNVQ  433

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKDI+EVI+RAN T YGLAAGV+T+++  ANTL R LRAGT
Sbjct  434  DDMLIAKDEIFGPVQTILKFKDINEVIRRANATRYGLAAGVFTNNVSTANTLMRALRAGT  493

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PL NPAW+
Sbjct  494  VWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLNNPAWL  544



>ref|XP_010515110.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Camelina sativa]
Length=537

 Score =   404 bits (1039),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEK+KARA++RV
Sbjct  307  GKSPFIVFEDADIDKAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKSKARALKRV  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQIDS+QFEKV+ YIRSG ES ATLECGGD+IG KGYFIQPT+FS+VK
Sbjct  367  VGDPFKKGIEQGPQIDSKQFEKVMNYIRSGVESNATLECGGDQIGDKGYFIQPTVFSNVK  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IAQDEIFGPVQ +LKF+D+DEVIKRAN+T YGLAAGV+T  +D AN ++R L+AGT
Sbjct  427  DNMLIAQDEIFGPVQSILKFRDVDEVIKRANDTRYGLAAGVFTKSLDTANRVSRALKAGT  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  PAWI
Sbjct  487  VWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI  537



>ref|XP_009600000.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=544

 Score =   404 bits (1039),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 218/231 (94%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA+ID+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RV
Sbjct  314  GKSPFIICEDADIDKAVELAHSAVFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRV  373

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQID+EQ+EK+L+YI+SG ESGATLE GGD++GSKG+++QPT+FS+V+
Sbjct  374  VGDPFKKGIEQGPQIDTEQYEKILKYIKSGIESGATLESGGDKLGSKGFYVQPTVFSNVQ  433

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IA+DEIFGPVQ +LKFKD++EVI+RAN+THYGLAAGV+T +ID ANT+ R LR GT
Sbjct  434  DNMLIAKDEIFGPVQSLLKFKDLEEVIRRANSTHYGLAAGVFTRNIDVANTITRALRVGT  493

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+++FDA IPFGGY+MSG GREKGVYSLNNYLQVKAVVT LKNPAW+
Sbjct  494  VWVNCFNIFDAAIPFGGYRMSGHGREKGVYSLNNYLQVKAVVTSLKNPAWM  544



>ref|XP_003517756.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
 gb|KHN12100.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=538

 Score =   404 bits (1039),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++R 
Sbjct  308  GKSPFIVCEDADVDEAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARALKRA  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDSEQF+K+L+YIRSG ESGATLE GGDR G+ G++IQPT+FS+VK
Sbjct  368  VGDPFKGGIEQGPQIDSEQFQKILKYIRSGVESGATLETGGDRFGNSGFYIQPTVFSNVK  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA++EIFGPVQ +LKFKD+D+VI+RANNTHYGLAAGV+T +I+ ANTL R LR GT
Sbjct  428  DDMLIAKEEIFGPVQTILKFKDLDDVIQRANNTHYGLAAGVFTKNINTANTLTRALRVGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVT LKNPAW+
Sbjct  488  VWINCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTSLKNPAWL  538



>ref|XP_006290873.1| hypothetical protein CARUB_v10016983mg [Capsella rubella]
 gb|EOA23771.1| hypothetical protein CARUB_v10016983mg [Capsella rubella]
Length=537

 Score =   404 bits (1038),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEK+KARA++RV
Sbjct  307  GKSPFIVFEDADIDKAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKSKARALKRV  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQIDS+QFEKV++YIRSG ES ATLECGGD+IG KGYFIQPT+FS+VK
Sbjct  367  VGDPFKKGIEQGPQIDSKQFEKVMKYIRSGVESNATLECGGDQIGDKGYFIQPTVFSNVK  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IAQDEIFGPVQ +LKF D+DEVIKRAN+T YGLAAGV+T  +D AN ++R L+AGT
Sbjct  427  DNMLIAQDEIFGPVQSILKFSDVDEVIKRANDTRYGLAAGVFTKSLDTANRVSRALKAGT  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            +W+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  PAWI
Sbjct  487  IWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI  537



>ref|XP_006416054.1| hypothetical protein EUTSA_v10007303mg [Eutrema salsugineum]
 gb|ESQ34407.1| hypothetical protein EUTSA_v10007303mg [Eutrema salsugineum]
Length=541

 Score =   404 bits (1038),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA+ R 
Sbjct  311  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAINRT  370

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+D EQF+K+L+YI+ G +SGATL+ GGD++GSKGY+IQPT+FSDVK
Sbjct  371  VGDPFKSGIEQGPQVDKEQFKKILKYIKYGVDSGATLQAGGDQLGSKGYYIQPTVFSDVK  430

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFKD+DEVI RAN + YGLAAGV+T ++D AN L R LR G+
Sbjct  431  DDMLIAQDEIFGPVQTILKFKDLDEVIARANKSRYGLAAGVFTQNLDTANRLMRALRVGS  490

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct  491  VWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTALKNPAWL  541



>emb|CDY61548.1| BnaA09g29890D, partial [Brassica napus]
Length=555

 Score =   404 bits (1039),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R 
Sbjct  325  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAIKRA  384

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+DSEQF+K+L++I+ G ESGATL+ GGDR GSKGY+IQPT+FSDVK
Sbjct  385  VGDPFKSGIEQGPQVDSEQFKKILKFIKHGVESGATLQAGGDRFGSKGYYIQPTVFSDVK  444

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D AN L R LR G+
Sbjct  445  DDMLIATDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDTANRLMRALRVGS  504

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNPAW+
Sbjct  505  VWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNPAWL  555



>gb|KFK34098.1| hypothetical protein AALP_AA5G101700 [Arabis alpina]
Length=540

 Score =   404 bits (1037),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEK+KARA++RV
Sbjct  310  GKSPFIVFEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKSKARALKRV  369

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQID +QFEKV++YIRSG ES ATLECGGD+IG+KGYFIQPT+FS+VK
Sbjct  370  VGDPFKKGIEQGPQIDLKQFEKVMKYIRSGVESNATLECGGDQIGNKGYFIQPTVFSNVK  429

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKF+D+DEVIKRAN T YGLAAGV+T  +D AN ++R L+AGT
Sbjct  430  DDMLIAQDEIFGPVQSILKFRDVDEVIKRANETRYGLAAGVFTKSLDTANRVSRALKAGT  489

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  PAWI
Sbjct  490  VWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI  540



>ref|XP_010426271.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Camelina sativa]
Length=537

 Score =   404 bits (1037),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEK+KARA++RV
Sbjct  307  GKSPFIVFEDADIDKAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKSKARALKRV  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKG+EQGPQIDS+QF+KV+ YIRSG ES ATLECGGD+IG KGYFIQPT+FS+VK
Sbjct  367  VGDPFKKGIEQGPQIDSKQFKKVMNYIRSGVESNATLECGGDQIGDKGYFIQPTVFSNVK  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IAQDEIFGPVQ +LKF+D+DEVIKRAN+T YGLAAGV+T  +D AN ++R L+AGT
Sbjct  427  DNMLIAQDEIFGPVQSILKFRDVDEVIKRANDTRYGLAAGVFTKSLDTANRVSRALKAGT  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  PAWI
Sbjct  487  VWINCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI  537



>ref|XP_009612265.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=536

 Score =   403 bits (1036),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRTYVHE++YDEF+EKAKARA++R 
Sbjct  306  GKSPFIVCEDADIDTAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFLEKAKARALKRT  365

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G EQGPQIDS+QF K++ YIRSG +SGATLE GG+R+G +GY+I+PT+FS+VK
Sbjct  366  VGDPFKSGTEQGPQIDSKQFHKIMNYIRSGIDSGATLETGGERLGERGYYIKPTVFSNVK  425

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFKD+D+VI+RANN+ YGLAAGV+T +ID ANTL R LR GT
Sbjct  426  DDMLIAQDEIFGPVQSILKFKDLDDVIRRANNSRYGLAAGVFTQNIDTANTLTRALRVGT  485

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D FDATIPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  486  VWVNCFDTFDATIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTPLKNPAWL  536



>ref|XP_004238676.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Solanum lycopersicum]
Length=529

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRTYVHE++YDEF+EKAKARA++RV
Sbjct  299  GKSPFIVCEDADIDTAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFLEKAKARALKRV  358

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G EQGPQIDS+QF+K+++YIRSG +SGATLE GG++ G KGY+I+PT+FS+VK
Sbjct  359  VGDPFKSGTEQGPQIDSKQFDKIMKYIRSGVDSGATLETGGEQFGKKGYYIRPTVFSNVK  418

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFKD+DEV++RAN++ YGLAAGV++ +ID ANTLAR LR GT
Sbjct  419  DDMLIAQDEIFGPVQSILKFKDLDEVVRRANSSRYGLAAGVFSQNIDTANTLARALRVGT  478

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D FDATIPFGGYKMSG GREKG Y L NYLQVKAVVTPLKNPAW+
Sbjct  479  VWINCFDTFDATIPFGGYKMSGQGREKGEYGLKNYLQVKAVVTPLKNPAWL  529



>gb|AFK40301.1| unknown [Medicago truncatula]
Length=328

 Score =   395 bits (1016),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+++EFVEKAKARA++R 
Sbjct  98   GKSPFIVCEDADIDEAVELAHFALFFNQGQCCCAGSRTFVHERVHEEFVEKAKARALKRA  157

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G EQGPQIDS+QFEK+L+YIRSG E+GATLE GG+R+GSKGY+IQPT+FS+V+
Sbjct  158  VGDPFKSGTEQGPQIDSKQFEKILKYIRSGVENGATLETGGERLGSKGYYIQPTVFSNVQ  217

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID ANTL R L+ GT
Sbjct  218  DGMQIAKEEIFGPVQTILKFKDLGEVIQRANNSKYGLAAGVFTKNIDTANTLTRALKVGT  277

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  278  VWVNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNPAWL  328



>ref|XP_006307216.1| hypothetical protein CARUB_v10008816mg [Capsella rubella]
 gb|EOA40114.1| hypothetical protein CARUB_v10008816mg [Capsella rubella]
Length=532

 Score =   402 bits (1034),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R 
Sbjct  302  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAVKRA  361

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDSEQF K+L+YI+ G ++GATL+ GGDR GSKGY+IQPT+FSDVK
Sbjct  362  VGDPFKSGIEQGPQIDSEQFNKILKYIKHGVDAGATLQAGGDRFGSKGYYIQPTVFSDVK  421

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D AN L R LR GT
Sbjct  422  DDMLIATDEIFGPVQTILKFKDLDEVIARANNSKYGLAAGVFTQNLDTANRLMRALRVGT  481

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DV DATIPFGGYKMSGIGREKG+YSL++YLQVKAVVT LKNPAW+
Sbjct  482  VWINCFDVLDATIPFGGYKMSGIGREKGLYSLSHYLQVKAVVTSLKNPAWL  532



>ref|XP_009110081.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Brassica rapa]
Length=537

 Score =   402 bits (1033),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSR +V ER+YDEFVEKAKARA+ R 
Sbjct  307  GKSPFIVCEDADVDQAVEMAHFALFFNQGQCCCAGSRPFVQERVYDEFVEKAKARAINRA  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+DSEQFEK+L+YIR G +SGATL+ GGDR GSKGY+IQPT+FSDVK
Sbjct  367  VGDPFKSGIEQGPQVDSEQFEKILKYIRHGVDSGATLQAGGDRHGSKGYYIQPTVFSDVK  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D AN L R LR G+
Sbjct  427  DDMLIAKDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDTANRLMRALRVGS  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNPAW+
Sbjct  487  VWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSIKNPAWL  537



>ref|XP_010653335.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Vitis vinifera]
 emb|CBI32132.3| unnamed protein product [Vitis vinifera]
 gb|AFY12671.1| mitochondrial aldehyde dehydrogenase 2B8 [Vitis quinquangularis]
Length=538

 Score =   402 bits (1032),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DAN+D AVE AHFALFFNQGQCCCAGSRT+VHE IYDEFVEKAKARA+RR 
Sbjct  308  GKSPFIVCEDANVDEAVELAHFALFFNQGQCCCAGSRTFVHESIYDEFVEKAKARALRRT  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDS+QFEK+LRYIRSG E+GATLE GG+R G +G+FI+PT+FS+V+
Sbjct  368  VGDPFKAGIEQGPQIDSDQFEKILRYIRSGVENGATLETGGERFGKEGFFIKPTVFSNVQ  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M+IAQDEIFGPVQ +LKFKD+ EVI+RAN T YGLAAGV+T ++D ANTL R L+ GT
Sbjct  428  DGMLIAQDEIFGPVQSILKFKDLGEVIRRANATSYGLAAGVFTQNLDTANTLTRALKVGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+YSL NYLQVKAV+TPLKNPAW+
Sbjct  488  VWINCFDVFDAAIPFGGYKMSGHGREKGIYSLQNYLQVKAVITPLKNPAWL  538



>ref|XP_009759823.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana sylvestris]
Length=542

 Score =   402 bits (1032),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHE++YDEF+EKAKARA++R 
Sbjct  312  GKSPFIVCEDADIDTAVEQAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKAKARALKRT  371

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G EQGPQIDS+QF+K++ YIRSG +SGATLE GG+R+G +GY+I+PT+FS+VK
Sbjct  372  VGDPFKSGTEQGPQIDSKQFDKIMNYIRSGIDSGATLETGGERLGERGYYIKPTVFSNVK  431

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFKD+D+VI+RANN+ YGLAAGV+T +ID ANTL R LR GT
Sbjct  432  DDMLIAQDEIFGPVQSILKFKDVDDVIRRANNSRYGLAAGVFTQNIDTANTLTRALRVGT  491

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D FDATIPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  492  VWVNCFDTFDATIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTPLKNPAWL  542



>emb|CAA71003.1| aldehyde dehydrogenase (NAD+) [Nicotiana tabacum]
Length=542

 Score =   402 bits (1032),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHE++YDEF+EKAKARA++R 
Sbjct  312  GKSPFIVCEDADIDTAVEQAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKAKARALKRT  371

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G EQGPQIDS+QF+K++ YIRSG +SGATLE GG+R+G +GY+I+PT+FS+VK
Sbjct  372  VGDPFKSGTEQGPQIDSKQFDKIMNYIRSGIDSGATLETGGERLGERGYYIKPTVFSNVK  431

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFKD+D+VI+RANN+ YGLAAGV+T +ID ANTL R LR GT
Sbjct  432  DDMLIAQDEIFGPVQSILKFKDVDDVIRRANNSRYGLAAGVFTQNIDTANTLTRALRVGT  491

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D FDATIPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  492  VWVNCFDTFDATIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTPLKNPAWL  542



>ref|XP_010251301.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nelumbo nucifera]
Length=534

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARAM+RV
Sbjct  304  GKSPFIVCEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHENVYDEFIEKAKARAMKRV  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID+EQ EKVL+YIR+G E GATLE GG+R G+KGYFIQPT+FS+V+
Sbjct  364  VGDPFKKGVEQGPQIDAEQLEKVLKYIRAGIECGATLETGGERFGTKGYFIQPTVFSNVE  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA DEIFGPVQ +LKFKD+D+VI+RAN + YGLAAGV+T +I+ ANTL R LR GT
Sbjct  424  DGMPIATDEIFGPVQSILKFKDLDDVIRRANKSRYGLAAGVFTKNIETANTLMRALRVGT  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+YSL+NYLQVKAVV+PLKNPAW+
Sbjct  484  VWINCFDVFDAAIPFGGYKMSGQGREKGIYSLSNYLQVKAVVSPLKNPAWL  534



>ref|XP_003532011.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Glycine max]
 gb|KHN10599.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=536

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE +Y+EFV+KAKARA+RRV
Sbjct  306  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHENVYEEFVQKAKARALRRV  365

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDS+QFEK+LRYIRSG ESGATLE GGD++G+KG++IQPT+FS+VK
Sbjct  366  VGDPFKGGIEQGPQIDSDQFEKILRYIRSGVESGATLETGGDKLGNKGFYIQPTVFSNVK  425

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M+IA+DEIFGPVQ +LKFKD+ EV++RANNT YGLAAGV+T ++D ANTL R LR GT
Sbjct  426  DGMLIAKDEIFGPVQSILKFKDLGEVVQRANNTRYGLAAGVFTKNMDTANTLTRALRVGT  485

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVV PLKNPAW+
Sbjct  486  VWINCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVNPLKNPAWL  536



>ref|XP_010044646.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW86738.1| hypothetical protein EUGRSUZ_B03349 [Eucalyptus grandis]
Length=544

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE IY+EFVEKAKARA  R 
Sbjct  314  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHESIYEEFVEKAKARATVRS  373

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDSEQF+K+LRYIRSG E GATLE GG+R G+KG++IQPT+FS+VK
Sbjct  374  VGDPFKSGIEQGPQIDSEQFQKILRYIRSGVEGGATLETGGERFGTKGHYIQPTVFSNVK  433

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID ANTL R L+ GT
Sbjct  434  DDMLIAKDEIFGPVQTILKFKDLKEVIQRANNSRYGLAAGVFTQNIDTANTLTRALKVGT  493

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKGVYSL+NYLQVKAVVT LKNPAW+
Sbjct  494  VWVNCFDVFDAAIPFGGYKMSGHGREKGVYSLSNYLQVKAVVTSLKNPAWL  544



>ref|XP_002877590.1| ALDH2B4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53849.1| ALDH2B4 [Arabidopsis lyrata subsp. lyrata]
Length=537

 Score =   400 bits (1029),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFVEK+KARA++RV
Sbjct  307  GKSPFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKSKARALKRV  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KG+EQGPQIDS+QFEKV++YIRSG ES ATLECGGD+IG KGYFIQPT+FS+VK
Sbjct  367  VGDPFRKGIEQGPQIDSKQFEKVMKYIRSGVESNATLECGGDQIGDKGYFIQPTVFSNVK  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKF D+DEVIKRAN T YGLAAGV+T  +D AN ++R L+AGT
Sbjct  427  DDMLIAQDEIFGPVQSILKFSDVDEVIKRANETRYGLAAGVFTKSLDTANRVSRALKAGT  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKG+YSL+NYLQ+KAVVT L  PAWI
Sbjct  487  VWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLSNYLQIKAVVTALNKPAWI  537



>ref|XP_008781996.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Phoenix dactylifera]
Length=543

 Score =   400 bits (1029),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II DDA++D AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFVEKAKARA++RV
Sbjct  313  GKSPMIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKAKARALKRV  372

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID +QF K+LRYI+SG +SGATL+ GGDR+GSKGYFIQPTIFSDVK
Sbjct  373  VGDPFRKGVEQGPQIDEDQFNKILRYIKSGIDSGATLQAGGDRLGSKGYFIQPTIFSDVK  432

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ +LKF D++EVI+RAN T YGLAAGV+T+++D ANTL R LRAGT
Sbjct  433  DGMQIAQEEIFGPVQSILKFSDLNEVIRRANTTRYGLAAGVFTNNLDTANTLTRALRAGT  492

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+ SL NYLQVKAVVTPLKNPAW+
Sbjct  493  VWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQVKAVVTPLKNPAWL  543



>emb|CDY47634.1| BnaC05g18900D [Brassica napus]
Length=544

 Score =   400 bits (1029),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 213/239 (89%), Gaps = 8/239 (3%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQ--------GQCCCAGSRTYVHERIYDEFVEKA  684
            GKSPFI+C+DA++D+AVE AHFALFFNQ        GQCCCAGSRT+VHER+YDEFVEKA
Sbjct  306  GKSPFIVCEDADVDQAVELAHFALFFNQATSLRKTSGQCCCAGSRTFVHERVYDEFVEKA  365

Query  683  KARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQ  504
            KARA++R VGDPFK G+EQGPQ+DSEQF+K+L+YI+ G ESGATL+ GGDR GSKGY+IQ
Sbjct  366  KARAIKRAVGDPFKSGIEQGPQVDSEQFKKILKYIKHGVESGATLQAGGDRFGSKGYYIQ  425

Query  503  PTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTL  324
            PT+FSDVK+DM+IA DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D AN L
Sbjct  426  PTVFSDVKDDMLIATDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTHNLDTANRL  485

