BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF042L07

Length=683
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796391.1|  PREDICTED: cyclin-A1-4                             179   2e-49   Nicotiana sylvestris
emb|CAA63542.1|  cyclin A-like protein                                  177   8e-49   Nicotiana tabacum [American tobacco]
dbj|BAA09366.1|  A-type cyclin                                          177   8e-49   Nicotiana tabacum [American tobacco]
ref|XP_010312445.1|  PREDICTED: cyclin A1 isoform X1                    177   2e-48   
ref|XP_009593178.1|  PREDICTED: cyclin-A1-4 isoform X2                  176   2e-48   Nicotiana tomentosiformis
ref|XP_009593177.1|  PREDICTED: cyclin-A1-4 isoform X1                  176   2e-48   Nicotiana tomentosiformis
ref|NP_001233762.1|  cyclin A1                                          176   2e-48   Solanum lycopersicum
ref|XP_006351136.1|  PREDICTED: cyclin-A1-3-like isoform X1             173   4e-47   Solanum tuberosum [potatoes]
ref|XP_006351137.1|  PREDICTED: cyclin-A1-3-like isoform X2             173   4e-47   Solanum tuberosum [potatoes]
ref|XP_006351138.1|  PREDICTED: cyclin-A1-3-like isoform X3             171   2e-46   Solanum tuberosum [potatoes]
emb|CDP10969.1|  unnamed protein product                                171   2e-46   Coffea canephora [robusta coffee]
ref|XP_002284567.1|  PREDICTED: cyclin-A1-1-like                        170   6e-46   Vitis vinifera
emb|CBI18982.3|  unnamed protein product                                170   2e-45   Vitis vinifera
dbj|BAE06271.1|  cyclin A                                               169   2e-45   Scutellaria baicalensis [Baikal skullcap]
gb|AEV43294.1|  cyclin A1                                               158   4e-45   Nicotiana benthamiana
ref|XP_006386358.1|  hypothetical protein POPTR_0002s08020g             166   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_011102309.1|  PREDICTED: cyclin-A1-1                             166   3e-44   Sesamum indicum [beniseed]
gb|EYU32511.1|  hypothetical protein MIMGU_mgv1a005475mg                165   3e-44   Erythranthe guttata [common monkey flower]
ref|XP_011027470.1|  PREDICTED: cyclin-A1-1-like                        163   2e-43   Populus euphratica
ref|XP_011027473.1|  PREDICTED: cyclin-A1-1-like                        163   3e-43   Populus euphratica
ref|XP_008219599.1|  PREDICTED: cyclin-A1-4-like                        162   4e-43   Prunus mume [ume]
ref|XP_002520329.1|  cyclin A, putative                                 162   8e-43   
ref|XP_009341345.1|  PREDICTED: cyclin-A1-4-like                        162   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_007223288.1|  hypothetical protein PRUPE_ppa005557mg             160   1e-42   
ref|XP_009343978.1|  PREDICTED: cyclin-A1-1-like                        159   8e-42   Pyrus x bretschneideri [bai li]
ref|XP_002306649.1|  cyclin family protein                              159   8e-42   Populus trichocarpa [western balsam poplar]
ref|XP_008338670.1|  PREDICTED: cyclin-A1-4                             159   8e-42   
ref|XP_010063417.1|  PREDICTED: cyclin-A1-1                             158   2e-41   
ref|XP_007019157.1|  Cyclin A1,1 isoform 1                              157   3e-41   
ref|XP_011003420.1|  PREDICTED: cyclin-A1-1-like                        157   4e-41   Populus euphratica
gb|KHG05394.1|  CYCA1-1: Cyclin-A1-1                                    151   7e-41   Gossypium arboreum [tree cotton]
ref|XP_008219598.1|  PREDICTED: cyclin-A1-1-like                        155   1e-40   Prunus mume [ume]
gb|KHN35496.1|  Cyclin-A1-1                                             152   2e-40   Glycine soja [wild soybean]
ref|XP_009387253.1|  PREDICTED: cyclin-A1-4-like                        155   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB59298.1|  hypothetical protein B456_009G248300                    154   3e-40   Gossypium raimondii
ref|XP_010530202.1|  PREDICTED: cyclin-A1-1                             154   3e-40   Tarenaya hassleriana [spider flower]
gb|KDP32823.1|  hypothetical protein JCGZ_12115                         154   5e-40   Jatropha curcas
ref|XP_004160710.1|  PREDICTED: cyclin-A1-1-like                        154   7e-40   
ref|XP_004149427.1|  PREDICTED: cyclin-A1-1-like                        154   7e-40   Cucumis sativus [cucumbers]
ref|XP_008466750.1|  PREDICTED: cyclin-A1-1                             153   8e-40   Cucumis melo [Oriental melon]
ref|XP_009343979.1|  PREDICTED: cyclin-A1-1-like                        153   1e-39   Pyrus x bretschneideri [bai li]
ref|NP_001237800.1|  mitotic cyclin a2-type                             152   1e-39   Glycine max [soybeans]
gb|KHG05847.1|  Cyclin-A1-1 -like protein                               152   2e-39   Gossypium arboreum [tree cotton]
ref|XP_008806262.1|  PREDICTED: cyclin-A1-4 isoform X2                  151   2e-39   Phoenix dactylifera
ref|XP_010925928.1|  PREDICTED: cyclin-A1-4                             152   2e-39   Elaeis guineensis
ref|XP_007225619.1|  hypothetical protein PRUPE_ppa004701mg             152   2e-39   Prunus persica
ref|XP_008806186.1|  PREDICTED: cyclin-A1-4 isoform X1                  151   4e-39   Phoenix dactylifera
gb|KJB64518.1|  hypothetical protein B456_010G052900                    150   6e-39   Gossypium raimondii
ref|XP_007019153.1|  Cyclin A1,1, putative                              150   8e-39   
ref|XP_010915932.1|  PREDICTED: cyclin-A1-4-like isoform X2             150   2e-38   
ref|XP_006472826.1|  PREDICTED: cyclin-A1-1-like                        149   2e-38   Citrus sinensis [apfelsine]
ref|XP_010915931.1|  PREDICTED: cyclin-A1-4-like isoform X1             150   2e-38   Elaeis guineensis
ref|XP_010684698.1|  PREDICTED: cyclin-A1-4-like                        149   3e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008783212.1|  PREDICTED: cyclin-A1-4-like                        149   4e-38   Phoenix dactylifera
ref|XP_003526649.1|  PREDICTED: cyclin-A1-1-like                        148   5e-38   Glycine max [soybeans]
gb|AFK46051.1|  unknown                                                 148   7e-38   Lotus japonicus
ref|XP_009399851.1|  PREDICTED: cyclin-A1-4-like                        147   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI18983.3|  unnamed protein product                                145   1e-37   Vitis vinifera
gb|KDO80523.1|  hypothetical protein CISIN_1g017988mg                   145   2e-37   Citrus sinensis [apfelsine]
ref|XP_007137455.1|  hypothetical protein PHAVU_009G128200g             147   2e-37   Phaseolus vulgaris [French bean]
ref|XP_010260855.1|  PREDICTED: cyclin-A1-4                             146   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_004290902.1|  PREDICTED: cyclin-A1-1                             146   3e-37   Fragaria vesca subsp. vesca
ref|XP_010664179.1|  PREDICTED: cyclin-A1-1-like                        145   3e-37   
ref|XP_010095429.1|  hypothetical protein L484_013386                   145   5e-37   Morus notabilis
gb|KJB80670.1|  hypothetical protein B456_013G109600                    144   6e-37   Gossypium raimondii
ref|XP_010095430.1|  hypothetical protein L484_013387                   145   6e-37   Morus notabilis
gb|KJB80669.1|  hypothetical protein B456_013G109600                    145   7e-37   Gossypium raimondii
ref|XP_006434258.1|  hypothetical protein CICLE_v10000927mg             145   8e-37   Citrus clementina [clementine]
ref|NP_001241939.1|  uncharacterized protein LOC100776207               144   1e-36   Glycine max [soybeans]
gb|KHG23907.1|  Cyclin-A1-1 -like protein                               144   1e-36   Gossypium arboreum [tree cotton]
gb|KHN05188.1|  Cyclin-A1-1                                             144   1e-36   Glycine soja [wild soybean]
gb|KEH35323.1|  carboxy-terminal domain cyclin                          144   2e-36   Medicago truncatula
ref|XP_009126172.1|  PREDICTED: cyclin-A1-1-like                        143   2e-36   Brassica rapa
gb|ADA70359.1|  mitotic cyclin A1-like protein                          143   3e-36   Persea americana
emb|CDX85466.1|  BnaA02g03470D                                          141   7e-36   
dbj|BAC56853.1|  cyclin A1                                              142   8e-36   Silene latifolia
ref|XP_004292715.1|  PREDICTED: cyclin-A1-4-like                        142   9e-36   Fragaria vesca subsp. vesca
gb|KFK24211.1|  hypothetical protein AALP_AAs42301U000600               141   9e-36   Arabis alpina [alpine rockcress]
gb|AAA51660.1|  cyclin                                                  141   1e-35   Brassica napus [oilseed rape]
ref|XP_002455447.1|  hypothetical protein SORBIDRAFT_03g010940          141   2e-35   Sorghum bicolor [broomcorn]
gb|KHN38997.1|  Cyclin-A1-1                                             141   2e-35   Glycine soja [wild soybean]
ref|XP_002457051.1|  hypothetical protein SORBIDRAFT_03g000520          141   2e-35   
emb|CDY02719.1|  BnaC02g07160D                                          140   2e-35   
ref|XP_003545652.1|  PREDICTED: cyclin-A1-1-like                        140   4e-35   Glycine max [soybeans]
ref|XP_004967382.1|  PREDICTED: cyclin-A1-1-like                        140   6e-35   Setaria italica
ref|XP_006393746.1|  hypothetical protein EUTSA_v10011442mg             139   7e-35   Eutrema salsugineum [saltwater cress]
ref|XP_006307397.1|  hypothetical protein CARUB_v10009020mg             139   9e-35   Capsella rubella
ref|NP_175077.1|  cyclin-A1-1                                           139   1e-34   Arabidopsis thaliana [mouse-ear cress]
gb|EEC70247.1|  hypothetical protein OsI_01036                          135   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_006859067.1|  hypothetical protein AMTR_s00068p00198800          138   2e-34   Amborella trichopoda
ref|XP_002454880.1|  hypothetical protein SORBIDRAFT_03g000690          138   2e-34   Sorghum bicolor [broomcorn]
ref|XP_002893979.1|  CYCA1_1                                            138   2e-34   Arabidopsis lyrata subsp. lyrata
gb|ABG21984.1|  Cyclin, N-terminal domain containing protein, exp...    136   3e-34   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001176910.1|  Os12g0298950                                       137   3e-34   
ref|XP_004289008.1|  PREDICTED: cyclin-A1-1-like                        135   3e-34   Fragaria vesca subsp. vesca
gb|EEC70248.1|  hypothetical protein OsI_01039                          137   4e-34   Oryza sativa Indica Group [Indian rice]
sp|Q0INT0.2|CCA13_ORYSJ  RecName: Full=Cyclin-A1-3; AltName: Full...    137   6e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960667.1|  PREDICTED: cyclin-A1-3-like                        136   1e-33   Setaria italica
ref|XP_010532201.1|  PREDICTED: cyclin-A1-1-like isoform X2             136   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_010532200.1|  PREDICTED: cyclin-A1-1-like isoform X1             136   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_006472824.1|  PREDICTED: cyclin-A1-1-like isoform X1             136   1e-33   
ref|NP_001288521.1|  uncharacterized protein LOC103649996               136   1e-33   Zea mays [maize]
ref|XP_006472825.1|  PREDICTED: cyclin-A1-1-like isoform X2             136   1e-33   Citrus sinensis [apfelsine]
ref|XP_008656316.1|  PREDICTED: cyclin-A1-4-like                        129   3e-33   
ref|NP_001042512.1|  Os01g0233500                                       135   4e-33   
dbj|BAJ94732.1|  predicted protein                                      134   4e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIL50245.1|  Ttam-3A                                                 134   5e-33   Triticum turgidum [cone wheat]
gb|AIL50247.1|  Ttam-3D                                                 134   5e-33   Triticum aestivum [Canadian hard winter wheat]
emb|CDY25649.1|  BnaC05g25280D                                          133   7e-33   Brassica napus [oilseed rape]
ref|XP_006643958.1|  PREDICTED: cyclin-A1-1-like                        133   9e-33   
ref|XP_007019154.1|  Cyclin A1,1, putative isoform 1                    132   1e-32   
emb|CDM82517.1|  unnamed protein product                                133   2e-32   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006645684.1|  PREDICTED: cyclin-A1-1-like                        133   2e-32   
ref|XP_010500134.1|  PREDICTED: cyclin-A1-1-like                        132   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010461434.1|  PREDICTED: cyclin-A1-1-like                        132   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006654172.1|  PREDICTED: cyclin-A1-4-like                        130   4e-32   Oryza brachyantha
gb|AAA20237.1|  cyclin IIZm                                             131   5e-32   Zea mays [maize]
gb|ACF80031.1|  unknown                                                 131   7e-32   Zea mays [maize]
gb|ACR33952.1|  unknown                                                 131   8e-32   Zea mays [maize]
ref|XP_007161469.1|  hypothetical protein PHAVU_001G071600g             130   1e-31   Phaseolus vulgaris [French bean]
ref|XP_009145051.1|  PREDICTED: cyclin-A1-1                             129   2e-31   Brassica rapa
ref|NP_001105387.1|  cyclin2                                            129   3e-31   
dbj|BAD81374.1|  putative type A-like cyclin                            129   3e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008352624.1|  PREDICTED: cyclin-A1-1-like                        128   6e-31   
ref|XP_008653791.1|  PREDICTED: cyclin-A1-1-like                        121   9e-31   
ref|NP_001054990.1|  Os05g0237100                                       122   2e-30   
sp|Q0JPA4.2|CCA12_ORYSJ  RecName: Full=Cyclin-A1-2; AltName: Full...    127   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010521286.1|  PREDICTED: cyclin-A1-2 isoform X2                  126   3e-30   Tarenaya hassleriana [spider flower]
gb|EEC78817.1|  hypothetical protein OsI_19095                          122   4e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_010521285.1|  PREDICTED: cyclin-A1-2 isoform X1                  126   4e-30   Tarenaya hassleriana [spider flower]
ref|XP_004962646.1|  PREDICTED: cyclin-A1-1-like isoform X2             126   4e-30   
gb|KEH35322.1|  carboxy-terminal domain cyclin                          126   5e-30   Medicago truncatula
ref|XP_004962645.1|  PREDICTED: cyclin-A1-1-like isoform X1             126   5e-30   Setaria italica
ref|XP_004502519.1|  PREDICTED: cyclin-A1-1-like                        125   7e-30   
ref|XP_003566404.1|  PREDICTED: cyclin-A1-4-like                        125   9e-30   Brachypodium distachyon [annual false brome]
ref|XP_003566077.1|  PREDICTED: cyclin-A1-1-like                        125   1e-29   Brachypodium distachyon [annual false brome]
ref|XP_003630475.1|  Cyclin A-like protein                              124   2e-29   
sp|Q0DJR9.2|CCA14_ORYSJ  RecName: Full=Cyclin-A1-4; AltName: Full...    123   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|EMS46237.1|  Cyclin-A1-1                                             123   3e-29   Triticum urartu
gb|EEE62924.1|  hypothetical protein OsJ_17729                          123   4e-29   Oryza sativa Japonica Group [Japonica rice]
gb|KFK38207.1|  hypothetical protein AALP_AA3G082800                    119   5e-28   Arabis alpina [alpine rockcress]
ref|NP_177863.2|  cyclin-A1-2                                           119   8e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003566081.1|  PREDICTED: cyclin-A1-1-like                        119   9e-28   Brachypodium distachyon [annual false brome]
ref|XP_006390095.1|  hypothetical protein EUTSA_v10018521mg             119   9e-28   Eutrema salsugineum [saltwater cress]
ref|XP_002889141.1|  CYCA1_2                                            117   4e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_007019146.1|  Cyclin A1,1, putative                              110   1e-26   
gb|AAN87004.1|  cyclin A                                                111   2e-26   Populus alba [abele]
ref|XP_006302208.1|  hypothetical protein CARUB_v10020219mg             114   4e-26   
gb|KFK42133.1|  hypothetical protein AALP_AA2G215400                    113   7e-26   Arabis alpina [alpine rockcress]
ref|XP_006829270.1|  hypothetical protein AMTR_s00001p00272790          112   1e-25   
ref|XP_010428818.1|  PREDICTED: cyclin-A1-2-like                        112   1e-25   Camelina sativa [gold-of-pleasure]
gb|KDO80524.1|  hypothetical protein CISIN_1g043577mg                   112   2e-25   Citrus sinensis [apfelsine]
ref|XP_006434257.1|  hypothetical protein CICLE_v10003984mg             112   3e-25   
ref|XP_010429845.1|  PREDICTED: cyclin-A1-2-like                        112   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010471932.1|  PREDICTED: cyclin-A1-2-like                        112   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010416680.1|  PREDICTED: cyclin-A1-2-like                        111   4e-25   Camelina sativa [gold-of-pleasure]
ref|XP_009106401.1|  PREDICTED: cyclin-A1-2                             111   5e-25   Brassica rapa
emb|CDX87520.1|  BnaA07g33530D                                          111   5e-25   
ref|XP_010277154.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...    110   8e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010271484.1|  PREDICTED: putative cyclin-A3-1 isoform X2         109   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010271477.1|  PREDICTED: putative cyclin-A3-1 isoform X1         109   2e-24   Nelumbo nucifera [Indian lotus]
emb|CDX88368.1|  BnaC06g38120D                                          109   2e-24   
ref|XP_002972287.1|  hypothetical protein SELMODRAFT_412894             107   7e-24   Selaginella moellendorffii
ref|XP_001778367.1|  predicted protein                                  106   9e-24   
dbj|BAA20410.1|  A-type cyclin                                          107   1e-23   Catharanthus roseus [chatas]
ref|XP_001766438.1|  predicted protein                                  105   1e-23   
ref|XP_002984199.1|  hypothetical protein SELMODRAFT_423455             105   5e-23   Selaginella moellendorffii
ref|XP_001786071.1|  predicted protein                                  103   9e-23   
ref|XP_001764427.1|  predicted protein                                  102   2e-22   
emb|CAC27333.1|  putative A-like cyclin                                 103   2e-22   Picea abies
ref|XP_008455011.1|  PREDICTED: cyclin-A3-1-like isoform X1             102   3e-22   Cucumis melo [Oriental melon]
ref|XP_008455012.1|  PREDICTED: cyclin-A3-1-like isoform X2             102   3e-22   Cucumis melo [Oriental melon]
ref|XP_010059872.1|  PREDICTED: putative cyclin-A3-1                    102   4e-22   Eucalyptus grandis [rose gum]
gb|KGN55246.1|  hypothetical protein Csa_4G642270                       102   4e-22   Cucumis sativus [cucumbers]
ref|XP_008452613.1|  PREDICTED: putative cyclin-A3-1                    102   5e-22   
ref|XP_004141395.1|  PREDICTED: putative cyclin-A3-1-like               102   6e-22   Cucumis sativus [cucumbers]
ref|XP_001772176.1|  predicted protein                                  101   7e-22   
dbj|BAA11560.1|  cyclin                                                 103   7e-22   Adiantum capillus-veneris [maidenhair fern]
dbj|BAK05525.1|  predicted protein                                      101   1e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010688280.1|  PREDICTED: putative cyclin-A3-1                    100   1e-21   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP01248.1|  unnamed protein product                                100   2e-21   Coffea canephora [robusta coffee]
ref|XP_010906637.1|  PREDICTED: cyclin-A3-1-like                        100   2e-21   Elaeis guineensis
ref|XP_011029106.1|  PREDICTED: putative cyclin-A3-1                    100   3e-21   Populus euphratica
ref|XP_002285074.2|  PREDICTED: putative cyclin-A3-1                  99.8    4e-21   Vitis vinifera
ref|XP_006374858.1|  cyclin A3.1 family protein                       99.8    4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_001766360.1|  predicted protein                                  100   5e-21   
ref|XP_007019155.1|  Cyclin A1,1, putative isoform 2                  99.8    5e-21   
ref|XP_011069760.1|  PREDICTED: putative cyclin-A3-1                  99.4    7e-21   Sesamum indicum [beniseed]
ref|XP_011017147.1|  PREDICTED: putative cyclin-A3-1                  99.0    7e-21   Populus euphratica
emb|CDY62408.1|  BnaCnng40230D                                        97.1    7e-21   Brassica napus [oilseed rape]
gb|EEE54182.1|  hypothetical protein OsJ_01005                          100   7e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002301157.1|  cyclin A3.1 family protein                       98.6    8e-21   
ref|XP_004963009.1|  PREDICTED: cyclin-A3-2-like isoform X1           99.4    9e-21   
gb|EEE54185.1|  hypothetical protein OsJ_01008                          100   9e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011015741.1|  PREDICTED: putative cyclin-A3-1                  98.6    1e-20   Populus euphratica
ref|XP_004290941.1|  PREDICTED: putative cyclin-A3-1                  98.6    1e-20   Fragaria vesca subsp. vesca
ref|XP_008780924.1|  PREDICTED: cyclin-A3-1-like                      98.6    1e-20   Phoenix dactylifera
ref|XP_003630468.1|  Cyclin A                                           100   1e-20   
ref|XP_009794344.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  98.2    2e-20   Nicotiana sylvestris
ref|XP_001764550.1|  predicted protein                                96.7    2e-20   
ref|NP_001042509.2|  Os01g0233100                                       100   2e-20   
ref|XP_002466828.1|  hypothetical protein SORBIDRAFT_01g014850        97.8    2e-20   Sorghum bicolor [broomcorn]
ref|XP_002510134.1|  cyclin A, putative                               97.8    2e-20   Ricinus communis
ref|XP_004238117.1|  PREDICTED: putative cyclin-A3-1                  97.8    2e-20   Solanum lycopersicum
ref|XP_010936556.1|  PREDICTED: cyclin-A3-1-like                      97.4    2e-20   Elaeis guineensis
ref|XP_009351160.1|  PREDICTED: cyclin-A3-1-like                      97.1    3e-20   
gb|KDP41661.1|  hypothetical protein JCGZ_16068                       97.1    3e-20   Jatropha curcas
ref|XP_004137091.1|  PREDICTED: cyclin-A3-4-like                      97.1    3e-20   Cucumis sativus [cucumbers]
ref|XP_008787130.1|  PREDICTED: cyclin-A3-1-like                      97.1    3e-20   Phoenix dactylifera
ref|XP_011100040.1|  PREDICTED: putative cyclin-A3-1                  97.1    3e-20   Sesamum indicum [beniseed]
ref|XP_008367648.1|  PREDICTED: putative cyclin-A3-1 isoform X1       97.1    4e-20   
ref|XP_008367649.1|  PREDICTED: putative cyclin-A3-1 isoform X2       97.1    4e-20   
ref|XP_009603340.1|  PREDICTED: putative cyclin-A3-1                  97.1    4e-20   Nicotiana tomentosiformis
ref|XP_004290942.1|  PREDICTED: cyclin-A3-2-like                      96.3    5e-20   Fragaria vesca subsp. vesca
ref|XP_006362078.1|  PREDICTED: cyclin-A3-2-like                      96.3    6e-20   Solanum tuberosum [potatoes]
ref|XP_010061706.1|  PREDICTED: putative cyclin-A3-1 isoform X1       96.3    7e-20   Eucalyptus grandis [rose gum]
ref|XP_008674080.1|  PREDICTED: cyclin-A3-2-like                      96.7    8e-20   
ref|XP_006486965.1|  PREDICTED: putative cyclin-A3-1-like             96.3    8e-20   Citrus sinensis [apfelsine]
ref|XP_004159935.1|  PREDICTED: cyclin-A3-2-like                      96.7    9e-20   
ref|XP_002442399.1|  hypothetical protein SORBIDRAFT_08g019410        96.3    9e-20   Sorghum bicolor [broomcorn]
gb|KFK44638.1|  hypothetical protein AALP_AA1G284800                  95.9    1e-19   Arabis alpina [alpine rockcress]
gb|KGN43871.1|  hypothetical protein Csa_7G071600                     96.7    1e-19   Cucumis sativus [cucumbers]
gb|KFK44637.1|  hypothetical protein AALP_AA1G284800                  95.9    1e-19   Arabis alpina [alpine rockcress]
ref|NP_001146465.1|  cyclin superfamily protein, putative             95.5    1e-19   Zea mays [maize]
ref|XP_003550316.1|  PREDICTED: putative cyclin-A3-1-like isoform X1  95.5    1e-19   Glycine max [soybeans]
tpg|DAA54692.1|  TPA: cyclin superfamily protein, putative            96.7    1e-19   
ref|XP_003578446.1|  PREDICTED: cyclin-A3-2-like                      95.5    1e-19   Brachypodium distachyon [annual false brome]
ref|XP_009346867.1|  PREDICTED: cyclin-A3-1-like isoform X1           95.1    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_006422880.1|  hypothetical protein CICLE_v10028641mg           95.1    2e-19   Citrus clementina [clementine]
