BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF042J21

Length=717
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006470683.1|  PREDICTED: homeobox protein knotted-1-like L...    206   5e-63   Citrus sinensis [apfelsine]
ref|XP_008806312.1|  PREDICTED: homeobox protein knotted-1-like L...    206   6e-63   Phoenix dactylifera
ref|XP_004514061.1|  PREDICTED: homeobox protein knotted-1-like L...    212   8e-63   Cicer arietinum [garbanzo]
emb|CBI21101.3|  unnamed protein product                                206   3e-62   Vitis vinifera
gb|KCW81344.1|  hypothetical protein EUGRSUZ_C02727                     205   5e-62   Eucalyptus grandis [rose gum]
ref|XP_009355804.1|  PREDICTED: homeobox protein knotted-1-like 3...    211   1e-61   Pyrus x bretschneideri [bai li]
ref|XP_006473945.1|  PREDICTED: homeobox protein knotted-1-like L...    207   2e-61   Citrus sinensis [apfelsine]
ref|XP_010656543.1|  PREDICTED: homeobox protein knotted-1-like 1...    210   2e-61   Vitis vinifera
ref|XP_010265706.1|  PREDICTED: homeobox protein knotted-1-like 3...    211   2e-61   Nelumbo nucifera [Indian lotus]
gb|KDO59338.1|  hypothetical protein CISIN_1g019151mg                   207   3e-61   Citrus sinensis [apfelsine]
emb|CBI25599.3|  unnamed protein product                                209   3e-61   Vitis vinifera
gb|KDO59339.1|  hypothetical protein CISIN_1g019151mg                   207   3e-61   Citrus sinensis [apfelsine]
ref|XP_006453704.1|  hypothetical protein CICLE_v10008821mg             207   3e-61   Citrus clementina [clementine]
ref|XP_010244782.1|  PREDICTED: homeobox protein knotted-1-like 1...    211   3e-61   Nelumbo nucifera [Indian lotus]
ref|XP_004514060.1|  PREDICTED: homeobox protein knotted-1-like L...    207   4e-61   Cicer arietinum [garbanzo]
gb|KHN13973.1|  Homeobox protein knotted-1-like 4                       201   4e-61   Glycine soja [wild soybean]
ref|XP_010929107.1|  PREDICTED: homeobox protein knotted-1-like 1...    209   4e-61   
ref|XP_010265705.1|  PREDICTED: homeobox protein knotted-1-like 3...    209   8e-61   Nelumbo nucifera [Indian lotus]
gb|KHN01262.1|  Homeobox protein knotted-1-like 3                       204   9e-61   Glycine soja [wild soybean]
ref|XP_004508615.1|  PREDICTED: homeobox protein knotted-1-like 4...    204   1e-60   
ref|XP_010648713.1|  PREDICTED: homeobox protein knotted-1-like 3...    208   1e-60   Vitis vinifera
gb|KEH38097.1|  class II knotted-like homeobox protein                  206   1e-60   Medicago truncatula
ref|XP_007155117.1|  hypothetical protein PHAVU_003G174900g             205   2e-60   Phaseolus vulgaris [French bean]
ref|XP_011458838.1|  PREDICTED: homeobox protein knotted-1-like 3...    207   2e-60   Fragaria vesca subsp. vesca
gb|AAM53320.1|  KNAT3 homeodomain protein                               203   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010656542.1|  PREDICTED: homeobox protein knotted-1-like 1...    207   3e-60   Vitis vinifera
ref|XP_010048922.1|  PREDICTED: homeobox protein knotted-1-like 4...    207   4e-60   Eucalyptus grandis [rose gum]
ref|XP_009355805.1|  PREDICTED: homeobox protein knotted-1-like 3...    207   4e-60   Pyrus x bretschneideri [bai li]
gb|KDO59340.1|  hypothetical protein CISIN_1g019151mg                   204   5e-60   Citrus sinensis [apfelsine]
gb|KDP33547.1|  hypothetical protein JCGZ_07118                         206   5e-60   Jatropha curcas
ref|XP_006453705.1|  hypothetical protein CICLE_v10008821mg             204   6e-60   
ref|XP_010234555.1|  PREDICTED: homeobox protein knotted-1-like 1...    202   6e-60   
ref|XP_008394136.1|  PREDICTED: homeobox protein knotted-1-like 3...    206   6e-60   Malus domestica [apple tree]
ref|XP_009362327.1|  PREDICTED: homeobox protein knotted-1-like 3...    206   6e-60   Pyrus x bretschneideri [bai li]
ref|XP_007138444.1|  hypothetical protein PHAVU_009G209500g             204   7e-60   Phaseolus vulgaris [French bean]
ref|XP_008378414.1|  PREDICTED: homeobox protein knotted-1-like 3...    206   7e-60   
ref|XP_009362326.1|  PREDICTED: homeobox protein knotted-1-like 3...    206   7e-60   Pyrus x bretschneideri [bai li]
ref|XP_006450341.1|  hypothetical protein CICLE_v10008269mg             206   8e-60   Citrus clementina [clementine]
ref|XP_003533879.2|  PREDICTED: homeobox protein knotted-1-like L...    204   8e-60   Glycine max [soybeans]
emb|CDX88165.1|  BnaA06g27560D                                          202   8e-60   
ref|XP_006450342.1|  hypothetical protein CICLE_v10008269mg             206   8e-60   Citrus clementina [clementine]
gb|KHN22519.1|  Homeobox protein knotted-1-like 3                       202   1e-59   Glycine soja [wild soybean]
gb|ABH03531.1|  class II knotted-like homeobox protein                  206   1e-59   Prunus persica
gb|KHN02035.1|  Homeobox protein knotted-1-like 3                       198   1e-59   Glycine soja [wild soybean]
ref|XP_007222132.1|  hypothetical protein PRUPE_ppa005712mg             206   1e-59   Prunus persica
gb|ACJ09316.1|  KNAT3-like transcription factor                         206   2e-59   Juglans nigra
ref|XP_003573667.2|  PREDICTED: homeobox protein knotted-1-like 1...    201   2e-59   
ref|XP_009775738.1|  PREDICTED: homeobox protein knotted-1-like L...    202   3e-59   Nicotiana sylvestris
ref|XP_007136985.1|  hypothetical protein PHAVU_009G090500g             204   3e-59   Phaseolus vulgaris [French bean]
ref|XP_007138445.1|  hypothetical protein PHAVU_009G209500g             202   3e-59   Phaseolus vulgaris [French bean]
ref|XP_010519640.1|  PREDICTED: homeobox protein knotted-1-like 3       200   4e-59   Tarenaya hassleriana [spider flower]
ref|XP_008219701.1|  PREDICTED: homeobox protein knotted-1-like 3       204   4e-59   
ref|XP_011036632.1|  PREDICTED: homeobox protein knotted-1-like 3...    204   4e-59   Populus euphratica
ref|XP_011084049.1|  PREDICTED: homeobox protein knotted-1-like L...    202   4e-59   Sesamum indicum [beniseed]
ref|XP_009770425.1|  PREDICTED: homeobox protein knotted-1-like L...    203   4e-59   Nicotiana sylvestris
ref|XP_009622163.1|  PREDICTED: homeobox protein knotted-1-like L...    203   5e-59   Nicotiana tomentosiformis
ref|XP_010913372.1|  PREDICTED: homeobox protein knotted-1-like 1...    204   6e-59   Elaeis guineensis
ref|XP_006587139.1|  PREDICTED: homeobox protein knotted-1-like L...    202   6e-59   Glycine max [soybeans]