Query  323  ARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
             R LR G+VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNPAW+
Sbjct  486  MRALRVGSVWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNPAWL  544



>ref|XP_010551563.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Tarenaya hassleriana]
Length=540

 Score =   400 bits (1029),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++R 
Sbjct  310  GKSPFIVCEDADVDKAVELAHLAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARAIKRA  369

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+DSEQF+K+LRYIRSG E+GATL+ GGD++GSKGY+IQPT+FSDVK
Sbjct  370  VGDPFKAGIEQGPQVDSEQFKKILRYIRSGIENGATLQAGGDQLGSKGYYIQPTVFSDVK  429

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++MVIA++EIFGPVQ +LKFKD++EVI RAN + YGLAAGV+T ++D AN L R LR G+
Sbjct  430  DEMVIAKEEIFGPVQSILKFKDLEEVIARANKSCYGLAAGVFTQNLDTANRLMRALRVGS  489

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA +PFGGYKMSGIGREKG+YSLNNYLQVKAVVTPL NPAW+
Sbjct  490  VWINCFDVFDAAVPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLTNPAWL  540



>ref|XP_010913576.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=543

 Score =   400 bits (1027),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II DDA++D AVE AH ALFFNQGQCCCAGSRT+VHE++YDEFVEKAKARA++RV
Sbjct  313  GKSPMIIMDDADVDHAVELAHMALFFNQGQCCCAGSRTFVHEKVYDEFVEKAKARALKRV  372

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID EQF K++RYI+SG +SGATL+ GGDR+GSKGYFIQPTIFSDVK
Sbjct  373  VGDPFRKGVEQGPQIDEEQFNKIMRYIKSGVDSGATLQAGGDRLGSKGYFIQPTIFSDVK  432

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ +LKF D++EVI+RAN T YGLAAGV+T+++D ANTL R LRAGT
Sbjct  433  DGMPIAQEEIFGPVQSILKFSDLNEVIQRANTTRYGLAAGVFTNNLDTANTLMRALRAGT  492

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPLKNPAW+
Sbjct  493  VWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLKNPAWL  543



>ref|NP_190383.1| aldehyde dehydrogenase 2B4 [Arabidopsis thaliana]
 sp|Q9SU63.1|AL2B4_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member B4, mitochondrial; 
Short=ALDH2a; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG42016.1|AF327426_1 putative (NAD+) aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAK15569.1|AF349522_1 putative aldehyde dehydrogenase (NAD+) [Arabidopsis thaliana]
 gb|AAK49627.1|AF372911_1 AT3g48000/T17F15_130 [Arabidopsis thaliana]
 emb|CAB41139.1| aldehyde dehydrogenase (NAD+)-like protein [Arabidopsis thaliana]
 dbj|BAA96792.1| aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAL91287.1| AT3g48000/T17F15_130 [Arabidopsis thaliana]
 gb|AAM27003.1| aldehyde dehydrogenase ALDH2a [Arabidopsis thaliana]
 gb|AAN31892.1| putative aldehyde dehydrogenase (NAD+) [Arabidopsis thaliana]
 gb|AAP21179.1| At3g48000/T17F15_130 [Arabidopsis thaliana]
 gb|AEE78355.1| aldehyde dehydrogenase 2B4 [Arabidopsis thaliana]
Length=538

 Score =   400 bits (1027),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFVEK+KARA++RV
Sbjct  308  GKSPFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKSKARALKRV  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KG+EQGPQID +QFEKV++YI+SG ES ATLECGGD+IG KGYFIQPT+FS+VK
Sbjct  368  VGDPFRKGIEQGPQIDLKQFEKVMKYIKSGIESNATLECGGDQIGDKGYFIQPTVFSNVK  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKF D+DEVIKRAN T YGLAAGV+T ++D AN ++R L+AGT
Sbjct  428  DDMLIAQDEIFGPVQSILKFSDVDEVIKRANETKYGLAAGVFTKNLDTANRVSRALKAGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  PAWI
Sbjct  488  VWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI  538



>emb|CDP00179.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   399 bits (1026),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKA ARA++R 
Sbjct  308  GKSPFIVCEDADVDNAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKATARALKRS  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF++ +EQGPQ+DSEQFEK+LRYIR+G +SGATLE GGDR+G KGY+I+PT+FS+V+
Sbjct  368  VGDPFRQEIEQGPQVDSEQFEKILRYIRAGVDSGATLETGGDRLGEKGYYIKPTVFSNVQ  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA++EIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T ++D ANTL R LRAGT
Sbjct  428  DDMPIAKEEIFGPVQTILKYKDLDEVIRRANSTRYGLAAGVFTQNLDTANTLMRALRAGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  488  VWINCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNPAWL  538



>ref|XP_003552014.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
 gb|KHN39739.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=536

 Score =   399 bits (1025),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEFVEKAKARA++RV
Sbjct  306  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFVEKAKARALKRV  365

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDS+QFEK+LRYIRSG ESGATLE GGD++G+KG++IQPT+FS+VK
Sbjct  366  VGDPFKGGIEQGPQIDSDQFEKILRYIRSGVESGATLETGGDKLGNKGFYIQPTVFSNVK  425

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M+IA+DEIFGPVQ +LKFKD+ EV++RANNT YGLAAGV+T+++D A TL R LR GT
Sbjct  426  DGMLIARDEIFGPVQSILKFKDLGEVVQRANNTRYGLAAGVFTTNMDTAYTLTRALRVGT  485

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVV PLKNPAW+
Sbjct  486  VWINCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVNPLKNPAWL  536



>ref|XP_007157468.1| hypothetical protein PHAVU_002G072100g [Phaseolus vulgaris]
 gb|ESW29462.1| hypothetical protein PHAVU_002G072100g [Phaseolus vulgaris]
Length=538

 Score =   399 bits (1025),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKA+ARA++R 
Sbjct  308  GKSPFIVCEDADVDEAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKARARALKRA  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDSEQF+K+L+YIRSG ESGATLE GGDR G+ G+++QPT+FS+VK
Sbjct  368  VGDPFKGGIEQGPQIDSEQFQKILKYIRSGVESGATLETGGDRFGNSGFYVQPTVFSNVK  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA++ IFGPVQ +LKFK++DEVI RANNTHYGLAAGV+T +I+ ANTL R L+ GT
Sbjct  428  DDMLIAKETIFGPVQSILKFKELDEVIHRANNTHYGLAAGVFTKNINTANTLTRALKVGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKG YSL NYLQVKAVVT LKNPAW+
Sbjct  488  VWVNCFDVFDAAIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTSLKNPAWL  538



>ref|XP_006355977.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum tuberosum]
Length=529

 Score =   399 bits (1024),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ +DA+ID AVE AHFALFFNQGQCCCAGSRTYVHE++YDEF+EKAKARA++RV
Sbjct  299  GKSPFIVYEDADIDTAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFLEKAKARALKRV  358

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G EQGPQIDS+QF+K+++YIRSG +SGATLE GG++ G KGY+I+PT+FS+VK
Sbjct  359  VGDPFKSGTEQGPQIDSKQFDKIMKYIRSGVDSGATLETGGEQFGKKGYYIKPTVFSNVK  418

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IAQDEIFGPVQ +LKFKD+DEV++RAN++ YGLAAGV++ +ID ANTLAR LR GT
Sbjct  419  DDMLIAQDEIFGPVQSILKFKDLDEVVRRANSSRYGLAAGVFSQNIDTANTLARALRVGT  478

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D FDATIPFGGYKMSG GREKG Y L NYLQVKAVVTPLKNPAW+
Sbjct  479  VWINCFDTFDATIPFGGYKMSGQGREKGEYGLRNYLQVKAVVTPLKNPAWL  529



>gb|KCW56066.1| hypothetical protein EUGRSUZ_I01821 [Eucalyptus grandis]
Length=423

 Score =   395 bits (1014),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA ID+AVE AHFALFFNQGQCC AGSRT+VHE +YDEFVEKA+ARAM+RV
Sbjct  193  GKSPFIVCKDAEIDKAVELAHFALFFNQGQCCNAGSRTFVHESVYDEFVEKARARAMKRV  252

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQ+D +QFEK+  YI+SG ESGATLECGG+R GSKG+FIQPT+FS+V+
Sbjct  253  VGDPFKPGVEQGPQVDIKQFEKIHTYIKSGIESGATLECGGERYGSKGFFIQPTVFSNVQ  312

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ + KFKD+DEVI+RAN + YGLAAGV+T +ID ANTLAR LRAG+
Sbjct  313  DDMLIAKDEIFGPVQTISKFKDLDEVIRRANKSPYGLAAGVFTQNIDTANTLARALRAGS  372

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCY V DA IPFGGYKMSGIGREKGVYSL+NYLQVKAVV PLKNPAW+
Sbjct  373  VWINCYHVVDAAIPFGGYKMSGIGREKGVYSLSNYLQVKAVVNPLKNPAWL  423



>gb|KCW86739.1| hypothetical protein EUGRSUZ_B03349 [Eucalyptus grandis]
Length=544

 Score =   399 bits (1025),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE IY+EFVEKAKARA  R 
Sbjct  314  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHESIYEEFVEKAKARATVRS  373

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ++SEQF+K+LRYIRSG E GATLE GG+R G+KG++IQPT+FS+VK
Sbjct  374  VGDPFKSGIEQGPQVNSEQFQKILRYIRSGVEGGATLETGGERFGTKGHYIQPTVFSNVK  433

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID ANTL R L+ GT
Sbjct  434  DDMLIAKDEIFGPVQTILKFKDLKEVIQRANNSRYGLAAGVFTQNIDTANTLTRALKVGT  493

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG GREKGVYSL+NYLQVKAVVT LKNPAW+
Sbjct  494  VWVNCFDVFDAAIPFGGYKMSGHGREKGVYSLSNYLQVKAVVTSLKNPAWL  544



>ref|XP_007036177.1| Aldehyde dehydrogenase family 2 member B4 [Theobroma cacao]
 gb|EOY20678.1| Aldehyde dehydrogenase family 2 member B4 [Theobroma cacao]
Length=567

 Score =   399 bits (1026),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA+RRV
Sbjct  310  GKSPFIVCEDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKAKARALRRV  369

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDSEQFEKVLRYIRSG ES ATLECGGDR+G KGYFIQPT+FS+V 
Sbjct  370  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGIESNATLECGGDRLGKKGYFIQPTVFSNVT  429

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LKFKD+DEVI+RAN T YGLAAGV+T +ID ANTL R LRAGT
Sbjct  430  DDMLIAKDEIFGPVQSILKFKDLDEVIRRANATRYGLAAGVFTKNIDTANTLTRALRAGT  489

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQV  186
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQ+
Sbjct  490  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQI  527



>ref|XP_007153639.1| hypothetical protein PHAVU_003G052500g [Phaseolus vulgaris]
 gb|ESW25633.1| hypothetical protein PHAVU_003G052500g [Phaseolus vulgaris]
Length=535

 Score =   398 bits (1023),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE +YDEFVEKAKARA++RV
Sbjct  305  GKSPFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFVEKAKARALKRV  364

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDSEQFEK+LRY+R G ESGATLE GGDR+G KGY+IQPT+FS+VK
Sbjct  365  VGDPFKGGIEQGPQIDSEQFEKILRYVRLGVESGATLETGGDRLGDKGYYIQPTVFSNVK  424

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA DEIFGPVQ +LKFKD+ EV++RANN+ YGLAAGV+T +ID AN L R LR GT
Sbjct  425  DDMRIATDEIFGPVQSILKFKDLGEVVQRANNSRYGLAAGVFTKNIDTANILTRALRVGT  484

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVV  LKNPAW+
Sbjct  485  VWINCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVNSLKNPAWL  535



>ref|XP_010271955.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Nelumbo nucifera]
Length=534

 Score =   398 bits (1023),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 214/231 (93%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHERIYDEFVEKAKARA+RRV
Sbjct  304  GKSPFIVCEDADIDSAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKAKARALRRV  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID++QF K+L YIRSG E+GATLE GG+R+GSKGYFI+PT+FS+V+
Sbjct  364  VGDPFEKGVEQGPQIDADQFVKILNYIRSGTENGATLETGGERLGSKGYFIRPTVFSNVE  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IA DEIFGPVQ +LKFKDI+EVI+R+N + +GLAAGV+T++++ ANTL R LR GT
Sbjct  424  DNMLIATDEIFGPVQSILKFKDINEVIRRSNKSRFGLAAGVFTNNLETANTLMRALRVGT  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+YSL+NYLQVKAVV+PLKN AW+
Sbjct  484  VWINCFDVFDAAIPFGGYKMSGNGREKGIYSLDNYLQVKAVVSPLKNAAWL  534



>ref|XP_007031425.1| Aldehyde dehydrogenase 2B7 isoform 3 [Theobroma cacao]
 gb|EOY02351.1| Aldehyde dehydrogenase 2B7 isoform 3 [Theobroma cacao]
Length=414

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA++D+AVE AH ALFFNQGQCCCAGSRT VHE +YDEFVEKAKARA++RV
Sbjct  184  GKSPFIVCKDADVDKAVELAHSALFFNQGQCCCAGSRTLVHESVYDEFVEKAKARALKRV  243

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KG+EQGPQID EQF+K+L+YIRSG ESGATLE GG+++GS+GY+IQPT+FS+V+
Sbjct  244  VGDPFQKGIEQGPQIDDEQFKKILKYIRSGIESGATLESGGEQLGSRGYYIQPTVFSNVQ  303

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ + KFKD+DEVI+RAN T YGLAAGV+T +++ ANTL R LRAGT
Sbjct  304  DDMLIAKDEIFGPVQSISKFKDLDEVIQRANATSYGLAAGVFTQNLETANTLTRALRAGT  363

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYD+FDA IPFGG+KMSG GREKG+Y L++YLQVKAVVTPLK+PAW+
Sbjct  364  VWINCYDIFDAAIPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKHPAWL  414



>ref|XP_010477682.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA+ R 
Sbjct  304  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAIHRS  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK
Sbjct  364  VGDPFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQTGGDRLGSKGYYIQPTVFSDVK  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLA+GV+T ++D AN L R LR GT
Sbjct  424  DDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLASGVFTQNLDTANRLMRALRVGT  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DV DATIPFGGYKMSG GREK +YSL++YLQVKAVVT LKNPAW+
Sbjct  484  VWINCFDVLDATIPFGGYKMSGTGREKSLYSLSHYLQVKAVVTSLKNPAWL  534



>gb|EYU22484.1| hypothetical protein MIMGU_mgv1a004342mg [Erythranthe guttata]
Length=532

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFVEKAK RA++R 
Sbjct  302  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKAKERALKRA  361

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQID EQF+K+L+YI+SG ESGATLE GGDR G+KGY+IQPT+FS+VK
Sbjct  362  VGDPFKAGMEQGPQIDGEQFKKILKYIKSGVESGATLEAGGDRFGTKGYYIQPTVFSNVK  421

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ VLKFK++ EVI+RANN+ +GLAAGV+T ++D ANTL R LRAGT
Sbjct  422  DDMLIAKDEIFGPVQTVLKFKELGEVIRRANNSPFGLAAGVFTQNLDTANTLTRALRAGT  481

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D FDA IPFGGYKMSGIGREKG YSL NYLQVKAVVT LK+PAW+
Sbjct  482  VWINCFDTFDAAIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTALKDPAWL  532



>ref|XP_004297641.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=535

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA +RV
Sbjct  305  GKSPFIVCEDADVDKAVEMAHLALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAEKRV  364

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G EQGPQIDS+QFEK+L+YI  G + GATLE GG++ GSKGY+I+PT+FS+VK
Sbjct  365  VGDPFKGGTEQGPQIDSDQFEKILKYIDYGIKGGATLETGGEQFGSKGYYIKPTVFSNVK  424

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA+DEIFGPVQ VLK+K++DEVIKRANNT YGLAAGV+T +ID ANTL R LR GT
Sbjct  425  DDMQIAKDEIFGPVQMVLKYKELDEVIKRANNTRYGLAAGVFTQNIDTANTLTRALRVGT  484

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDATIP GGYKMSGIGREKG+Y L NYLQVKAVVTPLKNPAW+
Sbjct  485  VWINCFDVFDATIPIGGYKMSGIGREKGIYGLQNYLQVKAVVTPLKNPAWL  535



>ref|XP_011463376.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=531

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA +RV
Sbjct  301  GKSPFIVCEDADVDKAVEMAHLALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAEKRV  360

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G EQGPQIDS+QFEK+L+YI  G + GATLE GG++ GSKGY+I+PT+FS+VK
Sbjct  361  VGDPFKGGTEQGPQIDSDQFEKILKYIDYGIKGGATLETGGEQFGSKGYYIKPTVFSNVK  420

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA+DEIFGPVQ VLK+K++DEVIKRANNT YGLAAGV+T +ID ANTL R LR GT
Sbjct  421  DDMQIAKDEIFGPVQMVLKYKELDEVIKRANNTRYGLAAGVFTQNIDTANTLTRALRVGT  480

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDATIP GGYKMSGIGREKG+Y L NYLQVKAVVTPLKNPAW+
Sbjct  481  VWINCFDVFDATIPIGGYKMSGIGREKGIYGLQNYLQVKAVVTPLKNPAWL  531



>gb|AGV54428.1| mitochondrial aldehyde dehydrogenase [Phaseolus vulgaris]
Length=535

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE +YDEFVEKAKARA++RV
Sbjct  305  GKSPFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFVEKAKARALKRV  364

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDSEQFEK+LRY+R G ESGATLE GGDR+G KGY+IQPT+FS+VK
Sbjct  365  VGDPFKGGIEQGPQIDSEQFEKILRYVRLGVESGATLETGGDRLGDKGYYIQPTVFSNVK  424

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA DEIFGPVQ +LKFKD+ EV++RANN+ YGLAAGV+T +ID AN L R LR GT
Sbjct  425  DDMRIATDEIFGPVQSILKFKDLGEVVQRANNSQYGLAAGVFTKNIDTANILTRALRVGT  484

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVV  LKNPAW+
Sbjct  485  VWINCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVNSLKNPAWL  535



>ref|XP_010100483.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
 gb|EXB82617.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
Length=537

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFII  DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE IYDEFV KA ARA++R 
Sbjct  307  GKSPFIIAADADVDQAVELAHFALFFNQGQCCCAGSRTFVHESIYDEFVSKATARAIKRT  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQID EQF+KVL YI+SG ESGATLE GG+RIGS GYF++PT+FS+V 
Sbjct  367  VGDPFKAGIEQGPQIDPEQFDKVLSYIKSGNESGATLETGGNRIGSTGYFVEPTVFSNVT  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA+DEIFGPVQ +LKFKD+DEVI+RAN T YGLAAGV+T +ID ANTL R LR GT
Sbjct  427  DDMKIAKDEIFGPVQSILKFKDLDEVIRRANATRYGLAAGVFTKNIDTANTLTRALRVGT  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV PLKNPAW+
Sbjct  487  VWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVEPLKNPAWL  537



>ref|XP_004297642.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=535

 Score =   397 bits (1020),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKA ARA +RV
Sbjct  305  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKATARAEKRV  364

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDS+QFEK+L+YI  G + GATLE GG+R GSKGY+I+PT+FS+VK
Sbjct  365  VGDPFKGGIEQGPQIDSDQFEKILKYIDYGIKGGATLETGGERFGSKGYYIKPTVFSNVK  424

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA+DEIFGPVQ VLK+K++DEVIKRANN+ YGLAAGV+T +ID ANTL R LR G+
Sbjct  425  DDMQIAKDEIFGPVQTVLKYKELDEVIKRANNSRYGLAAGVFTQNIDTANTLTRALRVGS  484

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA+IPFGGYKMSG GREKG+Y L NYLQVKAVVTPLKNPAW+
Sbjct  485  VWINCFDVFDASIPFGGYKMSGNGREKGIYGLQNYLQVKAVVTPLKNPAWL  535



>dbj|BAB92019.1| mitochondrial aldehyde dehydrogenase [Sorghum bicolor]
Length=547

 Score =   397 bits (1020),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFII DDA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RV
Sbjct  317  GKSPFIIMDDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRV  376