gb|KHG09323.1|  Cyclin-A3-2 -like protein                             95.1    2e-19   Gossypium arboreum [tree cotton]
ref|XP_006287744.1|  hypothetical protein CARUB_v10000955mg           95.9    2e-19   Capsella rubella
gb|AEX07598.1|  cyclin A3-1                                           94.4    2e-19   Brassica juncea [brown mustard]
gb|KJB58584.1|  hypothetical protein B456_009G216800                  95.1    2e-19   Gossypium raimondii
ref|XP_010549257.1|  PREDICTED: putative cyclin-A3-1 isoform X2       94.7    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_010549256.1|  PREDICTED: putative cyclin-A3-1 isoform X1       94.7    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_008377992.1|  PREDICTED: cyclin-A3-2-like                      94.7    2e-19   
gb|KHN21404.1|  Cyclin-A3-4                                           94.0    2e-19   Glycine soja [wild soybean]
ref|XP_010540385.1|  PREDICTED: putative cyclin-A3-1 isoform X2       94.7    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_010540384.1|  PREDICTED: putative cyclin-A3-1 isoform X1       94.7    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_010494276.1|  PREDICTED: putative cyclin-A3-1 isoform X2       94.4    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_008373079.1|  PREDICTED: cyclin-A3-1-like isoform X1           94.4    3e-19   
ref|XP_008367786.1|  PREDICTED: putative cyclin-A3-1                  90.9    3e-19   
ref|XP_006601271.1|  PREDICTED: putative cyclin-A3-1-like isoform X2  94.7    3e-19   Glycine max [soybeans]
ref|XP_009111667.1|  PREDICTED: cyclin-A2-1                           94.7    3e-19   Brassica rapa
emb|CDY22369.1|  BnaA06g36910D                                        94.0    3e-19   Brassica napus [oilseed rape]
ref|XP_002891340.1|  CYCA3_4                                          94.4    3e-19   
gb|KJB53898.1|  hypothetical protein B456_009G011300                  94.7    4e-19   Gossypium raimondii
ref|XP_007160891.1|  hypothetical protein PHAVU_001G025700g           94.0    4e-19   Phaseolus vulgaris [French bean]
gb|AES59369.2|  carboxy-terminal domain cyclin                        94.0    4e-19   Medicago truncatula
ref|XP_010500243.1|  PREDICTED: cyclin-A3-4 isoform X2                94.0    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010461520.1|  PREDICTED: cyclin-A3-4-like isoform X2           94.0    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_007018576.1|  Cyclin A3,1                                      94.0    5e-19   
ref|XP_010500242.1|  PREDICTED: cyclin-A3-4 isoform X1                94.0    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010461519.1|  PREDICTED: cyclin-A3-4-like isoform X1           94.0    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_003544479.1|  PREDICTED: putative cyclin-A3-1-like isoform X1  93.6    5e-19   Glycine max [soybeans]
ref|XP_007042567.1|  Cyclin A, putative                               93.6    5e-19   
ref|XP_009101815.1|  PREDICTED: putative cyclin-A3-1                  93.6    6e-19   Brassica rapa
ref|XP_010442082.1|  PREDICTED: putative cyclin-A3-1                  93.6    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010479121.1|  PREDICTED: cyclin-A3-4-like isoform X1           93.6    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010479122.1|  PREDICTED: cyclin-A3-4-like isoform X2           93.6    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006433587.1|  hypothetical protein CICLE_v10001544mg           93.6    6e-19   Citrus clementina [clementine]
ref|XP_006305073.1|  hypothetical protein CARUB_v10009441mg           93.6    6e-19   Capsella rubella
emb|CAB77269.1|  cyclin A3.1                                          93.2    7e-19   Pisum sativum [garden pea]
ref|XP_003589118.1|  Cyclin-A3-4                                      93.6    7e-19   
ref|XP_007013748.1|  Mitotic-like cyclin 3B from                      94.7    8e-19   
ref|XP_002865455.1|  CYCA3_1                                          92.8    9e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_004982444.1|  PREDICTED: cyclin-A3-1-like                      93.2    9e-19   Setaria italica
gb|KJB53897.1|  hypothetical protein B456_009G011300                  94.4    1e-18   Gossypium raimondii
ref|XP_009354143.1|  PREDICTED: putative cyclin-A3-1                  92.8    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_006578041.1|  PREDICTED: putative cyclin-A3-1-like             92.4    1e-18   Glycine max [soybeans]
ref|XP_006472254.1|  PREDICTED: cyclin-A3-4-like                      92.8    1e-18   Citrus sinensis [apfelsine]
ref|XP_009770807.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  92.4    1e-18   Nicotiana sylvestris
emb|CBI20929.3|  unnamed protein product                              92.8    1e-18   Vitis vinifera
ref|XP_002974260.1|  hypothetical protein SELMODRAFT_442428           92.4    1e-18   Selaginella moellendorffii
ref|XP_010061704.1|  PREDICTED: putative cyclin-A3-1 isoform X1       92.4    1e-18   Eucalyptus grandis [rose gum]
ref|XP_010061705.1|  PREDICTED: putative cyclin-A3-1 isoform X2       92.4    2e-18   Eucalyptus grandis [rose gum]
ref|XP_002985630.1|  hypothetical protein SELMODRAFT_234858           92.0    2e-18   Selaginella moellendorffii
emb|CAA83460.1|  cyclin 3a                                            93.2    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KHN04461.1|  Putative cyclin-A3-1                                  92.0    2e-18   Glycine soja [wild soybean]
ref|XP_006280684.1|  hypothetical protein CARUB_v10026648mg           92.0    2e-18   
emb|CDO97240.1|  unnamed protein product                              92.0    2e-18   
ref|NP_973983.1|  cyclin-A3-4                                         92.0    2e-18   
ref|NP_175156.1|  cyclin-A3-4                                         92.0    2e-18   
ref|XP_010648552.1|  PREDICTED: cyclin-A2-2-like                      93.2    2e-18   
ref|XP_008673556.1|  PREDICTED: cyclin-A2 isoform X1                  92.8    2e-18   
ref|XP_007160890.1|  hypothetical protein PHAVU_001G025600g           91.7    2e-18   
ref|NP_001147065.1|  cyclin-A2                                        92.4    2e-18   
ref|XP_009360192.1|  PREDICTED: putative cyclin-A3-1                  91.7    3e-18   
ref|NP_001288902.1|  cyclin-A3-4-like                                 91.7    3e-18   
emb|CDY19803.1|  BnaA09g04560D                                        94.4    3e-18   
ref|XP_006342652.1|  PREDICTED: putative cyclin-A3-1-like             91.3    3e-18   
ref|NP_199122.1|  cyclin A3-1                                         91.3    3e-18   
ref|XP_009404125.1|  PREDICTED: cyclin-A3-1-like                      91.3    3e-18   
emb|CDY17037.1|  BnaA08g04010D                                        91.3    3e-18   
ref|XP_008680494.1|  PREDICTED: cyclin-A1-2-like                      87.8    4e-18   
ref|XP_007227627.1|  hypothetical protein PRUPE_ppa024921mg           91.3    4e-18   
ref|XP_008360979.1|  PREDICTED: putative cyclin-A3-1                  91.3    4e-18   
ref|XP_009124590.1|  PREDICTED: cyclin-A3-4-like isoform X4           91.3    4e-18   
ref|XP_004292743.1|  PREDICTED: cyclin-A3-2-like                      90.9    4e-18   
ref|XP_006403300.1|  hypothetical protein EUTSA_v10003238mg           90.9    4e-18   
ref|XP_009124588.1|  PREDICTED: cyclin-A3-4-like isoform X2           91.3    4e-18   
ref|XP_010556425.1|  PREDICTED: putative cyclin-A3-1                  91.3    4e-18   
ref|XP_009124587.1|  PREDICTED: cyclin-A3-4-like isoform X1           91.3    5e-18   
ref|XP_010454867.1|  PREDICTED: cyclin-A2-1-like                      92.0    5e-18   
ref|XP_009123514.1|  PREDICTED: cyclin-A3-4-like isoform X1           90.9    6e-18   
ref|XP_008220357.1|  PREDICTED: putative cyclin-A3-1                  90.5    6e-18   
ref|XP_010491850.1|  PREDICTED: cyclin-A2-2                           91.3    6e-18   
ref|XP_009123515.1|  PREDICTED: cyclin-A3-4-like isoform X2           90.5    6e-18   
ref|XP_002874258.1|  CYCA2_1                                          91.3    6e-18   
ref|XP_006342653.1|  PREDICTED: cyclin-A3-2-like                      90.5    6e-18   
ref|XP_007224323.1|  hypothetical protein PRUPE_ppa020376mg           90.5    7e-18   
ref|XP_006393612.1|  hypothetical protein EUTSA_v10011575mg           90.5    7e-18   
ref|XP_006379173.1|  hypothetical protein POPTR_0009s09610g           89.0    7e-18   
emb|CDY06752.1|  BnaA10g05310D                                        89.7    7e-18   
ref|XP_006393613.1|  hypothetical protein EUTSA_v10011575mg           90.5    7e-18   
ref|XP_009627918.1|  PREDICTED: putative cyclin-A3-1                  90.5    7e-18   
ref|XP_010322316.1|  PREDICTED: cyclin A2 isoform X1                  91.7    8e-18   
ref|NP_001233768.1|  cyclin A2                                        91.7    8e-18   
ref|XP_009600841.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  90.1    8e-18   
gb|EYU22092.1|  hypothetical protein MIMGU_mgv1a022268mg              89.7    9e-18   
ref|XP_002972285.1|  hypothetical protein SELMODRAFT_412891           91.3    9e-18   
gb|AFK65510.1|  cyclin A                                              90.1    1e-17   
ref|XP_010520744.1|  PREDICTED: putative cyclin-A3-1 isoform X2       90.1    1e-17   
gb|AAT73638.1|  unknown protein, contains cyclins regulate cyclin...  90.9    1e-17   
ref|XP_004136337.1|  PREDICTED: cyclin-A2-2-like                      91.3    1e-17   
ref|NP_568248.2|  cyclin-A2-2                                         90.9    1e-17   
emb|CAB96665.1|  cyclin 3b                                            90.5    1e-17   
ref|XP_010494275.1|  PREDICTED: putative cyclin-A3-1 isoform X1       89.7    1e-17   
emb|CDY47595.1|  BnaC08g04650D                                        89.7    1e-17   
ref|XP_009354145.1|  PREDICTED: putative cyclin-A3-1 isoform X2       89.7    1e-17   
ref|XP_004499016.1|  PREDICTED: putative cyclin-A3-1-like isoform X1  89.7    1e-17   
ref|XP_008444589.1|  PREDICTED: cyclin-A3-2-like                      89.7    1e-17   
ref|XP_004252819.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  89.7    1e-17   
ref|XP_007136725.1|  hypothetical protein PHAVU_009G069000g           89.4    1e-17   
ref|XP_009354144.1|  PREDICTED: putative cyclin-A3-1 isoform X1       89.7    1e-17   
ref|XP_004499017.1|  PREDICTED: putative cyclin-A3-1-like isoform X2  89.7    1e-17   
gb|KJB35078.1|  hypothetical protein B456_006G100200                  90.9    1e-17   
emb|CDY17091.1|  BnaC06g00240D                                        89.4    1e-17   
ref|XP_010419687.1|  PREDICTED: cyclin-A2-2-like                      90.5    1e-17   
ref|XP_006287786.1|  hypothetical protein CARUB_v10000996mg           90.5    1e-17   
ref|XP_003636827.1|  Cyclin A-like protein                            88.6    2e-17   
ref|XP_010421392.1|  PREDICTED: cyclin-A2-1                           90.1    2e-17   
ref|XP_002984197.1|  hypothetical protein SELMODRAFT_423452           90.1    2e-17   
gb|KDP32289.1|  hypothetical protein JCGZ_13214                       90.5    2e-17   
ref|XP_006393614.1|  hypothetical protein EUTSA_v10011590mg           89.0    2e-17   
emb|CDX92090.1|  BnaA05g23170D                                        89.0    2e-17   
ref|XP_006577871.1|  PREDICTED: mitotic cyclin a2-type isoform X1     90.5    2e-17   
emb|CDY66770.1|  BnaCnng52280D                                        89.0    2e-17   
ref|XP_003597807.1|  Cyclin A2                                        87.4    2e-17   
gb|KHF99283.1|  Cyclin-A3-2 -like protein                             89.4    2e-17   
ref|XP_009146066.1|  PREDICTED: cyclin-A1-2-like                      89.0    3e-17   
gb|ACG41795.1|  cyclin-A2                                             88.6    3e-17   
ref|XP_002873505.1|  hypothetical protein ARALYDRAFT_350326           89.7    3e-17   
ref|XP_004142880.1|  PREDICTED: cyclin-A3-2-like                      88.6    3e-17   
ref|XP_011087041.1|  PREDICTED: cyclin-A2-2-like                      89.7    3e-17   
ref|XP_008347610.1|  PREDICTED: putative cyclin-A3-1 isoform X2       88.2    3e-17   
ref|NP_197920.2|  cyclin a2;1                                         89.4    4e-17   
ref|XP_002891337.1|  CYCA3_2                                          88.6    4e-17   
ref|XP_010461514.1|  PREDICTED: cyclin-A3-2                           88.6    4e-17   
ref|XP_010479118.1|  PREDICTED: cyclin-A3-2-like                      88.2    4e-17   
ref|XP_008804857.1|  PREDICTED: cyclin-A2-1-like                      89.7    4e-17   
ref|XP_008347609.1|  PREDICTED: putative cyclin-A3-1 isoform X1       88.2    4e-17   
ref|XP_010500240.1|  PREDICTED: cyclin-A3-2-like                      88.2    4e-17   
ref|NP_564499.3|  cyclin-dependent protein kinase 3;2                 88.2    4e-17   
sp|Q39071.3|CCA21_ARATH  RecName: Full=Cyclin-A2-1; AltName: Full...  89.4    4e-17   
gb|AAC98445.1|  cyclin 3a                                             89.0    4e-17   
ref|XP_008220286.1|  PREDICTED: putative cyclin-A3-1                  88.2    4e-17   
ref|XP_010228999.1|  PREDICTED: cyclin-A3-2-like isoform X2           87.4    4e-17   
ref|XP_006305132.1|  hypothetical protein CARUB_v10009501mg           88.2    4e-17   
emb|CDX97090.1|  BnaC09g45350D                                        89.0    5e-17   
ref|XP_006476192.1|  PREDICTED: cyclin-A2-1-like                      89.4    5e-17   
ref|XP_004252748.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  87.8    5e-17   
ref|XP_010917639.1|  PREDICTED: cyclin-A2-1-like                      89.4    5e-17   
gb|EPS73971.1|  hypothetical protein M569_00786                       87.4    6e-17   
ref|XP_010932850.1|  PREDICTED: cyclin-A2-1-like                      89.4    6e-17   
emb|CDY06757.1|  BnaA10g05360D                                        87.8    6e-17   
ref|XP_009123450.1|  PREDICTED: cyclin-A3-2                           87.8    6e-17   
gb|KFK44639.1|  hypothetical protein AALP_AA1G284900                  87.8    6e-17   
emb|CAA83277.1|  cyclin 3b                                            88.6    6e-17   
ref|XP_009128429.1|  PREDICTED: cyclin-A2-4-like                      88.6    7e-17   
ref|NP_001237783.1|  mitotic cyclin a2-type                           89.0    7e-17   
ref|XP_006342651.1|  PREDICTED: putative cyclin-A3-1-like             87.4    7e-17   
gb|KJB63916.1|  hypothetical protein B456_010G024100                  87.8    8e-17   
ref|XP_010453174.1|  PREDICTED: cyclin-A2-2-like                      88.2    8e-17   
gb|AES68059.2|  carboxy-terminal domain cyclin                        88.2    8e-17   
gb|EYU36354.1|  hypothetical protein MIMGU_mgv1a008278mg              87.4    8e-17   
ref|XP_006596120.1|  PREDICTED: cyclin-A2-2-like isoform X1           88.2    9e-17   
gb|KFK31753.1|  hypothetical protein AALP_AA6G154900                  87.0    9e-17   
ref|XP_003558533.1|  PREDICTED: cyclin-A3-2-like isoform X1           87.4    1e-16   
emb|CDY17039.1|  BnaA08g04030D                                        87.0    1e-16   
gb|KFK31754.1|  hypothetical protein AALP_AA6G154900                  87.0    1e-16   
ref|XP_003526434.1|  PREDICTED: cyclin-A2-2-like                      88.2    1e-16   
gb|KEH35767.1|  carboxy-terminal domain cyclin                        86.3    1e-16   
ref|XP_004501282.1|  PREDICTED: cyclin-A2-1-like isoform X1           88.6    1e-16   
ref|XP_008466372.1|  PREDICTED: cyclin-A2-2                           88.6    1e-16   
emb|CDY47596.1|  BnaC08g04660D                                        87.0    1e-16   
ref|XP_011001434.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  87.0    1e-16   
ref|XP_009124592.1|  PREDICTED: cyclin-A3-2-like                      87.0    1e-16   
ref|XP_004501805.1|  PREDICTED: putative cyclin-A3-1-like             87.0    1e-16   
gb|AFK37644.1|  unknown                                               88.2    1e-16   
emb|CDX87305.1|  BnaA07g35680D                                        88.2    1e-16   
ref|XP_004252821.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  86.7    1e-16   
emb|CDX79389.1|  BnaC06g19140D                                        87.8    1e-16   
ref|XP_007136726.1|  hypothetical protein PHAVU_009G069100g           86.7    1e-16   
gb|AAA90946.1|  cyclin 3c                                             85.5    1e-16   
ref|XP_001772222.1|  predicted protein                                85.9    1e-16   
ref|XP_011001425.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  86.7    1e-16   
ref|NP_001136529.1|  cyclin superfamily protein, putative             86.7    1e-16   
gb|EPS61050.1|  a-type cyclin                                         86.7    1e-16   
ref|XP_011001416.1|  PREDICTED: G2/mitotic-specific cyclin C13-1-...  87.0    1e-16   
ref|XP_004486712.1|  PREDICTED: cyclin-A2-4-like isoform X3           87.4    2e-16   
ref|XP_004486710.1|  PREDICTED: cyclin-A2-4-like isoform X1           87.4    2e-16   
gb|KJB47332.1|  hypothetical protein B456_008G021600                  85.5    2e-16   
ref|XP_002891338.1|  CYCA3_3                                          86.3    2e-16   
ref|XP_004501542.1|  PREDICTED: putative cyclin-A3-1-like isoform X2  86.3    2e-16   
ref|XP_004501541.1|  PREDICTED: putative cyclin-A3-1-like isoform X1  86.3    2e-16   
ref|XP_010109038.1|  hypothetical protein L484_007372                 87.4    2e-16   
emb|CDY37592.1|  BnaA02g19780D                                        87.4    2e-16   
ref|XP_011074386.1|  PREDICTED: putative cyclin-A3-1                  86.3    2e-16   
gb|KHG05835.1|  Cyclin-A2-2 -like protein                             86.3    2e-16   
ref|XP_006416893.1|  hypothetical protein EUTSA_v10007623mg           87.4    2e-16   
ref|XP_004292087.1|  PREDICTED: putative cyclin-A3-1                  85.9    2e-16   
emb|CDX69768.1|  BnaA10g21170D                                        87.0    2e-16   
ref|XP_009777214.1|  PREDICTED: putative cyclin-A3-1                  86.3    2e-16   
ref|XP_006450559.1|  hypothetical protein CICLE_v10008128mg           87.0    3e-16   
ref|XP_003523987.1|  PREDICTED: putative cyclin-A3-1-like             85.5    3e-16   
emb|CDX67944.1|  BnaA07g19840D                                        86.7    3e-16   
gb|KHN04463.1|  Putative cyclin-A3-1                                  85.5    3e-16   
ref|XP_010493797.1|  PREDICTED: cyclin-A2-1-like                      86.7    3e-16   
gb|KJB47330.1|  hypothetical protein B456_008G021600                  85.9    4e-16   
ref|XP_006469769.1|  PREDICTED: cyclin-A2-3-like                      84.7    4e-16   
ref|XP_006353656.1|  PREDICTED: cyclin-A2-1-like                      86.7    4e-16   
ref|XP_009121968.1|  PREDICTED: cyclin-A2-2                           86.3    4e-16   
emb|CDY38664.1|  BnaC02g23150D                                        86.3    4e-16   
ref|XP_006342724.1|  PREDICTED: cyclin-A3-2-like                      85.1    4e-16   
ref|XP_009104457.1|  PREDICTED: cyclin-A2-4-like                      86.3    5e-16   
ref|NP_001147088.1|  cyclin-A2                                        86.7    5e-16   
ref|XP_010463231.1|  PREDICTED: cyclin-A3-3-like                      84.7    5e-16   
ref|XP_007200054.1|  hypothetical protein PRUPE_ppa023592mg           85.1    5e-16   
ref|XP_011088191.1|  PREDICTED: putative cyclin-A3-1                  85.1    5e-16   
ref|XP_002280592.1|  PREDICTED: cyclin-A2-3 isoform X1                86.3    6e-16   
ref|XP_010654713.1|  PREDICTED: cyclin-A2-4 isoform X2                86.3    6e-16   
ref|XP_010539515.1|  PREDICTED: cyclin-A2-4-like                      86.3    6e-16   
ref|XP_009117821.1|  PREDICTED: cyclin-A2-3-like isoform X3           85.1    6e-16   
ref|XP_009390435.1|  PREDICTED: cyclin-A3-1-like                      85.5    6e-16   
ref|XP_003562292.1|  PREDICTED: cyclin-A3-1-like                      84.7    6e-16   
ref|XP_010670758.1|  PREDICTED: cyclin-A2-2 isoform X2                86.3    7e-16   
ref|XP_010670757.1|  PREDICTED: cyclin-A2-2 isoform X1                86.3    7e-16   
ref|XP_010459099.1|  PREDICTED: cyclin-A2-3-like                      85.9    7e-16   
ref|XP_010049038.1|  PREDICTED: cyclin-A2-1-like isoform X4           85.9    7e-16   
ref|XP_009106755.1|  PREDICTED: cyclin-A2-4-like isoform X1           85.9    7e-16   
ref|XP_006399631.1|  hypothetical protein EUTSA_v10013593mg           85.5    7e-16   
ref|XP_010049037.1|  PREDICTED: cyclin-A2-1-like isoform X3           85.9    7e-16   
emb|CDY23653.1|  BnaA05g17760D                                        84.7    7e-16   
emb|CDX81722.1|  BnaC08g38790D                                        85.1    8e-16   
ref|XP_009106758.1|  PREDICTED: cyclin-A2-4-like isoform X2           85.9    8e-16   
ref|XP_010497247.1|  PREDICTED: cyclin-A2-3 isoform X1                85.5    8e-16   
ref|XP_003523612.1|  PREDICTED: putative cyclin-A3-1-like isoform X1  84.3    8e-16   
ref|XP_010497255.1|  PREDICTED: cyclin-A2-3 isoform X2                85.5    8e-16   
ref|XP_009145034.1|  PREDICTED: cyclin-A3-2-like                      84.3    8e-16   
ref|XP_010049036.1|  PREDICTED: cyclin-A2-1-like isoform X2           85.9    8e-16   
ref|XP_009117820.1|  PREDICTED: cyclin-A2-3-like isoform X2           85.1    8e-16   
ref|XP_009117818.1|  PREDICTED: cyclin-A2-3-like isoform X1           85.1    8e-16   
emb|CDY41784.1|  BnaC02g13720D                                        84.3    8e-16   
emb|CDY53304.1|  BnaA09g56610D                                        85.1    9e-16   
ref|XP_004252747.1|  PREDICTED: putative cyclin-A3-1                  84.3    9e-16   
ref|XP_008236404.1|  PREDICTED: cyclin-A3-4-like                      84.3    9e-16   
ref|XP_010049034.1|  PREDICTED: cyclin-A2-1-like isoform X1           85.9    9e-16   
ref|XP_010476648.1|  PREDICTED: cyclin-A2-3-like                      85.5    9e-16   
gb|ACG42494.1|  cyclin-A2                                             85.5    9e-16   
gb|KHN04460.1|  Putative cyclin-A3-1                                  84.0    9e-16   
ref|XP_008643574.1|  PREDICTED: cyclin-A2 isoform X1                  85.5    9e-16   
ref|XP_006371725.1|  hypothetical protein POPTR_0018s01140g           84.3    1e-15   
ref|XP_006356489.1|  PREDICTED: cyclin-A3-4-like                      84.3    1e-15   
dbj|BAA09367.1|  A-type cyclin                                        85.5    1e-15   
ref|XP_006303782.1|  hypothetical protein CARUB_v10012028mg           83.6    1e-15   
ref|XP_010249891.1|  PREDICTED: cyclin-A2-4-like                      85.5    1e-15   
gb|EMT11280.1|  Putative cyclin-F3-2                                  83.2    1e-15   
ref|NP_001234787.1|  cyclin A3                                        84.3    1e-15   
ref|XP_009758618.1|  PREDICTED: cyclin-A2-2-like isoform X2           85.5    1e-15   
ref|NP_001151751.1|  cyclin-A2                                        85.5    1e-15   
ref|XP_009595773.1|  PREDICTED: cyclin-A2-2-like isoform X1           85.5    1e-15   
gb|KHN08097.1|  Cyclin-A2-2                                           85.1    1e-15   
ref|XP_011019732.1|  PREDICTED: cyclin-A2-2                           85.1    1e-15   
ref|XP_010537945.1|  PREDICTED: cyclin-A2-4-like isoform X1           85.1    1e-15   
ref|XP_001772175.1|  predicted protein                                83.2    1e-15   
ref|XP_006427108.1|  hypothetical protein CICLE_v10025498mg           85.1    1e-15   
ref|XP_006465433.1|  PREDICTED: cyclin-A2-4-like                      85.1    1e-15   
ref|XP_010254232.1|  PREDICTED: cyclin-A2-4-like                      85.1    2e-15   
ref|XP_009758609.1|  PREDICTED: cyclin-A2-2-like isoform X1           85.1    2e-15   
gb|KHN04464.1|  Putative cyclin-A3-1                                  82.8    2e-15   
sp|P25010.1|CCNAL_DAUCA  RecName: Full=G2/mitotic-specific cyclin...  83.6    2e-15   
ref|XP_010061967.1|  PREDICTED: cyclin-A2-3 isoform X1                84.7    2e-15   
gb|KCW69015.1|  hypothetical protein EUGRSUZ_F02573                   84.7    2e-15   
ref|XP_006307500.1|  hypothetical protein CARUB_v10009125mg           84.7    2e-15   
ref|XP_010061968.1|  PREDICTED: cyclin-A2-3 isoform X2                84.7    2e-15   
ref|XP_007135712.1|  hypothetical protein PHAVU_010G151900g           84.7    2e-15   
ref|XP_010647951.1|  PREDICTED: cyclin-A3-4-like                      83.2    2e-15   
ref|XP_007161259.1|  hypothetical protein PHAVU_001G055400g           84.3    2e-15   
emb|CDY39984.1|  BnaC06g40620D                                        84.3    2e-15   