ref|XP_010493771.1|  PREDICTED: homeobox protein knotted-1-like 3       199   6e-59   
emb|CDX78407.1|  BnaA03g03190D                                          202   6e-59   
ref|XP_010541588.1|  PREDICTED: homeobox protein knotted-1-like 3...    203   7e-59   Tarenaya hassleriana [spider flower]
emb|CDX80491.1|  BnaC07g29530D                                          203   8e-59   
gb|AAM63298.1|  KNAT3 homeodomain protein                               203   8e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287910.1|  hypothetical protein CARUB_v10001144mg             202   8e-59   Capsella rubella
ref|XP_009151045.1|  PREDICTED: homeobox protein knotted-1-like 3...    203   8e-59   Brassica rapa
ref|XP_009131190.1|  PREDICTED: LOW QUALITY PROTEIN: homeobox pro...    202   8e-59   
ref|NP_197904.1|  homeobox protein knotted-1-like 3                     203   8e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004138713.1|  PREDICTED: homeobox protein knotted-1-like 3...    204   9e-59   Cucumis sativus [cucumbers]
ref|XP_002872145.1|  hypothetical protein ARALYDRAFT_489374             203   9e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_011039618.1|  PREDICTED: homeobox protein knotted-1-like 4...    203   1e-58   Populus euphratica
ref|XP_010047186.1|  PREDICTED: homeobox protein knotted-1-like 3...    201   1e-58   Eucalyptus grandis [rose gum]
gb|KFK27790.1|  hypothetical protein AALP_AA8G429800                    202   1e-58   Arabis alpina [alpine rockcress]
ref|XP_006287805.1|  hypothetical protein CARUB_v10001020mg             202   1e-58   Capsella rubella
ref|XP_010454842.1|  PREDICTED: homeobox protein knotted-1-like 3...    203   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002871452.1|  KNAT4 homeobox protein                             202   1e-58   
emb|CDY05371.1|  BnaC02g40790D                                          202   1e-58   
ref|XP_006394770.1|  hypothetical protein EUTSA_v10004250mg             202   1e-58   Eutrema salsugineum [saltwater cress]
ref|XP_009610663.1|  PREDICTED: homeobox protein knotted-1-like L...    200   1e-58   Nicotiana tomentosiformis
ref|XP_010942157.1|  PREDICTED: homeobox protein knotted-1-like 1...    202   1e-58   Elaeis guineensis
ref|XP_006399606.1|  hypothetical protein EUTSA_v10013773mg             201   1e-58   Eutrema salsugineum [saltwater cress]
ref|XP_010047185.1|  PREDICTED: homeobox protein knotted-1-like 3...    201   1e-58   Eucalyptus grandis [rose gum]
ref|XP_010421369.1|  PREDICTED: homeobox protein knotted-1-like 3...    202   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_011036630.1|  PREDICTED: homeobox protein knotted-1-like 3...    202   2e-58   Populus euphratica
ref|XP_002324890.2|  Homeobox protein knotted-1 like 3                  202   2e-58   
emb|CDY05480.1|  BnaA02g32110D                                          202   2e-58   
gb|KJB65883.1|  hypothetical protein B456_010G117100                    202   2e-58   Gossypium raimondii
ref|XP_008394137.1|  PREDICTED: homeobox protein knotted-1-like 3...    202   2e-58   Malus domestica [apple tree]
gb|EPS71753.1|  hypothetical protein M569_03005                         196   2e-58   Genlisea aurea
ref|XP_009770424.1|  PREDICTED: homeobox protein knotted-1-like L...    201   2e-58   Nicotiana sylvestris
ref|XP_009622162.1|  PREDICTED: homeobox protein knotted-1-like L...    201   2e-58   Nicotiana tomentosiformis
ref|XP_006601171.1|  PREDICTED: homeobox protein knotted-1-like 3...    201   2e-58   Glycine max [soybeans]
gb|KHN29600.1|  Homeobox protein knotted-1-like 3                       194   2e-58   Glycine soja [wild soybean]
ref|XP_009129978.1|  PREDICTED: homeobox protein knotted-1-like 3...    201   3e-58   Brassica rapa
ref|XP_006848824.1|  hypothetical protein AMTR_s00026p00162850          203   3e-58   Amborella trichopoda
ref|XP_008784810.1|  PREDICTED: homeobox protein knotted-1-like 1...    201   3e-58   Phoenix dactylifera
gb|AEC04754.1|  knotted-like homeobox KNOX5                             200   3e-58   Fragaria vesca [alpine strawberry]
ref|XP_010453146.1|  PREDICTED: homeobox protein knotted-1-like 4...    201   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_008806313.1|  PREDICTED: homeobox protein knotted-1-like 2...    194   3e-58   Phoenix dactylifera
ref|XP_010491801.1|  PREDICTED: homeobox protein knotted-1-like 4...    200   3e-58   Camelina sativa [gold-of-pleasure]
dbj|BAA08554.1|  OSH45                                                  193   4e-58   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC57787.1|  OSH45                                                  194   4e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010419661.1|  PREDICTED: homeobox protein knotted-1-like 4...    200   4e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002515465.1|  homeobox protein knotted-1, putative               202   4e-58   
ref|XP_006596082.1|  PREDICTED: homeobox protein knotted-1-like 3...    201   5e-58   Glycine max [soybeans]
ref|XP_008802010.1|  PREDICTED: homeobox protein knotted-1-like 1...    202   5e-58   
gb|ABZ10963.1|  class 1 knox protein                                    200   5e-58   Kalanchoe x houghtonii
ref|XP_011039616.1|  PREDICTED: homeobox protein knotted-1-like 3...    201   6e-58   Populus euphratica
ref|XP_006601172.1|  PREDICTED: homeobox protein knotted-1-like 3...    200   6e-58   Glycine max [soybeans]
ref|NP_001061467.2|  Os08g0292900                                       194   6e-58   
ref|XP_008452885.1|  PREDICTED: homeobox protein knotted-1-like 3...    202   7e-58   
ref|XP_010234556.1|  PREDICTED: homeobox protein knotted-1-like 1...    196   7e-58   
ref|XP_004170654.1|  PREDICTED: homeobox protein knotted-1-like 3...    201   7e-58   
ref|XP_010244783.1|  PREDICTED: homeobox protein knotted-1-like 1...    201   8e-58   Nelumbo nucifera [Indian lotus]
ref|XP_006470682.1|  PREDICTED: homeobox protein knotted-1-like L...    193   8e-58   Citrus sinensis [apfelsine]
ref|XP_006659277.1|  PREDICTED: homeobox protein knotted-1-like 1...    193   9e-58   Oryza brachyantha
ref|XP_008452888.1|  PREDICTED: homeobox protein knotted-1-like 3...    201   9e-58   Cucumis melo [Oriental melon]
ref|XP_007013698.1|  Homeobox protein knotted-1-like 3                  198   9e-58   