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID EQF K+LRYIRSG +SGA L  GGDR+G KGY+IQPTIFSDV+
Sbjct  377  VGDPFRKGVEQGPQIDDEQFNKILRYIRSGVDSGANLVTGGDRLGEKGYYIQPTIFSDVQ  436

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D ANTL R LRAGT
Sbjct  437  DGMKIAQEEIFGPVQSILKFKDLNEVIKRANASPYGLAAGVFTNSLDTANTLTRALRAGT  496

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVTP+KN AW+
Sbjct  497  VWINCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTPIKNAAWL  547



>ref|XP_010029206.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
Length=532

 Score =   396 bits (1017),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA ID+AVE AHFALFFNQGQCC AGSRT+VHE +YDEFVEKA+ARAM+RV
Sbjct  302  GKSPFIVCKDAEIDKAVELAHFALFFNQGQCCNAGSRTFVHESVYDEFVEKARARAMKRV  361

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQ+D +QFEK+  YI+SG ESGATLECGG+R GSKG+FIQPT+FS+V+
Sbjct  362  VGDPFKPGVEQGPQVDIKQFEKIHTYIKSGIESGATLECGGERYGSKGFFIQPTVFSNVQ  421

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ + KFKD+DEVI+RAN + YGLAAGV+T +ID ANTLAR LRAG+
Sbjct  422  DDMLIAKDEIFGPVQTISKFKDLDEVIRRANKSPYGLAAGVFTQNIDTANTLARALRAGS  481

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCY V DA IPFGGYKMSGIGREKGVYSL+NYLQVKAVV PLKNPAW+
Sbjct  482  VWINCYHVVDAAIPFGGYKMSGIGREKGVYSLSNYLQVKAVVNPLKNPAWL  532



>gb|AAL77005.1| aldehyde dehydrogenase [Allium cepa]
Length=230

 Score =   385 bits (988),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 205/230 (89%), Gaps = 0/230 (0%)
 Frame = -3

Query  836  KSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVV  657
            KSP II DDA+ID+AVE AHFALFFNQGQCCCA S T+VHE+IYDEFVEKAKARAMRRVV
Sbjct  1    KSPMIILDDADIDQAVELAHFALFFNQGQCCCACSPTFVHEKIYDEFVEKAKARAMRRVV  60

Query  656  GDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKE  477
            GDPFKKGVEQGPQID EQF K+LRYI+ G + GA+L  GG+RIGSKGY+IQPTIFSDVK+
Sbjct  61   GDPFKKGVEQGPQIDDEQFNKILRYIKLGVDGGASLVTGGERIGSKGYYIQPTIFSDVKD  120

Query  476  DMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTV  297
            DMVIA++EIFGPVQ +LKF D++EVI+RAN + YGLAAGV+TS+IDKANTL R LR GTV
Sbjct  121  DMVIAKEEIFGPVQSILKFNDLNEVIRRANASRYGLAAGVFTSNIDKANTLTRALRVGTV  180

Query  296  WINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            W+NC+DVFDA IPFGGYKMSG GREKG+ SL  YLQ KAVVTPLKNPAW+
Sbjct  181  WVNCFDVFDAAIPFGGYKMSGQGREKGIDSLKGYLQTKAVVTPLKNPAWL  230



>ref|XP_008221788.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Prunus mume]
Length=534

 Score =   396 bits (1017),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFN GQCCC+GSRT+VHER+YDEF+EKAKARA +R+
Sbjct  304  GKSPFIVCEDADVDKAVELAHFALFFNMGQCCCSGSRTFVHERVYDEFIEKAKARAEKRI  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQIDS+QFEK+LRYI  G +SGATLE GG R+G+KG++I+PT+FS+VK
Sbjct  364  VGDPFKGGVEQGPQIDSDQFEKILRYIDYGIKSGATLETGGGRLGTKGFYIKPTVFSNVK  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IAQDEIFGPVQ +LK+KD+DEVI+RAN T YGLAAGV+T +ID ANTL R LR G+
Sbjct  424  DDMPIAQDEIFGPVQSILKYKDLDEVIRRANTTRYGLAAGVFTQNIDTANTLTRALRVGS  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+Y L+NYLQVKAVVTPLKNPAW+
Sbjct  484  VWINCFDVFDAAIPFGGYKMSGHGREKGIYGLSNYLQVKAVVTPLKNPAWL  534



>gb|KEH19981.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=509

 Score =   395 bits (1014),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+++EFVEKAKARA++R 
Sbjct  279  GKSPFIVCEDADIDEAVELAHFALFFNQGQCCCAGSRTFVHERVHEEFVEKAKARALKRA  338

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G EQGPQIDS+QFEK+L+YIRSG E+GATLE GG+R+GSKGY+IQPT+FS+V+
Sbjct  339  VGDPFKSGTEQGPQIDSKQFEKILKYIRSGVENGATLETGGERLGSKGYYIQPTVFSNVQ  398

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID ANTL R L+ GT
Sbjct  399  DGMQIAKEEIFGPVQTILKFKDLGEVIQRANNSKYGLAAGVFTKNIDTANTLTRALKVGT  458

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  459  VWVNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNPAWL  509



>dbj|BAB62757.1| mitochondrial aldehyde dehydrogenase ALDH2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ90704.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   396 bits (1017),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct  319  GKSPFIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV  378

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID EQF+K+LRYI+SG +SGATL  GGD++G KGY+IQPTIFSDV+
Sbjct  379  VGDPFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGDKLGDKGYYIQPTIFSDVQ  438

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++D ANTL R LRAGT
Sbjct  439  DDMKIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVFTNNLDTANTLTRALRAGT  498

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            +W+NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVT LKNPAW+
Sbjct  499  IWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTALKNPAWL  549



>emb|CBI32134.3| unnamed protein product [Vitis vinifera]
Length=571

 Score =   397 bits (1019),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DAN+D AVE AHF+LFFNQGQCCCAGS TYVHERIYDEFVEKAKARA++RV
Sbjct  341  GKSPFIVCEDANVDEAVELAHFSLFFNQGQCCCAGSHTYVHERIYDEFVEKAKARALKRV  400

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G EQGPQIDSE+FEK+LRYIRSG ++GATLE GG+R G+ GYFI+PT+FS+V+
Sbjct  401  VGDPFKAGTEQGPQIDSEKFEKILRYIRSGVDNGATLETGGERFGTGGYFIKPTVFSNVQ  460

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+ AQDEIFGPVQ +LKFKD+DEVI+RAN ++ GLAAGV+T +ID ANTL R LR GT
Sbjct  461  DDMLKAQDEIFGPVQSILKFKDLDEVIRRANASNCGLAAGVFTQNIDTANTLTRALRVGT  520

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+Y L NYLQVKAVV+PLKNPAW+
Sbjct  521  VWINCFDVFDAAIPFGGYKMSGNGREKGIYCLQNYLQVKAVVSPLKNPAWL  571


 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DAN+D AVE AHFALFFNQGQCC +GSRT+VHE +YDEFVEKAKARA+RR 
Sbjct  36   GKSPFIVCEDANVDEAVEMAHFALFFNQGQCCASGSRTFVHESVYDEFVEKAKARALRRT  95

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDS+QFEK++RYIRSG ESGATLE GG+R G +   +    F+D+ 
Sbjct  96   VGDPFKAGIEQGPQIDSKQFEKIMRYIRSGVESGATLESGGERFGKERSRVMWR-FADLL  154

Query  479  ED  474
            ED
Sbjct  155  ED  156



>gb|KEH19980.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=541

 Score =   395 bits (1016),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+++EFVEKAKARA++R 
Sbjct  311  GKSPFIVCEDADIDEAVELAHFALFFNQGQCCCAGSRTFVHERVHEEFVEKAKARALKRA  370

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G EQGPQIDS+QFEK+L+YIRSG E+GATLE GG+R+GSKGY+IQPT+FS+V+
Sbjct  371  VGDPFKSGTEQGPQIDSKQFEKILKYIRSGVENGATLETGGERLGSKGYYIQPTVFSNVQ  430

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID ANTL R L+ GT
Sbjct  431  DGMQIAKEEIFGPVQTILKFKDLGEVIQRANNSKYGLAAGVFTKNIDTANTLTRALKVGT  490

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  491  VWVNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNPAWL  541



>ref|XP_006844236.1| hypothetical protein AMTR_s00006p00268060 [Amborella trichopoda]
 gb|ERN05911.1| hypothetical protein AMTR_s00006p00268060 [Amborella trichopoda]
Length=501

 Score =   394 bits (1012),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 209/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHERIYDEF+EKAKARAM+RV
Sbjct  271  GKSPFIICEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFLEKAKARAMKRV  330

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID EQF K++ YI+SG +SGATLE GG+RIG+KGY+IQPTIFS+ K
Sbjct  331  VGDPFKKGVEQGPQIDLEQFNKIMGYIKSGVDSGATLELGGERIGTKGYYIQPTIFSNTK  390

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA DEIFGPVQ V KFKD++EVI+RAN + YGLAAGV+T +ID ANTL+R LR GT
Sbjct  391  DSMPIATDEIFGPVQTVFKFKDLNEVIQRANASRYGLAAGVFTKNIDTANTLSRALRVGT  450

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG+GREKG+ SL+NYLQVKAVV  L+NPAW+
Sbjct  451  VWVNCFDVFDAAIPFGGYKMSGVGREKGIQSLSNYLQVKAVVQHLRNPAWL  501



>ref|XP_007031423.1| Aldehyde dehydrogenase 2B4 isoform 1 [Theobroma cacao]
 gb|EOY02349.1| Aldehyde dehydrogenase 2B4 isoform 1 [Theobroma cacao]
Length=511

 Score =   394 bits (1012),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA++D+AVE AH ALFFNQGQCCCAGSRT VHE +YDEFVEKAKARA++RV
Sbjct  281  GKSPFIVCKDADVDKAVELAHSALFFNQGQCCCAGSRTLVHESVYDEFVEKAKARALKRV  340

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KG+EQGPQID EQF+K+L+YIRSG ESGATLE GG+++GS+GY+IQPT+FS+V+
Sbjct  341  VGDPFQKGIEQGPQIDDEQFKKILKYIRSGIESGATLESGGEQLGSRGYYIQPTVFSNVQ  400

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ + KFKD+DEVI+RAN T YGLAAGV+T +++ ANTL R LRAGT
Sbjct  401  DDMLIAKDEIFGPVQSISKFKDLDEVIQRANATSYGLAAGVFTQNLETANTLTRALRAGT  460

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYD+FDA IPFGG+KMSG GREKG+Y L++YLQVKAVVTPLK+PAW+
Sbjct  461  VWINCYDIFDAAIPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKHPAWL  511



>ref|XP_007221800.1| hypothetical protein PRUPE_ppa004036mg [Prunus persica]
 gb|EMJ22999.1| hypothetical protein PRUPE_ppa004036mg [Prunus persica]
Length=534

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFN GQCCC+GSRT+VHER+YDEF+EKA+ARA +R+
Sbjct  304  GKSPFIVCEDADVDKAVELAHFALFFNMGQCCCSGSRTFVHERVYDEFIEKARARAEKRI  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQIDS+QFEK+LRYI  G +SGATLE GG R+G+KG++I+PT+FS+VK
Sbjct  364  VGDPFKGGVEQGPQIDSDQFEKILRYIDYGIKSGATLETGGGRLGTKGFYIKPTVFSNVK  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IAQDEIFGPVQ +LK+KD+DEVI+RAN T YGLAAGV+T +ID ANTL R LR G+
Sbjct  424  DDMPIAQDEIFGPVQSILKYKDLDEVIRRANTTRYGLAAGVFTQNIDTANTLTRALRVGS  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+Y L+NYLQVKA+VTPLKNPAW+
Sbjct  484  VWINCFDVFDAAIPFGGYKMSGHGREKGIYGLSNYLQVKAIVTPLKNPAWL  534



>gb|AFK40600.1| unknown [Medicago truncatula]
Length=392

 Score =   389 bits (1000),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+++EFVEKAKARA++R 
Sbjct  162  GKSPFIVCEDADIDEAVELAHFALFFNQGQCCCAGSRTFVHERVHEEFVEKAKARALKRA  221

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G EQGPQIDS+QFEK+L+YIRSG E+GATLE GG+R+GSKGY+IQPT+FS+V+
Sbjct  222  VGDPFKSGTEQGPQIDSKQFEKILKYIRSGVENGATLETGGERLGSKGYYIQPTVFSNVQ  281

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPVQ +LKFKD+ EVI+RANN+ YG AAGV+  +ID ANTL R L+ GT
Sbjct  282  DGMQIAKEEIFGPVQTILKFKDLGEVIQRANNSKYGFAAGVFPKNIDTANTLTRALKVGT  341

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D FDA IPFGGYKMSG GRE+G YSL NYLQVKAVVTPLKNPAW+
Sbjct  342  VWVNCFDTFDAAIPFGGYKMSGQGRERGEYSLKNYLQVKAVVTPLKNPAWL  392



>ref|XP_006356663.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum tuberosum]
Length=537

 Score =   394 bits (1013),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE IYDEFVEKAKARA++R 
Sbjct  307  GKSPFIVCEDADVDQAVEFAHFALFFNQGQCCCAGSRTYVHESIYDEFVEKAKARALKRT  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+ G EQGPQI SEQFEKVL+YIRSG ESGATLE GGDR+G++GY+I+PT+FS+VK
Sbjct  367  VGDPFESGNEQGPQISSEQFEKVLKYIRSGIESGATLETGGDRLGTRGYYIKPTVFSNVK  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA DEIFGPVQ +LKFKD DEVI+RAN T YGLAAGV+T +ID ANT  R LR GT
Sbjct  427  DDMLIATDEIFGPVQSILKFKDHDEVIRRANATKYGLAAGVFTKNIDTANTFMRALRVGT  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            +WINC+D+FDA IPFGGYKMSG GREKG YSL  YLQVKAVVT LKNPAW+
Sbjct  487  IWINCFDIFDAAIPFGGYKMSGQGREKGEYSLKQYLQVKAVVTSLKNPAWL  537



>gb|KJB11464.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=414

 Score =   390 bits (1001),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA++D+AVE AH ALFFNQGQCCCAGSRT VHE +YDEFVEKAKARA++RV
Sbjct  184  GKSPFIVCKDADVDKAVELAHSALFFNQGQCCCAGSRTLVHESVYDEFVEKAKARALKRV  243

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQID+EQF+K+L+YIRSG ESGATLE GG++ GSKGY+IQPT+FS+V+
Sbjct  244  VGDPFKTGIEQGPQIDNEQFKKILKYIRSGIESGATLESGGEQFGSKGYYIQPTVFSNVQ  303

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ + KFKD++EV++RAN + YGLAAGV+T +I+ ANTL R LR GT
Sbjct  304  DDMLIAKDEIFGPVQSISKFKDLEEVVQRANASSYGLAAGVFTQNIETANTLTRALRVGT  363

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYD+FDA +PFGG+KMSG GREKG+Y L++YLQVKAVVTPLKNPAW+
Sbjct  364  VWINCYDIFDAAVPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKNPAWL  414



>ref|NP_001105891.1| mitochondrial aldehyde dehydrogenase 2 [Zea mays]
 gb|AAG43988.1|AF215823_1 T cytoplasm male sterility restorer factor 2 [Zea mays]
 gb|AAC49371.1| RF2 [Zea mays]
 gb|ACG38026.1| aldehyde dehydrogenase [Zea mays]
 gb|ACN28554.1| unknown [Zea mays]
 gb|AFW86312.1| restorer of fertility2 [Zea mays]
Length=549

 Score =   394 bits (1013),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RV
Sbjct  319  GKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRV  378

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID EQF K+LRYIR G + GATL  GGDR+G KG++IQPTIFSDV+
Sbjct  379  VGDPFRKGVEQGPQIDDEQFNKILRYIRYGVDGGATLVTGGDRLGDKGFYIQPTIFSDVQ  438

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D ANTL R LRAGT
Sbjct  439  DGMKIAQEEIFGPVQSILKFKDLNEVIKRANASQYGLAAGVFTNSLDTANTLTRALRAGT  498

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSGIGREKGV SL NYLQVKAVVTP+KN AW+
Sbjct  499  VWVNCFDVFDAAIPFGGYKMSGIGREKGVDSLKNYLQVKAVVTPIKNAAWL  549



>ref|XP_010477684.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   394 bits (1011),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 207/230 (90%), Gaps = 0/230 (0%)
 Frame = -3

Query  836  KSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVV  657
            KS FI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFV KAKARA+ R V
Sbjct  305  KSAFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVAKAKARAVNRSV  364

Query  656  GDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKE  477
            GDPFK G+EQGPQ+DSEQF K+L+YI+ G ESGATL+ GGDR+GSKGY+IQPT+FSDVK+
Sbjct  365  GDPFKSGIEQGPQVDSEQFNKILKYIKHGVESGATLQAGGDRLGSKGYYIQPTVFSDVKD  424

Query  476  DMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTV  297
            DM+IA DEIFGPVQ +LKFKD+DEVI RAN + YGLAAGV+T ++D AN L R LR GTV
Sbjct  425  DMLIATDEIFGPVQTILKFKDLDEVIARANKSMYGLAAGVFTQNLDTANRLMRALRVGTV  484

Query  296  WINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            WINC+D+FDATIPFGGYKMSGIGREK +YSL++YLQVKAVVT LKNPAW+
Sbjct  485  WINCFDLFDATIPFGGYKMSGIGREKSLYSLSHYLQVKAVVTSLKNPAWL  534



>gb|EMS51754.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Triticum 
urartu]
Length=550

 Score =   394 bits (1013),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct  320  GKSPFIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV  379

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID EQF+K+LRYI+SG +SGATL  GGD++G KGY+IQPTIFSDV+
Sbjct  380  VGDPFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGDKLGDKGYYIQPTIFSDVQ  439

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++D ANTL R LRAGT
Sbjct  440  DGMKIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVFTNNLDTANTLTRALRAGT  499

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVT LKNPAW+
Sbjct  500  VWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTALKNPAWL  550



>ref|XP_010265814.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nelumbo nucifera]
Length=539

 Score =   394 bits (1012),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEF+EK+KARAMRR+
Sbjct  309  GKSPFIVCEDADIDKAVELAHSAVFFNQGQCCCAGSRTFVHERVYDEFIEKSKARAMRRI  368

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID  QFEK+L  IRSG ESGATLE GG+R G+KGYFIQPT+FSDV+
Sbjct  369  VGDPFKKGVEQGPQIDKAQFEKILSCIRSGIESGATLETGGERFGTKGYFIQPTVFSDVQ  428

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA +EIFGPVQ +LKFKD+D+VI+RAN + YGLAAGV+T++I+ ANTL R LR GT
Sbjct  429  DDMAIATEEIFGPVQSILKFKDLDDVIQRANKSRYGLAAGVFTNNIETANTLMRSLRVGT  488

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCY VFDA IPFGGYKMSG GREKG Y LNNYLQVKAVV+PLKNPAW+
Sbjct  489  VWINCYFVFDAAIPFGGYKMSGKGREKGAYCLNNYLQVKAVVSPLKNPAWL  539



>gb|KJB11463.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=423

 Score =   390 bits (1001),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA++D+AVE AH ALFFNQGQCCCAGSRT VHE +YDEFVEKAKARA++RV
Sbjct  193  GKSPFIVCKDADVDKAVELAHSALFFNQGQCCCAGSRTLVHESVYDEFVEKAKARALKRV  252

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQID+EQF+K+L+YIRSG ESGATLE GG++ GSKGY+IQPT+FS+V+
Sbjct  253  VGDPFKTGIEQGPQIDNEQFKKILKYIRSGIESGATLESGGEQFGSKGYYIQPTVFSNVQ  312

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ + KFKD++EV++RAN + YGLAAGV+T +I+ ANTL R LR GT
Sbjct  313  DDMLIAKDEIFGPVQSISKFKDLEEVVQRANASSYGLAAGVFTQNIETANTLTRALRVGT  372

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYD+FDA +PFGG+KMSG GREKG+Y L++YLQVKAVVTPLKNPAW+
Sbjct  373  VWINCYDIFDAAVPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKNPAWL  423



>ref|XP_011071082.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Sesamum indicum]
Length=525