>ref|XP_009796391.1| PREDICTED: cyclin-A1-4 [Nicotiana sylvestris]
 emb|CAA63543.1| cyclin A-like protein [Nicotiana tabacum]
Length=482

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  SLQLEH ASY+AELSLL Y+MLCY+PS++AASAIFLA+Y L PSKKPWNSTLRHYT
Sbjct  363  NEVLSLQLEHLASYIAELSLLEYNMLCYAPSVIAASAIFLAKYILLPSKKPWNSTLRHYT  422

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            LYQPSDLRDCVMALH+LCCN+++SSLPAIREKYSQHKYKFVAKK CP +IP EFFQ++S
Sbjct  423  LYQPSDLRDCVMALHSLCCNNNNSSLPAIREKYSQHKYKFVAKKYCPPTIPVEFFQNIS  481



>emb|CAA63542.1| cyclin A-like protein [Nicotiana tabacum]
Length=483

 Score =   177 bits (450),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  SLQLEH ASY+AELSLL Y+MLCY+PS++AASAIFLA+Y L PSKKPWNSTLRHYT
Sbjct  364  NEVLSLQLEHLASYIAELSLLEYNMLCYAPSVIAASAIFLAKYILLPSKKPWNSTLRHYT  423

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            LYQPSDLRDCV+ALH+LCCN+++SSLPAIREKYSQHKYKFVAKK CP +IP EFFQ++S
Sbjct  424  LYQPSDLRDCVVALHSLCCNNNNSSLPAIREKYSQHKYKFVAKKYCPPTIPVEFFQNIS  482



>dbj|BAA09366.1| A-type cyclin [Nicotiana tabacum]
Length=483

 Score =   177 bits (450),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  SLQLEH ASY+AELSLL Y+MLCY+PS++AASAIFLA+Y L PSKKPWNSTLRHYT
Sbjct  364  NEVLSLQLEHLASYIAELSLLEYNMLCYAPSVIAASAIFLAKYILLPSKKPWNSTLRHYT  423

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            LYQPSDLRDCV+ALH+LCCN+++SSLPAIREKYSQHKYKFVAKK CP +IP EFFQ++S
Sbjct  424  LYQPSDLRDCVVALHSLCCNNNNSSLPAIREKYSQHKYKFVAKKYCPPTIPVEFFQNIS  482



>ref|XP_010312445.1| PREDICTED: cyclin A1 isoform X1 [Solanum lycopersicum]
Length=489

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  SLQLEH ASY+AELSLL Y+MLCY+PSL+AASAIFLA+Y L PS KPWNSTLRHYT
Sbjct  370  NEVLSLQLEHLASYIAELSLLEYNMLCYAPSLIAASAIFLAKYILLPSVKPWNSTLRHYT  429

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            LYQPSDLRDCV+ALH+LCCN+++SSLPA+REKYSQHKYKFVAKK CP ++P EFFQ++SS
Sbjct  430  LYQPSDLRDCVLALHSLCCNNNNSSLPAVREKYSQHKYKFVAKKYCPPTVPVEFFQNISS  489



>ref|XP_009593178.1| PREDICTED: cyclin-A1-4 isoform X2 [Nicotiana tomentosiformis]
Length=483

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  SLQLEH ASY+AELSLL Y+MLCY+PS++A SAIFLA+Y L PSKKPWNSTLRHYT
Sbjct  364  NEVLSLQLEHLASYIAELSLLEYNMLCYAPSVIAGSAIFLAKYILLPSKKPWNSTLRHYT  423

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            LYQPSDLRDCV+ALH+LCCN+++SSLPAIREKYSQHKYKFVAKK CP +IP EFFQ++S
Sbjct  424  LYQPSDLRDCVVALHSLCCNNNNSSLPAIREKYSQHKYKFVAKKYCPPTIPVEFFQNIS  482



>ref|XP_009593177.1| PREDICTED: cyclin-A1-4 isoform X1 [Nicotiana tomentosiformis]
Length=484

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  SLQLEH ASY+AELSLL Y+MLCY+PS++A SAIFLA+Y L PSKKPWNSTLRHYT
Sbjct  365  NEVLSLQLEHLASYIAELSLLEYNMLCYAPSVIAGSAIFLAKYILLPSKKPWNSTLRHYT  424

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            LYQPSDLRDCV+ALH+LCCN+++SSLPAIREKYSQHKYKFVAKK CP +IP EFFQ++S
Sbjct  425  LYQPSDLRDCVVALHSLCCNNNNSSLPAIREKYSQHKYKFVAKKYCPPTIPVEFFQNIS  483



>ref|NP_001233762.1| cyclin A1 [Solanum lycopersicum]
 emb|CAB46641.1| cyclin A1 [Solanum lycopersicum]
Length=490

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  SLQLEH ASY+AELSLL Y+MLCY+PSL+AASAIFLA+Y L PS KPWNSTLRHYT
Sbjct  371  NEVLSLQLEHLASYIAELSLLEYNMLCYAPSLIAASAIFLAKYILLPSVKPWNSTLRHYT  430

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            LYQPSDLRDCV+ALH+LCCN+++SSLPA+REKYSQHKYKFVAKK CP ++P EFFQ++SS
Sbjct  431  LYQPSDLRDCVLALHSLCCNNNNSSLPAVREKYSQHKYKFVAKKYCPPTVPVEFFQNISS  490



>ref|XP_006351136.1| PREDICTED: cyclin-A1-3-like isoform X1 [Solanum tuberosum]
Length=488

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  SLQLEH ASY+AELSLL Y+ML Y+PSL+AASAIFLA+Y L PS KPWNSTLRHYT
Sbjct  369  NEVLSLQLEHLASYIAELSLLEYNMLSYAPSLIAASAIFLAKYILLPSVKPWNSTLRHYT  428

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            LYQPSDL+DCVMALH+LCCN+++SSLPA+REKYSQHKYKFVAKK CP ++P EFFQ++SS
Sbjct  429  LYQPSDLQDCVMALHSLCCNNNNSSLPAVREKYSQHKYKFVAKKYCPPTVPVEFFQNISS  488



>ref|XP_006351137.1| PREDICTED: cyclin-A1-3-like isoform X2 [Solanum tuberosum]
Length=487

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  SLQLEH ASY+AELSLL Y+ML Y+PSL+AASAIFLA+Y L PS KPWNSTLRHYT
Sbjct  368  NEVLSLQLEHLASYIAELSLLEYNMLSYAPSLIAASAIFLAKYILLPSVKPWNSTLRHYT  427

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            LYQPSDL+DCVMALH+LCCN+++SSLPA+REKYSQHKYKFVAKK CP ++P EFFQ++SS
Sbjct  428  LYQPSDLQDCVMALHSLCCNNNNSSLPAVREKYSQHKYKFVAKKYCPPTVPVEFFQNISS  487



>ref|XP_006351138.1| PREDICTED: cyclin-A1-3-like isoform X3 [Solanum tuberosum]
Length=483

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            +ML Y+PSL+AASAIFLA+Y L PS KPWNSTLRHYTLYQPSDL+DCVMALH+LCCN+++
Sbjct  387  NMLSYAPSLIAASAIFLAKYILLPSVKPWNSTLRHYTLYQPSDLQDCVMALHSLCCNNNN  446

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            SSLPA+REKYSQHKYKFVAKK CP ++P EFFQ++SS
Sbjct  447  SSLPAVREKYSQHKYKFVAKKYCPPTVPVEFFQNISS  483



>emb|CDP10969.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  678  EASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTL  499
            EA SLQLE  A+Y+AELSLL Y MLCY+PSL+AAS IFLA+Y L P+K+PWNSTLRHYTL
Sbjct  386  EAQSLQLECLANYIAELSLLEYSMLCYAPSLIAASTIFLAKYILVPAKRPWNSTLRHYTL  445

Query  498  YQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            YQPSDL DCV ALH+LC  SH+SSLPAIREKYSQHKYKFVAKK CP SIP EFFQ+VSS
Sbjct  446  YQPSDLHDCVKALHSLCSGSHNSSLPAIREKYSQHKYKFVAKKYCPPSIPPEFFQNVSS  504



>ref|XP_002284567.1| PREDICTED: cyclin-A1-1-like [Vitis vinifera]
Length=495

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  SLQLE  A+Y+AELSLL Y MLCY+PSL+AASAIFLA Y L PSK+PWNSTLRHYT
Sbjct  376  NEVPSLQLECLANYIAELSLLEYSMLCYAPSLIAASAIFLANYILLPSKRPWNSTLRHYT  435

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            LYQPSDL DCV ALH LCCN+H+SSLPAIREKYSQHKYKFVAKK CP SIPSE F ++S+
Sbjct  436  LYQPSDLCDCVKALHRLCCNNHNSSLPAIREKYSQHKYKFVAKKYCPPSIPSELFHNLSN  495



>emb|CBI18982.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  SLQLE  A+Y+AELSLL Y MLCY+PSL+AASAIFLA Y L PSK+PWNSTLRHYT
Sbjct  431  NEVPSLQLECLANYIAELSLLEYSMLCYAPSLIAASAIFLANYILLPSKRPWNSTLRHYT  490

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            LYQPSDL DCV ALH LCCN+H+SSLPAIREKYSQHKYKFVAKK CP SIPSE F ++S+
Sbjct  491  LYQPSDLCDCVKALHRLCCNNHNSSLPAIREKYSQHKYKFVAKKYCPPSIPSELFHNLSN  550



>dbj|BAE06271.1| cyclin A [Scutellaria baicalensis]
Length=496

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLC++PSL+AA++IFLAR+ L PSK+PWN TLRHYTLYQP DLRDCV+ALH  CCNSH+S
Sbjct  401  MLCFAPSLIAAASIFLARFILLPSKRPWNHTLRHYTLYQPYDLRDCVLALHGFCCNSHNS  460

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            SLPAIREKYSQHKYKFVAKK CP SIP E+F +VSS
Sbjct  461  SLPAIREKYSQHKYKFVAKKYCPLSIPPEYFHNVSS  496



>gb|AEV43294.1| cyclin A1 [Nicotiana benthamiana]
Length=127

 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  SLQLEH ASY+AELSLL Y+MLCY+PS++AASAIFLA++ L PSKKPWNSTLRHYT
Sbjct  19   NEVLSLQLEHLASYIAELSLLEYNMLCYAPSVIAASAIFLAKFILLPSKKPWNSTLRHYT  78

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICP  361
            LYQPSDLRDCVMALH+LCCN+++SSLPAIREKYSQHKYKFVAKK CP
Sbjct  79   LYQPSDLRDCVMALHSLCCNNNNSSLPAIREKYSQHKYKFVAKKYCP  125



>ref|XP_006386358.1| hypothetical protein POPTR_0002s08020g [Populus trichocarpa]
 gb|ERP64155.1| hypothetical protein POPTR_0002s08020g [Populus trichocarpa]
Length=499

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  S+QLE  A+Y+AELSLL Y MLCY+PSLVAASAIFLA+Y L PSK+PWNSTL+HYT
Sbjct  380  NEVPSMQLECLANYIAELSLLEYSMLCYAPSLVAASAIFLAKYILLPSKRPWNSTLQHYT  439

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            LY+P DL DCV  LH LCC +H+S+LPAIREKYSQHKYKFVAKK CP SIP EFFQ++ S
Sbjct  440  LYEPVDLSDCVKDLHRLCCGNHNSTLPAIREKYSQHKYKFVAKKYCPPSIPGEFFQNLGS  499



>ref|XP_011102309.1| PREDICTED: cyclin-A1-1 [Sesamum indicum]
Length=495

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NEA  LQLE  A+Y+AELSLL Y MLC++PSL+AAS+IFLA++ L PSK+PWNSTL+HYT
Sbjct  376  NEAPLLQLECMANYIAELSLLEYSMLCFAPSLIAASSIFLAKFILVPSKRPWNSTLQHYT  435

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            LYQ  DLR+CV+ALH LCCNSH+SSLPAIREKYSQHKYKFVAKK CP S+P E+F D SS
Sbjct  436  LYQSRDLRNCVLALHGLCCNSHNSSLPAIREKYSQHKYKFVAKKYCPPSVPPEYFHDESS  495



>gb|EYU32511.1| hypothetical protein MIMGU_mgv1a005475mg [Erythranthe guttata]
Length=482

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NEA  LQLE  A+Y+AELSLL Y+MLC++PSL+AAS+IFLA++ L PS +PW+STLRHYT
Sbjct  363  NEAPLLQLECLANYIAELSLLEYNMLCFAPSLIAASSIFLAKFILAPSNRPWDSTLRHYT  422

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            LYQP DLRDCV+ALH LCCNS  S+LPA+REKYSQHKYKFVAKK CP SIP+E+F +VSS
Sbjct  423  LYQPYDLRDCVVALHGLCCNSQSSNLPAVREKYSQHKYKFVAKKYCPQSIPAEYFYNVSS  482



>ref|XP_011027470.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
 ref|XP_011027471.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=499

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  S+QLE  A+Y+AELSLL Y MLCY+PSLVAASAIFLA+Y L P+K+PWNSTL+HYT
Sbjct  380  NEVPSMQLECLANYIAELSLLEYSMLCYAPSLVAASAIFLAKYILLPTKRPWNSTLQHYT  439

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            LY+P DL DCV  LH LCC +H+S+LPAIREKYSQHKYKFVAKK CP SIP EFFQ++ 
Sbjct  440  LYEPVDLSDCVKDLHRLCCGNHNSTLPAIREKYSQHKYKFVAKKYCPPSIPGEFFQNLG  498



>ref|XP_011027473.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
 ref|XP_011027474.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=499

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  S+QLE  A+Y+AELSLL Y MLCY+PSLVAASAIFLA+Y L P+K+PWNSTL+HYT
Sbjct  380  NEVPSMQLECLANYIAELSLLEYSMLCYAPSLVAASAIFLAKYILLPTKRPWNSTLQHYT  439

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            LY+P DL DCV  LH LCC +H+S+LPAIREKYSQHKYKFVAKK CP SIP EFFQ++ 
Sbjct  440  LYEPVDLSDCVKDLHRLCCGNHNSTLPAIREKYSQHKYKFVAKKYCPPSIPGEFFQNLG  498



>ref|XP_008219599.1| PREDICTED: cyclin-A1-4-like [Prunus mume]
Length=514

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
             EA SLQL+  A Y+AELSLL Y MLCY+PSL+AASA FLA+Y L+PSKKPWNSTLRHYT
Sbjct  395  GEAPSLQLQCLAFYIAELSLLEYSMLCYAPSLIAASAAFLAKYILSPSKKPWNSTLRHYT  454

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            LYQ +DL DCV ALH LCCN   S LPA+REKY QHKYKFVAKK CP SIP+EFFQD++S
Sbjct  455  LYQAADLFDCVKALHRLCCNGCSSDLPAVREKYCQHKYKFVAKKYCPPSIPTEFFQDLNS  514



>ref|XP_002520329.1| cyclin A, putative [Ricinus communis]
 gb|EEF42115.1| cyclin A, putative [Ricinus communis]
Length=498

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  S+QLE  A+Y+ ELSLL Y ML Y PSL+AASAIFLA+Y L PS++PWNSTL+HYT
Sbjct  379  NEVPSMQLECLANYITELSLLEYTMLGYVPSLIAASAIFLAKYILLPSRRPWNSTLKHYT  438

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            LYQPSDL DCV  LH LCCN H+S+LPAIREKYSQHKYKFVAKK CP SIP EFF D
Sbjct  439  LYQPSDLSDCVKDLHRLCCNGHNSTLPAIREKYSQHKYKFVAKKYCPPSIPQEFFHD  495



>ref|XP_009341345.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341346.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341352.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341353.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
Length=521

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCY+PSL+AASA FLA+Y L+P KKPWNSTLRHYTLYQ SDLRDCV ALH+LCCN   S
Sbjct  426  MLCYAPSLIAASAAFLAKYILSPLKKPWNSTLRHYTLYQASDLRDCVKALHHLCCNGCGS  485

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            +LPA+REKYSQHKYKFVAKK CP SIP E FQD S
Sbjct  486  NLPAVREKYSQHKYKFVAKKYCPLSIPPELFQDFS  520



>ref|XP_007223288.1| hypothetical protein PRUPE_ppa005557mg [Prunus persica]
 gb|EMJ24487.1| hypothetical protein PRUPE_ppa005557mg [Prunus persica]
Length=454

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCY+PSL+AASA FLA+Y L+PSKKPWNSTLRHYTLYQ +DL DCV ALH LCCN   S
Sbjct  359  MLCYAPSLIAASAAFLAKYILSPSKKPWNSTLRHYTLYQAADLFDCVKALHRLCCNGCSS  418

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
             LPA+REKY QHKYKFVAKK CP SIP+EFFQD+++
Sbjct  419  DLPAVREKYCQHKYKFVAKKYCPPSIPTEFFQDLNN  454



>ref|XP_009343978.1| PREDICTED: cyclin-A1-1-like [Pyrus x bretschneideri]
Length=515

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCY+PSL+AASA FLA+Y L+P KKPWNSTLRHYTLYQ SDL DCV  LH LCCN   S
Sbjct  420  MLCYAPSLIAASAAFLAKYILSPVKKPWNSTLRHYTLYQASDLFDCVKVLHQLCCNGCGS  479

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            +LPAIREKY QHKYKFVAKK CP SIP EFFQD+S+
Sbjct  480  NLPAIREKYCQHKYKFVAKKYCPPSIPPEFFQDLSN  515



>ref|XP_002306649.1| cyclin family protein [Populus trichocarpa]
 gb|EEE93645.1| cyclin family protein [Populus trichocarpa]
Length=493

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  S+QLE  A+Y+AELSLL Y MLCY+PSLVAASAIFLA+Y L PSK+PWNSTL+HYT
Sbjct  374  NEVPSMQLECLANYIAELSLLEYTMLCYAPSLVAASAIFLAKYILLPSKRPWNSTLQHYT  433

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            LY+P DL  CV  L+ LCC SH+S+LPAIREKYSQHKYKFVAKK CP SIP EFFQ++S
Sbjct  434  LYEPVDLCHCVKDLYRLCCGSHNSTLPAIREKYSQHKYKFVAKKYCPPSIPEEFFQNLS  492



>ref|XP_008338670.1| PREDICTED: cyclin-A1-4 [Malus domestica]
Length=522

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCY+PSL+AASA FLA+Y L+P KKPWNSTLRHYTLYQ SDL DCV ALH LCCN   S
Sbjct  427  MLCYAPSLIAASAAFLAKYILSPLKKPWNSTLRHYTLYQASDLFDCVKALHQLCCNGCGS  486

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            +LPA+REKY QHKYKFVAKK CP SIP EFFQD+S+
Sbjct  487  NLPAVREKYCQHKYKFVAKKYCPPSIPPEFFQDLSN  522



>ref|XP_010063417.1| PREDICTED: cyclin-A1-1 [Eucalyptus grandis]
 gb|KCW70645.1| hypothetical protein EUGRSUZ_F03815 [Eucalyptus grandis]
Length=498

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  SLQLE  A+Y+AELSLL YDMLCY+PSLVAASAIFLA++ +TPSK+PW+ TL+HYT
Sbjct  379  NEVPSLQLECMANYIAELSLLEYDMLCYAPSLVAASAIFLAKFVITPSKRPWDPTLQHYT  438

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            LYQPSDL +CV  LH LC N+H S+LPAIREKYSQHKYK+VAKK CP SIP EFF ++
Sbjct  439  LYQPSDLGNCVKDLHRLCFNNHGSTLPAIREKYSQHKYKYVAKKYCPPSIPPEFFHNL  496



>ref|XP_007019157.1| Cyclin A1,1 isoform 1 [Theobroma cacao]
 gb|EOY16382.1| Cyclin A1,1 isoform 1 [Theobroma cacao]
Length=493

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  S+QLE  A+Y+AELSLL Y MLCY+PSL+AASAIFLA++ L PSK+PWNSTL+HYT
Sbjct  377  NEVPSMQLECMANYIAELSLLEYTMLCYAPSLIAASAIFLAKFILLPSKRPWNSTLQHYT  436

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            LY+PSDL DCV  LH LCCN+ +S+LPAIREKY+QHKYK VAKK CP SIPSEFFQ+
Sbjct  437  LYKPSDLCDCVKDLHRLCCNNQNSTLPAIREKYNQHKYKCVAKKYCPPSIPSEFFQN  493



>ref|XP_011003420.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=493

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  S+QLE  A+Y+AELSLL Y MLCY+PSLVAASAIFLA+Y L PSK+PWNSTL+HYT
Sbjct  374  NEVPSMQLECLANYIAELSLLEYTMLCYAPSLVAASAIFLAKYILLPSKRPWNSTLQHYT  433

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            LY+P +L  CV  L+ LCC SH+S+LPAIREKYSQHKYKFVAKK CP SIP EFFQ++S
Sbjct  434  LYEPVELCHCVKDLYRLCCGSHNSTLPAIREKYSQHKYKFVAKKYCPPSIPEEFFQNLS  492



>gb|KHG05394.1| CYCA1-1: Cyclin-A1-1 [Gossypium arboreum]
Length=245

 Score =   151 bits (381),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSL+AASA FLAR+ L+PS+KPW+S L HYTLYQPSD+ +CV ALH+LC N   +
Sbjct  152  MLHYAPSLIAASAAFLARFILSPSRKPWDSMLGHYTLYQPSDIGNCVKALHHLCRNGGGA  211

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            +LPAIREKYSQHKYKFVAKK CP SIP EFFQDV
Sbjct  212  NLPAIREKYSQHKYKFVAKKYCPASIPEEFFQDV  245



>ref|XP_008219598.1| PREDICTED: cyclin-A1-1-like [Prunus mume]
Length=496

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCY+PSLVAASAIFLA + L PSK+PWN+TL+HYTLYQPSDLRDCV  LH LCCNS  S
Sbjct  405  MLCYAPSLVAASAIFLANFILLPSKRPWNATLQHYTLYQPSDLRDCVKELHRLCCNSQSS  464

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEF  340
            SLPAIREKYSQHKYK VAKK CP +IPSE+
Sbjct  465  SLPAIREKYSQHKYKHVAKKYCPPTIPSEY  494



>gb|KHN35496.1| Cyclin-A1-1 [Glycine soja]
Length=348

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            +E  SLQLE   +Y+AELSL+ Y ML Y+PSLVAASAIFLA++ L PSKKPWNSTL+HYT
Sbjct  232  DEVPSLQLECLTNYIAELSLMEYSMLGYAPSLVAASAIFLAKFILFPSKKPWNSTLQHYT  291

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            LYQPSDL  CV  LH LCCNS +S+LPAIREKYSQHKYK+VAKK CP SIP EFFQ+
Sbjct  292  LYQPSDLCVCVKDLHRLCCNSPNSNLPAIREKYSQHKYKYVAKKYCPPSIPPEFFQN  348



>ref|XP_009387253.1| PREDICTED: cyclin-A1-4-like [Musa acuminata subsp. malaccensis]
Length=493

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            +LCY+PSL+AASAIFLAR+ L P+K+PWN+TL HYTLY+PSDL DCV ALH L C S  +
Sbjct  398  LLCYAPSLIAASAIFLARFILQPAKRPWNATLDHYTLYKPSDLSDCVKALHRLFCTSSGN  457

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPAIREKYSQHKYKFVAKK CP SIP+E+FQD
Sbjct  458  NLPAIREKYSQHKYKFVAKKYCPASIPAEYFQD  490



>gb|KJB59298.1| hypothetical protein B456_009G248300 [Gossypium raimondii]
Length=489

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  S+QLE  A+Y+AELSLL Y+MLCY PSL+AASAIFLA++ L PSKKPWNSTL+HYT
Sbjct  373  NEVPSMQLECMANYIAELSLLEYNMLCYPPSLIAASAIFLAKFILLPSKKPWNSTLQHYT  432

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            LY+PSDL +CV  LH LCCN+++S+LPAIREKYSQHKYK VAKK CP SIPS+FF +
Sbjct  433  LYKPSDLFECVKDLHRLCCNNNNSTLPAIREKYSQHKYKCVAKKYCPPSIPSDFFHN  489



>ref|XP_010530202.1| PREDICTED: cyclin-A1-1 [Tarenaya hassleriana]
Length=493

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML +SPSL+AASAIFLA+Y L P+ +PWNSTL+HYTLY+PS+LR CV  LH LCCN+H S
Sbjct  399  MLSHSPSLIAASAIFLAKYILDPTTRPWNSTLKHYTLYEPSELRKCVKGLHGLCCNAHTS  458

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPA+REKYSQHKYKFVAKK CP  IPSEFF +
Sbjct  459  TLPAVREKYSQHKYKFVAKKFCPPIIPSEFFHN  491



>gb|KDP32823.1| hypothetical protein JCGZ_12115 [Jatropha curcas]
Length=494

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            +ML Y+PSL+AASAIFLA+Y L PS++PWNSTL+HYTLYQPSDL +CV  LH LCC SH+
Sbjct  399  NMLSYAPSLIAASAIFLAKYILLPSRRPWNSTLQHYTLYQPSDLCECVKELHCLCCGSHN  458

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            S+LPAIREKYSQHKYKFVAKK CP SIP E+F + S
Sbjct  459  STLPAIREKYSQHKYKFVAKKYCPPSIPQEYFNNQS  494



>ref|XP_004160710.1| PREDICTED: cyclin-A1-1-like [Cucumis sativus]
Length=506

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 82/94 (87%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCC-NSHH  433
            MLCY+PSLVAASAIFLA++ L P+K+PWNSTL+HYT YQPSDL DCV  LH LCC N+H+
Sbjct  410  MLCYAPSLVAASAIFLAKFILLPTKRPWNSTLQHYTHYQPSDLVDCVKDLHGLCCNNTHN  469

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            SSLPAIREKYSQHKYK VAKK CP +IP EFFQ+
Sbjct  470  SSLPAIREKYSQHKYKHVAKKYCPPTIPPEFFQN  503



>ref|XP_004149427.1| PREDICTED: cyclin-A1-1-like [Cucumis sativus]
 gb|KGN47698.1| hypothetical protein Csa_6G382370 [Cucumis sativus]
Length=506

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 82/94 (87%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCC-NSHH  433
            MLCY+PSLVAASAIFLA++ L P+K+PWNSTL+HYT YQPSDL DCV  LH LCC N+H+
Sbjct  410  MLCYAPSLVAASAIFLAKFILLPTKRPWNSTLQHYTHYQPSDLVDCVKDLHGLCCNNTHN  469