ref|NP_196667.2|  homeobox protein knotted-1-like 4                     199   9e-58   Arabidopsis thaliana [mouse-ear cress]
emb|CAA63131.1|  KNAT4 homeobox protein                                 199   9e-58   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85732.1|  BnaA02g00810D                                          199   1e-57   
gb|KJB82790.1|  hypothetical protein B456_013G213900                    201   1e-57   Gossypium raimondii
gb|KHG25122.1|  Homeobox protein knotted-1-like 3                       196   1e-57   Gossypium arboreum [tree cotton]
ref|XP_006287804.1|  hypothetical protein CARUB_v10001020mg             200   1e-57   
gb|KJB53875.1|  hypothetical protein B456_009G012300                    196   1e-57   Gossypium raimondii
ref|XP_008354343.1|  PREDICTED: homeobox protein knotted-1-like 6...    192   1e-57   
gb|KHG00601.1|  Homeobox protein knotted-1-like 3                       200   1e-57   Gossypium arboreum [tree cotton]
gb|EEC83301.1|  hypothetical protein OsI_28664                          194   1e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_010047187.1|  PREDICTED: homeobox protein knotted-1-like 3...    198   1e-57   Eucalyptus grandis [rose gum]
gb|EYU30578.1|  hypothetical protein MIMGU_mgv1a023757mg                194   1e-57   Erythranthe guttata [common monkey flower]
ref|XP_006470684.1|  PREDICTED: homeobox protein knotted-1-like L...    192   1e-57   Citrus sinensis [apfelsine]
emb|CAC03454.1|  HOMEOBOX PROTEIN KNOTTED-1 LIKE 4 (KNAT4)              199   1e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDP10515.1|  unnamed protein product                                197   2e-57   Coffea canephora [robusta coffee]
gb|KFK25380.1|  hypothetical protein AALP_AA8G105800                    199   2e-57   Arabis alpina [alpine rockcress]
ref|XP_010265707.1|  PREDICTED: homeobox protein knotted-1-like 3...    201   2e-57   Nelumbo nucifera [Indian lotus]
gb|EYU30574.1|  hypothetical protein MIMGU_mgv1a023272mg                194   2e-57   Erythranthe guttata [common monkey flower]
ref|XP_011084050.1|  PREDICTED: homeobox protein knotted-1-like L...    198   2e-57   Sesamum indicum [beniseed]
sp|Q0J6N4.2|KNOSD_ORYSJ  RecName: Full=Homeobox protein knotted-1...    198   2e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009151046.1|  PREDICTED: homeobox protein knotted-1-like 3...    199   2e-57   Brassica rapa
gb|KFK27789.1|  hypothetical protein AALP_AA8G429800                    199   2e-57   Arabis alpina [alpine rockcress]
ref|XP_002265494.1|  PREDICTED: homeobox protein knotted-1-like 1...    199   2e-57   Vitis vinifera
ref|XP_004973169.1|  PREDICTED: homeobox protein knotted-1-like 1...    198   2e-57   Setaria italica
ref|XP_010541589.1|  PREDICTED: homeobox protein knotted-1-like 3...    199   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_002309651.2|  hypothetical protein POPTR_0006s27560g             199   2e-57   
ref|NP_001031938.1|  homeobox protein knotted-1-like 3                  199   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KHN07049.1|  Homeobox protein knotted-1-like 3                       195   2e-57   Glycine soja [wild soybean]
ref|XP_008242897.1|  PREDICTED: homeobox protein knotted-1-like 4...    197   2e-57   Prunus mume [ume]
ref|XP_006394769.1|  hypothetical protein EUTSA_v10004250mg             199   2e-57   Eutrema salsugineum [saltwater cress]
ref|XP_009355806.1|  PREDICTED: homeobox protein knotted-1-like 3...    199   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_010421370.1|  PREDICTED: homeobox protein knotted-1-like 3...    199   3e-57   Camelina sativa [gold-of-pleasure]
gb|AEI17370.1|  knox-like protein 3                                     199   3e-57   Arabidopsis lyrata [lyrate rockcress]
ref|XP_010454843.1|  PREDICTED: homeobox protein knotted-1-like 3...    199   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_011469909.1|  PREDICTED: homeobox protein knotted-1-like 3...    196   3e-57   Fragaria vesca subsp. vesca
ref|XP_002285407.2|  PREDICTED: homeobox protein knotted-1-like 3...    199   3e-57   Vitis vinifera
ref|XP_009125259.1|  PREDICTED: homeobox protein knotted-1-like 4...    198   3e-57   Brassica rapa
ref|XP_011458839.1|  PREDICTED: homeobox protein knotted-1-like 3...    199   3e-57   Fragaria vesca subsp. vesca
emb|CDY51104.1|  BnaCnng20070D                                          198   3e-57   Brassica napus [oilseed rape]
ref|XP_011036634.1|  PREDICTED: homeobox protein knotted-1-like 3...    198   4e-57   Populus euphratica
gb|KJB06462.1|  hypothetical protein B456_001G035700                    199   4e-57   Gossypium raimondii
gb|KJB65885.1|  hypothetical protein B456_010G117100                    199   4e-57   Gossypium raimondii
ref|XP_006450343.1|  hypothetical protein CICLE_v10008269mg             199   4e-57   
ref|XP_009366122.1|  PREDICTED: homeobox protein knotted-1-like 2...    197   4e-57   Pyrus x bretschneideri [bai li]
ref|XP_009341800.1|  PREDICTED: homeobox protein knotted-1-like 3...    197   5e-57   Pyrus x bretschneideri [bai li]
gb|KJB82793.1|  hypothetical protein B456_013G213900                    199   5e-57   Gossypium raimondii
ref|XP_009770426.1|  PREDICTED: homeobox protein knotted-1-like L...    197   5e-57   Nicotiana sylvestris
ref|XP_003550200.1|  PREDICTED: homeobox protein knotted-1-like 3...    197   5e-57   Glycine max [soybeans]
ref|XP_010665744.1|  PREDICTED: homeobox protein knotted-1-like 3       197   5e-57   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG04438.1|  Homeobox protein knotted-1-like 3                       198   5e-57   Gossypium arboreum [tree cotton]
ref|XP_009622164.1|  PREDICTED: homeobox protein knotted-1-like L...    197   6e-57   Nicotiana tomentosiformis
gb|ABZ10965.1|  class 1 knox protein                                    197   6e-57   Kalanchoe x houghtonii
gb|KHG13359.1|  Homeobox protein knotted-1-like 3                       199   6e-57   Gossypium arboreum [tree cotton]
ref|XP_010929108.1|  PREDICTED: homeobox protein knotted-1-like 1...    197   6e-57   Elaeis guineensis
ref|XP_006345637.1|  PREDICTED: homeobox protein knotted-1-like 3...    196   7e-57   Solanum tuberosum [potatoes]
ref|XP_009129979.1|  PREDICTED: homeobox protein knotted-1-like 3...    197   8e-57   Brassica rapa