 Score =   393 bits (1010),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFV KAK RAM+R 
Sbjct  295  GKSPFIVCEDADVDKAVEVAHFALFFNQGQCCCAGSRTFVHEKVYDEFVAKAKERAMKRS  354

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQID+EQF K+L+YI+ GKE GATLE GGDR G+KGY+IQPT+FS+V+
Sbjct  355  VGDPFKTGMEQGPQIDAEQFNKILKYIKYGKECGATLETGGDRFGTKGYYIQPTVFSNVQ  414

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA+DEIFGPVQ VLKFKD +EVI+RANN+ YGLAAG++T D+D ANTL R LR GT
Sbjct  415  DDMPIAKDEIFGPVQTVLKFKDNEEVIRRANNSPYGLAAGIFTQDLDTANTLTRALRVGT  474

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D FDA IPFGGYKMSGIGREKG YSL NYLQVKAVVT LKNPAW+
Sbjct  475  VWVNCFDTFDAAIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTSLKNPAWL  525



>ref|XP_002301540.1| mitochondrial aldehyde dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE80813.1| mitochondrial aldehyde dehydrogenase family protein [Populus 
trichocarpa]
Length=540

 Score =   393 bits (1010),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE +H A+FFNQGQCCCAGSRT+VHER+YDEFVEKAKARA +R 
Sbjct  310  GKSPFIVCEDADVDQAVELSHSAVFFNQGQCCCAGSRTFVHERVYDEFVEKAKARANQRA  369

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK+G+EQGPQ+DS+QFEK+LR IRSG ESGA L+ GGDR G+ GY+IQPT+FSDV+
Sbjct  370  VGDPFKEGIEQGPQVDSDQFEKILRIIRSGVESGANLKAGGDRFGTTGYYIQPTVFSDVQ  429

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA++EIFGPVQ + KFKD+DEVI+R+NN+ YGLAAG++T ++D ANTL+R L+ GT
Sbjct  430  DDMLIAKEEIFGPVQSIFKFKDLDEVIQRSNNSRYGLAAGIFTHNLDTANTLSRALKVGT  489

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct  490  VWINCYDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTSLKNPAWL  540



>gb|AAL99612.1|AF348416_1 mitochondrial aldehyde dehydrogenase [Arabidopsis thaliana]
Length=534

 Score =   393 bits (1009),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = -3

Query  821  ICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPFK  642
            +C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R VGDPFK
Sbjct  310  VCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRNVGDPFK  369

Query  641  KGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIA  462
             G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK+DM+IA
Sbjct  370  SGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKGYYIQPTVFSDVKDDMLIA  429

Query  461  QDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCY  282
             DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D A+ L R LR GTVWINC+
Sbjct  430  TDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALRVGTVWINCF  489

Query  281  DVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct  490  DVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNPAWL  534



>gb|EMT04899.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Aegilops 
tauschii]
Length=549

 Score =   393 bits (1010),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct  319  GKSPFIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV  378

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID EQF+K+LRYI+SG +SGATL  GGD++G KGY+IQPTIFSDV+
Sbjct  379  VGDPFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGDKLGDKGYYIQPTIFSDVQ  438

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++D ANTL R LRAGT
Sbjct  439  DGMKIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVFTNNLDTANTLTRALRAGT  498

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVT LKNPAW+
Sbjct  499  VWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTALKNPAWL  549



>dbj|BAB92017.1| mitochondrial aldehyde dehydrogenase [Secale cereale]
Length=549

 Score =   393 bits (1010),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct  319  GKSPFIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV  378

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID EQF+K+LRYI+SG +SGATL  GGD++G KGY+IQPTIFSDV+
Sbjct  379  VGDPFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGDKLGDKGYYIQPTIFSDVQ  438

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++D ANTL R LRAGT
Sbjct  439  DGMKIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVFTNNLDTANTLTRALRAGT  498

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            +W+NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVT LKNPAW+
Sbjct  499  IWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTALKNPAWL  549



>gb|AHM26656.1| aldehyde dehydrogenase 2-1 [Zea mays subsp. mays]
Length=549

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RV
Sbjct  319  GKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRV  378

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID EQF K+LRYIR G + GATL  GGDR+G KG++IQPTIFSDV+
Sbjct  379  VGDPFRKGVEQGPQIDDEQFNKILRYIRYGVDGGATLVTGGDRLGDKGFYIQPTIFSDVQ  438

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D ANTL R LRAGT
Sbjct  439  DGMKIAQEEIFGPVQSILKFKDLNEVIKRANASQYGLAAGVFTNSLDTANTLTRALRAGT  498

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGY+MSGIGREKGV SL NYLQVKAVVTP+KN AW+
Sbjct  499  VWVNCFDVFDAAIPFGGYRMSGIGREKGVDSLKNYLQVKAVVTPIKNAAWL  549



>gb|ABK24267.1| unknown [Picea sitchensis]
Length=544

 Score =   392 bits (1008),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE I+DEFVEKAKAR + RV
Sbjct  314  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHESIHDEFVEKAKARCLSRV  373

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID EQF K+LRYI++GKESGA L  GGD+IG+KG++I PTIFS+V+
Sbjct  374  VGDPFRKGVEQGPQIDQEQFNKILRYIKAGKESGAKLVTGGDQIGTKGFYIMPTIFSEVQ  433

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA DEIFGPVQ ++KFK +DEVIKRAN + YGLAAGV+T +I+ ANTL R LR GT
Sbjct  434  DDMAIATDEIFGPVQSIIKFKTLDEVIKRANASRYGLAAGVFTQNIETANTLTRALRVGT  493

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D+FDA IPFGGYKMSG GREKG+YSL NYLQVKAVVTPLKNPAW+
Sbjct  494  VWVNCFDIFDAGIPFGGYKMSGTGREKGIYSLQNYLQVKAVVTPLKNPAWL  544



>ref|XP_004245256.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum lycopersicum]
Length=534

 Score =   392 bits (1006),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 204/231 (88%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE IYDEFVEKAKARA++R 
Sbjct  304  GKSPFIVCEDADVDQAVEFAHFALFFNQGQCCCAGSRTYVHESIYDEFVEKAKARALKRT  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF    EQGPQI SEQFEKVL+YIRSG ESGATLE GGDR+G++GY+I+PT+FS+VK
Sbjct  364  VGDPFDSSNEQGPQISSEQFEKVLKYIRSGIESGATLETGGDRLGTQGYYIKPTVFSNVK  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA DEIFGPVQ +LKFKD DEVI+RAN T YGLAAGV+T +ID ANT  R LR GT
Sbjct  424  DDMLIATDEIFGPVQSILKFKDHDEVIRRANATKYGLAAGVFTKNIDTANTFMRALRVGT  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            +WINC+D+FDA IPFGGYKMSG GREKG YSL  YLQVKAVVT LKNPAW+
Sbjct  484  IWINCFDIFDAAIPFGGYKMSGQGREKGEYSLKQYLQVKAVVTSLKNPAWL  534



>ref|XP_003542700.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Glycine max]
Length=540

 Score =   392 bits (1006),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA++D AVE +HFALFFNQGQCCCAGSRT+VHE IY EFVEKAKARA++RV
Sbjct  310  GKSPFIVCKDADVDAAVEASHFALFFNQGQCCCAGSRTFVHESIYGEFVEKAKARALKRV  369

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQIDS QFEK+++YIRSG ESGA LE GG RIGSKGY+IQPT+FS+V+
Sbjct  370  VGDPFKNGVEQGPQIDSVQFEKIMKYIRSGVESGAQLESGGQRIGSKGYYIQPTVFSNVQ  429

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IA+DEIFGPVQ +LKFKD++EVI+RAN T YGLAAGV+T ++D ANTL R L+AGT
Sbjct  430  DNMLIAKDEIFGPVQSILKFKDLEEVIRRANATSYGLAAGVFTKNMDTANTLMRALQAGT  489

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYKMSG GR +G+YSL +YLQVKAVVT LKNPAW+
Sbjct  490  VWINCYDVFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKAVVTALKNPAWL  540



>ref|XP_010029207.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
Length=532

 Score =   391 bits (1004),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCC AGSRT+VHE +YDEFVEKA+ARAM+RV
Sbjct  302  GKSPFIVCEDADIDKAVELAHFALFFNQGQCCVAGSRTFVHESVYDEFVEKARARAMKRV  361

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQID +QFEK+  YI+SG ESGATLECGG++ GSKG+F+QPT+FS+V+
Sbjct  362  VGDPFKPGVEQGPQIDIKQFEKIRTYIKSGIESGATLECGGEQYGSKGFFVQPTVFSNVQ  421

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IA+DEIFGPVQ + KFKD+DEVI+RAN + YGLAAGV+T +ID ANTLAR L+AG+
Sbjct  422  DNMLIAKDEIFGPVQTISKFKDLDEVIRRANKSRYGLAAGVFTQNIDTANTLARALQAGS  481

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            V INCY VFDA IPFGGYKMSGIGREKGVY LNNYLQVKAVV PLKNPAW+
Sbjct  482  VCINCYHVFDAAIPFGGYKMSGIGREKGVYGLNNYLQVKAVVNPLKNPAWL  532



>ref|XP_006594290.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Glycine max]
Length=537

 Score =   391 bits (1005),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA++D AVE +HFALFFNQGQCCCAGSRT+VHE IY EFVEKAKARA++RV
Sbjct  307  GKSPFIVCKDADVDAAVEASHFALFFNQGQCCCAGSRTFVHESIYGEFVEKAKARALKRV  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQIDS QFEK+++YIRSG ESGA LE GG RIGSKGY+IQPT+FS+V+
Sbjct  367  VGDPFKNGVEQGPQIDSVQFEKIMKYIRSGVESGAQLESGGQRIGSKGYYIQPTVFSNVQ  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IA+DEIFGPVQ +LKFKD++EVI+RAN T YGLAAGV+T ++D ANTL R L+AGT
Sbjct  427  DNMLIAKDEIFGPVQSILKFKDLEEVIRRANATSYGLAAGVFTKNMDTANTLMRALQAGT  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYKMSG GR +G+YSL +YLQVKAVVT LKNPAW+
Sbjct  487  VWINCYDVFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKAVVTALKNPAWL  537



>ref|XP_006656871.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Oryza brachyantha]
Length=549

 Score =   391 bits (1005),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHERIYDEFVEKAKARAM+RV
Sbjct  319  GKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKAKARAMKRV  378

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQID +QF K+LRYI+ G ESGA L  GGDR+G KGY+IQPTIFSDVK
Sbjct  379  VGDPFKNGVEQGPQIDDDQFNKILRYIKYGVESGANLVTGGDRLGDKGYYIQPTIFSDVK  438

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IAQ+EIFGPVQ +LKF D++EVIKRAN + YGLAAGV+T++++ ANTL R LR GT
Sbjct  439  DNMKIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNTANTLTRALRVGT  498

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYK SGIGREKG+ SL NYLQVKAVVTPLKN AW+
Sbjct  499  VWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPLKNAAWL  549



>gb|KCW56067.1| hypothetical protein EUGRSUZ_I01824, partial [Eucalyptus grandis]
Length=511

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA+ID+AVE AHFALFFNQGQCC AGSRT+VHE +YDEFVEKA+ARAM+RV
Sbjct  281  GKSPFIVCEDADIDKAVELAHFALFFNQGQCCVAGSRTFVHESVYDEFVEKARARAMKRV  340

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQID +QFEK+  YI+SG ESGATLECGG++ GSKG+F+QPT+FS+V+
Sbjct  341  VGDPFKPGVEQGPQIDIKQFEKIRTYIKSGIESGATLECGGEQYGSKGFFVQPTVFSNVQ  400

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IA+DEIFGPVQ + KFKD+DEVI+RAN + YGLAAGV+T +ID ANTLAR L+AG+
Sbjct  401  DNMLIAKDEIFGPVQTISKFKDLDEVIRRANKSRYGLAAGVFTQNIDTANTLARALQAGS  460

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            V INCY VFDA IPFGGYKMSGIGREKGVY LNNYLQVKAVV PLKNPAW+
Sbjct  461  VCINCYHVFDAAIPFGGYKMSGIGREKGVYGLNNYLQVKAVVNPLKNPAWL  511



>gb|KDO82491.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=328

 Score =   383 bits (984),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+A E AH+ALFFNQGQCCCAGSRT+VHE +YD+FVEKA A AM+RV
Sbjct  98   GKSPFIVCEDADVDKAAELAHYALFFNQGQCCCAGSRTFVHESVYDQFVEKANALAMKRV  157

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+KGY+I+PT+F+ VK
Sbjct  158  VGDPFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVK  217

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++D ANTL R LR G+
Sbjct  218  DDMLIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGS  277

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LKNPAW+
Sbjct  278  VWINCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALKNPAWL  328



>ref|XP_008389628.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Malus domestica]
Length=534

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEF+EKAK RA RR+
Sbjct  304  GKSPFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKAKGRAERRL  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDS+QFEK+L+YI  G ++GA LE GG+R+G+KG++I+PT+FSDVK
Sbjct  364  VGDPFKGGIEQGPQIDSDQFEKILKYIDYGVKAGAKLETGGERVGTKGFYIKPTVFSDVK  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA +EIFGPVQ +LK+KD++EVI+RANN+ YGLAAGV+T +ID ANTL R LR G+
Sbjct  424  DDMRIASEEIFGPVQTILKYKDLNEVIRRANNSRYGLAAGVFTQNIDTANTLTRALRVGS  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            V+INC+DVFDA+IPFGGYKMSGIGREKG+Y L+NYLQVKAVVTPLKNPAW+
Sbjct  484  VFINCFDVFDASIPFGGYKMSGIGREKGIYGLSNYLQVKAVVTPLKNPAWL  534



>ref|XP_004965205.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Setaria italica]
Length=549

 Score =   390 bits (1003),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPF+I DDA++D AVE AHFALFFNQGQCCCAGSRT+VHERIYDEFVEK+KARA++RV
Sbjct  319  GKSPFVIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKSKARALKRV  378

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID EQF K+LRYIRSG +SGATL  GGDR+G KG++IQPTIFSDV+
Sbjct  379  VGDPFRKGVEQGPQIDDEQFNKILRYIRSGVDSGATLVTGGDRLGDKGFYIQPTIFSDVQ  438

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ +LKFKD++EVI+RAN + YGLAAGV+T  +D ANTL R LR GT
Sbjct  439  DGMKIAQEEIFGPVQSILKFKDLNEVIERANASQYGLAAGVFTKSLDTANTLTRALRVGT  498

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYK SGIGREKGV SL NYLQVKAVVTP+KN AW+
Sbjct  499  VWVNCFDVFDAGIPFGGYKQSGIGREKGVDSLKNYLQVKAVVTPIKNAAWL  549



>gb|AAK58370.1|AF269064_1 T-cytoplasm male sterility restorer factor 2 [Zea mays]
Length=549

 Score =   390 bits (1003),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKS FII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RV
Sbjct  319  GKSSFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRV  378

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID EQF+K+LRYIR G + GATL  GGDR+G KG++IQPTIFSDV+
Sbjct  379  VGDPFRKGVEQGPQIDDEQFKKILRYIRYGVDGGATLVTGGDRLGDKGFYIQPTIFSDVQ  438

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D ANTL R LRAGT
Sbjct  439  DGMKIAQEEIFGPVQSILKFKDLNEVIKRANASQYGLAAGVFTNSLDTANTLTRALRAGT  498

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYKMSG+GREKGV SL NYLQVKAVVTP+KN AW+
Sbjct  499  VWVNCFDVFDAAIPFGGYKMSGMGREKGVDSLKNYLQVKAVVTPIKNAAWL  549



>gb|KHG06517.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Gossypium 
arboreum]
Length=531

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA++D+AVE AH ALFFNQGQCCCAGSRT VHE +YDEFVEKAKARA++RV
Sbjct  301  GKSPFIVCKDADVDKAVELAHSALFFNQGQCCCAGSRTLVHESVYDEFVEKAKARALKRV  360

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQID+EQF+K+L+YIRSG ESGATLE GG++ GSKGY+IQPT+FS+V+
Sbjct  361  VGDPFKMGIEQGPQIDNEQFKKILKYIRSGIESGATLESGGEQFGSKGYYIQPTVFSNVQ  420

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ + KFKD++EV++RAN + YGLAAGV+T +I+ ANTL R LR GT
Sbjct  421  DDMLIAKDEIFGPVQSISKFKDLEEVVQRANASSYGLAAGVFTQNIETANTLTRALRVGT  480

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYD+FDA +PFGG+KMSG GREKG+Y L++YLQVKAVVTPLKNPAW+
Sbjct  481  VWINCYDIFDAAVPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKNPAWL  531



>gb|KJB11461.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=530

 Score =   389 bits (1000),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA++D+AVE AH ALFFNQGQCCCAGSRT VHE +YDEFVEKAKARA++RV
Sbjct  300  GKSPFIVCKDADVDKAVELAHSALFFNQGQCCCAGSRTLVHESVYDEFVEKAKARALKRV  359

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQID+EQF+K+L+YIRSG ESGATLE GG++ GSKGY+IQPT+FS+V+
Sbjct  360  VGDPFKTGIEQGPQIDNEQFKKILKYIRSGIESGATLESGGEQFGSKGYYIQPTVFSNVQ  419

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ + KFKD++EV++RAN + YGLAAGV+T +I+ ANTL R LR GT
Sbjct  420  DDMLIAKDEIFGPVQSISKFKDLEEVVQRANASSYGLAAGVFTQNIETANTLTRALRVGT  479

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYD+FDA +PFGG+KMSG GREKG+Y L++YLQVKAVVTPLKNPAW+
Sbjct  480  VWINCYDIFDAAVPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKNPAWL  530



>ref|XP_010498885.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   389 bits (998),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA  R 
Sbjct  304  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAANRA  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQ+DSEQF+K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK
Sbjct  364  VGDPFKSGIEQGPQVDSEQFKKILKYIKHGVEAGATLQTGGDRLGSKGYYIQPTVFSDVK  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLA+GV+T ++D AN L R LR GT
Sbjct  424  DDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLASGVFTQNLDTANRLMRALRVGT  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DV DATIPFGGYKMSGIGREKG+YSL+NYLQVKAVVT LKNPAW+
Sbjct  484  VWINCFDVLDATIPFGGYKMSGIGREKGLYSLSNYLQVKAVVTALKNPAWL  534



>dbj|BAB92018.1| mitochondrial aldehyde dehydrogenase [Sorghum bicolor]
Length=551

 Score =   389 bits (999),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPF++ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct  321  GKSPFVVMDDADVDQAVELAHQAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV  380

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+ GVEQGPQID +QF K+LRY++SG +SGATL  GGDR+GS+G++IQPT+F+D K
Sbjct  381  VGDPFRNGVEQGPQIDGDQFNKILRYVQSGVDSGATLVTGGDRVGSRGFYIQPTVFADAK  440

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA++EIFGPVQ +LKF  ++EVI+RAN THYGLAAGV+T  +D ANTL+R LRAGT
Sbjct  441  DDMKIAREEIFGPVQTILKFSGMEEVIRRANATHYGLAAGVFTRSLDAANTLSRALRAGT  500

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYDVFDATIPFGGYKMSG+GREKGVY+L NYLQ KAVVTP+K+PAW+
Sbjct  501  VWVNCYDVFDATIPFGGYKMSGVGREKGVYALRNYLQTKAVVTPIKDPAWL  551



>ref|XP_003563967.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Brachypodium distachyon]
Length=548

 Score =   388 bits (997),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFII DDA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct  318  GKSPFIIMDDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV  377

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID EQF K+LRYI+SG +SGATL  GGD++G KGY+IQPTIFSDV+
Sbjct  378  VGDPFRKGVEQGPQIDDEQFNKILRYIKSGVDSGATLVTGGDKLGDKGYYIQPTIFSDVQ  437

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++  ANTL R LRAGT
Sbjct  438  DGMKIAQEEIFGPVQSIFKFNDLNEVIKRANASRYGLAAGVFTNNLGTANTLTRALRAGT  497

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQ KAVVTP+KN AW+
Sbjct  498  VWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQTKAVVTPIKNAAWL  548