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            SSLPAIREKYSQHKYK VAKK CP +IP EFFQ+
Sbjct  470  SSLPAIREKYSQHKYKHVAKKYCPPTIPPEFFQN  503



>ref|XP_008466750.1| PREDICTED: cyclin-A1-1 [Cucumis melo]
Length=507

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 82/94 (87%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCC-NSHH  433
            MLCY+PSLVAASAIFLA++ L P+K+PWNSTL+HYT YQPSDL DCV  LH LCC N+H+
Sbjct  411  MLCYAPSLVAASAIFLAKFILLPTKRPWNSTLQHYTHYQPSDLVDCVKDLHGLCCNNTHN  470

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            SSLPAIREKYSQHKYK VAKK CP +IP EFFQ+
Sbjct  471  SSLPAIREKYSQHKYKHVAKKYCPPTIPPEFFQN  504



>ref|XP_009343979.1| PREDICTED: cyclin-A1-1-like [Pyrus x bretschneideri]
Length=498

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE +S+QLE  A+Y+AELSLL Y MLCY+PSL+AASAIFLA Y L PSK+PWN+TL HYT
Sbjct  383  NEVTSMQLECLANYIAELSLLEYSMLCYAPSLIAASAIFLANYILLPSKRPWNATLHHYT  442

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEF  340
            LYQPSDLRDC+ ALH LCC+S  SSLPAIREKYSQHKYK+VAK  CP +IPS++
Sbjct  443  LYQPSDLRDCINALHRLCCDSQTSSLPAIREKYSQHKYKYVAKMHCPPTIPSKY  496



>ref|NP_001237800.1| mitotic cyclin a2-type [Glycine max]
 dbj|BAA09466.1| mitotic cyclin a2-type [Glycine max]
Length=484

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSLVAASAIFLA++ L PSKKPWNSTL+HYTLYQPSDL  CV  LH LCCNS +S
Sbjct  392  MLGYAPSLVAASAIFLAKFILFPSKKPWNSTLQHYTLYQPSDLCVCVKDLHRLCCNSPNS  451

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPAIREKYSQHKYK+VAKK CP SIP EFFQ+
Sbjct  452  NLPAIREKYSQHKYKYVAKKYCPPSIPPEFFQN  484



>gb|KHG05847.1| Cyclin-A1-1 -like protein [Gossypium arboreum]
Length=489

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  S+QLE  A+Y+AELSLL Y MLCY PSL+AASAIFLA++   PSKKPWNSTL+HYT
Sbjct  373  NEVPSMQLECMANYIAELSLLEYSMLCYPPSLIAASAIFLAKFIFLPSKKPWNSTLQHYT  432

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            LY+PSDL +CV  LH LCCN+++S+LPAIREKYSQHKYK VAKK CP SIPS+FF +
Sbjct  433  LYKPSDLFECVKELHRLCCNNNNSTLPAIREKYSQHKYKCVAKKYCPPSIPSDFFHN  489



>ref|XP_008806262.1| PREDICTED: cyclin-A1-4 isoform X2 [Phoenix dactylifera]
Length=425

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            +MLCYSPSL+AASAIFLA++ L P KKPWN+TL HYTLY+PS+L DCV ALH L  +S  
Sbjct  329  NMLCYSPSLIAASAIFLAKFILQPMKKPWNATLGHYTLYKPSELCDCVKALHQLFHSSPG  388

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            SSLPAIREKYSQHKYKFVAKK CP SIPSEFFQD
Sbjct  389  SSLPAIREKYSQHKYKFVAKKYCPPSIPSEFFQD  422



>ref|XP_010925928.1| PREDICTED: cyclin-A1-4 [Elaeis guineensis]
Length=491

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            +MLCYSPSL+AASAIFLA++ L P KKPWN+TL HYTLY+PS+L DCV  LH L  NS  
Sbjct  395  NMLCYSPSLIAASAIFLAKFILQPMKKPWNATLGHYTLYKPSELLDCVKVLHRLFRNSAG  454

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            SSLPA+REKYSQHKYKFVAKK CP SIPSEFF+D
Sbjct  455  SSLPAVREKYSQHKYKFVAKKYCPPSIPSEFFED  488



>ref|XP_007225619.1| hypothetical protein PRUPE_ppa004701mg [Prunus persica]
 gb|EMJ26818.1| hypothetical protein PRUPE_ppa004701mg [Prunus persica]
Length=495

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSLVAASAIFLA + L PSK+PWN+TL+HYTLYQPSDLRDCV  LH LCCNS  S
Sbjct  404  MLGYAPSLVAASAIFLANFILLPSKRPWNATLQHYTLYQPSDLRDCVKDLHRLCCNSQSS  463

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEF  340
            SLPAIREKYSQHKYK VAKK CP +IPSE+
Sbjct  464  SLPAIREKYSQHKYKHVAKKYCPPTIPSEY  493



>ref|XP_008806186.1| PREDICTED: cyclin-A1-4 isoform X1 [Phoenix dactylifera]
Length=493

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            +MLCYSPSL+AASAIFLA++ L P KKPWN+TL HYTLY+PS+L DCV ALH L  +S  
Sbjct  397  NMLCYSPSLIAASAIFLAKFILQPMKKPWNATLGHYTLYKPSELCDCVKALHQLFHSSPG  456

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            SSLPAIREKYSQHKYKFVAKK CP SIPSEFFQD
Sbjct  457  SSLPAIREKYSQHKYKFVAKKYCPPSIPSEFFQD  490



>gb|KJB64518.1| hypothetical protein B456_010G052900 [Gossypium raimondii]
 gb|KJB64520.1| hypothetical protein B456_010G052900 [Gossypium raimondii]
Length=482

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSL+AASA FLAR+ L+PS+KPW+S L HYTLYQPSD  +CV ALH+LC N   +
Sbjct  389  MLHYAPSLIAASAAFLARFILSPSRKPWDSMLGHYTLYQPSDFGNCVKALHHLCRNGGGA  448

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            +LPAIREKYSQHKYKFVAKK CP SIP EFFQDV
Sbjct  449  NLPAIREKYSQHKYKFVAKKYCPASIPEEFFQDV  482



>ref|XP_007019153.1| Cyclin A1,1, putative [Theobroma cacao]
 gb|EOY16378.1| Cyclin A1,1, putative [Theobroma cacao]
Length=499

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSL+AASA FLA++ L+P+KKPW+S L HYT YQPSD+RDCV +LH+LC N   +
Sbjct  404  MLHYAPSLIAASAAFLAKFILSPTKKPWDSILEHYTPYQPSDMRDCVKSLHHLCRNGGRA  463

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            +LPAIREKYSQHKYKFVAKK CP SIP EFFQD+S
Sbjct  464  NLPAIREKYSQHKYKFVAKKYCPASIPQEFFQDLS  498



>ref|XP_010915932.1| PREDICTED: cyclin-A1-4-like isoform X2 [Elaeis guineensis]
Length=533

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            +MLCYSPSL+AASAIFLA++ L P+K+PWN+TL HYTLY+PS+L DC  ALH L  NS  
Sbjct  437  NMLCYSPSLIAASAIFLAKFILQPTKRPWNATLVHYTLYKPSELYDCAKALHRLFLNSSG  496

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQ  334
            SSLPA+REKYSQHK+KFVAKK CP SIPSEFFQ
Sbjct  497  SSLPAVREKYSQHKFKFVAKKNCPPSIPSEFFQ  529



>ref|XP_006472826.1| PREDICTED: cyclin-A1-1-like [Citrus sinensis]
Length=503

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  S+QLE  A+Y+ ELSLL Y MLC++PSL+AASAIFLA+Y L P+K+PWNSTL+HYT
Sbjct  385  NEVPSMQLECLANYVTELSLLDYSMLCHAPSLIAASAIFLAKYILLPAKRPWNSTLQHYT  444

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
            LYQPSDL +CV  LH LCCNS  S+LPAIREKYS HKYK VAKK CP SIP EFF
Sbjct  445  LYQPSDLMECVKDLHRLCCNSQSSTLPAIREKYSLHKYKCVAKKYCPPSIPPEFF  499



>ref|XP_010915931.1| PREDICTED: cyclin-A1-4-like isoform X1 [Elaeis guineensis]
Length=534

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            +MLCYSPSL+AASAIFLA++ L P+K+PWN+TL HYTLY+PS+L DC  ALH L  NS  
Sbjct  438  NMLCYSPSLIAASAIFLAKFILQPTKRPWNATLVHYTLYKPSELYDCAKALHRLFLNSSG  497

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQ  334
            SSLPA+REKYSQHK+KFVAKK CP SIPSEFFQ
Sbjct  498  SSLPAVREKYSQHKFKFVAKKNCPPSIPSEFFQ  530



>ref|XP_010684698.1| PREDICTED: cyclin-A1-4-like [Beta vulgaris subsp. vulgaris]
Length=504

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSL AASA+FLA++ L PS+KPWNSTL HYTLY+P DL DCV ALH LC +SH S
Sbjct  409  MLQYAPSLTAASAVFLAKFILCPSQKPWNSTLLHYTLYEPCDLHDCVKALHQLCLSSHSS  468

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            +LPAIREKYSQHKYKFVAKK CP +IPSE+F   SS
Sbjct  469  TLPAIREKYSQHKYKFVAKKCCPPTIPSEYFHSTSS  504



>ref|XP_008783212.1| PREDICTED: cyclin-A1-4-like [Phoenix dactylifera]
Length=534

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            +MLCYSPSL+AASAIFLA++ L P K+PWN+TL HYTLY+PS+L DC  ALH L  NS  
Sbjct  438  NMLCYSPSLIAASAIFLAKFILQPMKRPWNATLVHYTLYKPSELSDCAKALHRLFLNSFG  497

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            SSLPAIREKYSQHK+KFVAKK CP SIPSE F+D
Sbjct  498  SSLPAIREKYSQHKFKFVAKKNCPPSIPSELFRD  531



>ref|XP_003526649.1| PREDICTED: cyclin-A1-1-like [Glycine max]
Length=480

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            +E  SLQLE   +Y+AELSL+ Y ML Y+PSL+AASAIFLA++ L PSKKPW STL+HYT
Sbjct  364  DEVPSLQLECLTNYIAELSLMEYSMLGYAPSLIAASAIFLAKFILFPSKKPWTSTLQHYT  423

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            LY+PSDL  CV  LH LCCNS +S+LPAIREKYSQHKYK+VAKK CP SIP EFFQ+
Sbjct  424  LYKPSDLCVCVRDLHRLCCNSPNSNLPAIREKYSQHKYKYVAKKYCPPSIPPEFFQN  480



>gb|AFK46051.1| unknown [Lotus japonicus]
Length=507

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCY+PSLVAASAIFLA++ L PS KPW+STL+HYTLYQPSDL  CV  LH L CNS +S
Sbjct  415  MLCYAPSLVAASAIFLAKFILFPSIKPWSSTLQHYTLYQPSDLCVCVKELHRLFCNSPNS  474

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPAI+EKYSQHKYK+VAKK CP SIPSEFFQ+
Sbjct  475  NLPAIKEKYSQHKYKYVAKKYCPPSIPSEFFQN  507



>ref|XP_009399851.1| PREDICTED: cyclin-A1-4-like [Musa acuminata subsp. malaccensis]
Length=495

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++LCY+PS++AASAIFLA + + P+K+PWN+TL HYTLY+PSDL DCV  LH L C S  
Sbjct  399  NLLCYAPSIIAASAIFLANFIMQPTKRPWNATLGHYTLYKPSDLSDCVKELHRLFCTSAG  458

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            ++LPAIREKYSQHKYKFVAKK CP SIP ++FQD
Sbjct  459  NNLPAIREKYSQHKYKFVAKKYCPASIPLDYFQD  492



>emb|CBI18983.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            N+  SLQLE  ASYL ELSLL Y+MLCY+PSL+AASA FLAR+ L  ++KPWNS L HYT
Sbjct  224  NKDPSLQLECLASYLTELSLLEYNMLCYAPSLIAASATFLARFILFSAEKPWNSMLGHYT  283

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
             Y PS L DCV ALH+LCCN+H S LPAI+EKYSQHKYKFVAKK CP  +P EFF+D S 
Sbjct  284  HYLPSHLHDCVKALHHLCCNNHGSGLPAIKEKYSQHKYKFVAKKYCPPCVPPEFFEDPSD  343



>gb|KDO80523.1| hypothetical protein CISIN_1g017988mg [Citrus sinensis]
Length=362

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  S+QLE  A+Y+ ELSLL Y MLC++PSL+AASAIFLA+Y L P+K+PWNSTL+HYT
Sbjct  244  NEVPSMQLECLANYVTELSLLDYSMLCHAPSLIAASAIFLAKYILLPAKRPWNSTLQHYT  303

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
            LYQPSDL +CV  LH L CNS  S+LPAIREKYS HKYK VAKK CP SIP EFF
Sbjct  304  LYQPSDLMECVKDLHRLYCNSQSSTLPAIREKYSLHKYKCVAKKYCPPSIPPEFF  358



>ref|XP_007137455.1| hypothetical protein PHAVU_009G128200g [Phaseolus vulgaris]
 gb|ESW09449.1| hypothetical protein PHAVU_009G128200g [Phaseolus vulgaris]
Length=488

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCY+PSL+AASAIFLAR+ L PS KPWNSTL+HYTLYQPSDL  CV  LH LC NS ++
Sbjct  396  MLCYAPSLIAASAIFLARFILFPSTKPWNSTLQHYTLYQPSDLCVCVKELHRLCGNSPNT  455

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
            +LPAI+EKYSQHKYK+VAKK CP SIP EFF
Sbjct  456  NLPAIKEKYSQHKYKYVAKKYCPPSIPQEFF  486



>ref|XP_010260855.1| PREDICTED: cyclin-A1-4 [Nelumbo nucifera]
Length=497

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            +LCY+PS++AASAIFLA++ L+P K+PWN+TL HYT Y+PS+L +CV  LH L CNS ++
Sbjct  401  VLCYAPSMIAASAIFLAKFILSPLKRPWNATLGHYTQYKPSELCECVKMLHRLFCNSFNT  460

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            SLPAIREKYSQHKYKFVAKK CP SIP E+F D+SS
Sbjct  461  SLPAIREKYSQHKYKFVAKKYCPPSIPVEYFHDISS  496



>ref|XP_004290902.1| PREDICTED: cyclin-A1-1 [Fragaria vesca subsp. vesca]
Length=500

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSLVAASAIFLA Y   PSK+PWN+TL+HYTLYQPSDLR+CV  LH LCC++ +S
Sbjct  409  MLSYAPSLVAASAIFLANYITLPSKRPWNATLQHYTLYQPSDLRECVKDLHRLCCDNQNS  468

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEF  340
            SLPAIREKYSQHKYK+VAK  CP +IP E+
Sbjct  469  SLPAIREKYSQHKYKYVAKMYCPPTIPKEY  498



>ref|XP_010664179.1| PREDICTED: cyclin-A1-1-like [Vitis vinifera]
Length=424

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            +MLCY+PSL+AASA FLAR+ L  ++KPWNS L HYT Y PS L DCV ALH+LCCN+H 
Sbjct  328  NMLCYAPSLIAASATFLARFILFSAEKPWNSMLGHYTHYLPSHLHDCVKALHHLCCNNHG  387

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            S LPAI+EKYSQHKYKFVAKK CP  +P EFF+D S
Sbjct  388  SGLPAIKEKYSQHKYKFVAKKYCPPCVPPEFFEDPS  423



>ref|XP_010095429.1| hypothetical protein L484_013386 [Morus notabilis]
 gb|EXB60121.1| hypothetical protein L484_013386 [Morus notabilis]
Length=498

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCY+PSL+AASA FLA+Y L+P  KPWNSTL  YT YQ SDLR+CV ALH+L C+  +S
Sbjct  403  MLCYAPSLIAASATFLAKYILSPVNKPWNSTLMSYTFYQASDLRECVKALHHLWCSGSNS  462

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            +LPAIREKYS HKYKFVA+K CP S+P EFFQD+S
Sbjct  463  NLPAIREKYSHHKYKFVAQKYCPLSLPPEFFQDLS  497



>gb|KJB80670.1| hypothetical protein B456_013G109600 [Gossypium raimondii]
Length=416

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLC++PSL+AASAIFLA++ L PSKKPWNSTL+HYTLY+PSDL DCV  LH LCCN ++S
Sbjct  325  MLCHAPSLIAASAIFLAKFILLPSKKPWNSTLQHYTLYKPSDLCDCVKDLHRLCCN-NNS  383

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPAIREKY+QHKYK VAKK  P SIPSEFFQ+
Sbjct  384  TLPAIREKYNQHKYKCVAKKNWPPSIPSEFFQN  416



>ref|XP_010095430.1| hypothetical protein L484_013387 [Morus notabilis]
 gb|EXB60122.1| hypothetical protein L484_013387 [Morus notabilis]
Length=495

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  S+QLE  A+YLAELSLL Y MLCY+PSL+AASAIFLA + L PSK+PWNSTL+HYT
Sbjct  379  NEVPSMQLECLANYLAELSLLEYSMLCYAPSLIAASAIFLANFILLPSKRPWNSTLQHYT  438

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            LY+P+DL  CV  LH LC N+H+SSLPAIREKYSQHKYK+VAKK  P  IP EFF +
Sbjct  439  LYRPADLCKCVKDLHRLCSNNHNSSLPAIREKYSQHKYKYVAKKYVPPMIPPEFFHN  495



>gb|KJB80669.1| hypothetical protein B456_013G109600 [Gossypium raimondii]
Length=493

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLC++PSL+AASAIFLA++ L PSKKPWNSTL+HYTLY+PSDL DCV  LH LCCN ++S
Sbjct  402  MLCHAPSLIAASAIFLAKFILLPSKKPWNSTLQHYTLYKPSDLCDCVKDLHRLCCN-NNS  460

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPAIREKY+QHKYK VAKK  P SIPSEFFQ+
Sbjct  461  TLPAIREKYNQHKYKCVAKKNWPPSIPSEFFQN  493



>ref|XP_006434258.1| hypothetical protein CICLE_v10000927mg [Citrus clementina]
 gb|ESR47498.1| hypothetical protein CICLE_v10000927mg [Citrus clementina]
Length=503

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE  S+QLE  A+Y+ ELSLL Y MLC++PSL+AASAIFLA+Y L P+K+PWNSTL+HYT
Sbjct  385  NEVPSMQLECLANYVTELSLLDYSMLCHAPSLIAASAIFLAKYILLPAKRPWNSTLQHYT  444

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
            LYQPSDL +CV  LH L CNS  S+LPAIREKYS HKYK VAKK CP SIP EFF
Sbjct  445  LYQPSDLMECVKDLHRLYCNSQSSTLPAIREKYSLHKYKCVAKKYCPPSIPPEFF  499



>ref|NP_001241939.1| uncharacterized protein LOC100776207 [Glycine max]
 gb|ACU22685.1| unknown [Glycine max]
Length=503

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCY PS +AASAIFLAR+ L PSKKPWNSTL+HYTLY+PSDL  CV  LH LCC+SH S
Sbjct  411  MLCYPPSQIAASAIFLARFILFPSKKPWNSTLQHYTLYRPSDLCACVKDLHRLCCSSHDS  470

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQ  334
            +LPAIR+KYSQHKYK VAKK  P SIP E FQ
Sbjct  471  NLPAIRDKYSQHKYKCVAKKCIPPSIPQEVFQ  502



>gb|KHG23907.1| Cyclin-A1-1 -like protein [Gossypium arboreum]
Length=493

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLC+ PSL+AASAIFLA++ L PSKKPWNSTL+HYTLY+PSDL DCV  LH LCCN ++S
Sbjct  402  MLCHPPSLIAASAIFLAKFILLPSKKPWNSTLQHYTLYKPSDLCDCVKDLHRLCCN-NNS  460

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPAIREKY+QHKYK VAKK  P SIPSEFFQ+
Sbjct  461  TLPAIREKYNQHKYKCVAKKNWPPSIPSEFFQN  493



>gb|KHN05188.1| Cyclin-A1-1 [Glycine soja]
Length=503

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCY PS +AASAIFLAR+ L PSKKPWNSTL+HYTLY+PSDL  CV  LH LCC+SH S
Sbjct  411  MLCYPPSQIAASAIFLARFILFPSKKPWNSTLQHYTLYRPSDLCACVKDLHRLCCSSHDS  470

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQ  334
            +LPAIR+KYSQHKYK VAKK  P SIP E FQ
Sbjct  471  NLPAIRDKYSQHKYKCVAKKCIPPSIPQEVFQ  502



>gb|KEH35323.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=505

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCY+PSL+AAS+IFLA+Y L P+ KPWN TL+HYT YQPSDL  CV  LH LCCNS +S
Sbjct  413  MLCYAPSLIAASSIFLAKYMLFPAMKPWNPTLQHYTQYQPSDLCACVKDLHRLCCNSPNS  472

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPAI+EKY+QHKYK+VA K CP SIP EFFQ+
Sbjct  473  NLPAIKEKYNQHKYKYVANKYCPPSIPQEFFQN  505



>ref|XP_009126172.1| PREDICTED: cyclin-A1-1-like [Brassica rapa]
Length=426

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML +SPSLVAASAIFLA+YTL P+++PWNSTLRHYT Y+  +LR CVM L  LC N+H S
Sbjct  331  MLSHSPSLVAASAIFLAKYTLDPTRRPWNSTLRHYTQYEAMELRGCVMDLQRLCSNAHVS  390

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPA+R+KYSQHKYKFVAKK CP+ IP +FF++
Sbjct  391  TLPAVRDKYSQHKYKFVAKKFCPSIIPPDFFKN  423



>gb|ADA70359.1| mitotic cyclin A1-like protein [Persea americana]
Length=479

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            LCY+PSL+AASA+F+A     PSK+PWN+TL+HYTLY+PS+L  CV ALHNL C+SH +S
Sbjct  385  LCYAPSLIAASALFVANLYHQPSKRPWNATLQHYTLYKPSELCSCVNALHNLFCDSHSNS  444

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            LPAIREKYSQHKYKFVAKK CP++IP EFF D+
Sbjct  445  LPAIREKYSQHKYKFVAKKCCPSTIPLEFFYDL  477



>emb|CDX85466.1| BnaA02g03470D [Brassica napus]
Length=422

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML + PSLVAASAIFLA+YTL P+++PWNSTLRHYT Y+  +LR CVM L  LC N+H S
Sbjct  327  MLSHPPSLVAASAIFLAKYTLDPTRRPWNSTLRHYTQYEAMELRGCVMDLQRLCSNAHVS  386

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPA+R+KYSQHKYKFVAKK CP+ IP +FF++
Sbjct  387  TLPAVRDKYSQHKYKFVAKKFCPSIIPPDFFKN  419



>dbj|BAC56853.1| cyclin A1 [Silene latifolia]
Length=487

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSL+AAS++FLA+Y LT S +PWN+TLRHYTLY+ SDL +CV ALH LC NSH S
Sbjct  393  MLKYAPSLIAASSVFLAKYMLT-SSRPWNATLRHYTLYEASDLEECVKALHQLCLNSHIS  451

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            SLPAIREKYS HKYK VAKK CP+SIP+E+FQ+ S
Sbjct  452  SLPAIREKYSHHKYKSVAKKHCPSSIPAEYFQNSS  486



>ref|XP_004292715.1| PREDICTED: cyclin-A1-4-like [Fragaria vesca subsp. vesca]
Length=506

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            +ML Y+PSL+AASA FLA Y L+PSK+PWNSTLRHYT Y+  DL DCV  LH+LCCN   
Sbjct  410  NMLGYAPSLIAASATFLANYILSPSKRPWNSTLRHYTNYRACDLCDCVKVLHHLCCNGSG  469

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            S+L A+REKY QHKYKFVAKK CP SIP EFF D S+
Sbjct  470  SNLAAVREKYCQHKYKFVAKKYCPPSIPPEFFHDPSN  506



>gb|KFK24211.1| hypothetical protein AALP_AAs42301U000600 [Arabis alpina]
Length=444

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML YSPSLVAASAIFLA+Y L P+++PWNSTL+HYT Y+  +LR CV  L  LC N+H S
Sbjct  351  MLSYSPSLVAASAIFLAKYILDPTRRPWNSTLQHYTQYKALELRGCVKDLQRLCSNAHAS  410

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPA+REKYSQHKYKFVAKK CP+ IP EFF +
Sbjct  411  TLPAVREKYSQHKYKFVAKKFCPSIIPQEFFNN  443



>gb|AAA51660.1| cyclin [Brassica napus]
Length=425

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML + PSLVAASAIFLA+YTL P+++PWNSTLRHYT Y+  +LR CVM L  LC N+H S
Sbjct  330  MLSHPPSLVAASAIFLAKYTLDPTRRPWNSTLRHYTQYEAMELRGCVMDLQRLCSNAHVS  389

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPA+R+KYSQHKYKFVAKK CP+ IP +FF++
Sbjct  390  TLPAVRDKYSQHKYKFVAKKFCPSIIPPDFFKN  422



>ref|XP_002455447.1| hypothetical protein SORBIDRAFT_03g010940 [Sorghum bicolor]
 gb|EES00567.1| hypothetical protein SORBIDRAFT_03g010940 [Sorghum bicolor]
Length=505

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSL+AASAIFLAR+ L P+K PWNSTL HYT Y+PS+L DCV ALH LC     
Sbjct  409  NLLSYPPSLIAASAIFLARFILQPTKYPWNSTLAHYTQYKPSELSDCVKALHRLCSVGSG  468

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            ++LPAIREKYSQHKYKFVAKK CP  IP+EFF+D +
Sbjct  469  TNLPAIREKYSQHKYKFVAKKQCPPQIPTEFFRDAT  504



>gb|KHN38997.1| Cyclin-A1-1 [Glycine soja]
Length=504

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y PSLVAAS IFLAR+ L PSKKPWNSTL+HYTLY+PSDL  CV  LH LCC+SH S
Sbjct  411  MLSYPPSLVAASVIFLARFILFPSKKPWNSTLQHYTLYRPSDLCACVKDLHRLCCSSHDS  470

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQ  334
            +LPAIR+KYSQHKYK VAKK  P SIP E FQ
Sbjct  471  NLPAIRDKYSQHKYKCVAKKHIPPSIPREVFQ  502