dbj|BAA08552.1|  OSH45                                                  196   8e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007222130.1|  hypothetical protein PRUPE_ppa005712mg             198   8e-57   Prunus persica
ref|XP_009358509.1|  PREDICTED: homeobox protein knotted-1-like 1...    196   8e-57   Pyrus x bretschneideri [bai li]
ref|XP_008802008.1|  PREDICTED: homeobox protein knotted-1-like 1...    199   9e-57   Phoenix dactylifera
ref|XP_010491802.1|  PREDICTED: homeobox protein knotted-1-like 4...    196   9e-57   Camelina sativa [gold-of-pleasure]
gb|KDO46774.1|  hypothetical protein CISIN_1g013045mg                   197   9e-57   Citrus sinensis [apfelsine]
ref|XP_007222131.1|  hypothetical protein PRUPE_ppa005712mg             198   9e-57   
ref|XP_009338420.1|  PREDICTED: homeobox protein knotted-1-like 1...    196   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_008336944.1|  PREDICTED: homeobox protein knotted-1-like 1...    196   1e-56   
ref|XP_008354344.1|  PREDICTED: homeobox protein knotted-1-like 6...    189   1e-56   
ref|XP_006581338.1|  PREDICTED: homeobox protein knotted-1-like 3...    197   1e-56   Glycine max [soybeans]
ref|XP_006581339.1|  PREDICTED: homeobox protein knotted-1-like 3...    197   1e-56   Glycine max [soybeans]
ref|XP_010453147.1|  PREDICTED: homeobox protein knotted-1-like 4...    196   1e-56   Camelina sativa [gold-of-pleasure]
sp|O04136.1|KNAP3_MALDO  RecName: Full=Homeobox protein knotted-1...    197   1e-56   Malus domestica [apple tree]
ref|XP_006450340.1|  hypothetical protein CICLE_v10008269mg             198   1e-56   Citrus clementina [clementine]
ref|XP_009362329.1|  PREDICTED: homeobox protein knotted-1-like 3...    197   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_008378415.1|  PREDICTED: homeobox protein knotted-1-like 3...    197   1e-56   
ref|XP_003544602.1|  PREDICTED: homeobox protein knotted-1-like 3...    197   1e-56   Glycine max [soybeans]
ref|XP_010419662.1|  PREDICTED: homeobox protein knotted-1-like 4...    196   1e-56   Camelina sativa [gold-of-pleasure]
ref|NP_001281052.1|  homeobox protein knotted-1-like 3                  196   1e-56   Malus domestica [apple tree]
ref|XP_011039619.1|  PREDICTED: homeobox protein knotted-1-like 3...    197   1e-56   Populus euphratica
ref|XP_006578127.1|  PREDICTED: homeobox protein knotted-1-like 3...    197   1e-56   Glycine max [soybeans]
gb|KCW81341.1|  hypothetical protein EUGRSUZ_C02727                     197   1e-56   Eucalyptus grandis [rose gum]
ref|XP_009362328.1|  PREDICTED: homeobox protein knotted-1-like 3...    197   2e-56   Pyrus x bretschneideri [bai li]
ref|XP_011078583.1|  PREDICTED: homeobox protein knotted-1-like L...    196   2e-56   Sesamum indicum [beniseed]
ref|XP_008788775.1|  PREDICTED: homeobox protein knotted-1-like 1...    197   2e-56   Phoenix dactylifera
ref|XP_006473944.1|  PREDICTED: homeobox protein knotted-1-like L...    194   2e-56   Citrus sinensis [apfelsine]
ref|XP_010099875.1|  Homeobox protein knotted-1-like 3                  197   2e-56   
ref|XP_004244941.1|  PREDICTED: homeobox protein knotted-1-like 3       194   2e-56   Solanum lycopersicum
gb|KJB55054.1|  hypothetical protein B456_009G060200                    196   2e-56   Gossypium raimondii
ref|XP_010048923.1|  PREDICTED: homeobox protein knotted-1-like 3...    196   3e-56   Eucalyptus grandis [rose gum]
gb|AHX00581.1|  class II knox protein                                   196   3e-56   Solanum tuberosum [potatoes]
ref|XP_006359533.1|  PREDICTED: homeobox protein knotted-1-like L...    196   3e-56   
gb|KEH32161.1|  class II knotted-like homeobox protein                  194   3e-56   Medicago truncatula
gb|KDO59337.1|  hypothetical protein CISIN_1g019151mg                   194   3e-56   Citrus sinensis [apfelsine]
gb|AEW69803.1|  Hop-interacting protein THI041                          196   3e-56   Solanum lycopersicum
ref|XP_006600707.1|  PREDICTED: homeobox protein knotted-1-like L...    194   3e-56   Glycine max [soybeans]
ref|XP_010323157.1|  PREDICTED: homeobox protein knotted-1-like L...    196   3e-56   
ref|XP_009366123.1|  PREDICTED: homeobox protein knotted-1-like 3...    194   3e-56   Pyrus x bretschneideri [bai li]
ref|XP_009341802.1|  PREDICTED: homeobox protein knotted-1-like 3...    194   3e-56   Pyrus x bretschneideri [bai li]
ref|XP_003522507.1|  PREDICTED: homeobox protein knotted-1-like 3...    196   4e-56   Glycine max [soybeans]
gb|KJB06460.1|  hypothetical protein B456_001G035700                    196   4e-56   Gossypium raimondii
gb|KDP30176.1|  hypothetical protein JCGZ_16958                         194   4e-56   Jatropha curcas
ref|XP_006453706.1|  hypothetical protein CICLE_v10008821mg             194   4e-56   
ref|XP_009408038.1|  PREDICTED: homeobox protein knotted-1-like 13      196   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006594231.1|  PREDICTED: homeobox protein knotted-1-like L...    194   4e-56   Glycine max [soybeans]
ref|XP_008362878.1|  PREDICTED: homeobox protein knotted-1-like 3...    194   4e-56   
ref|XP_006473946.1|  PREDICTED: homeobox protein knotted-1-like L...    193   4e-56   Citrus sinensis [apfelsine]
gb|KHG09462.1|  Homeobox protein knotted-1-like 4                       192   5e-56   Gossypium arboreum [tree cotton]
ref|XP_007136984.1|  hypothetical protein PHAVU_009G090500g             195   5e-56   Phaseolus vulgaris [French bean]
gb|KHN18594.1|  Homeobox protein knotted-1-like 4                       193   5e-56   Glycine soja [wild soybean]
ref|XP_003549704.1|  PREDICTED: homeobox protein knotted-1-like L...    193   6e-56   Glycine max [soybeans]
ref|XP_004287231.1|  PREDICTED: homeobox protein knotted-1-like 3...    193   6e-56   Fragaria vesca subsp. vesca
ref|XP_007202255.1|  hypothetical protein PRUPE_ppa007698mg             194   6e-56   Prunus persica
ref|XP_009358510.1|  PREDICTED: homeobox protein knotted-1-like L...    194   6e-56   Pyrus x bretschneideri [bai li]
ref|XP_008336945.1|  PREDICTED: homeobox protein knotted-1-like L...    194   6e-56   
gb|ABZ10962.1|  class 1 knox protein                                    195   6e-56   Kalanchoe x houghtonii
emb|CDP18801.1|  unnamed protein product                                194   6e-56   Coffea canephora [robusta coffee]
ref|XP_009338421.1|  PREDICTED: homeobox protein knotted-1-like L...    194   7e-56   Pyrus x bretschneideri [bai li]