>ref|XP_004509835.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=538

 Score =   388 bits (997),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AH ALFFNQGQCCCAGSRT+VHE +YDEFVEKAKARA++R 
Sbjct  308  GKSPFIVCEDADVDQAVELAHSALFFNQGQCCCAGSRTFVHESVYDEFVEKAKARALKRA  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G EQGPQIDS+QFEK+L+YI+SG E+GATLE GG+R+GSKG++IQPT+FS+V+
Sbjct  368  VGDPFKSGTEQGPQIDSKQFEKILKYIKSGVENGATLETGGERLGSKGFYIQPTVFSNVQ  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +D +IA++EIFGPVQ +LKFKD+ EVI+RANNT YGLAAG++T +ID ANTL R L+ G+
Sbjct  428  DDHLIAKEEIFGPVQSILKFKDLGEVIQRANNTEYGLAAGIFTKNIDTANTLTRALKVGS  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D+ DA IPFGGYKMSG GREKG YSL NYLQVKAVV PLKNPAW+
Sbjct  488  VWVNCFDILDAAIPFGGYKMSGHGREKGEYSLKNYLQVKAVVIPLKNPAWL  538



>gb|KDO82489.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
 gb|KDO82490.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=378

 Score =   382 bits (982),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+A E AH+ALFFNQGQCCCAGSRT+VHE +YD+FVEKA A AM+RV
Sbjct  148  GKSPFIVCEDADVDKAAELAHYALFFNQGQCCCAGSRTFVHESVYDQFVEKANALAMKRV  207

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+KGY+I+PT+F+ VK
Sbjct  208  VGDPFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVK  267

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++D ANTL R LR G+
Sbjct  268  DDMLIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGS  327

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LKNPAW+
Sbjct  328  VWINCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALKNPAWL  378



>ref|XP_004509834.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=539

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AH ALFFNQGQCCCAGSRT+VHE +YDEFVEKAKARA++R 
Sbjct  309  GKSPFIVCEDADVDQAVELAHSALFFNQGQCCCAGSRTFVHESVYDEFVEKAKARALKRA  368

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G EQGPQIDS+QFEK+L+YI+SG E+GATLE GG+R+GSKG++IQPT+FS+V+
Sbjct  369  VGDPFKSGTEQGPQIDSKQFEKILKYIKSGVENGATLETGGERLGSKGFYIQPTVFSNVQ  428

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +D +IA++EIFGPVQ +LKFKD+ EVI+RANNT YGLAAG++T +ID ANTL R L+ G+
Sbjct  429  DDHLIAKEEIFGPVQSILKFKDLGEVIQRANNTEYGLAAGIFTKNIDTANTLTRALKVGS  488

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+D+ DA IPFGGYKMSG GREKG YSL NYLQVKAVV PLKNPAW+
Sbjct  489  VWVNCFDILDAAIPFGGYKMSGHGREKGEYSLKNYLQVKAVVIPLKNPAWL  539



>ref|XP_006647839.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Oryza brachyantha]
Length=551

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RV
Sbjct  321  GKSPFIVMDDADVDQAVELAHRALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALQRV  380

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF++GVEQGPQID EQF+K+LRY++SG ESGATL  GGDR GS+G++IQPT+F+DV+
Sbjct  381  VGDPFRRGVEQGPQIDGEQFKKILRYVKSGVESGATLVAGGDRAGSRGFYIQPTVFADVE  440

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IAQDEIFGPVQ +LKF  ++EV++RAN T YGLAAGV+T  +D ANTLAR LR GT
Sbjct  441  DEMTIAQDEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTRRLDAANTLARALRVGT  500

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYDVFDA IPFGGYKMSG+GREKG YSL NYLQ KAVVTP+K+ AW+
Sbjct  501  VWVNCYDVFDAAIPFGGYKMSGVGREKGFYSLRNYLQTKAVVTPVKDAAWL  551



>ref|XP_009363532.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=534

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEF+EK+KARA RR+
Sbjct  304  GKSPFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKSKARAERRL  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDS+QFEK+L+YI  G ++GA LE GG+R+G+KG++I+PT+FSDV+
Sbjct  364  VGDPFKGGIEQGPQIDSDQFEKILKYIDYGVKAGAKLETGGERVGTKGFYIKPTVFSDVQ  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA +EIFGPVQ +LK+KD++EVI+RANN+ YGLAAGV+T +ID ANTL R LR G+
Sbjct  424  DDMRIACEEIFGPVQTILKYKDLNEVIQRANNSRYGLAAGVFTQNIDTANTLTRALRVGS  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            V+INC+DVFDA+IPFGGYKMSGIGREKG+Y L+NYLQVKAVVTPLKNPAW+
Sbjct  484  VFINCFDVFDASIPFGGYKMSGIGREKGIYGLSNYLQVKAVVTPLKNPAWL  534



>ref|XP_011003158.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Populus euphratica]
Length=540

 Score =   387 bits (994),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPF++C+DA++D+AVE +H A+FFNQGQCCCAGSRT+VHER+Y+EFVEKAKARA++R 
Sbjct  310  GKSPFVVCEDADVDQAVELSHSAVFFNQGQCCCAGSRTFVHERVYNEFVEKAKARAIQRT  369

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF++G+EQGPQ+DS+QFEK+LR IRSG ESGA L+ GGDR G+ GY+IQPT+FSDV+
Sbjct  370  VGDPFREGIEQGPQVDSDQFEKILRLIRSGVESGANLKAGGDRFGTTGYYIQPTVFSDVQ  429

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA++EIFGPVQ + KFKD+DEVI+R+NN+ YGLAAG++T ++D ANTL+R L+ GT
Sbjct  430  DDMLIAKEEIFGPVQSIFKFKDLDEVIQRSNNSRYGLAAGIFTHNLDTANTLSRALKVGT  489

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYKMSG GREKG+YSL+NYLQVKAVVT L NPAW+
Sbjct  490  VWINCYDVFDAGIPFGGYKMSGNGREKGIYSLSNYLQVKAVVTSLNNPAWL  540



>ref|XP_010460154.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Camelina sativa]
Length=534

 Score =   387 bits (993),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA  R 
Sbjct  304  GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAANRA  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF  G+EQGPQ+DSEQF+K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK
Sbjct  364  VGDPFNSGIEQGPQVDSEQFKKILKYIKYGVEAGATLQTGGDRLGSKGYYIQPTVFSDVK  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLA+GV+T ++D AN L R LR GT
Sbjct  424  DDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLASGVFTQNLDTANRLMRALRVGT  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DV DATIPFGGYKMSGIGREKG+YSL+NYLQVKAVVT LKNPAW+
Sbjct  484  VWINCFDVLDATIPFGGYKMSGIGREKGLYSLSNYLQVKAVVTALKNPAWL  534



>ref|XP_004139235.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=538

 Score =   387 bits (993),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE+++DEFVEKA+ RA  RV
Sbjct  308  GKSPFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVHDEFVEKARNRAANRV  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF  G+EQGPQ+D+EQF+K+L+YI+ G E GATLE GGDR GSKGY++QPT+FS+VK
Sbjct  368  VGDPFLGGIEQGPQVDAEQFKKILKYIKYGIEGGATLEAGGDRFGSKGYYVQPTVFSNVK  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA+DEIFGPVQ +LK+KDIDEVI+RAN + YGLAAGV+T +I+ AN L R LR G+
Sbjct  428  DDMKIAEDEIFGPVQTILKYKDIDEVIRRANASRYGLAAGVFTQNINTANRLTRSLRVGS  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA +PFGGYKMSG GREKG+YSL+NYLQVKAVVTPL+NPAW+
Sbjct  488  VWINCFDVFDAAVPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLENPAWL  538



>ref|XP_004156463.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=540

 Score =   387 bits (993),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE+++DEFVEKA+ RA  RV
Sbjct  310  GKSPFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVHDEFVEKARNRAANRV  369

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF  G+EQGPQ+D+EQF+K+L+YI+ G E GATLE GGDR GSKGY++QPT+FS+VK
Sbjct  370  VGDPFLGGIEQGPQVDAEQFKKILKYIKYGIEGGATLEAGGDRFGSKGYYVQPTVFSNVK  429

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA+DEIFGPVQ +LK+KDIDEVI+RAN + YGLAAGV+T +I+ AN L R LR G+
Sbjct  430  DDMKIAEDEIFGPVQTILKYKDIDEVIRRANASRYGLAAGVFTQNINTANRLTRSLRVGS  489

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA +PFGGYKMSG GREKG+YSL+NYLQVKAVVTPL+NPAW+
Sbjct  490  VWINCFDVFDAAVPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLENPAWL  540



>gb|KDO82486.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
 gb|KDO82487.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
 gb|KDO82488.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=423

 Score =   382 bits (982),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+A E AH+ALFFNQGQCCCAGSRT+VHE +YD+FVEKA A AM+RV
Sbjct  193  GKSPFIVCEDADVDKAAELAHYALFFNQGQCCCAGSRTFVHESVYDQFVEKANALAMKRV  252

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+KGY+I+PT+F+ VK
Sbjct  253  VGDPFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVK  312

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++D ANTL R LR G+
Sbjct  313  DDMLIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGS  372

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LKNPAW+
Sbjct  373  VWINCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALKNPAWL  423



>ref|NP_001105576.1| aldehyde dehydrogenase2 [Zea mays]
 gb|AAL99613.1|AF348417_1 mitochondrial aldehyde dehydrogenase RF2B [Zea mays]
Length=550

 Score =   387 bits (993),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct  320  GKSPFIVMDDADVDQAVELAHQAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV  379

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+ GVEQGPQID EQF K+LRY++SG +SGATL  GGDR+G +G++IQPT+F+D K
Sbjct  380  VGDPFRDGVEQGPQIDGEQFNKILRYVQSGVDSGATLVAGGDRVGDRGFYIQPTVFADAK  439

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D ANTL+R LRAGT
Sbjct  440  DEMKIAREEIFGPVQTILKFSGVEEVIRRANATPYGLAAGVFTRSLDAANTLSRALRAGT  499

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYDVFDATIPFGGYKMSG+GREKG+Y+L NYLQ KAVVTP+KNPAW+
Sbjct  500  VWVNCYDVFDATIPFGGYKMSGVGREKGIYALRNYLQTKAVVTPIKNPAWL  550



>ref|NP_001057358.1| Os06g0270900 [Oryza sativa Japonica Group]
 dbj|BAB19052.1| aldehyde dehydrogenase ALDH2b [Oryza sativa Japonica Group]
 dbj|BAD54414.1| aldehyde dehydrogenase ALDH2b [Oryza sativa Japonica Group]
 dbj|BAF19272.1| Os06g0270900 [Oryza sativa Japonica Group]
 gb|EAZ36586.1| hypothetical protein OsJ_20928 [Oryza sativa Japonica Group]
 dbj|BAG93278.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94020.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99957.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AJB98432.1| aldehyde dehydrogenase, partial [Oryza sativa]
Length=549

 Score =   387 bits (993),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHERIYDEFVEKAKARA++RV
Sbjct  319  GKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKAKARALKRV  378

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQID EQF K+LRYI+ G +SGA L  GGDR+G KGY+IQPTIFSDV+
Sbjct  379  VGDPFKNGVEQGPQIDDEQFNKILRYIKYGVDSGANLVTGGDRLGDKGYYIQPTIFSDVQ  438

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IAQ+EIFGPVQ +LKF D++EVIKRAN + YGLAAGV+T++++ ANTL R LR GT
Sbjct  439  DNMRIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNTANTLTRALRVGT  498

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYK SGIGREKG+ SL NYLQVKAVVTP+KN AW+
Sbjct  499  VWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPIKNAAWL  549



>gb|EAZ00462.1| hypothetical protein OsI_22484 [Oryza sativa Indica Group]
Length=549

 Score =   387 bits (993),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHERIYDEFVEKAKARA++RV
Sbjct  319  GKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKAKARALKRV  378

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQID EQF K+LRYI+ G +SGA L  GGDR+G KGY+IQPTIFSDV+
Sbjct  379  VGDPFKNGVEQGPQIDDEQFNKILRYIKYGVDSGANLVTGGDRLGDKGYYIQPTIFSDVQ  438

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IAQ+EIFGPVQ +LKF D++EVIKRAN + YGLAAGV+T++++ ANTL R LR GT
Sbjct  439  DNMRIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNTANTLTRALRVGT  498

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYK SGIGREKG+ SL NYLQVKAVVTP+KN AW+
Sbjct  499  VWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPIKNAAWL  549



>gb|AAF73828.1|AF162665_1 aldehyde dehydrogenase [Oryza sativa]
Length=549

 Score =   387 bits (993),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHERIYDEFVEKAKARA++RV
Sbjct  319  GKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKAKARALKRV  378

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQID EQF K+LRYI+ G +SGA L  GGDR+G KGY+IQPTIFSDV+
Sbjct  379  VGDPFKNGVEQGPQIDDEQFNKILRYIKYGVDSGANLVTGGDRLGDKGYYIQPTIFSDVQ  438

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IAQ+EIFGPVQ +LKF D++EVIKRAN + YGLAAGV+T++++ ANTL R LR GT
Sbjct  439  DNMRIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNTANTLTRALRVGT  498

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGYK SGIGREKG+ SL NYLQVKAVVTP+KN AW+
Sbjct  499  VWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPIKNAAWL  549



>gb|ACG32898.1| aldehyde dehydrogenase [Zea mays]
Length=550

 Score =   387 bits (993),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct  320  GKSPFIVMDDADVDQAVELAHQAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV  379

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+ GVEQGPQID EQF K+LRY++SG +SGATL  GGDR+G +G++IQPT+F+D K
Sbjct  380  VGDPFRDGVEQGPQIDGEQFNKILRYVQSGVDSGATLVAGGDRVGERGFYIQPTVFADAK  439

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D ANTL+R LRAGT
Sbjct  440  DEMKIAREEIFGPVQTILKFSGVEEVIRRANATPYGLAAGVFTRSLDAANTLSRALRAGT  499

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYDVFDATIPFGGYKMSG+GREKG+Y+L NYLQ KAVVTP+KNPAW+
Sbjct  500  VWVNCYDVFDATIPFGGYKMSGVGREKGIYALRNYLQTKAVVTPIKNPAWL  550



>gb|AAL99614.2|AF348418_1 mitochondrial aldehyde dehydrogenase RF2B [Zea mays]
 gb|AFW63789.1| aldehyde dehydrogenase [Zea mays]
Length=550

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct  320  GKSPFIVMDDADVDQAVELAHQAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV  379

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+ GVEQGPQID EQF K+LRY++SG +SGATL  GGDR+G +G++IQPT+F+D K
Sbjct  380  VGDPFRDGVEQGPQIDGEQFNKILRYVQSGVDSGATLVAGGDRVGDRGFYIQPTVFADAK  439

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D ANTL+R LRAGT
Sbjct  440  DEMKIAREEIFGPVQTILKFSGVEEVIRRANATPYGLAAGVFTRSLDAANTLSRALRAGT  499

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYDVFDATIPFGGYKMSG+GREKG+Y+L NYLQ KAVVTP+KNPAW+
Sbjct  500  VWVNCYDVFDATIPFGGYKMSGVGREKGIYALRNYLQTKAVVTPIKNPAWL  550



>gb|KGN60807.1| hypothetical protein Csa_2G010420 [Cucumis sativus]
Length=592

 Score =   387 bits (993),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE+++DEFVEKA+ RA  RV
Sbjct  362  GKSPFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVHDEFVEKARNRAANRV  421

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF  G+EQGPQ+D+EQF+K+L+YI+ G E GATLE GGDR GSKGY++QPT+FS+VK
Sbjct  422  VGDPFLGGIEQGPQVDAEQFKKILKYIKYGIEGGATLEAGGDRFGSKGYYVQPTVFSNVK  481

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA+DEIFGPVQ +LK+KDIDEVI+RAN + YGLAAGV+T +I+ AN L R LR G+
Sbjct  482  DDMKIAEDEIFGPVQTILKYKDIDEVIRRANASRYGLAAGVFTQNINTANRLTRSLRVGS  541

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA +PFGGYKMSG GREKG+YSL+NYLQVKAVVTPL+NPAW+
Sbjct  542  VWINCFDVFDAAVPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLENPAWL  592



>gb|KHN47185.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=538

 Score =   384 bits (987),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 206/231 (89%), Gaps = 2/231 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA++D AVE +HFALFFNQGQCCCAGSRT+VHE IY EFVEKAKARA++RV
Sbjct  310  GKSPFIVCKDADVDAAVEASHFALFFNQGQCCCAGSRTFVHESIYGEFVEKAKARALKRV  369

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQIDS QFEK+++YIRSG ESGA LE GG RIGSKGY+IQPT+FS+  
Sbjct  370  VGDPFKNGVEQGPQIDSVQFEKIMKYIRSGVESGAQLESGGQRIGSKGYYIQPTVFSN--  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IA+DEIFGPVQ +LKFKD++EVI+RAN T YGLAAGV+T ++D ANTL R L+AGT
Sbjct  428  DNMLIAKDEIFGPVQSILKFKDLEEVIRRANATSYGLAAGVFTKNMDTANTLMRALQAGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYKMSG GR +G+YSL +YLQVKAVVT LKNPAW+
Sbjct  488  VWINCYDVFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKAVVTALKNPAWL  538



>gb|AHM26657.1| aldehyde dehydrogenase 2-2 [Zea mays subsp. mays]
Length=550

 Score =   384 bits (987),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct  320  GKSPFIVMDDADVDQAVELAHQAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV  379

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+ GVEQGPQID EQF K+LRY++SG +SGATL  GGDR+G +G++IQP +F+D K
Sbjct  380  VGDPFRDGVEQGPQIDGEQFNKILRYVQSGVDSGATLVAGGDRVGDRGFYIQPMVFADAK  439

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D ANTL+R LRAGT
Sbjct  440  DEMKIAREEIFGPVQTILKFSGVEEVIRRANATPYGLAAGVFTRSLDAANTLSRALRAGT  499

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYDVFDATIPFGGYKMSG+GREKG+Y+L NYLQ KAVVTP+KNPAW+
Sbjct  500  VWVNCYDVFDATIPFGGYKMSGVGREKGIYALRNYLQTKAVVTPIKNPAWL  550



>ref|XP_002274863.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Vitis vinifera]
 emb|CBI34947.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   384 bits (985),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE +H ALF+NQGQ CC+GSRT+VHE IYDEF+EKAKARA++RV
Sbjct  305  GKSPFIVCEDADVDKAVELSHTALFYNQGQSCCSGSRTFVHESIYDEFIEKAKARALKRV  364

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDS+QF K+L YI+SG E+GATLE GG++  SKGY+IQPT+FS+V 
Sbjct  365  VGDPFKKGVEQGPQIDSQQFNKILGYIKSGIEAGATLEAGGEKFSSKGYYIQPTVFSNVH  424

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M+IA++EIFGPVQ +LKFKD+DEVI+RAN THYGLAAG++T ++D ANTL R LR GT
Sbjct  425  DNMLIAKEEIFGPVQSILKFKDLDEVIRRANATHYGLAAGIFTQNLDTANTLTRALRVGT  484

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+ VFDA IPFGG KMSG GREKG+Y L+NY+QVKAVVTPLKNPAW+
Sbjct  485  VWINCFFVFDAAIPFGGRKMSGHGREKGIYGLSNYMQVKAVVTPLKNPAWL  535



>ref|XP_008456004.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Cucumis melo]
Length=537

 Score =   384 bits (985),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEF+EKA+ RA  RV
Sbjct  307  GKSPFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKARNRAANRV  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF  G+EQGPQ+D EQF+K+L+YI+ G E GATLE GG+R GSKGY++QPT+FS+VK
Sbjct  367  VGDPFLGGIEQGPQVDGEQFKKILKYIKYGIEGGATLEAGGERFGSKGYYVQPTVFSNVK  426

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IAQ+EIFGPVQ +LK+KD+DEVI+RAN + YGLAAGV+T +I+ AN L R LR G+
Sbjct  427  DDMKIAQEEIFGPVQTILKYKDMDEVIRRANASRYGLAAGVFTQNINTANRLTRSLRVGS  486