>ref|XP_002457051.1| hypothetical protein SORBIDRAFT_03g000520 [Sorghum bicolor]
 gb|EES02171.1| hypothetical protein SORBIDRAFT_03g000520 [Sorghum bicolor]
Length=533

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSL+AASA+FLARY L P+K PWNSTL HYT Y+PS+L DCV ALH L      
Sbjct  412  NLLSYPPSLIAASAVFLARYVLQPTKYPWNSTLAHYTQYKPSELSDCVKALHRLFSVGPG  471

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            S+LPAIREKYSQHKYKFVA+K CP SIP+EFF+DV+
Sbjct  472  SNLPAIREKYSQHKYKFVARKQCPPSIPTEFFRDVT  507



>emb|CDY02719.1| BnaC02g07160D [Brassica napus]
Length=429

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML + PSLVAASAIFLA+YTL P+++PWNSTL+HYT Y+  +LR CVM L  LC N+H S
Sbjct  336  MLSHPPSLVAASAIFLAKYTLDPTRRPWNSTLQHYTQYEALELRGCVMDLQRLCSNAHVS  395

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPA+R+KYSQHKYKFVAKK CP+ IP EFF++
Sbjct  396  TLPAVRDKYSQHKYKFVAKKFCPSIIPPEFFKN  428



>ref|XP_003545652.1| PREDICTED: cyclin-A1-1-like [Glycine max]
Length=504

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y PSL+AAS IFLAR+ L PSKKPWNSTL+HYTLY+PSDL  CV  LH LCC+SH S
Sbjct  411  MLSYPPSLIAASVIFLARFILFPSKKPWNSTLQHYTLYRPSDLCACVKDLHRLCCSSHDS  470

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQ  334
            +LPAIR+KYSQHKYK VAKK  P SIP E FQ
Sbjct  471  NLPAIRDKYSQHKYKCVAKKHIPPSIPREVFQ  502



>ref|XP_004967382.1| PREDICTED: cyclin-A1-1-like [Setaria italica]
Length=506

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSL+AASAIFLA++ L P+K PWNSTL HYT Y+PS L DCV ALH+L      
Sbjct  410  NLLSYPPSLIAASAIFLAKFVLQPTKYPWNSTLAHYTQYKPSQLCDCVKALHHLFSVGPA  469

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            S+LPAIREKYSQHKYKFVAKK CPTSIP+EFF+DV+
Sbjct  470  SNLPAIREKYSQHKYKFVAKKQCPTSIPTEFFRDVT  505



>ref|XP_006393746.1| hypothetical protein EUTSA_v10011442mg [Eutrema salsugineum]
 gb|ESQ31032.1| hypothetical protein EUTSA_v10011442mg [Eutrema salsugineum]
Length=481

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML +SPSLVAASAIFLA+Y L P+++PWNSTL+HYT Y+  +LR CV  L  LC N+H S
Sbjct  388  MLSHSPSLVAASAIFLAKYILDPTRRPWNSTLQHYTQYRAMELRGCVKDLQRLCSNAHVS  447

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPA+REKYSQHKYKFVAKK CP+ IP EFF +
Sbjct  448  TLPAVREKYSQHKYKFVAKKFCPSIIPQEFFNN  480



>ref|XP_006307397.1| hypothetical protein CARUB_v10009020mg [Capsella rubella]
 gb|EOA40295.1| hypothetical protein CARUB_v10009020mg [Capsella rubella]
Length=476

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML +SPSLVAASAIFLA+Y L P+++PWN TL+HYT Y+ S+LR CV  L  LC  SH S
Sbjct  383  MLSHSPSLVAASAIFLAKYILDPTRRPWNPTLQHYTQYKASELRGCVKDLQRLCSTSHGS  442

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPA+REKYSQHKYKFVAKK CP+ IP EFF +
Sbjct  443  TLPAVREKYSQHKYKFVAKKFCPSIIPQEFFNN  475



>ref|NP_175077.1| cyclin-A1-1 [Arabidopsis thaliana]
 sp|Q9C6Y3.1|CCA11_ARATH RecName: Full=Cyclin-A1-1; AltName: Full=G2/mitotic-specific 
cyclin-A1-1; Short=CycA1;1 [Arabidopsis thaliana]
 gb|AAG50557.1|AC074228_12 mitotic cyclin a2-type, putative [Arabidopsis thaliana]
 dbj|BAD43169.1| putative mitotic cyclin a2-type [Arabidopsis thaliana]
 gb|AEE32021.1| cyclin-A1-1 [Arabidopsis thaliana]
Length=460

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML +SPSLVAASAIFLA+Y L P+++PWNSTL+HYT Y+  +LR CV  L  LC  +H S
Sbjct  367  MLSHSPSLVAASAIFLAKYILDPTRRPWNSTLQHYTQYKAMELRGCVKDLQRLCSTAHGS  426

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPA+REKYSQHKYKFVAKK CP+ IP EFF +
Sbjct  427  TLPAVREKYSQHKYKFVAKKFCPSVIPQEFFNN  459



>gb|EEC70247.1| hypothetical protein OsI_01036 [Oryza sativa Indica Group]
Length=262

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSLVAASAIFLA++ L P+K PWNSTL HYT Y+ S+L DCV ALH L      
Sbjct  166  NLLSYPPSLVAASAIFLAKFILQPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPG  225

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            S+LPAIREKY+QHKYKFVAKK CP S+PSEFF+DV+
Sbjct  226  SNLPAIREKYTQHKYKFVAKKHCPPSVPSEFFRDVT  261



>ref|XP_006859067.1| hypothetical protein AMTR_s00068p00198800 [Amborella trichopoda]
 gb|ERN20534.1| hypothetical protein AMTR_s00068p00198800 [Amborella trichopoda]
Length=498

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 78/94 (83%), Gaps = 2/94 (2%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS-  430
            LCY PSL+AASAIFLA++ L PSK+PWN+TLRHYTLY+PSDLR+CV AL  L  NS  S 
Sbjct  405  LCYFPSLIAASAIFLAKFMLYPSKRPWNATLRHYTLYRPSDLRNCVKALEVLHSNSQSSN  464

Query  429  -SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
             +LPAIREKYSQHKYK VAK  CP +IP+EFFQD
Sbjct  465  TNLPAIREKYSQHKYKCVAKYPCPPAIPAEFFQD  498



>ref|XP_002454880.1| hypothetical protein SORBIDRAFT_03g000690 [Sorghum bicolor]
 gb|EER99999.1| hypothetical protein SORBIDRAFT_03g000690 [Sorghum bicolor]
Length=502

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSL+AASAIFLAR+ L P+K PWNSTL HYT Y+PS+L DCV ALH L      
Sbjct  407  NLLSYPPSLIAASAIFLARFILQPTKYPWNSTLSHYTQYKPSELSDCVKALHRLFSVGPG  466

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            S+LPAIREKYSQHKYKFVAKK CP  IP+EFF+D +
Sbjct  467  SNLPAIREKYSQHKYKFVAKKQCPPQIPTEFFRDTT  502



>ref|XP_002893979.1| CYCA1_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70238.1| CYCA1_1 [Arabidopsis lyrata subsp. lyrata]
Length=467

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML +SPSLVAASAIFLA+Y L P+++PWNSTL+HYT Y+  +LR CV  L  LC  +H S
Sbjct  374  MLSHSPSLVAASAIFLAKYILDPTRRPWNSTLQHYTQYKAMELRGCVKDLQRLCSTAHGS  433

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPA+REKYSQHKYKFVAKK CP+ IP EFF +
Sbjct  434  TLPAVREKYSQHKYKFVAKKFCPSIIPQEFFNN  466



>gb|ABG21984.1| Cyclin, N-terminal domain containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABG21985.1| Cyclin, N-terminal domain containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|EEE53081.1| hypothetical protein OsJ_35837 [Oryza sativa Japonica Group]
Length=345

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSLVAASAIFLA++ L P+K PWNSTL HYT Y+ S+L DCV ALH L C    
Sbjct  249  NLLSYPPSLVAASAIFLAKFILQPAKHPWNSTLAHYTQYKSSELSDCVKALHRLFCVGPG  308

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            S+LPAIREKY+QHKYKFVAKK CP SIP+EFF+D
Sbjct  309  SNLPAIREKYTQHKYKFVAKKPCPPSIPTEFFRD  342



>ref|NP_001176910.1| Os12g0298950 [Oryza sativa Japonica Group]
 dbj|BAH95638.1| Os12g0298950 [Oryza sativa Japonica Group]
Length=391

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSLVAASAIFLA++ L P+K PWNSTL HYT Y+ S+L DCV ALH L C    
Sbjct  295  NLLSYPPSLVAASAIFLAKFILQPAKHPWNSTLAHYTQYKSSELSDCVKALHRLFCVGPG  354

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            S+LPAIREKY+QHKYKFVAKK CP SIP+EFF+D
Sbjct  355  SNLPAIREKYTQHKYKFVAKKPCPPSIPTEFFRD  388



>ref|XP_004289008.1| PREDICTED: cyclin-A1-1-like [Fragaria vesca subsp. vesca]
Length=299

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCY+PSL+AASAIFLA Y + PSKKPWN+TL+HYTLY PSDL DCV  LH LC ++  S
Sbjct  208  MLCYAPSLIAASAIFLANYIMLPSKKPWNATLKHYTLYHPSDLPDCVKDLHRLCYDNPSS  267

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEF  340
             LPAIREKYS+H+YK VA+K CP +IP+E+
Sbjct  268  GLPAIREKYSEHEYKCVAEKHCPATIPTEY  297



>gb|EEC70248.1| hypothetical protein OsI_01039 [Oryza sativa Indica Group]
Length=506

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSLVAASAIFLA++ L P+K PWNSTL HYT Y+ S+L DCV ALH L C    
Sbjct  410  NLLSYPPSLVAASAIFLAKFILQPAKHPWNSTLAHYTQYKSSELSDCVKALHRLFCVGPG  469

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            S+LPAIREKY+QHKYKFVAKK CP SIP+EFF+D
Sbjct  470  SNLPAIREKYTQHKYKFVAKKPCPPSIPTEFFRD  503



>sp|Q0INT0.2|CCA13_ORYSJ RecName: Full=Cyclin-A1-3; AltName: Full=G2/mitotic-specific 
cyclin-A1-3; Short=CycA1;3 [Oryza sativa Japonica Group]
 gb|ABG21983.1| Cyclin, N-terminal domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=491

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSLVAASAIFLA++ L P+K PWNSTL HYT Y+ S+L DCV ALH L C    
Sbjct  395  NLLSYPPSLVAASAIFLAKFILQPAKHPWNSTLAHYTQYKSSELSDCVKALHRLFCVGPG  454

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            S+LPAIREKY+QHKYKFVAKK CP SIP+EFF+D
Sbjct  455  SNLPAIREKYTQHKYKFVAKKPCPPSIPTEFFRD  488



>ref|XP_004960667.1| PREDICTED: cyclin-A1-3-like [Setaria italica]
Length=476

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -3

Query  603  CYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSL  424
            CY PSLVAAS++FLAR+ L P+K PWNS+L +YT Y PS+LR CV  LH L C      L
Sbjct  383  CYLPSLVAASSVFLARFILKPAKNPWNSSLSYYTQYTPSELRCCVRVLHRLFCFGPGRDL  442

Query  423  PAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            PAIREKYSQHKYKFVAKK CP SIP+EFFQD +S
Sbjct  443  PAIREKYSQHKYKFVAKKYCPPSIPTEFFQDATS  476



>ref|XP_010532201.1| PREDICTED: cyclin-A1-1-like isoform X2 [Tarenaya hassleriana]
Length=501

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML +  SLVAASAIFLA+Y L P++ PWNSTL+HYTLY+ SDLR CV  LH LCC +  S
Sbjct  406  MLPHPMSLVAASAIFLAKYILDPTRSPWNSTLKHYTLYEASDLRKCVKDLHRLCCGACTS  465

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            +LPA+REKYSQHKYKFVA+K CP  IP EFF +  S
Sbjct  466  TLPAVREKYSQHKYKFVARKFCPPIIPPEFFHNNES  501



>ref|XP_010532200.1| PREDICTED: cyclin-A1-1-like isoform X1 [Tarenaya hassleriana]
Length=503

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML +  SLVAASAIFLA+Y L P++ PWNSTL+HYTLY+ SDLR CV  LH LCC +  S
Sbjct  408  MLPHPMSLVAASAIFLAKYILDPTRSPWNSTLKHYTLYEASDLRKCVKDLHRLCCGACTS  467

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            +LPA+REKYSQHKYKFVA+K CP  IP EFF +  S
Sbjct  468  TLPAVREKYSQHKYKFVARKFCPPIIPPEFFHNNES  503



>ref|XP_006472824.1| PREDICTED: cyclin-A1-1-like isoform X1 [Citrus sinensis]
Length=516

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            N+A S+Q E  A+Y+ ELSLL Y+MLCYSPSL+AASA FLA + L P KKPWNSTL HYT
Sbjct  398  NKAPSMQFECLANYILELSLLDYNMLCYSPSLIAASATFLANFILYPLKKPWNSTLGHYT  457

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
             YQPSDL DCV ALH L C+   S+L AIREKYSQHKYK+VAKK C +SI  E F+D S
Sbjct  458  FYQPSDLCDCVKALHRLFCDGGLSNLSAIREKYSQHKYKYVAKKHCSSSILPEIFEDPS  516



>ref|NP_001288521.1| uncharacterized protein LOC103649996 [Zea mays]
 ref|XP_008673897.1| PREDICTED: cyclin-A1-1 [Zea mays]
 ref|XP_008673900.1| PREDICTED: cyclin-A1-1-like [Zea mays]
 gb|ACF87709.1| unknown [Zea mays]
Length=509

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = -3

Query  594  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  415
            PSL+AASAIFLAR+ L P+K PWNSTL HYT Y+PS L +CV ALH LC     S+LPAI
Sbjct  419  PSLIAASAIFLARFILQPTKYPWNSTLAHYTQYKPSKLSECVKALHRLCSVGSGSNLPAI  478

Query  414  REKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            REKYSQHKYKFVAKK CP  IP+EFF+D +
Sbjct  479  REKYSQHKYKFVAKKQCPPQIPTEFFRDTT  508



>ref|XP_006472825.1| PREDICTED: cyclin-A1-1-like isoform X2 [Citrus sinensis]
Length=511

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            N+A S+Q E  A+Y+ ELSLL Y+MLCYSPSL+AASA FLA + L P KKPWNSTL HYT
Sbjct  393  NKAPSMQFECLANYILELSLLDYNMLCYSPSLIAASATFLANFILYPLKKPWNSTLGHYT  452

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
             YQPSDL DCV ALH L C+   S+L AIREKYSQHKYK+VAKK C +SI  E F+D S
Sbjct  453  FYQPSDLCDCVKALHRLFCDGGLSNLSAIREKYSQHKYKYVAKKHCSSSILPEIFEDPS  511



>ref|XP_008656316.1| PREDICTED: cyclin-A1-4-like [Zea mays]
Length=194

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -3

Query  603  CYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSL  424
            CY PS+VAAS++FLA++ L P K PWNS+L +YT Y PS+LR CV  LH L      S+L
Sbjct  101  CYLPSMVAASSVFLAKFILMPIKNPWNSSLSYYTRYTPSELRGCVRVLHRLFRLGPGSNL  160

Query  423  PAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            PAIREKYSQHKYKFVAKK CP SIP++FFQD++S
Sbjct  161  PAIREKYSQHKYKFVAKKYCPQSIPTKFFQDLTS  194



>ref|NP_001042512.1| Os01g0233500 [Oryza sativa Japonica Group]
 sp|Q7F830.1|CCA11_ORYSJ RecName: Full=Cyclin-A1-1; AltName: Full=G2/mitotic-specific 
cyclin-A1-1; Short=CycA1;1 [Oryza sativa Japonica Group]
 dbj|BAA86628.1| cyclin [Oryza sativa]
 dbj|BAA96590.1| putative type A-like cyclin [Oryza sativa Japonica Group]
 dbj|BAF04426.1| Os01g0233500 [Oryza sativa Japonica Group]
Length=508

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSLVAASAIFLA++ L P+K PWNSTL HYT Y+ S+L DCV ALH L      
Sbjct  412  NLLSYPPSLVAASAIFLAKFILQPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPG  471

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            S+LPAIREKY+QHKYKFVAKK CP SIP+EFF+D +
Sbjct  472  SNLPAIREKYTQHKYKFVAKKPCPPSIPTEFFRDAT  507



>dbj|BAJ94732.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=515

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -3

Query  603  CYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSL  424
             Y PSLVAASAIFL+++ L P+K PWNSTL HYT Y+PS+L DCV ALH L      S+L
Sbjct  422  AYPPSLVAASAIFLSKFILQPAKHPWNSTLAHYTQYKPSELCDCVKALHRLFSVGPGSNL  481

Query  423  PAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            PAIREKYSQHKYKFV KK CPTS+P+EFF+D +
Sbjct  482  PAIREKYSQHKYKFVGKKQCPTSVPAEFFRDAA  514



>gb|AIL50245.1| Ttam-3A [Triticum turgidum]
Length=513

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -3

Query  603  CYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSL  424
             Y PSLVAASAIFL+++ L P+K PWNSTL HYT Y+PS+L DCV ALH L      S+L
Sbjct  420  AYPPSLVAASAIFLSKFILQPAKHPWNSTLAHYTQYKPSELCDCVKALHRLFSVGPGSNL  479

Query  423  PAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            PAIREKYSQHKYKFV KK CPTS+P+EFF+D +
Sbjct  480  PAIREKYSQHKYKFVGKKQCPTSVPAEFFRDAA  512



>gb|AIL50247.1| Ttam-3D [Triticum aestivum]
Length=510

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -3

Query  603  CYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSL  424
             Y PSLVAASAIFL+++ L P+K PWNSTL HYT Y+PS+L DCV ALH L      S+L
Sbjct  417  AYPPSLVAASAIFLSKFILQPAKHPWNSTLAHYTQYKPSELCDCVKALHRLFSVGPGSNL  476

Query  423  PAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            PAIREKYSQHKYKFV KK CPTS+P+EFF+D +
Sbjct  477  PAIREKYSQHKYKFVGKKQCPTSVPAEFFRDAA  509



>emb|CDY25649.1| BnaC05g25280D [Brassica napus]
Length=437

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NEA  +QLE  A+Y+AELSLL Y ML +SPSLVAASAIFLA Y L P+++PWNSTL+HYT
Sbjct  313  NEAPCMQLECMANYIAELSLLEYTMLSHSPSLVAASAIFLATYILDPTRRPWNSTLQHYT  372

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
             Y   +LR CV  L   C N+H S+LPA+R+KYSQHKYKFVAKK CP+ IP EFF +
Sbjct  373  QYGAMELRGCVKDLQRFCSNAHVSTLPAVRDKYSQHKYKFVAKKFCPSIIPPEFFNN  429



>ref|XP_006643958.1| PREDICTED: cyclin-A1-1-like [Oryza brachyantha]
Length=496

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSLVAASAIFLA++ L P+K PWNSTL HYT Y+ S+L DCV ALH L      
Sbjct  400  NLLSYPPSLVAASAIFLAKFILQPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPG  459

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            S+LPAIREKYSQHKYKFVAKK CP S+P+EFF++ +
Sbjct  460  SNLPAIREKYSQHKYKFVAKKHCPPSVPTEFFRNAT  495



>ref|XP_007019154.1| Cyclin A1,1, putative isoform 1 [Theobroma cacao]
 gb|EOY16379.1| Cyclin A1,1, putative isoform 1 [Theobroma cacao]
Length=393

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSL+AASA+FLA++ L+PS+KPW+S L  YTLYQPS+L +CV  LH+LC N    
Sbjct  301  MLHYAPSLIAASAVFLAKFILSPSRKPWDSMLGRYTLYQPSELYNCVKDLHHLCLNGDCP  360

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +L AI++KYSQHKYKFVA+K CP+SIP EFF+D
Sbjct  361  NLAAIKQKYSQHKYKFVAEKDCPSSIPQEFFRD  393



>emb|CDM82517.1| unnamed protein product [Triticum aestivum]
 gb|AIL50246.1| Ttam-3B [Triticum turgidum]
Length=510

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -3

Query  603  CYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSL  424
             Y PSLVAASAIFL+++ L P+K PWNSTL HYT Y+PS+L DCV ALH L      S+L
Sbjct  417  AYPPSLVAASAIFLSKFILQPAKHPWNSTLAHYTQYKPSELCDCVKALHRLFSVGPGSNL  476

Query  423  PAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            PAIREKYSQHKYKFV KK CP+S+P+EFF+D +
Sbjct  477  PAIREKYSQHKYKFVGKKQCPSSVPAEFFRDAA  509



>ref|XP_006645684.1| PREDICTED: cyclin-A1-1-like [Oryza brachyantha]
Length=538

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSLVAASAIFLA++ L P+K PWNSTL HYT Y+ S+L DCV ALH L      
Sbjct  442  NLLSYPPSLVAASAIFLAKFILQPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPG  501

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            S+LPAIREKYSQHKYKFVAKK CP S+P+EFF++ +
Sbjct  502  SNLPAIREKYSQHKYKFVAKKHCPPSVPTEFFRNAA  537



>ref|XP_010500134.1| PREDICTED: cyclin-A1-1-like [Camelina sativa]
Length=474

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML +SPSLVAAS+IFLA+Y L P+ +PWN TL+HYT Y+  +LR CV  L  LC  +H S
Sbjct  381  MLSHSPSLVAASSIFLAKYILEPTIRPWNPTLQHYTQYKALELRGCVKDLQRLCITAHGS  440

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPA+REKYSQHKYKFVAKK CP+ IP EFF +
Sbjct  441  TLPAVREKYSQHKYKFVAKKFCPSVIPQEFFNN  473



>ref|XP_010461434.1| PREDICTED: cyclin-A1-1-like [Camelina sativa]
Length=486

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML +SPSLVAAS+IFLA+Y L P+ +PWN TL+HYT Y+  +LR CV  L  LC  +H S
Sbjct  393  MLSHSPSLVAASSIFLAKYILEPTIRPWNPTLQHYTQYKALELRGCVKDLQRLCSTAHGS  452

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +LPA+REKYSQHKYKFVAKK CP+ IP EFF +
Sbjct  453  TLPAVREKYSQHKYKFVAKKFCPSVIPQEFFNN  485



>ref|XP_006654172.1| PREDICTED: cyclin-A1-4-like [Oryza brachyantha]
Length=352

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ++CY PSL+AAS+IFLA++ L P++ PWNSTL  YT Y+PSDLRDC   LH L      S
Sbjct  257  LICYVPSLIAASSIFLAKFILKPTENPWNSTLCFYTQYKPSDLRDCTKGLHRLFLVGPGS  316

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            +L A+REKYSQHKYKFVAKK  P SIP+EFFQD SS
Sbjct  317  NLRAVREKYSQHKYKFVAKKYSPPSIPAEFFQDPSS  352



>gb|AAA20237.1| cyclin IIZm, partial [Zea mays]
Length=456

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = -3

Query  594  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  415
            PSL+AASAIFLAR+ L P+K PWNSTL HYT Y+PS L +CV ALH LC     S+LPAI
Sbjct  363  PSLIAASAIFLARFILQPTKYPWNSTLAHYTQYKPSKLSECVKALHRLCSVGSGSNLPAI  422

Query  414  REKYSQHKYKFVAKKICPTSIPS-EFFQDVS  325
            REKYSQHKYKFVAKK CP  IPS EFF+D +
Sbjct  423  REKYSQHKYKFVAKKQCPPQIPSLEFFRDAT  453



>gb|ACF80031.1| unknown [Zea mays]
Length=502

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -3

Query  594  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  415
            PSL+AASAIFLAR+ L P+K PWNSTL HYT Y+PS+L +CV  LH L      S+LPAI
Sbjct  412  PSLIAASAIFLARFVLQPTKYPWNSTLAHYTQYKPSELSECVKTLHRLSSVGPGSNLPAI  471

Query  414  REKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            REKYSQHKYKFVAKK CP  IP+EFF+D +
Sbjct  472  REKYSQHKYKFVAKKQCPPQIPAEFFRDAA  501



>gb|ACR33952.1| unknown [Zea mays]
Length=527

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -3

Query  594  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  415
            PSL+AASAIFLAR+ L P+K PWNSTL HYT Y+PS+L +CV  LH L      S+LPAI
Sbjct  437  PSLIAASAIFLARFVLQPTKYPWNSTLAHYTQYKPSELSECVKTLHRLSSVGPGSNLPAI  496

Query  414  REKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            REKYSQHKYKFVAKK CP  IP+EFF+D +
Sbjct  497  REKYSQHKYKFVAKKQCPPQIPAEFFRDAA  526



>ref|XP_007161469.1| hypothetical protein PHAVU_001G071600g [Phaseolus vulgaris]
 gb|ESW33463.1| hypothetical protein PHAVU_001G071600g [Phaseolus vulgaris]
Length=457

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCY PSL+AASA FLAR+ L PSKKPWNS L+HY  Y+PSDL  CV  LH LCC+S  +
Sbjct  364  MLCYPPSLIAASATFLARFILFPSKKPWNSILQHYAQYRPSDLCACVKDLHRLCCSSSDT  423

Query  429  S-LPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            S LPAIREKYSQHKYK VAKK  P SIP E F++
Sbjct  424  SNLPAIREKYSQHKYKCVAKKYIPLSIPQEVFRN  457



>ref|XP_009145051.1| PREDICTED: cyclin-A1-1 [Brassica rapa]
 emb|CDY65994.1| BnaA05g35600D [Brassica napus]
Length=443

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NEA  +QLE  A+Y+AELSLL Y ML +SPSLVAASAIFLA Y L P+++PWNSTL+ YT
Sbjct  319  NEAPCMQLECMANYIAELSLLEYTMLSHSPSLVAASAIFLAMYILDPTRRPWNSTLQLYT  378

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
             Y   +LR CV  L   C N+H S+LPA+R+KYSQHKYKFVAKK CP+ IP EFF +
Sbjct  379  QYGAMELRGCVKDLQRFCSNAHVSTLPAVRDKYSQHKYKFVAKKFCPSIIPPEFFNN  435