gb|KDO59341.1|  hypothetical protein CISIN_1g019151mg                   193   7e-56   Citrus sinensis [apfelsine]
ref|XP_003542625.1|  PREDICTED: homeobox protein knotted-1-like L...    193   7e-56   Glycine max [soybeans]
ref|XP_006453707.1|  hypothetical protein CICLE_v10008821mg             192   8e-56   
gb|KEH39852.1|  class II knotted-like homeobox protein                  196   8e-56   Medicago truncatula
ref|XP_008242898.1|  PREDICTED: homeobox protein knotted-1-like 4...    193   8e-56   Prunus mume [ume]
gb|ADX60161.1|  ORPHAN transcription factor                             187   8e-56   Zea mays [maize]
ref|NP_001233945.1|  homeobox protein knotted-1-like LET12              195   9e-56   
gb|ADD14043.1|  class 2 KNOTTED-like transcription factor KNOPE4        193   9e-56   Prunus persica
gb|KEH32160.1|  class II knotted-like homeobox protein                  192   9e-56   Medicago truncatula
ref|NP_001281051.1|  homeobox protein knotted-1-like 3                  195   1e-55   Malus domestica [apple tree]
ref|XP_008445246.1|  PREDICTED: LOW QUALITY PROTEIN: homeobox pro...    195   1e-55   Cucumis melo [Oriental melon]
ref|XP_004498767.1|  PREDICTED: homeobox protein knotted-1-like 3...    195   1e-55   
ref|XP_008788774.1|  PREDICTED: homeobox protein knotted-1-like 1...    196   1e-55   Phoenix dactylifera
ref|XP_003609525.1|  Homeobox protein knotted-1-like protein            192   1e-55   
ref|XP_009125260.1|  PREDICTED: homeobox protein knotted-1-like 4...    194   1e-55   Brassica rapa
ref|XP_010913371.1|  PREDICTED: homeobox protein knotted-1-like 1...    196   1e-55   Elaeis guineensis
gb|ABO26062.1|  KNOPE4                                                  194   1e-55   Prunus persica
ref|XP_006656302.1|  PREDICTED: homeobox protein knotted-1-like 1...    188   1e-55   Oryza brachyantha
gb|EPS70616.1|  hypothetical protein M569_04142                         191   1e-55   Genlisea aurea
gb|KHN22108.1|  Homeobox protein knotted-1-like 3                       191   2e-55   Glycine soja [wild soybean]
ref|XP_010913373.1|  PREDICTED: homeobox protein knotted-1-like 1...    195   2e-55   Elaeis guineensis
ref|XP_008802011.1|  PREDICTED: homeobox protein knotted-1-like 1...    195   2e-55   Phoenix dactylifera
gb|ACR34012.1|  unknown                                                 187   2e-55   Zea mays [maize]
ref|XP_004501363.1|  PREDICTED: homeobox protein knotted-1-like 3...    193   2e-55   Cicer arietinum [garbanzo]
gb|AFK38423.1|  unknown                                                 192   2e-55   Medicago truncatula
ref|XP_003603330.1|  Homeobox protein knotted-1-like protein            192   2e-55   Medicago truncatula
ref|XP_006600708.1|  PREDICTED: homeobox protein knotted-1-like L...    192   2e-55   Glycine max [soybeans]
ref|XP_004501362.1|  PREDICTED: homeobox protein knotted-1-like 3...    193   2e-55   
ref|XP_003603329.1|  Homeobox protein knotted-1-like protein            192   2e-55   Medicago truncatula
ref|XP_006594232.1|  PREDICTED: homeobox protein knotted-1-like L...    191   2e-55   Glycine max [soybeans]
ref|XP_010928258.1|  PREDICTED: homeobox protein knotted-1-like 1...    194   3e-55   Elaeis guineensis
ref|NP_001280884.1|  homeobox protein knotted-1-like 3                  194   3e-55   Malus domestica [apple tree]
ref|XP_006581340.1|  PREDICTED: homeobox protein knotted-1-like 3...    193   3e-55   
dbj|BAA77822.2|  HOS59                                                  186   3e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004498766.1|  PREDICTED: homeobox protein knotted-1-like 3...    194   3e-55   Cicer arietinum [garbanzo]
ref|XP_010928259.1|  PREDICTED: homeobox protein knotted-1-like 1...    194   3e-55   Elaeis guineensis
ref|XP_008362879.1|  PREDICTED: homeobox protein knotted-1-like 3...    192   3e-55   
ref|XP_004251773.1|  PREDICTED: homeobox protein knotted-1-like L...    191   3e-55   Solanum lycopersicum
ref|XP_008802009.1|  PREDICTED: homeobox protein knotted-1-like 1...    195   3e-55   
ref|XP_004498768.1|  PREDICTED: homeobox protein knotted-1-like 3...    194   3e-55   Cicer arietinum [garbanzo]
ref|XP_006350068.1|  PREDICTED: homeobox protein knotted-1-like L...    191   4e-55   Solanum tuberosum [potatoes]
ref|XP_010105978.1|  Homeobox protein knotted-1-like 3                  192   4e-55   Morus notabilis
ref|XP_009392148.1|  PREDICTED: homeobox protein knotted-1-like 13      194   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006453703.1|  hypothetical protein CICLE_v10008821mg             191   4e-55   
ref|XP_006656303.1|  PREDICTED: homeobox protein knotted-1-like 1...    186   4e-55   Oryza brachyantha
ref|XP_004145519.1|  PREDICTED: homeobox protein knotted-1-like 3...    194   4e-55   Cucumis sativus [cucumbers]
ref|XP_008384696.1|  PREDICTED: homeobox protein knotted-1-like 3...    192   4e-55   
emb|CAJ58045.1|  KNOX family class 2 homeodomain protein                186   4e-55   
ref|XP_009784534.1|  PREDICTED: homeobox protein knotted-1-like 3...    193   5e-55   
gb|AAD09582.1|  homeobox 1 protein                                      192   6e-55   
gb|KJB82792.1|  hypothetical protein B456_013G213900                    193   7e-55   
gb|KEH35909.1|  class II knotted-like homeobox protein                  192   7e-55   
ref|XP_011078582.1|  PREDICTED: homeobox protein knotted-1-like L...    192   7e-55   
ref|XP_008452889.1|  PREDICTED: homeobox protein knotted-1-like 3...    193   7e-55   
ref|XP_004965737.1|  PREDICTED: homeobox protein knotted-1-like 1...    189   8e-55   
ref|XP_003526284.1|  PREDICTED: homeobox protein knotted-1-like 3...    192   8e-55   
gb|AEI17371.1|  Knox-like protein 3                                     192   8e-55   
gb|KJB82791.1|  hypothetical protein B456_013G213900                    193   8e-55   
dbj|BAJ85164.1|  predicted protein                                      187   9e-55   
gb|AEZ00855.1|  putative knotted-like homeodomain protein               182   1e-54   
gb|ADE76332.1|  unknown                                                 190   1e-54   
ref|XP_009420368.1|  PREDICTED: homeobox protein knotted-1-like 1...    192   1e-54   
ref|XP_006646986.1|  PREDICTED: homeobox protein knotted-1-like 2...    186   1e-54   
gb|ABO33480.1|  class II KNOX homeobox transcription factor             192   1e-54   