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+D+FDA +PFGGYKMSG GREKG+YSL+NYLQVKAVVTPL+NPAW+
Sbjct  487  VWINCFDIFDAAVPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLENPAWL  537



>gb|KDO82484.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=493

 Score =   382 bits (980),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+A E AH+ALFFNQGQCCCAGSRT+VHE +YD+FVEKA A AM+RV
Sbjct  263  GKSPFIVCEDADVDKAAELAHYALFFNQGQCCCAGSRTFVHESVYDQFVEKANALAMKRV  322

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+KGY+I+PT+F+ VK
Sbjct  323  VGDPFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVK  382

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++D ANTL R LR G+
Sbjct  383  DDMLIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGS  442

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LKNPAW+
Sbjct  443  VWINCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALKNPAWL  493



>ref|XP_009391259.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=532

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 203/231 (88%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP I+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RV
Sbjct  302  GKSPMIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAIKRV  361

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF KGVEQGPQID EQF K+L YI+SG E GATL  GG R G+KGY+IQPTIF+DV+
Sbjct  362  VGDPFIKGVEQGPQIDEEQFSKILHYIKSGVEDGATLVTGGTRAGTKGYYIQPTIFTDVQ  421

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ +LKFKD++EVI+R+N T YGLAAGV+T+++  ANTL R LR G+
Sbjct  422  DGMKIAQEEIFGPVQSILKFKDLNEVIQRSNKTRYGLAAGVFTNNLHTANTLMRALRVGS  481

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPL NPAW+
Sbjct  482  VWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLNNPAWL  532



>ref|XP_006438422.1| hypothetical protein CICLE_v10031155mg [Citrus clementina]
 ref|XP_006483828.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Citrus sinensis]
 gb|ESR51662.1| hypothetical protein CICLE_v10031155mg [Citrus clementina]
Length=546

 Score =   382 bits (981),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+A E AH+ALFFNQGQCCCAGSRT+VHE +YD+FVEKA A AM+RV
Sbjct  316  GKSPFIVCEDADVDKAAELAHYALFFNQGQCCCAGSRTFVHESVYDQFVEKANALAMKRV  375

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+KGY+I+PT+F+ VK
Sbjct  376  VGDPFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVK  435

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++D ANTL R LR G+
Sbjct  436  DDMLIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGS  495

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LKNPAW+
Sbjct  496  VWINCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALKNPAWL  546



>dbj|BAD15920.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAD16359.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAG99615.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score =   378 bits (970),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEKA+ARA++RV
Sbjct  191  GKSPFIVMDDADVDQAVELAHRALFFNQGQCCCAGSRTFVHERVYDEFVEKARARALQRV  250

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+ GVEQGPQID EQF+K+L+Y++SG +SGATL  GGDR GS+G++IQPT+F+DV+
Sbjct  251  VGDPFRTGVEQGPQIDGEQFKKILQYVKSGVDSGATLVAGGDRAGSRGFYIQPTVFADVE  310

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IAQ+EIFGPVQ +LKF  ++EV++RAN T YGLAAGV+T  +D ANTLAR LR GT
Sbjct  311  DEMKIAQEEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTQRLDAANTLARALRVGT  370

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+N YDVFDA +PFGGYKMSG+GREKGVYSL NYLQ KAVVTP+K+ AW+
Sbjct  371  VWVNTYDVFDAAVPFGGYKMSGVGREKGVYSLRNYLQTKAVVTPIKDAAWL  421



>ref|XP_009391258.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=534

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 203/231 (88%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP I+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RV
Sbjct  304  GKSPMIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAIKRV  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF KGVEQGPQID EQF K+L YI+SG E GATL  GG R G+KGY+IQPTIF+DV+
Sbjct  364  VGDPFIKGVEQGPQIDEEQFSKILHYIKSGVEDGATLVTGGTRAGTKGYYIQPTIFTDVQ  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ +LKFKD++EVI+R+N T YGLAAGV+T+++  ANTL R LR G+
Sbjct  424  DGMKIAQEEIFGPVQSILKFKDLNEVIQRSNKTRYGLAAGVFTNNLHTANTLMRALRVGS  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPL NPAW+
Sbjct  484  VWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLNNPAWL  534



>gb|KDO82485.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=546

 Score =   382 bits (981),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+A E AH+ALFFNQGQCCCAGSRT+VHE +YD+FVEKA A AM+RV
Sbjct  316  GKSPFIVCEDADVDKAAELAHYALFFNQGQCCCAGSRTFVHESVYDQFVEKANALAMKRV  375

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+KGY+I+PT+F+ VK
Sbjct  376  VGDPFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVK  435

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM+IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++D ANTL R LR G+
Sbjct  436  DDMLIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGS  495

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LKNPAW+
Sbjct  496  VWINCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALKNPAWL  546



>ref|XP_009391257.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=539

 Score =   381 bits (979),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 203/231 (88%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP I+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RV
Sbjct  309  GKSPMIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAIKRV  368

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF KGVEQGPQID EQF K+L YI+SG E GATL  GG R G+KGY+IQPTIF+DV+
Sbjct  369  VGDPFIKGVEQGPQIDEEQFSKILHYIKSGVEDGATLVTGGTRAGTKGYYIQPTIFTDVQ  428

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ +LKFKD++EVI+R+N T YGLAAGV+T+++  ANTL R LR G+
Sbjct  429  DGMKIAQEEIFGPVQSILKFKDLNEVIQRSNKTRYGLAAGVFTNNLHTANTLMRALRVGS  488

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPL NPAW+
Sbjct  489  VWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLNNPAWL  539



>ref|XP_009391256.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=541

 Score =   381 bits (978),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 203/231 (88%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP I+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RV
Sbjct  311  GKSPMIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAIKRV  370

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF KGVEQGPQID EQF K+L YI+SG E GATL  GG R G+KGY+IQPTIF+DV+
Sbjct  371  VGDPFIKGVEQGPQIDEEQFSKILHYIKSGVEDGATLVTGGTRAGTKGYYIQPTIFTDVQ  430

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ +LKFKD++EVI+R+N T YGLAAGV+T+++  ANTL R LR G+
Sbjct  431  DGMKIAQEEIFGPVQSILKFKDLNEVIQRSNKTRYGLAAGVFTNNLHTANTLMRALRVGS  490

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPL NPAW+
Sbjct  491  VWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLNNPAWL  541



>ref|XP_004953799.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X2 [Setaria italica]
Length=548

 Score =   381 bits (978),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA +RV
Sbjct  318  GKSPFIVMDDADVDQAVELAHHAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARAQKRV  377

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+ GVEQGPQID EQF+K+LRY++SG +SGATL  GGDR GS+G++IQPT+F+D K
Sbjct  378  VGDPFRNGVEQGPQIDEEQFKKILRYVQSGVDSGATLVAGGDRAGSRGFYIQPTVFADAK  437

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D ANTL+R LRAGT
Sbjct  438  DEMKIAREEIFGPVQTILKFSGVEEVIRRANATQYGLAAGVFTRSLDAANTLSRALRAGT  497

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYDVFDA IPFGGYKMSG+GREKGVY+L NYLQ KAVVTP++N AW+
Sbjct  498  VWVNCYDVFDAGIPFGGYKMSGVGREKGVYALRNYLQTKAVVTPIRNAAWL  548



>emb|CBI16844.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 199/231 (86%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP I+C+DAN+D AVE AHFALFFNQ QCC A SRT+VHE IYDEFVEKAK RA+RR 
Sbjct  158  GKSPVIVCEDANVDEAVELAHFALFFNQWQCCAACSRTFVHESIYDEFVEKAKTRALRRT  217

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            +G+PFK G+EQGPQIDS+QFEK+LRYIRSG E+  TLE GG+R G++G+FI+PT+FS+V+
Sbjct  218  IGNPFKAGIEQGPQIDSDQFEKILRYIRSGVENAGTLETGGERFGNEGFFIKPTVFSNVQ  277

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M+IAQDEIFGPVQ +LKFKD+DEVI+RAN   YGLAAGV+T ++D  NTL R LR GT
Sbjct  278  DGMLIAQDEIFGPVQSILKFKDLDEVIRRANAASYGLAAGVFTQNLDTTNTLTRALRVGT  337

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NC+DVFDA IPFGGY MSG GREKG+YSL NYLQVKAV+  LKNPAW+
Sbjct  338  VWVNCFDVFDAAIPFGGYTMSGHGREKGMYSLQNYLQVKAVIASLKNPAWL  388



>ref|XP_002970420.1| hypothetical protein SELMODRAFT_231526 [Selaginella moellendorffii]
 gb|EFJ28550.1| hypothetical protein SELMODRAFT_231526 [Selaginella moellendorffii]
Length=488

 Score =   378 bits (970),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFII  DA+ID+AVE +HFALFFNQGQCCCAGSRT+VHE IYDE++EKAKARA++RV
Sbjct  258  GKSPFIIMPDADIDQAVELSHFALFFNQGQCCCAGSRTFVHESIYDEYIEKAKARALKRV  317

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQ+D  QFEK+L YI  G+  GA L  GG RIG+KGY+IQPTIFSDVK
Sbjct  318  VGDPFKSGVEQGPQVDKAQFEKILSYIDVGRHEGANLVTGGARIGNKGYYIQPTIFSDVK  377

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM I++DEIFGPVQ V KF+ + E I+RANN+ YGLAAGV+T DID ANT +R LR G+
Sbjct  378  DDMAISRDEIFGPVQAVTKFRTVQEAIERANNSPYGLAAGVFTKDIDTANTFSRALRVGS  437

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYKMSG GREKG Y L+NY QVKAVVTPLKNPAW+
Sbjct  438  VWINCYDVFDAAIPFGGYKMSGQGREKGEYVLHNYTQVKAVVTPLKNPAWL  488



>ref|XP_004953798.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Setaria italica]
Length=555

 Score =   380 bits (975),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA +RV
Sbjct  325  GKSPFIVMDDADVDQAVELAHHAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARAQKRV  384

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+ GVEQGPQID EQF+K+LRY++SG +SGATL  GGDR GS+G++IQPT+F+D K
Sbjct  385  VGDPFRNGVEQGPQIDEEQFKKILRYVQSGVDSGATLVAGGDRAGSRGFYIQPTVFADAK  444

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D ANTL+R LRAGT
Sbjct  445  DEMKIAREEIFGPVQTILKFSGVEEVIRRANATQYGLAAGVFTRSLDAANTLSRALRAGT  504

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYDVFDA IPFGGYKMSG+GREKGVY+L NYLQ KAVVTP++N AW+
Sbjct  505  VWVNCYDVFDAGIPFGGYKMSGVGREKGVYALRNYLQTKAVVTPIRNAAWL  555



>dbj|BAJ85552.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=423

 Score =   375 bits (962),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHE +YDEFVEK+KARA RRV
Sbjct  193  GKSPFIVMDDADVDQAVELAHRAIFFNQGQCCCAGSRTFVHESVYDEFVEKSKARAQRRV  252

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID +QF+K+L Y++SG +SGATL  GGDR+GS+G+++QPT+F+DV+
Sbjct  253  VGDPFKKGVEQGPQIDGQQFKKILGYVKSGVDSGATLVTGGDRLGSRGFYVQPTVFADVE  312

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGP+Q +LKF+D+ EV++RAN T YGLAAGV+T  +D AN +AR LR GT
Sbjct  313  DEMKIAKEEIFGPIQSILKFRDVGEVVRRANPTQYGLAAGVFTGSLDTANAVARALRVGT  372

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+NCYDVFDA IPFGGYKMSG+GREKG YSL NYLQ KAVV PL++PAW+
Sbjct  373  VWVNCYDVFDAAIPFGGYKMSGVGREKGPYSLGNYLQTKAVVAPLRDPAWL  423



>ref|XP_008793866.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Phoenix dactylifera]
Length=538

 Score =   379 bits (972),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II DDA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct  308  GKSPMIIMDDADVDQAVELAHSALFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQ+D +QF+K++ YI+SG +SGATL  GGDRIG KG+++QPT+FSDVK
Sbjct  368  VGDPFKNGVEQGPQVDEKQFKKIMHYIKSGIDSGATLVAGGDRIGDKGFYVQPTVFSDVK  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA+++IFGPVQ +LKFKD+ EVI+RAN T YGLAAGV+T+D++ ANTL R LR GT
Sbjct  428  DEMAIAREDIFGPVQSILKFKDLHEVIQRANATEYGLAAGVFTNDMNTANTLMRALRVGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW NC+ VFDATIPFGGYKMSG GREKG+ SL NYLQVKAVVT LKNPAW+
Sbjct  488  VWFNCFHVFDATIPFGGYKMSGQGREKGIDSLKNYLQVKAVVTSLKNPAWL  538



>gb|EEC73936.1| hypothetical protein OsI_08800 [Oryza sativa Indica Group]
Length=553

 Score =   379 bits (972),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEKA+ARA++RV
Sbjct  323  GKSPFIVMDDADVDQAVELAHRALFFNQGQCCCAGSRTFVHERVYDEFVEKARARALQRV  382

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+ GVEQGPQID EQF+K+L+Y++SG +SGATL  GGDR GS+G++IQPT+F+DV+
Sbjct  383  VGDPFRTGVEQGPQIDGEQFKKILQYVKSGVDSGATLVAGGDRAGSRGFYIQPTVFADVE  442

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IAQ+EIFGPVQ +LKF  ++EV++RAN T YGLAAGV+T  +D ANTLAR LR GT
Sbjct  443  DEMKIAQEEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTQRLDAANTLARALRVGT  502

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+N YDVFDA +PFGGYKMSG+GREKGVYSL NYLQ KAVVTP+K+ AW+
Sbjct  503  VWVNTYDVFDAAVPFGGYKMSGVGREKGVYSLRNYLQTKAVVTPIKDAAWL  553



>ref|NP_001048010.1| Os02g0730000 [Oryza sativa Japonica Group]
 dbj|BAA96793.1| mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa Japonica 
Group]
 dbj|BAD15919.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAD16358.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAF09924.1| Os02g0730000 [Oryza sativa Japonica Group]
 dbj|BAH00573.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57740.1| hypothetical protein OsJ_08254 [Oryza sativa Japonica Group]
Length=553

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEKA+ARA++RV
Sbjct  323  GKSPFIVMDDADVDQAVELAHRALFFNQGQCCCAGSRTFVHERVYDEFVEKARARALQRV  382

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+ GVEQGPQID EQF+K+L+Y++SG +SGATL  GGDR GS+G++IQPT+F+DV+
Sbjct  383  VGDPFRTGVEQGPQIDGEQFKKILQYVKSGVDSGATLVAGGDRAGSRGFYIQPTVFADVE  442

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IAQ+EIFGPVQ +LKF  ++EV++RAN T YGLAAGV+T  +D ANTLAR LR GT
Sbjct  443  DEMKIAQEEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTQRLDAANTLARALRVGT  502

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+N YDVFDA +PFGGYKMSG+GREKGVYSL NYLQ KAVVTP+K+ AW+
Sbjct  503  VWVNTYDVFDAAVPFGGYKMSGVGREKGVYSLRNYLQTKAVVTPIKDAAWL  553



>ref|XP_002978501.1| hypothetical protein SELMODRAFT_233128 [Selaginella moellendorffii]
 gb|EFJ20487.1| hypothetical protein SELMODRAFT_233128 [Selaginella moellendorffii]
Length=497

 Score =   377 bits (967),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFII  DA+ID+AVE +HFALFFNQGQCCCAGSRT+VHE IYDE++EKAKARA++RV
Sbjct  267  GKSPFIIMPDADIDQAVELSHFALFFNQGQCCCAGSRTFVHESIYDEYIEKAKARALKRV  326

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQ+D  QFEK+L YI  G+  GA L  GG RIG+KGY+IQPTIFSDVK
Sbjct  327  VGDPFKSGVEQGPQVDKAQFEKILSYIDVGRHEGANLVTGGTRIGNKGYYIQPTIFSDVK  386

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM I++DEIFGPVQ V KF+ + E I+RANNT YGLAAGV+T DID ANT +R LR G+
Sbjct  387  DDMAISRDEIFGPVQAVTKFRTVQEAIERANNTTYGLAAGVFTKDIDTANTFSRALRVGS  446

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYKMSG GREKG Y L+NY QVKAVVTPL+NPAW+
Sbjct  447  VWINCYDVFDAAIPFGGYKMSGQGREKGEYVLHNYTQVKAVVTPLRNPAWL  497



>ref|XP_009399660.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=542

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RV
Sbjct  312  GKSPIIIMDDADIDQAVEVAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRV  371

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQID EQF K+L YI+SG +SGATL  GGDRIGSKGY+IQPT+FSDV+
Sbjct  372  VGDPFRKGVEQGPQIDEEQFSKILHYIKSGVDSGATLVTGGDRIGSKGYYIQPTVFSDVE  431

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPVQ +LKFKD++EVI+RAN T YGLAAGV+T +++ ANT  R LRAGT
Sbjct  432  DKMKIAKEEIFGPVQTILKFKDVNEVIQRANTTRYGLAAGVFTHNLNTANTFMRALRAGT  491

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYKMSG GREKG+ SL NYLQVKAVVTPLKNPAW+
Sbjct  492  VWINCYDVFDAAIPFGGYKMSGNGREKGIDSLKNYLQVKAVVTPLKNPAWL  542



>ref|XP_010928601.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=543

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II DDA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R+
Sbjct  313  GKSPMIIMDDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRI  372

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF++GVEQGPQID +QF K+L YI+SG +SGATL  GGDR+GSKGYFIQPT+F+DVK
Sbjct  373  VGDPFRQGVEQGPQIDEDQFRKILGYIKSGTDSGATLIAGGDRLGSKGYFIQPTVFADVK  432

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPVQ +LKF D++EVI+RAN +HYGLAAG++++++D  NTL R LRAG+
Sbjct  433  DEMKIAREEIFGPVQSILKFSDLNEVIRRANASHYGLAAGIFSNNMDTVNTLMRALRAGS  492

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            V++NC+DVFDA IPFGGYKMSG GR+KG+ SL NY Q+KAVVT LKNPAW+
Sbjct  493  VFVNCFDVFDAAIPFGGYKMSGHGRDKGMDSLKNYSQIKAVVTALKNPAWL  543



>ref|XP_010928603.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=538

 Score =   375 bits (964),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 203/231 (88%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP I+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEK+KA A++R+
Sbjct  308  GKSPMIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKSKAHALKRI  367

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GV+QGPQ+D +Q  K++ YI SG  SGATL  GG+RIG+KG+++QPT+FSDVK
Sbjct  368  VGDPFKNGVQQGPQVDEKQLNKIMHYIESGINSGATLVAGGNRIGNKGFYVQPTVFSDVK  427

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA+++IFGPVQ +LKFKD+DE+I+RAN T YGLAAGV+T++++ ANTL R LR GT
Sbjct  428  DEMAIAREDIFGPVQSILKFKDLDEIIRRANATEYGLAAGVFTNNMNTANTLMRALRVGT  487

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW NC+ VFD TIPFGGYKMSG GREKG+ SL NYLQVKAVVTPLKNPAW+
Sbjct  488  VWFNCFHVFDPTIPFGGYKMSGQGREKGIDSLKNYLQVKAVVTPLKNPAWL  538



>ref|XP_009363534.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=534

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEF+EK+KARA RR+
Sbjct  304  GKSPFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKSKARAERRL  363

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK G+EQGPQIDS QFEK+L+YI  G ++GA LE GG+R+G+KG++I+PT+FSDV+
Sbjct  364  VGDPFKGGIEQGPQIDSVQFEKILKYIDYGVKAGAKLETGGERVGTKGFYIKPTVFSDVQ  423

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA +EIFGPVQ +LK+KD++EVI+RANN+ YGLAAGV+T +ID ANTL R LR G+
Sbjct  424  DDMSIACEEIFGPVQTILKYKDLNEVIRRANNSRYGLAAGVFTQNIDTANTLTRALRVGS  483

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            V+INCY VFDA+IPFGGYKMS  GREKG+  L+NYLQVKAVVTPLKNPAW+
Sbjct  484  VFINCYYVFDASIPFGGYKMSCCGREKGISGLSNYLQVKAVVTPLKNPAWL  534