>ref|NP_001105387.1| cyclin2 [Zea mays]
 gb|AAC50013.1| type A-like cyclin [Zea mays]
Length=502

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -3

Query  594  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  415
            PSL+AASAIFLAR+ L P+K PWNSTL HYT Y+PS+L +CV ALH L      S+LPAI
Sbjct  412  PSLIAASAIFLARFVLQPTKYPWNSTLAHYTQYKPSELSECVKALHRLSSVGPGSNLPAI  471

Query  414  REKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            REKYSQHKYKFVAKK  P  IP+EFF+D +
Sbjct  472  REKYSQHKYKFVAKKQSPPQIPAEFFRDAA  501



>dbj|BAD81374.1| putative type A-like cyclin [Oryza sativa Japonica Group]
Length=521

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPW-NSTLRHYTLYQPSDLRDCVMALHNLCCNSH  436
            ++L Y PSLVAASAIFLA++ L P+K PW NSTL HYT Y+ S+L DCV ALH L     
Sbjct  424  NLLSYPPSLVAASAIFLAKFILQPTKHPWQNSTLAHYTQYKSSELSDCVKALHRLFSVGP  483

Query  435  HSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
             S+LPAIREKY+QHKYKFVAKK CP S+PSEFF+D +
Sbjct  484  GSNLPAIREKYTQHKYKFVAKKHCPPSVPSEFFRDAT  520



>ref|XP_008352624.1| PREDICTED: cyclin-A1-1-like [Malus domestica]
Length=479

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            NE +S+QLE  A+Y+AELSLL Y MLCY+PSL+AASAIFLA Y L PSK+PWN+TL HYT
Sbjct  382  NEVTSMQLECLANYIAELSLLEYSMLCYAPSLIAASAIFLANYILLPSKRPWNATLHHYT  441

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHK  391
            LYQPSDL DC+ ALH LCC+S  SSLPAIREKYSQHK
Sbjct  442  LYQPSDLLDCINALHRLCCDSQTSSLPAIREKYSQHK  478



>ref|XP_008653791.1| PREDICTED: cyclin-A1-1-like [Zea mays]
Length=124

 Score =   121 bits (303),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -3

Query  594  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  415
            PSL+AASAIFLAR+ L P+K PWNSTL HYT Y+ S+L +CV  LH L      S+LP+I
Sbjct  34   PSLIAASAIFLARFVLQPTKYPWNSTLAHYTQYKRSELSECVKTLHRLSSVGPGSNLPSI  93

Query  414  REKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
             EKYSQHKYKFVAKK CP  IP+EFF+D +
Sbjct  94   TEKYSQHKYKFVAKKQCPPQIPAEFFKDAA  123



>ref|NP_001054990.1| Os05g0237100 [Oryza sativa Japonica Group]
 dbj|BAF16904.1| Os05g0237100, partial [Oryza sativa Japonica Group]
Length=204

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ++CY PSL+AAS+IFLA++ L P++ PWNSTL  YT Y+PSDL +C   LH L       
Sbjct  105  LICYVPSLIAASSIFLAKFILKPTENPWNSTLSFYTQYKPSDLCNCAKGLHRLFLVGPGG  164

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            +L A+REKYSQHKYKFVAKK  P SIP+EFF+D SS
Sbjct  165  NLRAVREKYSQHKYKFVAKKYSPPSIPAEFFEDPSS  200



>sp|Q0JPA4.2|CCA12_ORYSJ RecName: Full=Cyclin-A1-2; AltName: Full=G2/mitotic-specific 
cyclin-A1-2; Short=CycA1;2 [Oryza sativa Japonica Group]
Length=477

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSLVAASAIFLA++ L P+K PWNSTL HYT Y+ S+L DCV ALH L      
Sbjct  382  NLLSYPPSLVAASAIFLAKFILQPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPG  441

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            S+LPAIREKY+QHK KFVAKK CP S+PSEFF+D +
Sbjct  442  SNLPAIREKYTQHK-KFVAKKHCPPSVPSEFFRDAT  476



>ref|XP_010521286.1| PREDICTED: cyclin-A1-2 isoform X2 [Tarenaya hassleriana]
Length=493

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNS--H  436
            ML Y PSLVAASA+FLARY L PS+KPWNSTL +YTLY   DLRDCV  L  L  +   H
Sbjct  399  MLQYLPSLVAASAVFLARYILEPSRKPWNSTLGNYTLYSGKDLRDCVKDLLRLYRDGTRH  458

Query  435  HSSLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
              S+PA+R+KYSQHKYKF AKK CP S+P EFF
Sbjct  459  SCSVPAVRKKYSQHKYKFAAKKFCPASVPPEFF  491



>gb|EEC78817.1| hypothetical protein OsI_19095 [Oryza sativa Indica Group]
Length=240

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ++CY PSL+AAS+IFLA++ L P++ PWNSTL  YT Y+PSDL +C   LH L       
Sbjct  141  LICYVPSLIAASSIFLAKFILKPTENPWNSTLSFYTQYKPSDLCNCAKGLHRLFLVGPGG  200

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            +L A+REKYSQHKYKFVAKK  P SIP+EFF+D SS
Sbjct  201  NLRAVREKYSQHKYKFVAKKYSPPSIPAEFFEDPSS  236



>ref|XP_010521285.1| PREDICTED: cyclin-A1-2 isoform X1 [Tarenaya hassleriana]
Length=518

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNS--H  436
            ML Y PSLVAASA+FLARY L PS+KPWNSTL +YTLY   DLRDCV  L  L  +   H
Sbjct  424  MLQYLPSLVAASAVFLARYILEPSRKPWNSTLGNYTLYSGKDLRDCVKDLLRLYRDGTRH  483

Query  435  HSSLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
              S+PA+R+KYSQHKYKF AKK CP S+P EFF
Sbjct  484  SCSVPAVRKKYSQHKYKFAAKKFCPASVPPEFF  516



>ref|XP_004962646.1| PREDICTED: cyclin-A1-1-like isoform X2 [Setaria italica]
Length=511

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++LCY PS +AASAIFLA+Y L P+K+PWN TL  YT Y+PS+L +CV A+H +      
Sbjct  415  NLLCYPPSQIAASAIFLAKYILYPTKQPWNPTLARYTRYKPSELCECVKAMHRVFSIGPM  474

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            ++LPA+REKY QHKYKFVAK  CP SIP+ FF+DV+
Sbjct  475  NNLPAVREKYGQHKYKFVAKLRCPASIPTGFFEDVT  510



>gb|KEH35322.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=510

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            DML Y+PSL+AASA FLA+Y L  +K PWNS LRHYT YQ S+LR+CV  LH L  N +H
Sbjct  415  DMLKYTPSLIAASATFLAKYILLSTKNPWNSMLRHYTGYQASELRECVEGLHLLYRNGYH  474

Query  432  S--SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            S  S+ AIREKYSQHK+KF AKK CP SIP E F +
Sbjct  475  SSPSITAIREKYSQHKFKFAAKKCCPPSIPVEVFHN  510



>ref|XP_004962645.1| PREDICTED: cyclin-A1-1-like isoform X1 [Setaria italica]
Length=509

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++LCY PS +AASAIFLA+Y L P+K+PWN TL  YT Y+PS+L +CV A+H +      
Sbjct  413  NLLCYPPSQIAASAIFLAKYILYPTKQPWNPTLARYTRYKPSELCECVKAMHRVFSIGPM  472

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            ++LPA+REKY QHKYKFVAK  CP SIP+ FF+DV+
Sbjct  473  NNLPAVREKYGQHKYKFVAKLRCPASIPTGFFEDVT  508



>ref|XP_004502519.1| PREDICTED: cyclin-A1-1-like [Cicer arietinum]
Length=514

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            DML Y+PSL+AASA FLA+Y L P KKPWNS LRHYT YQ S+L +C+  L  L CN +H
Sbjct  419  DMLQYAPSLIAASATFLAKYILLPRKKPWNSMLRHYTGYQASELCECINGLCLLYCNGYH  478

Query  432  S--SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            S  S+ AIREKYSQHK+KFVAKK CP SIP E F +
Sbjct  479  SSPSIIAIREKYSQHKFKFVAKKYCPPSIPVEAFHN  514



>ref|XP_003566404.1| PREDICTED: cyclin-A1-4-like [Brachypodium distachyon]
Length=482

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = -3

Query  603  CYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSL  424
            CY+PSL+AAS++FLA + L P++ PWN++L ++T Y+PS L DCV  LH L      S+L
Sbjct  389  CYAPSLIAASSVFLANFILKPTRNPWNTSLSYHTQYKPSSLHDCVKVLHLLFRVGPGSNL  448

Query  423  PAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            PAIREKYSQHKYKFVAKK CP SIP EFFQD
Sbjct  449  PAIREKYSQHKYKFVAKKYCPPSIPVEFFQD  479



>ref|XP_003566077.1| PREDICTED: cyclin-A1-1-like [Brachypodium distachyon]
Length=510

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            Y PSLVAASA+FL+++ L P+K PWNSTL HYT Y+ S+L DCV ALH L      S+LP
Sbjct  418  YPPSLVAASAVFLSKFILQPTKCPWNSTLAHYTQYKASELCDCVKALHRLFSVGPGSNLP  477

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            AIREKYSQHKYKFVAKK CP  +P++FF+D +
Sbjct  478  AIREKYSQHKYKFVAKKQCPPLVPADFFRDAT  509



>ref|XP_003630475.1| Cyclin A-like protein [Medicago truncatula]
Length=531

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -3

Query  681  NEASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYT  502
            +E  SLQLE   +++AELSLL Y MLCY+PSL+AAS+IFLA+Y L P+ KPWN TL+HYT
Sbjct  392  DEVPSLQLECLTNFIAELSLLEYSMLCYAPSLIAASSIFLAKYMLFPAMKPWNPTLQHYT  451

Query  501  LYQPSDLRDCVMALHNLCCNSHHSSLPAIREKYSQHKYKFVAKK  370
             YQPSDL  CV  LH LCCNS +S+LPAI+EKY+QHKYK+VA K
Sbjct  452  QYQPSDLCACVKDLHRLCCNSPNSNLPAIKEKYNQHKYKYVANK  495



>sp|Q0DJR9.2|CCA14_ORYSJ RecName: Full=Cyclin-A1-4; AltName: Full=G2/mitotic-specific 
cyclin-A1-4; Short=CycA1;4 [Oryza sativa Japonica Group]
Length=356

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ++CY PSL+AAS+IFLA++ L P++ PWNSTL  YT Y+PSDL +C   LH L       
Sbjct  257  LICYVPSLIAASSIFLAKFILKPTENPWNSTLSFYTQYKPSDLCNCAKGLHRLFLVGPGG  316

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            +L A+REKYSQHKYKFVAKK  P SIP+EFF+D SS
Sbjct  317  NLRAVREKYSQHKYKFVAKKYSPPSIPAEFFEDPSS  352



>gb|EMS46237.1| Cyclin-A1-1 [Triticum urartu]
Length=439

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 74/110 (67%), Gaps = 18/110 (16%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            Y PSLVAASAIFL+++ L P+K PWNSTL HYT Y+PS+L DCV ALH L      S+LP
Sbjct  329  YPPSLVAASAIFLSKFILQPAKHPWNSTLAHYTQYKPSELCDCVKALHRLFSVGPGSNLP  388

Query  420  AIREKYSQH------------------KYKFVAKKICPTSIPSEFFQDVS  325
            AIREKYSQH                  +YKFV KK CPTS+P+EFFQD +
Sbjct  389  AIREKYSQHKLLGKLMLMLTSSTPFFPQYKFVGKKQCPTSVPAEFFQDAA  438



>gb|EEE62924.1| hypothetical protein OsJ_17729 [Oryza sativa Japonica Group]
Length=425

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ++CY PSL+AAS+IFLA++ L P++ PWNSTL  YT Y+PSDL +C   LH L       
Sbjct  326  LICYVPSLIAASSIFLAKFILKPTENPWNSTLSFYTQYKPSDLCNCAKGLHRLFLVGPGG  385

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            +L A+REKYSQHKYKFVAKK  P SIP+EFF+D SS
Sbjct  386  NLRAVREKYSQHKYKFVAKKYSPPSIPAEFFEDPSS  421



>gb|KFK38207.1| hypothetical protein AALP_AA3G082800 [Arabis alpina]
Length=399

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 3/94 (3%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML +SPSLVAAS +FLA+Y L P+++PWNSTL+HYT Y+  +LR CV  L  L  N+H  
Sbjct  309  MLSHSPSLVAASVVFLAKYILYPTRRPWNSTLQHYTQYKGLELRGCVKDLQRLSSNAHAF  368

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
               A+REKYSQHKYKFVA K+CP+ IP EFF ++
Sbjct  369  ---AVREKYSQHKYKFVAYKLCPSIIPQEFFNNI  399



>ref|NP_177863.2| cyclin-A1-2 [Arabidopsis thaliana]
 sp|Q9FVX0.2|CCA12_ARATH RecName: Full=Cyclin-A1-2; AltName: Full=G2/mitotic-specific 
cyclin-A1-2; Short=CycA1;2; AltName: Full=Protein TARDY ASYNCHRONOUS 
MEIOSIS [Arabidopsis thaliana]
 gb|AEE35972.1| cyclin-A1-2 [Arabidopsis thaliana]
Length=442

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSLVAASA+FLA+YTL PS+KPWN+TL HYT Y+   +  CV  L  LC     S
Sbjct  351  MLRYAPSLVAASAVFLAQYTLHPSRKPWNATLEHYTSYRAKHMEACVKNLLQLCNEKLSS  410

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
             + AIR+KYSQHKYKF AKK+CPTS+P E F
Sbjct  411  DVVAIRKKYSQHKYKFAAKKLCPTSLPQELF  441



>ref|XP_003566081.1| PREDICTED: cyclin-A1-1-like [Brachypodium distachyon]
Length=501

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            Y PSLVAASA+FL+++ L P+K PWNSTL HYT Y+ S+L DCV  L  L C +  S LP
Sbjct  409  YPPSLVAASALFLSKFILQPTKSPWNSTLAHYTQYKASELCDCVKELQRLFCVAPGSKLP  468

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            AIREKYSQHKYKF AKK CP  +P+++F D +
Sbjct  469  AIREKYSQHKYKFAAKKQCPPMVPADYFCDAA  500



>ref|XP_006390095.1| hypothetical protein EUTSA_v10018521mg [Eutrema salsugineum]
 gb|ESQ27381.1| hypothetical protein EUTSA_v10018521mg [Eutrema salsugineum]
Length=457

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSLVAASA+FLA+Y L PS++PWN+TL HYT Y+  DL  CV +L  LC  S  +
Sbjct  365  MLRYAPSLVAASAVFLAQYILHPSREPWNATLEHYTSYRAKDLEGCVKSLLQLCHESPSA  424

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
             + A+R+KYSQHKYKF AKK CP S+P E F
Sbjct  425  DVVAVRKKYSQHKYKFAAKKFCPASLPQELF  455



>ref|XP_002889141.1| CYCA1_2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65400.1| CYCA1_2 [Arabidopsis lyrata subsp. lyrata]
Length=443

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSLVAASA+FLA+Y L PS+KPWN+TL HYT Y+   +  CV  L  LC     S
Sbjct  351  MLRYAPSLVAASAVFLAQYILHPSRKPWNATLEHYTSYRAKHMEACVKNLLQLCNEKPSS  410

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
             + AIR+KYSQHKYKF AKK+CPTS+P E F
Sbjct  411  DVVAIRKKYSQHKYKFAAKKLCPTSLPQELF  441



>ref|XP_007019146.1| Cyclin A1,1, putative [Theobroma cacao]
 gb|EOY16371.1| Cyclin A1,1, putative [Theobroma cacao]
Length=126

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 75/108 (69%), Gaps = 15/108 (14%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNST-----LRHYTLYQPSDLRDC--------V  469
            ML Y+PSL+AASA FLA++TL+P+KKPW        L H TL+   ++  C        V
Sbjct  20   MLHYAPSLIAASAAFLAKFTLSPTKKPWVIFVYFFYLLHRTLFW--NITHCTSPLICVTV  77

Query  468  MALHNLCCNSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
             +LH+LC N   ++LPAIREKYSQHKYKFVAKK CP SIP EFFQD+S
Sbjct  78   KSLHHLCRNGGRANLPAIREKYSQHKYKFVAKKYCPASIPQEFFQDLS  125



>gb|AAN87004.1| cyclin A [Populus alba]
Length=191

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -3

Query  678  EASSLQlehxasylaelsllaYDMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTL  499
            EA S+QLE  A+Y+AEL LL Y MLCY+PSLVAASAIFLA+Y L PSK+PWNSTL+HYTL
Sbjct  102  EAPSMQLECLANYIAELPLLEYSMLCYAPSLVAASAIFLAKYILLPSKRPWNSTLQHYTL  161

Query  498  YQPSDLRDCVMALHNLCCNSHHSSLPAIRE  409
            Y+P DL DCV   H LCC  H+S+LPAIRE
Sbjct  162  YEPVDLSDCVKDPHRLCCGDHNSTLPAIRE  191



>ref|XP_006302208.1| hypothetical protein CARUB_v10020219mg, partial [Capsella rubella]
 gb|EOA35106.1| hypothetical protein CARUB_v10020219mg, partial [Capsella rubella]
Length=478

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSLVAASA+FL +Y L PS+KPWN+TL+HYT Y+ + +  CV  L  LC  +  S
Sbjct  386  MLRYTPSLVAASAVFLTQYILHPSRKPWNATLQHYTSYKVTHMETCVKELLQLCHGNPSS  445

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
             + A+R+KYSQH YKF AKK+CPTS+P E F
Sbjct  446  DVVAVRKKYSQHNYKFAAKKLCPTSLPQELF  476



>gb|KFK42133.1| hypothetical protein AALP_AA2G215400 [Arabis alpina]
Length=399

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSL+AASA+FLA+Y L PS+ PWN+TL HYT Y+   L  CV  L  LC  +  +
Sbjct  307  MLRYAPSLIAASAVFLAQYILQPSRTPWNATLEHYTSYRAKHLEACVKNLLQLCHENPSA  366

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
             + ++R+KYSQHKYKF AKK+CPTS+P E F
Sbjct  367  DVVSVRKKYSQHKYKFAAKKLCPTSLPQELF  397



>ref|XP_006829270.1| hypothetical protein AMTR_s00001p00272790 [Amborella trichopoda]
 gb|ERM96686.1| hypothetical protein AMTR_s00001p00272790 [Amborella trichopoda]
Length=361

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS++AAS IFLAR+TL P   PW STL+HYT Y+ SDL+DCV+A+H+L  N+   SL 
Sbjct  269  FFPSIIAASVIFLARFTLRPQTHPWTSTLQHYTGYKSSDLKDCVIAIHSLQLNTKGCSLA  328

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            AIR+KY  HK+K V+    PT IPS+FF+D++ 
Sbjct  329  AIRDKYKSHKFKCVSSLSPPTEIPSQFFEDING  361



>ref|XP_010428818.1| PREDICTED: cyclin-A1-2-like [Camelina sativa]
Length=412

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSL+AASA+FL ++ L PS KPWN+TL HYT Y+ + +  CV  L  LC  +  S
Sbjct  320  MLRYTPSLIAASAVFLTQHILHPSIKPWNATLEHYTSYKATHMEACVKDLLQLCRGNPSS  379

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
             + AIR+KYSQHKYKF AKK+CPTS+P E F
Sbjct  380  DVVAIRKKYSQHKYKFAAKKLCPTSLPQELF  410



>gb|KDO80524.1| hypothetical protein CISIN_1g043577mg, partial [Citrus sinensis]
Length=402

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCYSPSL+AASA FLA + L P KKPWNSTL HYT YQPSDL DCV ALH L C+   S
Sbjct  330  MLCYSPSLIAASATFLANFILYPLKKPWNSTLGHYTFYQPSDLCDCVKALHRLFCDGGLS  389

Query  429  SLPAIREKYSQHK  391
            +L AIREKYSQHK
Sbjct  390  NLSAIREKYSQHK  402



>ref|XP_006434257.1| hypothetical protein CICLE_v10003984mg, partial [Citrus clementina]
 gb|ESR47497.1| hypothetical protein CICLE_v10003984mg, partial [Citrus clementina]
Length=489

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            MLCYSPSL+AASA FLA + L P KKPWNSTL HYT YQPSDL DCV ALH L C+   S
Sbjct  417  MLCYSPSLIAASATFLANFILYPLKKPWNSTLGHYTFYQPSDLCDCVKALHRLFCDGGLS  476

Query  429  SLPAIREKYSQHK  391
            +L AIREKYSQHK
Sbjct  477  NLSAIREKYSQHK  489



>ref|XP_010429845.1| PREDICTED: cyclin-A1-2-like [Camelina sativa]
Length=448

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSLVAASA+FL ++ L PS+KPWN+TL HYT Y+ + +  CV  L  LC  +  S
Sbjct  356  MLRYTPSLVAASAVFLTQHILHPSRKPWNATLEHYTSYKATHMEACVKDLLQLCHGNPSS  415

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
             + A+R+KYSQH YKF AKK+CPTS+P E F
Sbjct  416  DVVAVRKKYSQHNYKFAAKKLCPTSLPQELF  446



>ref|XP_010471932.1| PREDICTED: cyclin-A1-2-like [Camelina sativa]
Length=456

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSLVAASA+FL ++ L PS+KPWN+TL HYT Y+ + +  CV  L  LC  +  S
Sbjct  364  MLRYTPSLVAASAVFLTQHILHPSRKPWNATLEHYTSYKATHMEACVKDLLQLCHGNPSS  423

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
             + A+R+KYSQH YKF AKK+CPTS+P E F
Sbjct  424  DVVAVRKKYSQHNYKFAAKKLCPTSLPQELF  454



>ref|XP_010416680.1| PREDICTED: cyclin-A1-2-like [Camelina sativa]
Length=455

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSLVAASA+FL ++ L PS+KPWN+TL HYT Y+ + +  CV  L  LC  +  +
Sbjct  363  MLRYTPSLVAASAVFLTQHVLHPSRKPWNATLEHYTSYKATHMEACVKDLLQLCHGNPST  422

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
             + A+R+KYSQH YKF AKK+CPTS+P E F
Sbjct  423  DVVAVRKKYSQHNYKFAAKKLCPTSLPQELF  453



>ref|XP_009106401.1| PREDICTED: cyclin-A1-2 [Brassica rapa]
Length=386

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSLVAASA+FLA+Y L PS KPW+STL HYT Y+   L  CV  L  LC  S  +
Sbjct  295  MLRYAPSLVAASAVFLAQYILHPSTKPWSSTLEHYTSYRAKHLEACVKNLLQLCHESPSA  354

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
             + A+R+KYSQ KYKF AKK CPTS+P E F
Sbjct  355  DVVAVRKKYSQDKYKFAAKKFCPTSLPQELF  385



>emb|CDX87520.1| BnaA07g33530D [Brassica napus]
Length=386

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSLVAASA+FLA+Y L PS KPW+STL HYT Y+   L  CV  L  LC  S  +
Sbjct  295  MLRYAPSLVAASAVFLAQYILHPSTKPWSSTLEHYTSYRAKHLEACVKNLLQLCHESPSA  354

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
             + A+R+KYSQ KYKF AKK CPTS+P E F
Sbjct  355  DVVAVRKKYSQDKYKFAAKKFCPTSLPQELF  385



>ref|XP_010277154.1| PREDICTED: G2/mitotic-specific cyclin C13-1-like [Nelumbo nucifera]
Length=360

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS +FLAR+T+ P   PW+ TL+HY+ Y+PSDL+DCV+A+H+L  N   SSL 
Sbjct  268  FLPSLVAASVVFLARFTIRPKMNPWSLTLQHYSGYRPSDLKDCVLAIHDLQLNRKGSSLV  327

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            A+R+KY QHK+K VA    P  +P+ +F+D+  
Sbjct  328  AVRDKYKQHKFKCVATLASPPEMPNHYFEDIKG  360



>ref|XP_010271484.1| PREDICTED: putative cyclin-A3-1 isoform X2 [Nelumbo nucifera]
Length=389

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PSLVAAS +FL+R+T+ P   PWNSTL+HY+ Y+PSDL+DCV+A+ +L  N    S
Sbjct  295  LRFLPSLVAASVVFLSRFTIQPKMHPWNSTLQHYSGYKPSDLKDCVIAIQDLQLNRRGGS  354

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            L A+++KY QHK+K VA    P  IP+ +F+D+
Sbjct  355  LIAVKDKYKQHKFKCVATLSSPPEIPTHYFEDI  387



>ref|XP_010271477.1| PREDICTED: putative cyclin-A3-1 isoform X1 [Nelumbo nucifera]
Length=390

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PSLVAAS +FL+R+T+ P   PWNSTL+HY+ Y+PSDL+DCV+A+ +L  N    S
Sbjct  296  LRFLPSLVAASVVFLSRFTIQPKMHPWNSTLQHYSGYKPSDLKDCVIAIQDLQLNRRGGS  355

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            L A+++KY QHK+K VA    P  IP+ +F+D+
Sbjct  356  LIAVKDKYKQHKFKCVATLSSPPEIPTHYFEDI  388



>emb|CDX88368.1| BnaC06g38120D [Brassica napus]
Length=380

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSLVAASA+FLA+  L PS+KPW+STL HYT Y+   L  CV  L  LC  S  +
Sbjct  289  MLRYAPSLVAASAVFLAQCILHPSRKPWSSTLEHYTSYRAKHLEGCVKNLLQLCHESPSA  348

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
             + A+R+KYSQ KYKF AKK CPTS+P E F
Sbjct  349  DVVAVRKKYSQDKYKFAAKKFCPTSLPQELF  379



>ref|XP_002972287.1| hypothetical protein SELMODRAFT_412894 [Selaginella moellendorffii]
 gb|EFJ26373.1| hypothetical protein SELMODRAFT_412894 [Selaginella moellendorffii]
Length=404

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L Y PS++AASA+FLA+ T+ P++ PWN TLRHYT Y  S+L  CV  +H L CN+    
Sbjct  311  LKYKPSMIAASAVFLAKLTVDPTEDPWNGTLRHYTGYCASELAQCVRDIHELQCNTKGCG  370

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            LPA+REKY QHK+K VA    P+ I +E F+D
Sbjct  371  LPAVREKYKQHKFKCVATLAAPSPIAAEKFED  402