ref|XP_008784811.1|  PREDICTED: homeobox protein knotted-1-like 1...    192   1e-54   
ref|XP_004965738.1|  PREDICTED: homeobox protein knotted-1-like 1...    188   2e-54   
gb|AFW70462.1|  putative knotted-like transcription factor family...    188   2e-54   
gb|KJB64584.1|  hypothetical protein B456_010G056100                    187   2e-54   
ref|XP_010525937.1|  PREDICTED: homeobox protein knotted-1-like 5       187   2e-54   
dbj|BAA77821.2|  HOS58                                                  184   2e-54   
ref|NP_001169973.1|  putative knotted-like transcription factor f...    188   3e-54   
gb|EEE66116.1|  hypothetical protein OsJ_22154                          186   3e-54   
ref|XP_002523551.1|  homeobox protein knotted-1, putative               189   4e-54   
ref|XP_006646985.1|  PREDICTED: homeobox protein knotted-1-like 2...    184   4e-54   
dbj|BAA25921.1|  NTH23                                                  190   5e-54   
ref|XP_009398657.1|  PREDICTED: homeobox protein knotted-1-like 1...    191   5e-54   
ref|XP_009618001.1|  PREDICTED: homeobox protein knotted-1-like 3...    190   5e-54   
ref|XP_010942158.1|  PREDICTED: homeobox protein knotted-1-like 1...    190   5e-54   
ref|XP_009398658.1|  PREDICTED: homeobox protein knotted-1-like 1...    191   6e-54   
ref|XP_011033486.1|  PREDICTED: homeobox protein knotted-1-like L...    188   6e-54   
ref|XP_009775739.1|  PREDICTED: homeobox protein knotted-1-like L...    188   6e-54   
ref|XP_002309315.2|  hypothetical protein POPTR_0006s20440g             188   6e-54   
ref|NP_001046101.1|  Os02g0182800                                       184   6e-54   
gb|AFW66300.1|  LOW QUALITY PROTEIN: putative knotted-like transc...    187   8e-54   
gb|KCW80322.1|  hypothetical protein EUGRSUZ_C01686                     189   8e-54   
ref|XP_004951667.1|  PREDICTED: homeobox protein knotted-1-like 2...    187   8e-54   
gb|EEC81077.1|  hypothetical protein OsI_23897                          187   9e-54   
sp|Q94LW4.2|KNOSB_ORYSJ  RecName: Full=Homeobox protein knotted-1...    187   9e-54   
ref|XP_004951666.1|  PREDICTED: homeobox protein knotted-1-like 2...    186   9e-54   
ref|NP_001058200.1|  Os06g0646600                                       187   1e-53   
gb|ACG31614.1|  homeobox protein knotted-1-like 3                       186   1e-53   
gb|EAZ21985.1|  hypothetical protein OsJ_05640                          186   1e-53   
dbj|BAJ89425.1|  predicted protein                                      186   1e-53   
ref|NP_001105852.1|  KNOX family class 2 homeodomain protein            186   1e-53   
gb|AAQ11887.1|  knotted 7                                               187   1e-53   
ref|XP_003563314.1|  PREDICTED: homeobox protein knotted-1-like 1...    186   1e-53   
ref|XP_010048153.1|  PREDICTED: homeobox protein knotted-1-like 3       187   2e-53   
gb|KCW80324.1|  hypothetical protein EUGRSUZ_C01686                     188   2e-53   
gb|AFW66299.1|  putative knotted-like transcription factor family...    187   2e-53   
ref|XP_002451671.1|  hypothetical protein SORBIDRAFT_04g005620          189   2e-53   
gb|EMT22774.1|  Homeobox protein knotted-1-like 11                      187   3e-53   
ref|XP_010239924.1|  PREDICTED: homeobox protein knotted-1-like 1...    185   3e-53   
dbj|BAH86595.1|  class2 knotted-like homeobox                           178   4e-53   
sp|Q0E3C3.2|KNOS2_ORYSJ  RecName: Full=Homeobox protein knotted-1...    185   5e-53   
gb|KHN34443.1|  Homeobox protein HD1                                    181   8e-53   
ref|XP_009418154.1|  PREDICTED: homeobox protein knotted-1-like 1...    188   1e-52   
ref|XP_009420367.1|  PREDICTED: homeobox protein knotted-1-like 1...    187   1e-52   
gb|ABZ10964.1|  class 1 knox protein                                    186   1e-52   
gb|EMS47776.1|  Homeobox protein knotted-1-like 2                       179   1e-52   
ref|XP_002992720.1|  hypothetical protein SELMODRAFT_450988             182   2e-52   
dbj|BAB18585.1|  CRKNOX3                                                187   2e-52   
ref|XP_002992719.1|  KNOX transcription factor                          183   2e-52   
ref|XP_009610670.1|  PREDICTED: homeobox protein knotted-1-like L...    183   3e-52   
ref|XP_011017948.1|  PREDICTED: homeobox protein knotted-1-like L...    183   5e-52   
ref|XP_008659775.1|  PREDICTED: homeobox protein knotted-1-like 1...    182   5e-52   
ref|XP_002324571.2|  hypothetical protein POPTR_0018s12200g             183   5e-52   
ref|XP_008659776.1|  PREDICTED: homeobox protein knotted-1-like 1...    182   5e-52   
ref|XP_002969148.1|  hypothetical protein SELMODRAFT_451277             181   6e-52   
ref|XP_003525739.1|  PREDICTED: homeobox protein HD1-like isoform X1    181   7e-52   
ref|XP_002973915.1|  KNOX transcription factor                          181   7e-52   
ref|XP_002969147.1|  KNOX transcription factor                          181   7e-52   
ref|XP_006440502.1|  hypothetical protein CICLE_v10021319mg             181   1e-51   
gb|EYU25289.1|  hypothetical protein MIMGU_mgv1a004814mg                186   1e-51   
ref|XP_007155574.1|  hypothetical protein PHAVU_003G213500g             180   1e-51   
gb|EYU32372.1|  hypothetical protein MIMGU_mgv1a007798mg                183   2e-51   
gb|AGT52107.1|  putative lignin regulation                              174   2e-51   
ref|XP_006579609.1|  PREDICTED: homeobox protein HD1-like isoform X2    180   3e-51   
ref|XP_008660553.1|  PREDICTED: homeobox protein knotted-1-like 3       176   3e-51   
ref|XP_006477358.1|  PREDICTED: homeobox protein HD1-like               179   4e-51   
ref|XP_002973914.1|  hypothetical protein SELMODRAFT_173857             181   4e-51   
tpg|DAA43028.1|  TPA: putative knotted-like transcription factor ...    176   4e-51   
gb|EYU32370.1|  hypothetical protein MIMGU_mgv1a007798mg                182   4e-51   
gb|EYU32371.1|  hypothetical protein MIMGU_mgv1a007798mg                181   6e-51   
ref|XP_010910776.1|  PREDICTED: homeobox protein knotted-1-like 1       174   7e-51   
ref|XP_010933996.1|  PREDICTED: homeobox protein knotted-1-like 1...    175   7e-51   
ref|XP_006440504.1|  hypothetical protein CICLE_v10021319mg             179   7e-51   
gb|AAW62519.1|  KNOTTED1-like protein                                   180   9e-51   