>ref|XP_008793883.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Phoenix dactylifera]
Length=540

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 204/231 (88%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II DDA++D+AVE AHFALFFNQGQCCC+GSRT+VHER+YDEFVEKAKARA++R+
Sbjct  310  GKSPMIIMDDADVDQAVELAHFALFFNQGQCCCSGSRTFVHERVYDEFVEKAKARALKRI  369

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQID +QF+K+L YI+SG +SGATL  GGDR GSKGYFIQPT+F+DVK
Sbjct  370  VGDPFKHGVEQGPQIDEKQFDKILGYIKSGIDSGATLIAGGDRFGSKGYFIQPTVFADVK  429

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IAQ+EIFGPVQ +LKF DI+EVI+RAN T YGLAAGV+++++D  +TL R LR G+
Sbjct  430  DGMKIAQNEIFGPVQSILKFSDINEVIRRANATPYGLAAGVFSNNMDAVSTLMRALRVGS  489

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            V++NC++V DA IPFGGYKMSG GR+KGV+SL NYLQ KAVVT LKNPAW+
Sbjct  490  VFVNCFNVLDAAIPFGGYKMSGHGRDKGVHSLQNYLQTKAVVTALKNPAWL  540



>ref|XP_001785650.1| predicted protein [Physcomitrella patens]
 gb|EDQ49530.1| predicted protein [Physcomitrella patens]
Length=530

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 199/231 (86%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP IIC+DAN+D AVE AHFALFFN GQCCCAGSRT+VHE IYDEFVEK+KARA++RV
Sbjct  300  GKSPMIICEDANVDEAVELAHFALFFNMGQCCCAGSRTFVHESIYDEFVEKSKARALKRV  359

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+KGVEQGPQ+D +QF KVL Y+ SG E GA L  GG R+GSKGY+I+PTIF+DVK
Sbjct  360  VGDPFRKGVEQGPQVDKDQFHKVLGYVESGMEQGANLITGGGRLGSKGYYIKPTIFTDVK  419

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            E M I  +EIFGPVQ + KFK +DEV++RANNT YGLAAG+++++I+  NTL+R LRAGT
Sbjct  420  EGMKIFDEEIFGPVQSIAKFKTLDEVVQRANNTVYGLAAGIFSNNINTVNTLSRALRAGT  479

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            +W+NC+DVFDATIPFGGYK SGIGREKG Y L +Y QVKAVVTPL NPAW+
Sbjct  480  IWVNCFDVFDATIPFGGYKQSGIGREKGKYVLESYTQVKAVVTPLHNPAWL  530



>gb|KHN23562.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=510

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 209/239 (87%), Gaps = 8/239 (3%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D AVE AHFALFFNQGQCCCAGSRT+VHE IYDEFVEKAKARA++RV
Sbjct  272  GKSPFIVCEDADVDAAVEAAHFALFFNQGQCCCAGSRTFVHESIYDEFVEKAKARALKRV  331

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQIDS QFEK+++YIRSG E+GATLE GG RIGSKGY+IQPT+FS+V+
Sbjct  332  VGDPFKNGVEQGPQIDSAQFEKIMKYIRSGVENGATLESGGQRIGSKGYYIQPTVFSNVQ  391

Query  479  --------EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTL  324
                    ++M+IA+DEI GPVQ +LKFKD++EVI+RAN T YGLA+GV+T ++D ANTL
Sbjct  392  ARYLQLTMDNMLIAKDEILGPVQSILKFKDLEEVIRRANATSYGLASGVFTQNMDTANTL  451

Query  323  ARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
             R LR GTVWINCYDVFDA IPFGGYKMSG GR +G+YSL +YLQVKAVVT LKNPAW+
Sbjct  452  MRALRVGTVWINCYDVFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKAVVTALKNPAWL  510



>gb|ABU96176.1| aldehyde dehydrogenase [Populus tremula x Populus alba]
Length=357

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 156/217 (72%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE +H A+FFNQGQCCCA SRT+VHER+Y+EFVEKAKARA++R 
Sbjct  141  GKSPFIVCEDADVDQAVELSHSAVFFNQGQCCCADSRTFVHERVYNEFVEKAKARAIQRT  200

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF++G+EQGPQ+DS+QFEK+LR IRSG ESGA L+ GGDR G+ GY+IQPT+FSDV+
Sbjct  201  VGDPFREGIEQGPQVDSDQFEKILRIIRSGVESGANLKAGGDRFGTTGYYIQPTVFSDVQ  260

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM++A++EIFGPVQ + KFKD+DEVI+R+N+T YGLAAG++T ++D ANTL+R L+ GT
Sbjct  261  DDMLVAKEEIFGPVQSIFKFKDLDEVIQRSNSTRYGLAAGIFTHNLDTANTLSRALKVGT  320

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQ  189
            VWINCYDVFDA IPFGG KMSG GREKG+YSL NYLQ
Sbjct  321  VWINCYDVFDAAIPFGGSKMSGNGREKGIYSLRNYLQ  357



>gb|EMT22926.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Aegilops 
tauschii]
Length=678

 Score =   360 bits (924),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 196/221 (89%), Gaps = 0/221 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+ DDA++D+AVE AH ALFFNQGQCCCAGSRT+VHE +YDEFVEK+KARA RRV
Sbjct  315  GKSPFIVMDDADVDQAVELAHRALFFNQGQCCCAGSRTFVHESVYDEFVEKSKARAQRRV  374

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQID +QF+K+L Y++SG +SGATL  GG+R+GS+G++IQPT+F+DV+
Sbjct  375  VGDPFKKGVEQGPQIDGQQFKKILGYVKSGVDSGATLVTGGERVGSRGFYIQPTVFADVE  434

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IAQ+EIFGP+Q +LKF+++ EV++RAN T YGLAAGV+T  +D AN +AR LR GT
Sbjct  435  DEMKIAQEEIFGPIQSILKFREVGEVVRRANATQYGLAAGVFTRSLDTANAVARALRVGT  494

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV  177
            VW+NCYDVFDA IPFGGYKMSG+GREKG YSL NYLQ KAV
Sbjct  495  VWVNCYDVFDAAIPFGGYKMSGVGREKGAYSLGNYLQTKAV  535



>ref|XP_002961352.1| hypothetical protein SELMODRAFT_266598 [Selaginella moellendorffii]
 gb|EFJ38891.1| hypothetical protein SELMODRAFT_266598 [Selaginella moellendorffii]
Length=491

 Score =   353 bits (906),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 191/231 (83%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA+ID+A+E +H ALFFNQGQ CCAGSRT+VHE +YDEFVEKAK +A  RV
Sbjct  261  GKSPFIVCGDADIDKALELSHLALFFNQGQTCCAGSRTFVHESVYDEFVEKAKKKAENRV  320

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            +GDPF+ GVE GPQ+D  QF KV++YI  GKE GATL  GG+R G KG++IQPT+F+DV 
Sbjct  321  LGDPFQSGVEHGPQVDISQFNKVMKYIGYGKEQGATLLTGGERHGDKGFYIQPTVFADVG  380

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M I++DEIFGPVQC+ KFK ++EV++RANNT YGLAAGV+T  +D AN L+R L+ GT
Sbjct  381  DSMAISRDEIFGPVQCISKFKTLEEVVERANNTQYGLAAGVFTQSLDTANFLSRALKVGT  440

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+N Y  FDA IPFGGYKMSG GREKG Y L NYLQVKAVVTPLKNPAW+
Sbjct  441  VWVNTYYAFDAAIPFGGYKMSGFGREKGEYVLKNYLQVKAVVTPLKNPAWL  491



>ref|XP_002983210.1| hypothetical protein SELMODRAFT_234195 [Selaginella moellendorffii]
 gb|EFJ15552.1| hypothetical protein SELMODRAFT_234195 [Selaginella moellendorffii]
Length=483

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 191/231 (83%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA+ID+A+E +H ALFFNQGQ CCAGSRT+VHE +YDEFV+KAK +A  RV
Sbjct  253  GKSPFIVCGDADIDKALELSHLALFFNQGQTCCAGSRTFVHESVYDEFVDKAKKKAENRV  312

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            +GDPF+ GVE GPQ+D  QF KV++YI  GKE GATL  GG+R G KG++IQPT+F+DV 
Sbjct  313  LGDPFQSGVEHGPQVDISQFNKVMKYIGYGKEQGATLLTGGERHGDKGFYIQPTVFADVG  372

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M I++DEIFGPVQC+ KFK ++EV++RANNT YGLAAGV+T  +D AN L+R L+ GT
Sbjct  373  DSMAISRDEIFGPVQCISKFKTLEEVVERANNTPYGLAAGVFTQSLDTANFLSRALKVGT  432

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VW+N Y  FDA IPFGGYKMSG GREKG Y L NYLQVKAVVTPLKNPAW+
Sbjct  433  VWVNTYYAFDAAIPFGGYKMSGFGREKGEYVLKNYLQVKAVVTPLKNPAWL  483



>gb|AEV40467.1| mitochondrial aldehyde dehydrogenase [Miscanthus sinensis]
Length=201

 Score =   340 bits (873),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -3

Query  749  CCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSG  570
            CCCAGSRT+VHERIYDEFVEKAKARA++RVVGDPF+KGVEQGPQID EQF K+LRYIRSG
Sbjct  1    CCCAGSRTFVHERIYDEFVEKAKARALKRVVGDPFRKGVEQGPQIDDEQFNKILRYIRSG  60

Query  569  KESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRA  390
             +SGA L  GGDR+G KGY+IQPTIFSDV++ M IAQ+EIFGPVQ +LKFKD++EVIKRA
Sbjct  61   VDSGANLVTGGDRLGDKGYYIQPTIFSDVQDGMKIAQEEIFGPVQSILKFKDLNEVIKRA  120

Query  389  NNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVY  210
            N + YGLAAGV+T+ +D ANTL R LR GTVW+NC+D+FDA IPFGGYKMSGIGREKG+ 
Sbjct  121  NASQYGLAAGVFTNSLDTANTLTRALRVGTVWVNCFDIFDAAIPFGGYKMSGIGREKGID  180

Query  209  SLNNYLQVKAVVTPLKNPAWI  147
            SL NYLQVKAVVTP+KN AW+
Sbjct  181  SLKNYLQVKAVVTPIKNAAWL  201



>emb|CAN80790.1| hypothetical protein VITISV_020547 [Vitis vinifera]
Length=480

 Score =   347 bits (889),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 193/234 (82%), Gaps = 12/234 (5%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C+DA++D+AVE +H ALF+NQGQ CC+GSRT+VHE IYDEF+EKAKARA++RV
Sbjct  256  GKSPFIVCEDADVDKAVELSHTALFYNQGQSCCSGSRTFVHESIYDEFIEKAKARALKRV  315

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFKKGVEQGPQIDS+QF K+L YI+SG E+GATLE GG++  SKGY+IQPT+FS+V 
Sbjct  316  VGDPFKKGVEQGPQIDSQQFNKILGYIKSGIEAGATLEAGGEKFSSKGYYIQPTVFSNV-  374

Query  479  EDMVIAQDEIFGPVQCVLKF---KDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLR  309
                     IF P      F   +D+DEVI+RAN THYGLAAG++T ++D ANTL R LR
Sbjct  375  --------HIFPPFTXFYAFTNNRDLDEVIRRANATHYGLAAGIFTQNLDTANTLTRALR  426

Query  308  AGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
             GTVWINC+ VFDA IPFGG KMSG GREKG+Y L+NY+QVKAVVTPLKNPAW+
Sbjct  427  VGTVWINCFFVFDAAIPFGGRKMSGHGREKGIYGLSNYMQVKAVVTPLKNPAWL  480



>ref|XP_007151102.1| hypothetical protein PHAVU_004G018000g [Phaseolus vulgaris]
 gb|ESW23096.1| hypothetical protein PHAVU_004G018000g [Phaseolus vulgaris]
Length=522

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 189/231 (82%), Gaps = 7/231 (3%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA+ID AVE AH ALFFNQGQCCCAGSRT+VHE IYDEFVEKAK RA++RV
Sbjct  299  GKSPFIVCKDADIDAAVEAAHSALFFNQGQCCCAGSRTFVHESIYDEFVEKAKTRAIKRV  358

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQID  QF+K+L+YIRSG ESGATLE GG R+GSKGY+I+PT+FS+V 
Sbjct  359  VGDPFKSGVEQGPQIDFTQFKKILKYIRSGIESGATLESGGQRVGSKGYYIEPTVFSNV-  417

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
                  Q   F  +  +   KD++EVI+RAN T YGLAAGVYT +ID ANTL R LR GT
Sbjct  418  ------QAWHFQLIMVLFLNKDLEEVIRRANATSYGLAAGVYTRNIDTANTLMRALRVGT  471

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYD+FDA IPFGGYKMSG GR +G+YSL +YLQVKA VT LKNPAW+
Sbjct  472  VWINCYDIFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKACVTALKNPAWL  522



>gb|KJB31274.1| hypothetical protein B456_005G183300 [Gossypium raimondii]
Length=509

 Score =   340 bits (872),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 190/231 (82%), Gaps = 23/231 (10%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPFI+C DA++D+AVE AHFALFFNQ                        KARA++R 
Sbjct  302  GKSPFIVCKDADVDKAVELAHFALFFNQ-----------------------RKARALKRS  338

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPFK GVEQGPQIDSEQFEK+LRYIRSG ESGATL  GGDR+GSKG++IQPT+F++VK
Sbjct  339  VGDPFKAGVEQGPQIDSEQFEKILRYIRSGIESGATLITGGDRLGSKGFYIQPTVFTNVK  398

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            EDM+I+QDEIFGPVQ +LKF+ +DEVI+RAN+T YGLAAGV+T+D+D ANTL+R L+ GT
Sbjct  399  EDMLISQDEIFGPVQSILKFRYMDEVIRRANSTRYGLAAGVFTNDLDTANTLSRALKVGT  458

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCYDVFDA IPFGGYKMSG GREKGV+ L+NYLQVKA+V PLKNPAWI
Sbjct  459  VWINCYDVFDAAIPFGGYKMSGQGREKGVHCLSNYLQVKAIVAPLKNPAWI  509



>ref|XP_001690955.1| aldehyde dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP05401.1| aldehyde dehydrogenase [Chlamydomonas reinhardtii]
Length=536

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 145/230 (63%), Positives = 183/230 (80%), Gaps = 1/230 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP I+C D ++D+AV DAH ALFFN GQCC AGSR YVHE +YDEFV K+   A  R 
Sbjct  307  GKSPIIVCPDVDVDKAVADAHMALFFNHGQCCAAGSRVYVHEAVYDEFVRKSTEAAATRK  366

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF   VEQGPQ+D +QF+K+L YI SGK  GA L  GG R G +GY+++PT+F+DVK
Sbjct  367  VGDPFSS-VEQGPQVDDDQFKKILSYIDSGKRQGAKLMTGGGRKGDRGYYVEPTVFADVK  425

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA++EIFGPVQ ++K+K +D+VI RANN+ YGLAAGV++++ID  NTL R L++GT
Sbjct  426  DDMKIAREEIFGPVQSIMKWKSLDDVIARANNSPYGLAAGVFSNNIDTVNTLTRALKSGT  485

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW  150
            VW+NCY+++D  +PFGGYK SGIGREKG Y+L+NY QVKAV  PL NPAW
Sbjct  486  VWVNCYNLYDNAVPFGGYKESGIGREKGEYALSNYTQVKAVYQPLSNPAW  535



>emb|CAD10505.1| aldehyde dehydrogenase [Polytomella sp. Pringsheim 198.80]
Length=523

 Score =   325 bits (832),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 143/230 (62%), Positives = 179/230 (78%), Gaps = 0/230 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP I+C D ++DRAV DAH ALFFN GQCC AGSR YVHE+IYDEFVEKA   A    
Sbjct  293  GKSPIIVCPDVDVDRAVADAHMALFFNHGQCCAAGSRVYVHEKIYDEFVEKATKAAANHS  352

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF    +QGPQ+D+ QF K+L Y+  GK  GA L  GG R+G+KGY++ PT+FS+V 
Sbjct  353  VGDPFSGQYDQGPQVDNAQFSKILSYVEHGKAEGAKLNVGGCRVGNKGYYVAPTVFSNVT  412

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPVQ +LK+   DEVI+RAN + YGLA+GV++ D+D  NTL RGL AGT
Sbjct  413  DNMKIAREEIFGPVQSILKYSTFDEVIRRANASDYGLASGVFSKDLDTVNTLVRGLHAGT  472

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW  150
            VW+NCY++FD+ +PFGG+K SGIGREKG Y+L+NY +VKAV  PL NPAW
Sbjct  473  VWVNCYNLFDSAVPFGGFKTSGIGREKGEYALSNYTKVKAVYMPLVNPAW  522



>ref|XP_011483309.1| PREDICTED: aldehyde dehydrogenase, mitochondrial [Oryzias latipes]
Length=417

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 174/229 (76%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP I+  DAN++ AVE +HFALFFNQGQCCCAGSRTYV   IYDEFVE++  RA RRV
Sbjct  188  GKSPNIVLSDANMEDAVEQSHFALFFNQGQCCCAGSRTYVQADIYDEFVERSVERAKRRV  247

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF    EQGPQ+D EQF K+L YI SGK  GA L CGG     +GYFIQPT+F DV+
Sbjct  248  VGDPFDMKTEQGPQVDQEQFNKILGYISSGKREGAKLMCGGGVAADRGYFIQPTVFGDVQ  307

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPV  + KFK ++EV+ RAN++ YGLAA V+T DIDKAN ++ GLRAGT
Sbjct  308  DNMTIAREEIFGPVMQIFKFKTLEEVLTRANDSKYGLAAAVFTKDIDKANYVSSGLRAGT  367

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VWINCYDVF A  PFGGYK SG+GRE G Y L NY +VK V    P KN
Sbjct  368  VWINCYDVFGAQAPFGGYKASGVGRELGQYGLENYTEVKTVTIKIPQKN  416



>ref|WP_011612157.1| betaine-aldehyde dehydrogenase [Trichodesmium erythraeum]
 gb|ABG51795.1| aldehyde dehydrogenase (acceptor) [Trichodesmium erythraeum IMS101]
Length=490

 Score =   316 bits (810),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 179/225 (80%), Gaps = 0/225 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP I+  DA++D A+E +HFALFFNQGQCCCAGSR +V E+ YDEFV K+  RA  R+
Sbjct  266  GKSPNIVFADADMDAAIEGSHFALFFNQGQCCCAGSRLFVEEKCYDEFVNKSVERAKLRM  325

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF + VEQGPQ+D EQF KV+ YI SG++ GA + CGG R+G +GYFI PT+F+DV+
Sbjct  326  VGDPFTERVEQGPQVDEEQFNKVMSYIESGQQDGAQMLCGGSRVGDRGYFIAPTVFADVQ  385

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IAQ+EIFGPV  ++KFKDIDE+++RANN+ YGLAAGV+T D+ KA+TLA  LRAGT
Sbjct  386  DNMKIAQEEIFGPVMSIIKFKDIDELVERANNSMYGLAAGVWTQDVTKAHTLAHRLRAGT  445

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL  165
            VW+NCYDVFDA  PFGG+K SG+GRE G Y L  Y ++K V   +
Sbjct  446  VWVNCYDVFDAAAPFGGFKQSGLGRELGEYGLQQYTEIKTVTMKM  490



>ref|XP_003977205.1| PREDICTED: aldehyde dehydrogenase, mitochondrial-like [Takifugu 
rubripes]
Length=380

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 174/219 (79%), Gaps = 0/219 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DAN++ AVE +HFALFFNQGQCCCAGSRTYV E +Y+EF+E++  RA RR+
Sbjct  116  GKSPNIILSDANMEDAVEQSHFALFFNQGQCCCAGSRTYVQEDVYEEFLERSAERAKRRL  175

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF    EQGPQ+D EQF K+L YI +GK  GA L CGG    +KGYFIQPT+F DV+
Sbjct  176  VGDPFDLKTEQGPQVDLEQFNKILGYISTGKREGAKLMCGGGVAANKGYFIQPTVFGDVQ  235