>ref|XP_001778367.1| predicted protein [Physcomitrella patens]
 gb|EDQ56818.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS++AAS  +LAR TL  S++PW++TL+HYT Y+PS+L  CV A+H L CN+   +LP
Sbjct  181  FLPSMIAASCAYLARVTLDSSRRPWDATLQHYTGYRPSELEQCVRAMHELQCNTRGCTLP  240

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            A+REKY  HK+K VA  + P  +P E+F+++ 
Sbjct  241  AVREKYRHHKFKCVAALVPPAVLPEEYFRELE  272



>dbj|BAA20410.1| A-type cyclin [Catharanthus roseus]
Length=372

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSL+A+S IFL+R+TL P   PWNS L+H + Y+P+DL++CV+ +H+L  +   SSL 
Sbjct  282  FLPSLIASSVIFLSRFTLQPKVHPWNSLLQHNSGYKPADLKECVLIIHDLQLSKRGSSLV  341

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            A+R+KY QHK+K V+    P SIP EFF+D+
Sbjct  342  AVRDKYKQHKFKCVSTLTAPPSIPDEFFEDI  372



>ref|XP_001766438.1| predicted protein [Physcomitrella patens]
 gb|EDQ68766.1| predicted protein, partial [Physcomitrella patens]
Length=282

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS++AAS  +LAR TL  S++PW++TL+HYT Y+PS+L  CV A+H L CN+   +
Sbjct  189  LPFLPSMIAASCAYLARVTLDSSRRPWDATLQHYTGYRPSELEQCVRAMHELQCNTRGCT  248

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            LPA+REKY  HK+K VA  + P  +P E+F+++ 
Sbjct  249  LPAVREKYRHHKFKCVAALVPPALLPEEYFRELE  282



>ref|XP_002984199.1| hypothetical protein SELMODRAFT_423455 [Selaginella moellendorffii]
 gb|EFJ14709.1| hypothetical protein SELMODRAFT_423455 [Selaginella moellendorffii]
Length=404

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L Y PS++AASA+FLA+ T+ P++ PWN TLRHYT Y  S+L  CV  +H L CN+    
Sbjct  311  LKYKPSMIAASAVFLAKLTVDPTEDPWNGTLRHYTGYCASELAQCVRDIHELQCNTKGCG  370

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQ  334
            LPA+REKY QHK+K VA    P+ I +E F+
Sbjct  371  LPAVREKYKQHKFKCVATLAAPSPIAAEKFE  401



>ref|XP_001786071.1| predicted protein [Physcomitrella patens]
 gb|EDQ49118.1| predicted protein, partial [Physcomitrella patens]
Length=284

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML + PS+VAASA+++AR TL PS  PW++TL+HYT Y+ S L  CV  +H+L  NS + 
Sbjct  188  MLGFLPSMVAASAVYMARLTLDPSSCPWDATLQHYTGYKASALEKCVRDIHDLQRNSKNC  247

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            +LPAIREKY  HK+K VA    P+ +P EFF+D+
Sbjct  248  TLPAIREKYRLHKFKCVATLTPPSVLPPEFFKDL  281



>ref|XP_001764427.1| predicted protein [Physcomitrella patens]
 gb|EDQ70694.1| predicted protein [Physcomitrella patens]
Length=237

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS++AASA+++++ TL PS +PW+ TL+HYT Y+ SDL  CV  +H+L  N+ + +
Sbjct  142  LGFLPSMIAASAVYMSKLTLDPSTRPWDVTLQHYTGYKASDLEKCVRLIHDLQRNTKNCT  201

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            LPAIREKY  HK+K VA    P+ +P EFF+D
Sbjct  202  LPAIREKYRNHKFKCVATLTPPSVLPPEFFKD  233



>emb|CAC27333.1| putative A-like cyclin [Picea abies]
Length=380

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            D L Y PSL+AA+A+FLAR TL P   PWNSTL+HYT Y+ SD+RDC+ A+H+L  N   
Sbjct  284  DFLKYLPSLIAAAAVFLARMTLDPMVHPWNSTLQHYTGYKVSDMRDCICAIHDLQLNRKG  343

Query  432  SSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
             +L AIR+KY+Q K+K VA    P  I  +FF D
Sbjct  344  CTLAAIRDKYNQPKFKCVANLFPPPVISPQFFID  377



>ref|XP_008455011.1| PREDICTED: cyclin-A3-1-like isoform X1 [Cucumis melo]
Length=360

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = -3

Query  594  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  415
            PS VAASAIFL+R+T+ P + PW   L+HYT Y+PS+L++C++A+H+L  N   SSL AI
Sbjct  264  PSKVAASAIFLSRFTIQPGEHPWCLALQHYTGYRPSELKECILAIHDLQLNRKGSSLRAI  323

Query  414  REKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            R KY ++K++ VA+   P+ IP+++F+D+ S
Sbjct  324  RNKYKENKFRRVAELSSPSEIPADYFEDIVS  354



>ref|XP_008455012.1| PREDICTED: cyclin-A3-1-like isoform X2 [Cucumis melo]
Length=359

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = -3

Query  594  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  415
            PS VAASAIFL+R+T+ P + PW   L+HYT Y+PS+L++C++A+H+L  N   SSL AI
Sbjct  263  PSKVAASAIFLSRFTIQPGEHPWCLALQHYTGYRPSELKECILAIHDLQLNRKGSSLRAI  322

Query  414  REKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            R KY ++K++ VA+   P+ IP+++F+D+ S
Sbjct  323  RNKYKENKFRRVAELSSPSEIPADYFEDIVS  353



>ref|XP_010059872.1| PREDICTED: putative cyclin-A3-1 [Eucalyptus grandis]
 gb|KCW66318.1| hypothetical protein EUGRSUZ_F00143 [Eucalyptus grandis]
Length=385

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS IFLAR+ + P   PW+  L+ Y+ Y P DL+DCV  LH+L  +    SLP
Sbjct  293  FLPSLVAASVIFLARFMIRPKSHPWSLALQQYSGYCPKDLKDCVQILHDLYLSRRGGSLP  352

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            A+REKY QHK+K VA    P  IP+ +F+D+  
Sbjct  353  AVREKYRQHKFKCVASMASPPEIPATYFEDIGE  385



>gb|KGN55246.1| hypothetical protein Csa_4G642270 [Cucumis sativus]
Length=353

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS  FLAR+ +   K PW S L H+T Y+P+D++DC++ +H+L  +    +L 
Sbjct  261  FLPSLVAASVTFLARFMIQSKKHPWTSRLEHFTGYKPADMKDCILLVHDLYLSRRGGALS  320

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            AIREKY QHK+KFV+    P  IP  +F+DV
Sbjct  321  AIREKYKQHKFKFVSVMPSPPEIPIPYFEDV  351



>ref|XP_008452613.1| PREDICTED: putative cyclin-A3-1 [Cucumis melo]
 ref|XP_008452615.1| PREDICTED: putative cyclin-A3-1 [Cucumis melo]
 ref|XP_008452616.1| PREDICTED: putative cyclin-A3-1 [Cucumis melo]
 ref|XP_008452617.1| PREDICTED: putative cyclin-A3-1 [Cucumis melo]
Length=377

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS  FLAR+ +   K PW S L H+T Y+P+D++DC++ +H+L  +    +L 
Sbjct  285  FLPSLVAASVTFLARFMIQSKKHPWTSRLEHFTGYKPADMKDCILLVHDLYLSRRGGALS  344

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            AIREKY QHK+KFV+    P  IP  +F+DV
Sbjct  345  AIREKYKQHKFKFVSVMPSPPEIPIPYFEDV  375



>ref|XP_004141395.1| PREDICTED: putative cyclin-A3-1-like [Cucumis sativus]
 ref|XP_004164035.1| PREDICTED: putative cyclin-A3-1-like [Cucumis sativus]
Length=376

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS  FLAR+ +   K PW S L H+T Y+P+D++DC++ +H+L  +    +L 
Sbjct  284  FLPSLVAASVTFLARFMIQSKKHPWTSRLEHFTGYKPADMKDCILLVHDLYLSRRGGALS  343

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            AIREKY QHK+KFV+    P  IP  +F+DV
Sbjct  344  AIREKYKQHKFKFVSVMPSPPEIPIPYFEDV  374



>ref|XP_001772176.1| predicted protein [Physcomitrella patens]
 gb|EDQ62989.1| predicted protein [Physcomitrella patens]
Length=297

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML + PS+VAASA++LA+ TL PSK PW+++L+HYT Y+ S+L  CV  +H+L  N+   
Sbjct  201  MLGFLPSMVAASAVYLAKLTLDPSKCPWDASLQHYTGYRASELEKCVKVIHDLQRNTSSC  260

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
             LPAIREKY +HK+K V     P+ IP EFF D
Sbjct  261  ILPAIREKYRKHKFKCVEMLTPPSVIPPEFFID  293



>dbj|BAA11560.1| cyclin [Adiantum capillus-veneris]
Length=532

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS++A +A+ +AR TL P+ +PWNSTL+HY+ Y+ S+L++C  A+  L  N+ + +
Sbjct  439  LHFLPSMIAGAAVLVARVTLNPTWRPWNSTLQHYSGYKASELKECAKAILELQKNTKNCT  498

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            LPAIREKY QHK+K VA    P SIP+E+F D+
Sbjct  499  LPAIREKYRQHKFKCVATLHPPASIPAEYFDDI  531



>dbj|BAK05525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS+VAAS+IFLAR T+ P   PW   +   T Y  S+L+DC++A+H+L  N    S
Sbjct  282  LRFLPSVVAASSIFLARLTIGPDTNPWGKEMHKLTGYGASELKDCIIAIHDLQLNRKGPS  341

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            LPAIR+KY QH++K V+  + P  IP+ +FQD++
Sbjct  342  LPAIRDKYKQHRFKCVSMLLPPVEIPASYFQDLT  375



>ref|XP_010688280.1| PREDICTED: putative cyclin-A3-1 [Beta vulgaris subsp. vulgaris]
Length=383

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS+VAAS IFLA++T+ P K PWNS+L+ YT Y+PSDL++CV+ + +L  +    SL 
Sbjct  290  FLPSMVAASVIFLAKFTIHPKKHPWNSSLQSYTGYKPSDLKECVLRIQDLQLDRRGGSLV  349

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            A++ KY QHKYK V+     + IP+ +F+DV+ 
Sbjct  350  AVKNKYKQHKYKCVSTLTSLSEIPASYFEDVNE  382



>emb|CDP01248.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            Y PSLVAA+ +FL+R+TL P   PWN+ L+ Y+ Y+P++L++CV  +H+L      S+L 
Sbjct  265  YLPSLVAAAVVFLSRFTLQPELHPWNAALQQYSGYKPAELKECVQLIHDLQLGRRGSTLV  324

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            A+REKY+QHK+K V+    P  IP  FF+DV  
Sbjct  325  AVREKYNQHKFKCVSTLSPPPGIPDTFFEDVKD  357



>ref|XP_010906637.1| PREDICTED: cyclin-A3-1-like [Elaeis guineensis]
Length=372

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS+VAASA+FLAR T+ P+  PWN TL++ T Y+PS+L++CV A+H L  N   S+L 
Sbjct  280  FLPSVVAASAVFLARLTINPASHPWNETLQNNTGYRPSELKECVHAIHALQLNKKGSALV  339

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            AI++KY QH++K V+  + P+ IP+ +F+D+
Sbjct  340  AIKDKYKQHRFKCVSALLPPSKIPTSYFEDL  370



>ref|XP_011029106.1| PREDICTED: putative cyclin-A3-1 [Populus euphratica]
Length=363

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            Y PSLVAAS IFL R+ + P   PW+STL+ YT Y+ +DL+DCV+ +H+L  +     L 
Sbjct  273  YLPSLVAASVIFLTRFLMRPKTHPWSSTLQQYTGYKATDLKDCVLIIHDLYLSRRGGGLQ  332

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            A+REKY QHK+K VA    P  IP+ +F +V
Sbjct  333  AVREKYKQHKFKCVANMPSPPEIPALYFDEV  363



>ref|XP_002285074.2| PREDICTED: putative cyclin-A3-1 [Vitis vinifera]
 emb|CBI19446.3| unnamed protein product [Vitis vinifera]
Length=365

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS+VAAS IFL+R+TL P   PW S+L+H++ Y+PS+L++CV+ +H+L  +    SL 
Sbjct  273  FLPSMVAASVIFLSRFTLRPKTHPWCSSLQHHSGYKPSELKECVLIIHDLQLSRRGGSLV  332

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            A+REKY QHK+K VA    P+ IP  +F+D+
Sbjct  333  AVREKYKQHKFKCVATLSSPSVIPVSYFEDI  363



>ref|XP_006374858.1| cyclin A3.1 family protein [Populus trichocarpa]
 gb|ERP52655.1| cyclin A3.1 family protein [Populus trichocarpa]
Length=363

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            Y PSLVAAS IFL R+ + P   PW+STL+ YT Y+ +DL+DCV+ +H+L  +     L 
Sbjct  273  YLPSLVAASVIFLTRFLMRPKTHPWSSTLQQYTGYKATDLKDCVLIIHDLYLSRRGGGLQ  332

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            A+REKY QHK+K VA    P  IP+ +F +V
Sbjct  333  AVREKYKQHKFKCVANMPSPPEIPALYFDEV  363



>ref|XP_001766360.1| predicted protein [Physcomitrella patens]
 gb|EDQ68688.1| predicted protein [Physcomitrella patens]
Length=486

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS++AASA++LA+ TL  S  PW++TL+HYT Y+PS+L  CV A+H L  N+   S
Sbjct  393  LPFLPSMIAASAVYLAKITLDSSTCPWDATLQHYTGYRPSELGHCVKAIHELQRNTDSCS  452

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            LPA+REKY QHK+K VA    P  +P E+F D
Sbjct  453  LPAVREKYRQHKFKCVATLAPPAVLPEEYFLD  484



>ref|XP_007019155.1| Cyclin A1,1, putative isoform 2 [Theobroma cacao]
 gb|EOY16380.1| Cyclin A1,1, putative isoform 2 [Theobroma cacao]
Length=418

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ML Y+PSL+AASA+FLA++ L+PS+KPW+S L  YTLYQPS+L +CV  LH+LC N    
Sbjct  301  MLHYAPSLIAASAVFLAKFILSPSRKPWDSMLGRYTLYQPSELYNCVKDLHHLCLNGDCP  360

Query  429  SLPAIREKYSQHKYKFVA  376
            +L AI++KYSQHK   V 
Sbjct  361  NLAAIKQKYSQHKVNVVV  378



>ref|XP_011069760.1| PREDICTED: putative cyclin-A3-1 [Sesamum indicum]
Length=386

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS IFL+R+TL P   PWNS L+ ++ Y+ +DL++CV  LH+L  +   S+L 
Sbjct  288  FLPSLVAASVIFLSRFTLQPQLHPWNSALQRHSGYEAADLKECVCILHDLQMSRRGSALV  347

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            A+REKY Q K+K V+    P+ +P  FF+D+ S
Sbjct  348  AVREKYKQQKFKCVSTLSTPSEVPESFFEDIKS  380



>ref|XP_011017147.1| PREDICTED: putative cyclin-A3-1 [Populus euphratica]
Length=363

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS IFL R+ + P   PW+STL+ YT Y+ +DLR+CV+ +H+L        LP
Sbjct  273  FLPSLVAASVIFLTRFLMRPKTNPWSSTLQQYTGYKAADLRECVLIIHDLYLRRRGGGLP  332

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            A+ EKY QHK+K VA    P  +P+ +F++V
Sbjct  333  AVGEKYKQHKFKCVANMPSPPELPALYFEEV  363



>emb|CDY62408.1| BnaCnng40230D [Brassica napus]
Length=211

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 64/93 (69%), Gaps = 2/93 (2%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKP-WNSTLRHYTLYQPSDLRDCVMALHNLCCNS-H  436
            ML Y+PSLVAASA+FLARY L PS+KP W+STL HYT Y+   L  CV  L  LC  S  
Sbjct  118  MLRYAPSLVAASAVFLARYVLHPSRKPSWSSTLEHYTRYRAEHLEACVKNLLRLCHESPS  177

Query  435  HSSLPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
              ++ A+R+KYS+ KYKF A  I PTS+P E F
Sbjct  178  GDNVVAVRKKYSKAKYKFAANMIYPTSLPQELF  210



>gb|EEE54182.1| hypothetical protein OsJ_01005 [Oryza sativa Japonica Group]
Length=505

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSLVAASAIFLA++ L P+K PWNSTL HYT Y+ S+L DCV ALH L      
Sbjct  414  NLLSYPPSLVAASAIFLAKFILQPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPG  473

Query  432  SSLPAIREKYSQHKYKFVAKKI  367
            S+LPAIREKY+QHK    A  I
Sbjct  474  SNLPAIREKYTQHKILHAADVI  495



>ref|XP_002301157.1| cyclin A3.1 family protein [Populus trichocarpa]
 gb|EEE80430.1| cyclin A3.1 family protein [Populus trichocarpa]
Length=360

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS IFL R+ + P   PW+STL+ YT Y+ +DLR+CV+ +H+L  +     L 
Sbjct  270  FLPSLVAASVIFLTRFLMRPKTNPWSSTLQQYTGYKAADLRECVLIIHDLYLSRRGGGLQ  329

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            A+REKY QHK+K VA    P  +P+ +F++V
Sbjct  330  AVREKYKQHKFKCVANMPSPPELPALYFEEV  360



>ref|XP_004963009.1| PREDICTED: cyclin-A3-2-like isoform X1 [Setaria italica]
 ref|XP_004963010.1| PREDICTED: cyclin-A3-2-like isoform X2 [Setaria italica]
Length=437

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS+VAAS +F+AR T+ P   PWN  L+  T Y+ S+L+DC++A+H+L  N   SS
Sbjct  343  LRFLPSVVAASVMFVARLTIDPDVNPWNKKLQKVTGYKASELKDCIIAIHDLQLNRKCSS  402

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            L AIR+KY QHK+KFV+  + P  IP+ + +D++
Sbjct  403  LMAIRDKYKQHKFKFVSTLLPPVVIPASYLEDLA  436



>gb|EEE54185.1| hypothetical protein OsJ_01008 [Oryza sativa Japonica Group]
Length=497

 Score =   100 bits (248),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSLVAASAIFLA++ L P+K PWNSTL HYT Y+ S+L DCV ALH L      
Sbjct  407  NLLSYPPSLVAASAIFLAKFILQPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPG  466

Query  432  SSLPAIREKYSQHK  391
            S+LPAIREKY+QHK
Sbjct  467  SNLPAIREKYTQHK  480



>ref|XP_011015741.1| PREDICTED: putative cyclin-A3-1 [Populus euphratica]
Length=363

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS IFL R+ + P   PW+STL+ YT Y+ +DLR+CV+ +H+L  +     L 
Sbjct  273  FLPSLVAASVIFLTRFLMRPKTNPWSSTLQQYTGYKAADLRECVLIIHDLYLSRRGGGLQ  332

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            A+REKY QHK+K VA    P  +P+ +F++V
Sbjct  333  AVREKYKQHKFKCVANMPSPPELPALYFEEV  363



>ref|XP_004290941.1| PREDICTED: putative cyclin-A3-1 [Fragaria vesca subsp. vesca]
Length=365

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS +FL R+ + P   PW S+L+ Y+ Y+PS+L++CV+ +H+L       SL 
Sbjct  273  FLPSLVAASVVFLTRFIIQPRMNPWTSSLQQYSGYKPSELKECVLIIHDLYLGRRGGSLQ  332

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            AIREKY +HK+K VA    P  +P+ FF+DV
Sbjct  333  AIREKYKRHKFKCVAVMPSPPEVPAYFFEDV  363



>ref|XP_008780924.1| PREDICTED: cyclin-A3-1-like [Phoenix dactylifera]
Length=379

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 68/92 (74%), Gaps = 1/92 (1%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS++AASA+FLAR T+  +  PWN TL+ YT Y+PS+L++CV A+++L  N   S+L 
Sbjct  286  FLPSVIAASAVFLARLTINRASHPWNETLQRYTGYKPSELKECVHAIYDLQLNKKGSALV  345

Query  420  AIREKYSQHKYKFVAKKICPTS-IPSEFFQDV  328
            AI+EKY QH++K VA  + P S IP+ +F+D+
Sbjct  346  AIKEKYRQHRFKCVAAALLPPSEIPASYFEDL  377



>ref|XP_003630468.1| Cyclin A [Medicago truncatula]
Length=558

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            DML Y+PSL+AASA FLA+Y L  +K PWNS LRHYT YQ S+LR+CV  LH L  N +H
Sbjct  415  DMLKYTPSLIAASATFLAKYILLSTKNPWNSMLRHYTGYQASELRECVEGLHLLYRNGYH  474

Query  432  S--SLPAIREKYSQHK  391
            S  S+ AIREKYSQHK
Sbjct  475  SSPSITAIREKYSQHK  490



>ref|XP_009794344.1| PREDICTED: G2/mitotic-specific cyclin C13-1-like [Nicotiana sylvestris]
 emb|CAA63541.1| cyclin A-like protein [Nicotiana tabacum]
Length=384

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            Y PSL+AA+ +FL+R+TL P+  PW+  L+ Y+ Y+ +DL++C++ LH+L  +    SL 
Sbjct  291  YVPSLLAAAVVFLSRFTLQPNTHPWSLALQQYSGYKAADLKECILILHDLQLSRRGGSLA  350

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            A+R+KY QHK+K V+    P  IP+ FF+D+
Sbjct  351  AVRDKYKQHKFKCVSSLTSPVEIPASFFEDM  381



>ref|XP_001764550.1| predicted protein [Physcomitrella patens]
 gb|EDQ70532.1| predicted protein [Physcomitrella patens]
Length=234

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS+VAASA+++A+ TL PS  PW++TL+HYT Y+ S+L  CV  +H+L  N+ + +
Sbjct  142  LGFLPSMVAASAVYVAKLTLDPSTCPWDATLQHYTGYRASELEKCVRIIHDLQRNTKNCT  201

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            LPAIREKY  HK+K VA    P  +  EFF+D
Sbjct  202  LPAIREKYRHHKFKCVATLTPPLVLTPEFFKD  233



>ref|NP_001042509.2| Os01g0233100 [Oryza sativa Japonica Group]
 dbj|BAF04423.2| Os01g0233100 [Oryza sativa Japonica Group]
Length=634

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  612  DMLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHH  433
            ++L Y PSLVAASAIFLA++ L P+K PWNSTL HYT Y+ S+L DCV ALH L      
Sbjct  512  NLLSYPPSLVAASAIFLAKFILQPTKHPWNSTLAHYTQYKSSELSDCVKALHRLFSVGPG  571

Query  432  SSLPAIREKYSQHKYKFVAKKI  367
            S+LPAIREKY+QHK    A  I
Sbjct  572  SNLPAIREKYTQHKILHAADVI  593



>ref|XP_002466828.1| hypothetical protein SORBIDRAFT_01g014850 [Sorghum bicolor]
 gb|EER93826.1| hypothetical protein SORBIDRAFT_01g014850 [Sorghum bicolor]
Length=378

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            +L + PSLVAAS +F+AR TL P   PW+  ++  T Y+PS+L+DCV A+H++  N  +S
Sbjct  283  LLRFLPSLVAASVVFVARLTLDPHTNPWSKKMQTLTGYKPSELKDCVAAIHHMQLNRKYS  342

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQ  334
            S+ AIREKY QHK+K V+  + P  IP+ +F+
Sbjct  343  SMMAIREKYKQHKFKGVSALLPPVEIPASYFK  374



>ref|XP_002510134.1| cyclin A, putative [Ricinus communis]
 gb|EEF52321.1| cyclin A, putative [Ricinus communis]
Length=373

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVA+S IFLAR+ + P   PW+STL+ ++ Y+PSDL++CV+ +H+L  +     L 
Sbjct  281  FLPSLVASSVIFLARFMIKPKMHPWSSTLQQHSGYRPSDLKECVLIIHDLYLSRRGGGLQ  340

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            A+REKY QHK+K VA    P  IP+ +F+ V
Sbjct  341  AVREKYKQHKFKCVATMPSPPEIPAAYFEGV  371



>ref|XP_004238117.1| PREDICTED: putative cyclin-A3-1 [Solanum lycopersicum]
Length=371

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS IFL+R+TL P+  PW++ L+ Y+ Y+ SDL++CV+ LH+L  +    SL 
Sbjct  278  FLPSLVAASVIFLSRFTLQPNAHPWSAALQRYSGYKASDLKECVLILHDLQLSRRGGSLV  337

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            A+R+KY QHK+K V+       IP+ FF+D
Sbjct  338  AVRDKYKQHKFKCVSTLTSLVEIPASFFED  367



>ref|XP_010936556.1| PREDICTED: cyclin-A3-1-like [Elaeis guineensis]
Length=376

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS++AASA+FLAR+T+ P   PW+  L+  T Y+PS+L+DCV A+H+L  N   SSL 
Sbjct  284  FLPSVIAASAVFLARFTINPKVHPWSLPLQQQTGYKPSELKDCVCAIHDLQLNRKWSSLT  343

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            AIREKY QH++K  +  + P+ IP+ + +D+
Sbjct  344  AIREKYKQHRFKCASMLLSPSEIPASYLEDL  374



>ref|XP_009351160.1| PREDICTED: cyclin-A3-1-like [Pyrus x bretschneideri]
Length=356

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = -3

Query  594  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  415
            PS+VAASAIFL+R+T+ P   PW+  L+ YT Y+PSDLR CV+A+H+L  N   SSL AI
Sbjct  266  PSVVAASAIFLSRFTIQPDVHPWSLALQSYTGYRPSDLRMCVLAIHDLQLNRKPSSLRAI  325

Query  414  REKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            REKY++ + K VAK   P+ IP  +F+ +
Sbjct  326  REKYARPQNKSVAKLSSPSEIPGGYFEAI  354



>gb|KDP41661.1| hypothetical protein JCGZ_16068 [Jatropha curcas]
Length=368

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS IFLAR+ + P   PW+ TL+ Y+ Y+ S+L++CV+ +H+L  +   + L 
Sbjct  276  FLPSLVAASVIFLARFIIKPKMHPWSLTLQQYSRYKSSELKECVLIIHDLYLSRRGAGLQ  335