gb|AGT52115.1|  putative lignin regulation                              173   1e-50   
gb|KJB20769.1|  hypothetical protein B456_003G163800                    178   1e-50   
gb|AAQ11886.1|  knotted 6                                               174   1e-50   
ref|XP_011029150.1|  PREDICTED: homeobox protein HD1                    178   2e-50   
gb|EMT07955.1|  Homeobox protein knotted-1-like protein 3               174   2e-50   
ref|XP_002299569.2|  homeodomain transcription factor family protein    178   2e-50   
ref|XP_003538444.1|  PREDICTED: homeobox protein HD1                    177   2e-50   
gb|ADE75908.1|  unknown                                                 174   2e-50   
gb|EPS60349.1|  hypothetical protein M569_14455                         177   2e-50   
gb|AGT52132.1|  putative lignin regulation                              172   2e-50   
ref|XP_009113030.1|  PREDICTED: homeobox protein HD1-like isoform X1    177   2e-50   
gb|AGT52128.1|  putative lignin regulation                              172   3e-50   
gb|AGT52124.1|  putative lignin regulation                              172   3e-50   
ref|XP_010676578.1|  PREDICTED: homeobox protein HD1                    177   3e-50   
gb|KHG29303.1|  Homeobox protein knotted-1-like 7                       177   3e-50   
ref|XP_004143939.1|  PREDICTED: homeobox protein knotted-1-like 7...    177   3e-50   
gb|ABF93721.1|  Homeobox protein HD1, putative, expressed               174   3e-50   
ref|XP_004511615.1|  PREDICTED: homeobox protein HD1-like isoform X1    177   3e-50   
dbj|BAA77823.1|  HOS66                                                  174   3e-50   
ref|XP_009377898.1|  PREDICTED: homeobox protein HD1-like               177   3e-50   
gb|KHN25738.1|  Homeobox protein knotted-1-like 7                       176   3e-50   
ref|XP_009362836.1|  PREDICTED: homeobox protein HD1-like               177   3e-50   
ref|NP_001280775.1|  homeobox protein HD1-like                          177   3e-50   
ref|XP_006573753.1|  PREDICTED: homeobox protein HD1-like               176   3e-50   
gb|KJB52028.1|  hypothetical protein B456_008G242800                    177   3e-50   
ref|XP_003611172.1|  Homeobox protein knotted-1-like protein            177   4e-50   
ref|XP_008807225.1|  PREDICTED: homeobox protein knotted-1-like 3       177   4e-50   
gb|AGT52122.1|  putative lignin regulation                              171   4e-50   
ref|XP_004298727.1|  PREDICTED: homeobox protein knotted-1-like 7       177   4e-50   
ref|XP_008437194.1|  PREDICTED: homeobox protein knotted-1-like 7       177   4e-50   
ref|XP_004511616.1|  PREDICTED: homeobox protein HD1-like isoform X2    176   4e-50   
ref|NP_001242278.1|  uncharacterized protein LOC100782179               177   4e-50   
gb|AAN74841.1|  Putative homeobox gene                                  172   4e-50   
gb|KHG04347.1|  Homeobox protein knotted-1-like 7                       177   4e-50   
ref|XP_008373758.1|  PREDICTED: homeobox protein HD1-like               176   4e-50   
ref|XP_007158449.1|  hypothetical protein PHAVU_002G153300g             176   4e-50   
ref|XP_002282231.1|  PREDICTED: homeobox protein HD1                    176   5e-50   
ref|XP_003611171.1|  Homeobox protein knotted-1-like protein            177   5e-50   
emb|CDY45968.1|  BnaA09g12980D                                          176   5e-50   
gb|KDP25543.1|  hypothetical protein JCGZ_20699                         177   5e-50   
ref|XP_007209425.1|  hypothetical protein PRUPE_ppa009464mg             176   5e-50   
gb|KHG08187.1|  Homeobox HD1                                            177   5e-50   
ref|XP_008238758.1|  PREDICTED: homeobox protein HD1                    176   5e-50   
ref|XP_007040089.1|  KNOTTED-like homeobox of 7                         176   6e-50   
gb|ACU19284.1|  unknown                                                 176   6e-50   
ref|XP_003570788.1|  PREDICTED: homeobox protein knotted-1-like 2...    177   6e-50   
gb|KJB25695.1|  hypothetical protein B456_004G206600                    176   6e-50   
gb|AGV15454.1|  KNOX protein                                            176   6e-50   
ref|NP_001150419.1|  homeobox protein HD1                               177   6e-50   
gb|EYU39009.1|  hypothetical protein MIMGU_mgv1a011133mg                176   6e-50   
emb|CDX93852.1|  BnaC04g20110D                                          174   7e-50   
ref|XP_010313840.1|  PREDICTED: homeobox protein knotted-1-like L...    177   7e-50   
ref|XP_006350069.1|  PREDICTED: homeobox protein knotted-1-like L...    177   8e-50   
ref|XP_009617782.1|  PREDICTED: homeobox protein HD1                    176   8e-50   
ref|XP_006358851.1|  PREDICTED: homeobox protein HD1-like               176   9e-50   
ref|XP_002509684.1|  homeobox protein knotted-1, putative               176   9e-50   
ref|NP_001233933.1|  homeobox 2 protein                                 176   1e-49   
ref|XP_009772031.1|  PREDICTED: homeobox protein HD1                    176   1e-49   
ref|XP_010233918.1|  PREDICTED: homeobox protein knotted-1-like 2...    176   1e-49   
ref|XP_006650990.1|  PREDICTED: homeobox protein knotted-1-like 3...    174   1e-49   
ref|XP_011072032.1|  PREDICTED: homeobox protein HD1                    176   1e-49   
ref|XP_010473525.1|  PREDICTED: homeobox protein knotted-1-like 7       176   1e-49   
ref|XP_002869296.1|  hypothetical protein ARALYDRAFT_328525             178   1e-49   
ref|XP_010430375.1|  PREDICTED: homeobox protein knotted-1-like 7       175   1e-49   
ref|XP_006302629.1|  hypothetical protein CARUB_v10020735mg             175   1e-49   
ref|NP_194932.1|  homeobox protein knotted-1-like 5                     178   1e-49   
ref|XP_003558936.2|  PREDICTED: homeobox protein knotted-1-like 3       176   1e-49   
ref|XP_006829106.1|  hypothetical protein AMTR_s00001p00264520          175   1e-49   
ref|NP_001151200.1|  LOC100284833                                       176   1e-49   
ref|XP_002887986.1|  hypothetical protein ARALYDRAFT_475053             175   1e-49   
ref|XP_010418303.1|  PREDICTED: homeobox protein knotted-1-like 7       175   1e-49   
ref|XP_010272595.1|  PREDICTED: homeobox protein HD1-like               176   1e-49   
ref|XP_006391797.1|  hypothetical protein EUTSA_v10023617mg             175   2e-49   