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPV  +LKFK ++EV++RAN+T YGLAA V+T DIDKA+ ++ GLRAGT
Sbjct  236  DNMTIAREEIFGPVMQILKFKSLEEVVERANDTKYGLAAAVFTKDIDKAHYISNGLRAGT  295

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVK  183
            VWINCYDVF A  PFGGYK SGIGRE G Y L NY ++K
Sbjct  296  VWINCYDVFGAQAPFGGYKASGIGRELGEYGLTNYTRLK  334



>ref|XP_010783440.1| PREDICTED: aldehyde dehydrogenase, mitochondrial-like, partial 
[Notothenia coriiceps]
Length=284

 Score =   308 bits (789),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 174/226 (77%), Gaps = 2/226 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DAN++ AVE +HFALFFNQGQCCCAGSRTYV   IYDEFVE++  RA RRV
Sbjct  23   GKSPNIILSDANMEDAVEQSHFALFFNQGQCCCAGSRTYVQADIYDEFVERSVERAKRRV  82

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF    EQGPQ+D EQF K+L YI SGK  GA L CGG     +GY+IQPT+F DV+
Sbjct  83   VGDPFDLKTEQGPQVDQEQFNKILGYISSGKREGAKLLCGGGVAADRGYYIQPTVFGDVQ  142

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPV  +LKFK ++EV++RAN+T YGLAA V+T DIDKAN ++  LRAGT
Sbjct  143  DNMTIAREEIFGPVMQILKFKSLEEVVERANDTKYGLAAAVFTKDIDKANYVSHSLRAGT  202

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK  162
            VWINCYDVF A  PFGGYK SG GRE G Y L NY +VK +  PL+
Sbjct  203  VWINCYDVFGAQAPFGGYKASGNGRELGEYGLENYTEVKTL--PLR  246



>ref|XP_005080706.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X3 [Mesocricetus 
auratus]
Length=384

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 176/229 (77%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ ARA  RV
Sbjct  155  GKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRV  214

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VG+PF    EQGPQ+D  QF+K+L YI+SG++ GA L CGG     +GYFIQPT+F DVK
Sbjct  215  VGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVK  274

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGT
Sbjct  275  DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGT  334

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VWINCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  335  VWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTIKVPQKN  383



>ref|XP_004635979.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X3 [Octodon 
degus]
Length=384

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 176/229 (77%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +Y+EFVE++ ARA  RV
Sbjct  155  GKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYEEFVERSVARAKARV  214

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VG+PF    EQGPQ+D  QF+K+L YI+SGKE GA L CGG     +GYFIQPT+F DV+
Sbjct  215  VGNPFDSRTEQGPQVDESQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQ  274

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T DIDKAN L++ L+AGT
Sbjct  275  DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDIDKANYLSQALQAGT  334

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VW+NCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  335  VWVNCYDVFGAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTVKVPQKN  383



>ref|XP_004571367.1| PREDICTED: aldehyde dehydrogenase, mitochondrial-like isoform 
X1 [Maylandia zebra]
Length=556

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 175/223 (78%), Gaps = 0/223 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA+++ AVE +HFALFFNQGQCCCAGSRTYV   +YDEFVE++  RA +RV
Sbjct  318  GKSPNIILSDADMEYAVEQSHFALFFNQGQCCCAGSRTYVQADVYDEFVERSVERAKKRV  377

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF    EQGPQID EQF K+L YI SGK  GA L CGG     +GYFIQPT+F DV+
Sbjct  378  VGDPFNLKTEQGPQIDQEQFNKILGYISSGKREGAKLMCGGGIAADRGYFIQPTVFGDVQ  437

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPV  +LKFK ++EV+ RAN+T YGLAA V+T DIDKAN ++ GLRAGT
Sbjct  438  DNMTIAREEIFGPVMQILKFKTLEEVVTRANDTKYGLAAAVFTKDIDKANYVSSGLRAGT  497

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVT  171
            VWINCYDVF A  PFGGYK SG+GRE G Y L+NY +VK V+T
Sbjct  498  VWINCYDVFGAQAPFGGYKASGVGRELGQYGLDNYTEVKTVIT  540



>ref|XP_009296559.1| PREDICTED: aldehyde dehydrogenase, mitochondrial-like, partial 
[Danio rerio]
Length=384

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 174/229 (76%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DAN++ AVE +H ALFFNQGQCCCAG+RT+V E IYDEFVE++  RA  R+
Sbjct  155  GKSPNIILSDANMEEAVEQSHIALFFNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRI  214

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF    EQGPQ++ +QF+KVL YI SGK  GA L CGG     +GYFIQPT+F DVK
Sbjct  215  VGDPFDLNTEQGPQVNEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVK  274

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA++EIFGPV  +LKFK ++EVI+RAN++ YGLA  V+T DIDKAN ++ GLRAGT
Sbjct  275  DDMTIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGLRAGT  334

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VWINCY+VF    PFGGYK SGIGRE G Y L NY +VK V    P KN
Sbjct  335  VWINCYNVFGVQAPFGGYKASGIGREMGEYGLENYTEVKTVTIKVPEKN  383



>ref|XP_005472420.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X2 [Oreochromis 
niloticus]
Length=471

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 176/229 (77%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA+++ AVE +HFALFFNQGQCCCAGSRTYV   +YDEFVE++  RA +RV
Sbjct  242  GKSPNIILSDADMEYAVEQSHFALFFNQGQCCCAGSRTYVQADVYDEFVERSVERAKKRV  301

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF    EQGPQID EQF K+L YI SGK  GA L CGG     +GYFIQPT+F DV+
Sbjct  302  VGDPFDLKTEQGPQIDQEQFNKILGYISSGKREGAKLMCGGGIAADRGYFIQPTVFGDVQ  361

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPV  +LKFK ++EV+ RAN+T YGLAA V+T DIDKAN ++ GLRAGT
Sbjct  362  DNMTIAREEIFGPVMQILKFKTLEEVVTRANDTKYGLAAAVFTKDIDKANYVSSGLRAGT  421

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VWINCYDVF A  PFGGYK SG+GRE G Y L+NY +VK V    P KN
Sbjct  422  VWINCYDVFGAQAPFGGYKASGVGRELGQYGLDNYTEVKTVTIKVPQKN  470



>ref|XP_003965899.1| PREDICTED: aldehyde dehydrogenase, mitochondrial-like [Takifugu 
rubripes]
Length=518

 Score =   314 bits (805),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 178/229 (78%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DAN++ AVE +HFALFFNQGQCCCAGSRTYV E +Y+EF+E++  RA RR+
Sbjct  289  GKSPNIILSDANMEDAVEQSHFALFFNQGQCCCAGSRTYVQEDVYEEFLERSAERAKRRL  348

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF    EQGPQ+D EQF K+L YI +GK  GA L CGG    +KGYFIQPT+F DV+
Sbjct  349  VGDPFDLKTEQGPQVDLEQFNKILGYISTGKREGAKLMCGGGVAANKGYFIQPTVFGDVQ  408

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPV  +LKFK ++EV++RAN+T YGLAA V+T DIDKA+ ++ GLRAGT
Sbjct  409  DNMTIAREEIFGPVMQILKFKSLEEVVERANDTKYGLAAAVFTKDIDKAHYISNGLRAGT  468

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VWINCYDVF A  PFGGYK SGIGRE G Y L NY +VK V    P KN
Sbjct  469  VWINCYDVFGAQAPFGGYKASGIGRELGEYGLTNYTEVKTVTIRVPQKN  517



>ref|XP_003446212.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X1 [Oreochromis 
niloticus]
Length=518

 Score =   314 bits (804),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 176/229 (77%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA+++ AVE +HFALFFNQGQCCCAGSRTYV   +YDEFVE++  RA +RV
Sbjct  289  GKSPNIILSDADMEYAVEQSHFALFFNQGQCCCAGSRTYVQADVYDEFVERSVERAKKRV  348

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF    EQGPQID EQF K+L YI SGK  GA L CGG     +GYFIQPT+F DV+
Sbjct  349  VGDPFDLKTEQGPQIDQEQFNKILGYISSGKREGAKLMCGGGIAADRGYFIQPTVFGDVQ  408

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPV  +LKFK ++EV+ RAN+T YGLAA V+T DIDKAN ++ GLRAGT
Sbjct  409  DNMTIAREEIFGPVMQILKFKTLEEVVTRANDTKYGLAAAVFTKDIDKANYVSSGLRAGT  468

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VWINCYDVF A  PFGGYK SG+GRE G Y L+NY +VK V    P KN
Sbjct  469  VWINCYDVFGAQAPFGGYKASGVGRELGQYGLDNYTEVKTVTIKVPQKN  517



>ref|XP_004595352.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X2 [Ochotona 
princeps]
Length=384

 Score =   309 bits (792),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 176/229 (77%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +Y+EFVE++ ARA  RV
Sbjct  155  GKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYNEFVERSVARAKSRV  214

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VG+PF    EQGPQ+D  QF+K+L YI+SGK+ GA L CGG     +GYFIQPT+F DV+
Sbjct  215  VGNPFDSRTEQGPQVDETQFKKILGYIKSGKQEGAKLLCGGGAAADRGYFIQPTVFGDVQ  274

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGT
Sbjct  275  DSMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGT  334

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VW+NCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  335  VWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN  383



>gb|ABR16485.1| unknown [Picea sitchensis]
Length=500

 Score =   313 bits (802),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 180/231 (78%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP I+ DDA++D+AV  AH A++ N GQ C AGSR +V E IYDEFV+KA ARA ++V
Sbjct  270  GKSPLIVMDDADVDKAVNIAHLAVYTNMGQVCLAGSRVFVQEGIYDEFVKKAVARAKQQV  329

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF+ GV+ GPQID  QFEK+L+YI+ GK  GA L  GG+ +G+KG++I+PTIFSDV+
Sbjct  330  VGDPFQPGVQHGPQIDKMQFEKILKYIQYGKRDGANLVLGGNSLGNKGFYIEPTIFSDVE  389

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IA++EIFGP+  +LKFK I+EVI+R N T YGL AG+ T DID AN LAR LR GT
Sbjct  390  DDMQIAKEEIFGPIMSILKFKTIEEVIERGNKTIYGLGAGIITKDIDIANRLARSLRVGT  449

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  147
            VWINCY V  A +P GGYKMSGIGRE G Y L NYLQVK V++PL++  W+
Sbjct  450  VWINCYLVVGADVPLGGYKMSGIGREYGSYGLTNYLQVKCVISPLQHSPWL  500



>ref|XP_005642984.1| aldehyde dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE18440.1| aldehyde dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=565

 Score =   315 bits (807),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 181/228 (79%), Gaps = 0/228 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSPF++C DA++D AVE AH ALFFN GQCC AGSRT+VHE IYDEFV++A  RA  + 
Sbjct  333  GKSPFVVCPDADLDAAVECAHQALFFNMGQCCTAGSRTFVHESIYDEFVKRAVKRAAEKA  392

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF +  EQGPQ+  EQFEK+L YI  G++ GA LE GG RIG KGY+++PT+FS+V 
Sbjct  393  VGDPFDESTEQGPQVSKEQFEKILSYIDKGQQEGAKLEYGGKRIGDKGYYVEPTVFSNVT  452

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA+DEIFGPVQ +LK+  I EV++RAN T YGLAAGV+T +++ A TL+RGL+AGT
Sbjct  453  DEMSIAKDEIFGPVQSILKWSTIGEVLERANATEYGLAAGVFTQNLNWATTLSRGLKAGT  512

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  156
            +W+N ++ FDA +PFGGYK+SGIGRE G  +L++Y Q K+V  PL+ P
Sbjct  513  IWVNTWNTFDAGVPFGGYKLSGIGREHGEAALSHYTQTKSVYQPLEEP  560



>ref|XP_006178148.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X2 [Camelus 
ferus]
Length=377

 Score =   309 bits (791),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 175/229 (76%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IY EFVE++ ARA  RV
Sbjct  148  GKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYTEFVERSVARARSRV  207

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VG+PF    EQGPQ+D  QF+KVL YI+SGKE GA L CGG     +GYFIQPT+F DV+
Sbjct  208  VGNPFDSQTEQGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQ  267

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGT
Sbjct  268  DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGT  327

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VW+NCYDVF A  PFGGYK+SG GRE G Y L  Y +VK V    P KN
Sbjct  328  VWVNCYDVFGAQSPFGGYKLSGNGRELGEYGLQAYTEVKTVTVKVPQKN  376



>ref|XP_005752934.1| PREDICTED: aldehyde dehydrogenase, mitochondrial-like isoform 
X2 [Pundamilia nyererei]
 ref|XP_005946398.1| PREDICTED: aldehyde dehydrogenase, mitochondrial-like isoform 
X2 [Haplochromis burtoni]
Length=500

 Score =   313 bits (802),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 173/222 (78%), Gaps = 0/222 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA+++ AVE +HFALFFNQGQCCCAGSRTYV   +YDEFVE++  RA +RV
Sbjct  271  GKSPNIILSDADMEYAVEQSHFALFFNQGQCCCAGSRTYVQADVYDEFVERSVERAKKRV  330

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF    EQGPQID EQF K+L YI SGK  GA L CGG     +GYFIQPT+F DV+
Sbjct  331  VGDPFNLKTEQGPQIDQEQFNKILGYISSGKREGAKLMCGGGIAADRGYFIQPTVFGDVQ  390

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA++EIFGPV  +LKFK ++EV+ RAN+T YGLAA V+T DIDKAN ++ GLRAGT
Sbjct  391  DNMTIAREEIFGPVMQILKFKTLEEVVTRANDTKYGLAAAVFTKDIDKANYVSSGLRAGT  450

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV  174
            VWINCYDVF A  PFGGYK SG+GRE G Y L+NY +VK V 
Sbjct  451  VWINCYDVFGAQAPFGGYKASGVGRELGQYGLDNYTEVKTVT  492



>ref|XP_007058380.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X2 [Chelonia 
mydas]
Length=384

 Score =   309 bits (792),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 175/229 (76%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA++D AVE AHFALFFNQGQCCCAGSRTYV E +Y EFVE++  RA  RV
Sbjct  155  GKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTYVQEDVYHEFVERSIERAKSRV  214

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VG+PF    EQGPQ+D EQF+K+L YI +GK+ GA L CGG+    +GYFIQPTIF DV+
Sbjct  215  VGNPFDSQTEQGPQVDEEQFKKILGYISTGKQEGAKLLCGGNPAADRGYFIQPTIFGDVQ  274

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            ++M IA +EIFGPV  +LKFK I+EVI+RANN+ YGLAA V+T D+DKAN +++ LRAGT
Sbjct  275  DNMTIATEEIFGPVMQILKFKTIEEVIERANNSKYGLAAAVFTKDLDKANYVSQALRAGT  334

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VWINCYDVF A  PFGGYK SG GRE G Y L  Y +VK V    P KN
Sbjct  335  VWINCYDVFGAQAPFGGYKASGNGRELGEYGLEAYTEVKTVTIKVPQKN  383



>gb|AAK57732.1| aldehyde dehydrogenase [Rattus norvegicus]
Length=443

 Score =   311 bits (797),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 176/229 (77%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ ARA  RV
Sbjct  214  GKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRV  273

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VG+PF    EQGPQ+D  QF+K+L YI+SG++ GA L CGG     +GYFIQPT+F DVK
Sbjct  274  VGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVK  333

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGT
Sbjct  334  DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGT  393

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VWINCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  394  VWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN  442



>ref|XP_003462991.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform 2 [Cavia 
porcellus]
Length=474

 Score =   312 bits (799),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 176/229 (77%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +Y+EFVE++ ARA  RV
Sbjct  245  GKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQESVYEEFVERSIARAKARV  304

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VG+PF    EQGPQ+D  QF+K+L YI+SGKE GA L CGG     +GYFIQPT+F DV+
Sbjct  305  VGNPFDSRTEQGPQVDETQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQ  364

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPV  +LKFK I+EV+ RANNT YGLAA V+T D+DKAN L++ L+AGT
Sbjct  365  DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNTKYGLAAAVFTKDLDKANYLSQALQAGT  424

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VW+NCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  425  VWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN  473



>ref|XP_007529029.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X3 [Erinaceus 
europaeus]
Length=384

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 175/229 (76%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +Y+EFVE++ ARA  RV
Sbjct  155  GKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYNEFVERSVARAKSRV  214

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VG+PF    EQGPQ+D  QF KVL YI+SGKE GA L CGG     +GYFIQPT+F DVK
Sbjct  215  VGNPFDSQTEQGPQVDETQFNKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVK  274

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPV  +LKFK I+EV++RANN+ YGLAA V+T D+DKAN L++ L+AGT
Sbjct  275  DGMTIAKEEIFGPVMQILKFKTIEEVVERANNSKYGLAAAVFTKDLDKANYLSQALQAGT  334

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VW+NCYDVF A  PFGGYKMSG  RE G Y L  Y +VK V    P KN
Sbjct  335  VWVNCYDVFGAQSPFGGYKMSGNCRELGEYGLQAYTEVKTVTVKVPQKN  383



>ref|XP_005080705.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X2 [Mesocricetus 
auratus]
Length=472

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 176/229 (77%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ ARA  RV
Sbjct  243  GKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRV  302

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VG+PF    EQGPQ+D  QF+K+L YI+SG++ GA L CGG     +GYFIQPT+F DVK
Sbjct  303  VGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVK  362

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGT
Sbjct  363  DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGT  422

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VWINCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  423  VWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTIKVPQKN  471



>ref|XP_006178149.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X3 [Camelus 
ferus]
Length=384

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 175/229 (76%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IY EFVE++ ARA  RV
Sbjct  155  GKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYTEFVERSVARARSRV  214

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VG+PF    EQGPQ+D  QF+KVL YI+SGKE GA L CGG     +GYFIQPT+F DV+
Sbjct  215  VGNPFDSQTEQGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQ  274

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGT
Sbjct  275  DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGT  334

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VW+NCYDVF A  PFGGYK+SG GRE G Y L  Y +VK V    P KN
Sbjct  335  VWVNCYDVFGAQSPFGGYKLSGNGRELGEYGLQAYTEVKTVTVKVPQKN  383



>ref|XP_004635978.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X2 [Octodon 
degus]
Length=474

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 176/229 (77%), Gaps = 2/229 (1%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +Y+EFVE++ ARA  RV
Sbjct  245  GKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYEEFVERSVARAKARV  304

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VG+PF    EQGPQ+D  QF+K+L YI+SGKE GA L CGG     +GYFIQPT+F DV+
Sbjct  305  VGNPFDSRTEQGPQVDESQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQ  364

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            + M IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T DIDKAN L++ L+AGT
Sbjct  365  DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDIDKANYLSQALQAGT  424

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  159
            VW+NCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  425  VWVNCYDVFGAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTVKVPQKN  473



>ref|WP_009547631.1| MULTISPECIES: betaine-aldehyde dehydrogenase [Cyanothece]
 gb|ACB52577.1| aldehyde dehydrogenase [Cyanothece sp. ATCC 51142]
Length=490

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = -3

Query  839  GKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV  660
            GKSP I+  DAN+D+A+E AHF LFFNQGQCCCAGSR +V E+ YDEFV K+  RA +R+
Sbjct  266  GKSPNIVFADANLDQAIEGAHFGLFFNQGQCCCAGSRLFVEEKCYDEFVAKSVERAKQRI  325

Query  659  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK  480
            VGDPF     QGPQ+D  QF+KV+ YI SG+  GA L CGG R+G +GYFI+PT+F+DV+
Sbjct  326  VGDPFDDHTTQGPQVDKTQFDKVMEYIESGQREGAKLLCGGGRVGDRGYFIEPTVFADVQ  385

Query  479  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  300
            +DM IAQ+EIFGPV  ++KFKD+DEVI+RAN+T YGLAA V+T DI K + +A  LRAGT
Sbjct  386  DDMKIAQEEIFGPVMSIIKFKDMDEVIQRANDTMYGLAAAVWTQDISKGHAIANALRAGT  445

Query  299  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL  165
            VW+NCYDVFDA  PFGG+K SG+GRE G Y L  Y ++K V   L
Sbjct  446  VWVNCYDVFDAAAPFGGFKQSGMGRELGEYGLQQYTEIKTVTVKL  490



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1766194434865