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            A+REKY QHK+K+VA    P  +P  FF+ V  
Sbjct  336  AVREKYKQHKFKYVATLPSPPEVPGYFFEGVKE  368



>ref|XP_004137091.1| PREDICTED: cyclin-A3-4-like [Cucumis sativus]
Length=362

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -3

Query  594  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  415
            PS VAASAIFL+R+T+ P + PW   L+ Y+ Y+ S+L++C++A+H+L  N   SSL AI
Sbjct  263  PSKVAASAIFLSRFTIQPEEHPWCLALQRYSGYRASELKECILAIHDLQLNRKGSSLLAI  322

Query  414  REKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            REKY ++K+K VA+   P+ IP+++F+D+
Sbjct  323  REKYKENKFKCVAELCSPSEIPADYFEDI  351



>ref|XP_008787130.1| PREDICTED: cyclin-A3-1-like [Phoenix dactylifera]
Length=376

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS++AASA+F+AR+T+ P   PW+ +L+  T Y+P++L+DCV A+H+L  N   SSL 
Sbjct  284  FLPSVIAASAVFIARFTIDPKAHPWSLSLQQQTGYKPTELKDCVCAIHDLQLNRKWSSLT  343

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            AIREKY QH++K  +  + P+ IP+ + +D+
Sbjct  344  AIREKYKQHRFKCASMLLSPSEIPASYLEDL  374



>ref|XP_011100040.1| PREDICTED: putative cyclin-A3-1 [Sesamum indicum]
Length=391

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS IFL+R+TL P   PWNS L+ ++ Y+ +DL++CV  LH+L  +   S L 
Sbjct  298  FLPSLVAASVIFLSRFTLQPQLHPWNSALQRHSGYEAADLKECVCILHDLQMSRRGSGLV  357

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            A+REKY Q K+K V+    P+ +P  FF+D+
Sbjct  358  AVREKYKQQKFKCVSTLSTPSQVPESFFEDI  388



>ref|XP_008367648.1| PREDICTED: putative cyclin-A3-1 isoform X1 [Malus domestica]
Length=378

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS  FLAR+ + P   PW  +L+ Y+ Y+P+DL++CV+ +++L CN   +SL 
Sbjct  274  FLPSLVAASVTFLARFMIRPKDHPWTLSLQRYSGYKPADLKECVLLIYDLHCNKRGASLQ  333

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +IR KY QHK+K VA    P  +PS +F+D
Sbjct  334  SIRAKYKQHKFKCVATISSPAEVPSNYFED  363



>ref|XP_008367649.1| PREDICTED: putative cyclin-A3-1 isoform X2 [Malus domestica]
Length=373

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS  FLAR+ + P   PW  +L+ Y+ Y+P+DL++CV+ +++L CN   +SL 
Sbjct  269  FLPSLVAASVTFLARFMIRPKDHPWTLSLQRYSGYKPADLKECVLLIYDLHCNKRGASLQ  328

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            +IR KY QHK+K VA    P  +PS +F+D
Sbjct  329  SIRAKYKQHKFKCVATISSPAEVPSNYFED  358



>ref|XP_009603340.1| PREDICTED: putative cyclin-A3-1 [Nicotiana tomentosiformis]
Length=383

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            Y PSL+AA+ +FL+R+TL P+  PW+  L  Y+ Y+ +DL++CV+ LH+L  +    SL 
Sbjct  290  YLPSLLAAAVVFLSRFTLQPNTHPWSLALEQYSGYKAADLKECVLILHDLQLSRRGGSLV  349

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            A+R+KY QHK+K V+    P  IP+ FF+D
Sbjct  350  AVRDKYKQHKFKCVSSLTSPVEIPASFFED  379



>ref|XP_004290942.1| PREDICTED: cyclin-A3-2-like [Fragaria vesca subsp. vesca]
Length=355

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS+VA+S +FLAR  +     PW STL+HYT Y+ +DL+DCV+ LH+L        L 
Sbjct  263  FLPSMVASSVVFLARLMIRSKINPWCSTLQHYTGYKAADLKDCVVVLHDLYLGRRGGLLQ  322

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
             +REKY QHK+K+VA   CP  +P+  F +V +
Sbjct  323  VVREKYKQHKFKYVANLPCPPELPAPLFDNVKA  355



>ref|XP_006362078.1| PREDICTED: cyclin-A3-2-like [Solanum tuberosum]
Length=368

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS +FL+R+TL P+  PW++ L+ Y+ Y+ SDL++CV+ LH+L  +    SL 
Sbjct  275  FLPSLVAASVMFLSRFTLQPNAHPWSAALQRYSGYKASDLKECVLILHDLQLSRRGGSLV  334

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            A+R+KY QHK+K V+       IP+ FF+D
Sbjct  335  AVRDKYKQHKFKCVSTLTSLVEIPASFFED  364



>ref|XP_010061706.1| PREDICTED: putative cyclin-A3-1 isoform X1 [Eucalyptus grandis]
 gb|KCW68680.1| hypothetical protein EUGRSUZ_F02276 [Eucalyptus grandis]
Length=367

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS+VAAS  FLARY   P   PW S+LR Y+ Y   DL++CV  +H+L       SL 
Sbjct  275  FLPSVVAASVTFLARYITQPRTHPWTSSLRRYSGYTVKDLKECVQIIHDLYLGRRGGSLQ  334

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            A+REKY QHK+K VA    P  IP+ +F+DV+ 
Sbjct  335  AVREKYKQHKFKRVAVMPSPPDIPASYFKDVNE  367



>ref|XP_008674080.1| PREDICTED: cyclin-A3-2-like [Zea mays]
 tpg|DAA54691.1| TPA: cyclin superfamily protein, putative [Zea mays]
Length=437

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS+VAAS +F+AR T+ P+  PWN+ L+  T Y+ S+L+DC++A+H+L  N    S
Sbjct  343  LRFLPSVVAASVMFVARLTIDPNTNPWNTKLQKMTGYKVSELKDCIVAIHDLQLNRKCPS  402

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            L AIR+KY QHK+K V+  + P  IP+ +F+D++
Sbjct  403  LTAIRDKYKQHKFKCVSLILVPVVIPTSYFEDLA  436



>ref|XP_006486965.1| PREDICTED: putative cyclin-A3-1-like [Citrus sinensis]
Length=385

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L Y PSLVAAS+IFL+R+ + P   PW+  L+ ++ Y+PSDL++CV+A+H+L      +S
Sbjct  291  LWYLPSLVAASSIFLSRFIMQPKIHPWSWELQSFSGYRPSDLKECVLAIHDLYNKRKANS  350

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
              AIREKY QHK+K VA   CP+ +P  +F
Sbjct  351  SQAIREKYMQHKFKLVALLSCPSEVPERYF  380



>ref|XP_004159935.1| PREDICTED: cyclin-A3-2-like [Cucumis sativus]
Length=443

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -3

Query  594  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  415
            PS VAASAIFL+R+T+ P + PW   L+ Y+ Y+ S+L++C++A+H+L  N   SSL AI
Sbjct  344  PSKVAASAIFLSRFTIQPEEHPWCLALQRYSGYRASELKECILAIHDLQLNRKGSSLLAI  403

Query  414  REKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            REKY ++K+K VA+   P+ IP+++F+D+
Sbjct  404  REKYKENKFKCVAELCSPSEIPADYFEDI  432



>ref|XP_002442399.1| hypothetical protein SORBIDRAFT_08g019410 [Sorghum bicolor]
 gb|EES16237.1| hypothetical protein SORBIDRAFT_08g019410 [Sorghum bicolor]
Length=428

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS+VAAS +F+AR T+ P+  PWN+ L+  T Y+ SDL+DC++A+H+L  N    S
Sbjct  334  LRFLPSVVAASVMFVARLTIDPNVNPWNTKLQKMTGYKVSDLKDCIVAIHDLQLNRKCPS  393

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            L AIR+KY QHK+K V+  + P  IP+ +F+D+
Sbjct  394  LMAIRDKYKQHKFKCVSTLLPPVVIPASYFEDL  426



>gb|KFK44638.1| hypothetical protein AALP_AA1G284800 [Arabis alpina]
Length=369

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = -3

Query  609  MLCYS-----PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCC  445
            ML YS     PSL+AASAIFLAR+ L P + PWN TL  YT Y+ SDL+ CV  +H+L  
Sbjct  264  MLDYSCVGFLPSLLAASAIFLARFILRPKQHPWNQTLEEYTKYKASDLQLCVGIIHDLYL  323

Query  444  NSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            +   + L A+R KY QHK+K VA       +P  FF+DV+
Sbjct  324  SRRGNGLEAVRNKYKQHKFKCVATMPVSPEMPLAFFEDVT  363



>gb|KGN43871.1| hypothetical protein Csa_7G071600 [Cucumis sativus]
Length=443

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -3

Query  594  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  415
            PS VAASAIFL+R+T+ P + PW   L+ Y+ Y+ S+L++C++A+H+L  N   SSL AI
Sbjct  344  PSKVAASAIFLSRFTIQPEEHPWCLALQRYSGYRASELKECILAIHDLQLNRKGSSLLAI  403

Query  414  REKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            REKY ++K+K VA+   P+ IP+++F+D+
Sbjct  404  REKYKENKFKCVAELCSPSEIPADYFEDI  432



>gb|KFK44637.1| hypothetical protein AALP_AA1G284800 [Arabis alpina]
Length=370

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = -3

Query  609  MLCYS-----PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCC  445
            ML YS     PSL+AASAIFLAR+ L P + PWN TL  YT Y+ SDL+ CV  +H+L  
Sbjct  265  MLDYSCVGFLPSLLAASAIFLARFILRPKQHPWNQTLEEYTKYKASDLQLCVGIIHDLYL  324

Query  444  NSHHSSLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            +   + L A+R KY QHK+K VA       +P  FF+DV+
Sbjct  325  SRRGNGLEAVRNKYKQHKFKCVATMPVSPEMPLAFFEDVT  364



>ref|NP_001146465.1| cyclin superfamily protein, putative [Zea mays]
 gb|ACL54073.1| unknown [Zea mays]
 tpg|DAA50473.1| TPA: cyclin superfamily protein, putative [Zea mays]
Length=372

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -3

Query  594  PSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLPAI  415
            PSLVAASA+F+AR TL P   PW+  ++  T Y+PS+L+DCV A+HNL  N    S+ AI
Sbjct  282  PSLVAASAVFVARLTLDPHTHPWSKKVQTLTGYKPSELKDCVAAIHNLQLNRTCQSMVAI  341

Query  414  REKYSQHKYKFVAKKICPTSIPSEFF  337
            REKY QH++K V+  + P  IP+ +F
Sbjct  342  REKYRQHRFKGVSALLPPVEIPASYF  367



>ref|XP_003550316.1| PREDICTED: putative cyclin-A3-1-like isoform X1 [Glycine max]
 gb|KHN45268.1| Putative cyclin-A3-1 [Glycine soja]
Length=367

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS +FLAR+  +    PWNS L   T Y+P+DL++CV+ LH+L  +   +SL 
Sbjct  270  FLPSLVAASVVFLARFMFSTKTHPWNSALHQLTRYKPADLKECVLNLHDLYLSRRGASLQ  329

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQ  334
            A+REKY QHK+K VA    P  IP  FF+
Sbjct  330  AVREKYKQHKFKCVATTPSPPEIPLSFFE  358



>tpg|DAA54692.1| TPA: cyclin superfamily protein, putative [Zea mays]
Length=474

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS+VAAS +F+AR T+ P+  PWN+ L+  T Y+ S+L+DC++A+H+L  N    S
Sbjct  380  LRFLPSVVAASVMFVARLTIDPNTNPWNTKLQKMTGYKVSELKDCIVAIHDLQLNRKCPS  439

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            L AIR+KY QHK+K V+  + P  IP+ +F+D++
Sbjct  440  LTAIRDKYKQHKFKCVSLILVPVVIPTSYFEDLA  473



>ref|XP_003578446.1| PREDICTED: cyclin-A3-2-like [Brachypodium distachyon]
Length=381

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS+VAASA+FLAR T+ P   PW+  ++  T Y+ S+L+DC+ A+H+L  N    S
Sbjct  288  LQFLPSVVAASAVFLARLTIAPDCNPWSKEMQKLTGYKASELKDCIRAIHDLQLNRKGLS  347

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            L AIR+KY QH++K V+  + P  IP+ +FQD
Sbjct  348  LTAIRDKYKQHRFKCVSTLLPPVEIPASYFQD  379



>ref|XP_009346867.1| PREDICTED: cyclin-A3-1-like isoform X1 [Pyrus x bretschneideri]
Length=356

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS+VAASAIFL+R+T+ P   PW+  L+ YT Y PSDLR CV+A+H L  N   SSL 
Sbjct  264  FLPSVVAASAIFLSRFTIQPDVHPWSLALQSYTGYGPSDLRMCVLAIHALQLNRKPSSLR  323

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            AIREKY++ + K VAK   P+ IP  +F+ +
Sbjct  324  AIREKYARPQNKSVAKLSSPSEIPGAYFEAI  354



>ref|XP_006422880.1| hypothetical protein CICLE_v10028641mg [Citrus clementina]
 gb|ESR36120.1| hypothetical protein CICLE_v10028641mg [Citrus clementina]
Length=385

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L Y PSLVAAS+IFL+R+ + P   PW+  L+ ++ Y+PSDL++CV+A+H+L      +S
Sbjct  291  LRYLPSLVAASSIFLSRFIMQPKIHPWSWELQTFSGYRPSDLKECVLAIHDLYNKRKANS  350

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFF  337
              AIREKY QHK+K VA   CP+ +P  +F
Sbjct  351  SQAIREKYMQHKFKLVALLSCPSEVPERYF  380



>gb|KHG09323.1| Cyclin-A3-2 -like protein [Gossypium arboreum]
Length=389

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS+VAAS IFLAR+ + P   PW+S ++ Y+ Y+ SDL++CV+ +H+L  +    +L 
Sbjct  285  FLPSMVAASVIFLARFIIEPKMHPWSSAVQEYSGYKASDLKECVLIIHDLYLSRRGGALQ  344

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            A+REKY QHK+K VA       IP+ +F+DV
Sbjct  345  AVREKYKQHKFKCVATMPASPEIPASYFEDV  375



>ref|XP_006287744.1| hypothetical protein CARUB_v10000955mg [Capsella rubella]
 gb|EOA20642.1| hypothetical protein CARUB_v10000955mg [Capsella rubella]
Length=446

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PSL+AASA+FLAR+TL  S  PWN TL+HYT Y+ S L++ V+A+ NL  N++ S+
Sbjct  356  LRFQPSLIAASAVFLARWTLDQSSHPWNPTLQHYTRYEASALKNTVIAMENLQLNTNGST  415

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEF  340
            L AIR KY+Q K+K VA    P  + + F
Sbjct  416  LIAIRTKYNQEKFKSVATLTSPERVTTLF  444



>gb|AEX07598.1| cyclin A3-1, partial [Brassica juncea]
Length=267

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS+VAASA++LAR+ + P + PW+  L  YT Y+  DLR+CV  +H+L  +    +
Sbjct  173  LKFLPSVVAASAVYLARFIIRPKQHPWSVMLEEYTRYKAGDLRECVCMIHDLYLSRKGGA  232

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            L A+REKY QHK+K VA       +P  FF+DVS
Sbjct  233  LQAVREKYKQHKFKCVATMPVSPELPLTFFEDVS  266



>gb|KJB58584.1| hypothetical protein B456_009G216800 [Gossypium raimondii]
Length=389

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS+VAAS IFLAR+ + P   PW+S ++ Y+ Y+ SDL++CV+ +H+L  +    +L 
Sbjct  285  FLPSMVAASVIFLARFIIQPKMHPWSSAVQEYSGYKASDLKECVLIIHDLYLSRRGGALQ  344

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            A+REKY QHK+K VA       IP+ +F+DV
Sbjct  345  AVREKYKQHKFKCVATMPASPEIPASYFEDV  375



>ref|XP_010549257.1| PREDICTED: putative cyclin-A3-1 isoform X2 [Tarenaya hassleriana]
Length=375

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS+VAASAIFLAR+ + P + PWN  L+ YT Y+P+DL++CV  +H+L  +    +L 
Sbjct  283  FLPSMVAASAIFLARFIMRPKQHPWNPMLQEYTKYKPADLKECVGIIHDLYLSRRGGALQ  342

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            A+R KY QH++K VA       +P  FF+DV
Sbjct  343  AVRAKYKQHRFKCVATLPVSPELPLLFFEDV  373



>ref|XP_010549256.1| PREDICTED: putative cyclin-A3-1 isoform X1 [Tarenaya hassleriana]
Length=376

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS+VAASAIFLAR+ + P + PWN  L+ YT Y+P+DL++CV  +H+L  +    +L 
Sbjct  284  FLPSMVAASAIFLARFIMRPKQHPWNPMLQEYTKYKPADLKECVGIIHDLYLSRRGGALQ  343

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            A+R KY QH++K VA       +P  FF+DV
Sbjct  344  AVRAKYKQHRFKCVATLPVSPELPLLFFEDV  374



>ref|XP_008377992.1| PREDICTED: cyclin-A3-2-like [Malus domestica]
 ref|XP_008357378.1| PREDICTED: cyclin-A3-2-like [Malus domestica]
Length=361

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = -3

Query  609  MLCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHS  430
            ++ + PSLVAASA+FLAR+       PW   L+ YT Y+ +DL++CV+A+H++C      
Sbjct  266  LVKFLPSLVAASAVFLARFMTQTKTHPWCPELQQYTGYKAADLKECVLAIHDMCLGRRAR  325

Query  429  SLPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
            +L  I+EKY Q K+K VA   CP  IP  FFQD+ +
Sbjct  326  NLNVIQEKYKQPKFKQVAHIPCPQEIPVHFFQDLKA  361



>gb|KHN21404.1| Cyclin-A3-4 [Glycine soja]
Length=265

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS +FLAR+  +    PWN  L   T Y+P+DL++CV+ LH+L  +   +SL 
Sbjct  168  FLPSLVAASVVFLARFMFSTKTHPWNLALHQLTRYKPADLKECVLNLHDLYLSRRGASLQ  227

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQ  334
            A+REKY QHK+K VA    P  IP  FF+
Sbjct  228  AVREKYKQHKFKCVATTASPPKIPLSFFE  256



>ref|XP_010540385.1| PREDICTED: putative cyclin-A3-1 isoform X2 [Tarenaya hassleriana]
Length=374

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS+ AASAIFLAR+ L P + PWN  L  YT Y+P+DL++CV  +H+L  +    +L 
Sbjct  282  FLPSMSAASAIFLARFILHPKQHPWNHMLHEYTRYKPADLKECVGIIHDLYLSRRGGALQ  341

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            A+R++Y QHK+K VA       IP +FF+D
Sbjct  342  AVRDRYKQHKFKCVATMPVSPEIPPDFFED  371



>ref|XP_010540384.1| PREDICTED: putative cyclin-A3-1 isoform X1 [Tarenaya hassleriana]
Length=375

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS+ AASAIFLAR+ L P + PWN  L  YT Y+P+DL++CV  +H+L  +    +L 
Sbjct  283  FLPSMSAASAIFLARFILHPKQHPWNHMLHEYTRYKPADLKECVGIIHDLYLSRRGGALQ  342

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQD  331
            A+R++Y QHK+K VA       IP +FF+D
Sbjct  343  AVRDRYKQHKFKCVATMPVSPEIPPDFFED  372



>ref|XP_010494276.1| PREDICTED: putative cyclin-A3-1 isoform X2 [Camelina sativa]
Length=364

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS+VAASA+FLAR+ + P + PWN  L  YT Y+  DL++CV  +H+L  +    +
Sbjct  270  LKFLPSIVAASAVFLARFIIRPKQHPWNVMLEEYTKYKAGDLKECVRMIHDLYLSRKGGA  329

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            L AIREKY QHK+K VA       +P   F+DV+
Sbjct  330  LQAIREKYKQHKFKCVATMPVSPELPLTVFEDVN  363



>ref|XP_008373079.1| PREDICTED: cyclin-A3-1-like isoform X1 [Malus domestica]
Length=356

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS+VAASAIFL+R+T+ P   PW+  L+ Y+ Y+PSDL+ CV+A+H+L  N   SSL 
Sbjct  264  FLPSVVAASAIFLSRFTIQPDVHPWSLALQSYSGYRPSDLKMCVLAVHDLQLNRKPSSLR  323

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDV  328
            AIREKY + K K VAK   P+ IP  +F+ +
Sbjct  324  AIREKYMRPKNKSVAKLSSPSEIPGAYFEAI  354



>ref|XP_008367786.1| PREDICTED: putative cyclin-A3-1 [Malus domestica]
Length=131

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSL+AASA FLAR+       PW   L+ YT Y+ +DL++CV+A+H +C      +L 
Sbjct  39   FLPSLIAASAAFLARFMTRTKTHPWCPALQQYTGYKAADLKECVLAIHEMCLGRRARNLN  98

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVSS  322
             I+EKY Q K+K VA   CP  IP  FFQD+ +
Sbjct  99   VIQEKYKQPKFKCVAHIPCPQEIPVHFFQDLKA  131



>ref|XP_006601271.1| PREDICTED: putative cyclin-A3-1-like isoform X2 [Glycine max]
Length=405

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS +FLAR+  +    PWNS L   T Y+P+DL++CV+ LH+L  +   +SL 
Sbjct  308  FLPSLVAASVVFLARFMFSTKTHPWNSALHQLTRYKPADLKECVLNLHDLYLSRRGASLQ  367

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQ  334
            A+REKY QHK+K VA    P  IP  FF+
Sbjct  368  AVREKYKQHKFKCVATTPSPPEIPLSFFE  396



>ref|XP_009111667.1| PREDICTED: cyclin-A2-1 [Brassica rapa]
Length=421

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PSL+AASA+FLAR+TL  SK PWNSTL+HYT Y+   L++ V+A+ +L  N+  S 
Sbjct  331  LRFLPSLIAASAVFLARWTLDQSKHPWNSTLQHYTRYETPALKNTVLAMEDLQLNTSGSI  390

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEF  340
            L AIR KY+Q K+K VA    P S+ + F
Sbjct  391  LVAIRNKYNQEKFKRVATLTSPESVTTLF  419



>emb|CDY22369.1| BnaA06g36910D [Brassica napus]
Length=351

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS+VAASA++LAR+ + P + PW+  L  YT Y+  DLR+CV  +H+L  +    +
Sbjct  257  LKFLPSVVAASAVYLARFIIRPKQHPWSVMLEEYTRYKAGDLRECVCMIHDLYLSRKGGA  316

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            L A+REKY QHK+K VA       +P  FF+DVS
Sbjct  317  LQAVREKYKQHKFKCVATMPVSPELPLTFFEDVS  350



>ref|XP_002891340.1| CYCA3_4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67599.1| CYCA3_4 [Arabidopsis lyrata subsp. lyrata]
Length=373

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            Y PSL+AASA+FLAR+ + P + PWN  L  YT Y+ SDL+ CV  +H+L  +   ++L 
Sbjct  277  YLPSLLAASAVFLARFIIRPKQHPWNQMLEEYTKYKASDLQVCVGIIHDLYLSRRGNTLE  336

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            A+R KY QHKYK VA       +P  FF+D++
Sbjct  337  AVRNKYKQHKYKCVATMPVSPELPLAFFEDIT  368



>gb|KJB53898.1| hypothetical protein B456_009G011300 [Gossypium raimondii]
 gb|KJB53899.1| hypothetical protein B456_009G011300 [Gossypium raimondii]
Length=420

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = -3

Query  606  LCYSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSS  427
            L + PS +AASA+FLAR+TL  S  PWN TL HYT Y+ S+L++ V+AL +L  N++  S
Sbjct  330  LKFLPSNIAASAVFLARWTLNQSDHPWNPTLEHYTSYKASELKNTVLALEDLQLNTNGCS  389

Query  426  LPAIREKYSQHKYKFVAKKICPTSIPSEFFQ  334
            L AIREKY Q K+K VA    P S+ S F +
Sbjct  390  LNAIREKYRQQKFKCVAMMTSPESVGSVFLR  420



>ref|XP_007160891.1| hypothetical protein PHAVU_001G025700g [Phaseolus vulgaris]
 gb|ESW32885.1| hypothetical protein PHAVU_001G025700g [Phaseolus vulgaris]
Length=349

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PSLVAAS +FLAR+ L+    PWNS L   T Y+P+DL++C++ +H+L       SL 
Sbjct  256  FLPSLVAASVVFLARFMLSTRTHPWNSALHQLTKYKPADLKECILNIHDLYLRRRGPSLE  315

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQ  334
            A+REKY QHK+K VA    P  IP  FF+
Sbjct  316  AVREKYKQHKFKCVATTPSPPEIPLSFFE  344



>gb|AES59369.2| carboxy-terminal domain cyclin [Medicago truncatula]
Length=363

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            + PS+VAAS +FLAR+ L+P   PWNS +  +T Y+P+DL++CV+ +H+L       SL 
Sbjct  269  FLPSMVAASVVFLARFMLSPKTHPWNSAIYEFTRYKPADLKECVLNIHDLYLGRKGGSLQ  328

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQ  334
            A+R+KY QHK+K VA    P  I   FF+
Sbjct  329  AVRDKYKQHKFKCVATTPSPPEISLSFFE  357



>ref|XP_010500243.1| PREDICTED: cyclin-A3-4 isoform X2 [Camelina sativa]
Length=374

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = -3

Query  600  YSPSLVAASAIFLARYTLTPSKKPWNSTLRHYTLYQPSDLRDCVMALHNLCCNSHHSSLP  421
            Y PSL+AASA+FLAR+ + P + PWN  L  YT Y+ +DL+ CV  +H+L  +   ++L 
Sbjct  278  YLPSLLAASAVFLARFIIRPKQHPWNQMLEEYTKYKAADLQLCVGIIHDLYLSRRGNTLE  337

Query  420  AIREKYSQHKYKFVAKKICPTSIPSEFFQDVS  325
            A+R KY QHKYK VA       +P  FF+D+S
Sbjct  338  AVRNKYKQHKYKCVATMPVSPELPLAFFEDIS  369



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060