ref|XP_009112718.1|  PREDICTED: homeobox protein HD1                    175   2e-49   
dbj|BAC42940.1|  putative homeodomain transcription factor KNAT6        175   2e-49   
gb|AAF75812.1|AC011000_15  Strong similarity to Homeobox Protein ...    175   2e-49   
dbj|BAK00737.1|  predicted protein                                      176   2e-49   
ref|NP_564805.1|  homeobox protein knotted-1-like 7                     175   2e-49   
ref|XP_010933995.1|  PREDICTED: homeobox protein knotted-1-like 3...    175   2e-49   
emb|CDY66559.1|  BnaCnng51440D                                          175   2e-49   
sp|P46606.1|HD1_BRANA  RecName: Full=Homeobox protein HD1               175   2e-49   
emb|CDY64892.1|  BnaA09g52990D                                          175   2e-49   
ref|XP_004985913.1|  PREDICTED: homeobox protein knotted-1-like 3...    175   2e-49   
ref|XP_010108056.1|  Homeobox protein knotted-1-like 7                  175   2e-49   
ref|XP_010255584.1|  PREDICTED: homeobox protein HD1-like               175   2e-49   
emb|CDP09828.1|  unnamed protein product                                175   3e-49   
gb|KFK40551.1|  homeobox protein knotted-1-like protein                 174   3e-49   
ref|NP_001048805.1|  Os03g0123500                                       174   3e-49   
gb|EEC74421.1|  hypothetical protein OsI_09790                          175   3e-49   
gb|EYU36935.1|  hypothetical protein MIMGU_mgv1a010809mg                175   3e-49   
ref|XP_006412522.1|  hypothetical protein EUTSA_v10025443mg             177   3e-49   
gb|AHX00582.1|  class II knox protein                                   175   3e-49   
ref|XP_009138065.1|  PREDICTED: homeobox protein knotted-1-like 5...    176   3e-49   
emb|CDY13472.1|  BnaA03g51900D                                          177   4e-49   
ref|XP_009138064.1|  PREDICTED: homeobox protein knotted-1-like 5...    176   4e-49   
gb|AAM67281.1|  homeodomain-containing protein HD1, putative            174   5e-49   
sp|Q94LW3.1|KNOS3_ORYSJ  RecName: Full=Homeobox protein knotted-1...    174   5e-49   
ref|XP_010053355.1|  PREDICTED: homeobox protein HD1                    174   6e-49   
sp|P56660.1|KNOX2_MAIZE  RecName: Full=Homeobox protein knotted-1...    167   6e-49   
emb|CDX75215.1|  BnaA01g04870D                                          176   7e-49   
emb|CDX68812.1|  BnaC01g06410D                                          176   7e-49   
emb|CDX72343.1|  BnaC07g43650D                                          176   7e-49   
emb|CDJ26235.1|  hypothetical protein                                   176   8e-49   
ref|XP_008783524.1|  PREDICTED: homeobox protein knotted-1-like 3       172   1e-48   
ref|XP_010533731.1|  PREDICTED: homeobox protein HD1                    173   1e-48   
gb|KHN09737.1|  Putative rhamnose biosynthetic enzyme 1                 177   2e-48   
ref|XP_009126437.1|  PREDICTED: homeobox protein knotted-1-like 5...    174   2e-48   
ref|XP_009126429.1|  PREDICTED: homeobox protein knotted-1-like 5...    174   3e-48   
ref|XP_009389816.1|  PREDICTED: homeobox protein knotted-1-like 3...    171   6e-48   
ref|XP_010447446.1|  PREDICTED: homeobox protein knotted-1-like 5       173   1e-47   
ref|XP_010432778.1|  PREDICTED: homeobox protein knotted-1-like 5...    173   1e-47   
ref|XP_010432780.1|  PREDICTED: homeobox protein knotted-1-like 5...    172   1e-47   
ref|XP_010437960.1|  PREDICTED: homeobox protein knotted-1-like 5...    172   1e-47   
gb|KFK29818.1|  hypothetical protein AALP_AA7G182900                    172   1e-47   
ref|XP_010437959.1|  PREDICTED: homeobox protein knotted-1-like 5...    172   1e-47   
sp|P56664.1|KNOX6_MAIZE  RecName: Full=Homeobox protein knotted-1...    163   2e-47   
ref|XP_006283917.1|  hypothetical protein CARUB_v10005036mg             172   2e-47   
ref|XP_001765575.1|  KNOX class 2 protein MKN6                          174   3e-47   
ref|XP_001772723.1|  KNOX class 2 protein MKN1-3                        172   3e-46   
ref|XP_011081057.1|  PREDICTED: homeobox protein HD1-like               165   8e-46   
emb|CAA63132.1|  KNAT5 homeobox protein                                 159   2e-45   
sp|P56659.1|KNOX1_MAIZE  RecName: Full=Homeobox protein knotted-1...    157   3e-45   
gb|AAK61309.1|AF285148_1  class 2 KNOTTED1-like protein MKN1-3          169   4e-45   
dbj|BAL46506.1|  Knotted1-like homeobox protein                         164   4e-44   
gb|AEX56207.1|  class II KNOX protein                                   151   9e-42   
gb|AEX56204.1|  class II KNOX protein                                   151   9e-42   
gb|AEX56205.1|  class II KNOX protein                                   148   1e-40   
gb|AEX56206.1|  class II KNOX protein                                   148   1e-40   
ref|WP_041515128.1|  hypothetical protein                               139   2e-38   
gb|AEX56203.1|  class II KNOX protein                                   136   6e-36   
ref|XP_006450338.1|  hypothetical protein CICLE_v10008269mg             126   3e-30   



>ref|XP_006470683.1| PREDICTED: homeobox protein knotted-1-like LET12-like isoform 
X2 [Citrus sinensis]
Length=184

 Score =   206 bits (525),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  65   SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  124

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K+KRKS A KSS E+
Sbjct  125  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTAS--KSKRKSNAGKSSNEN  182

Query  356  FM  351
            FM
Sbjct  183  FM  184



>ref|XP_008806312.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X1 [Phoenix 
dactylifera]
Length=184

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 114/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGD+TSLLK+WWQSHSKWP
Sbjct  65   SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDSTSLLKSWWQSHSKWP  124

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTE+DKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K+KRKS A  ++ EH
Sbjct  125  YPTEDDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTAL--KSKRKSNAGDNNAEH  182

Query  356  FM  351
            FM
Sbjct  183  FM  184



>ref|XP_004514061.1| PREDICTED: homeobox protein knotted-1-like LET12-like isoform 
X2 [Cicer arietinum]
Length=367

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYK KI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  248  SERSLMERVRQELKHELKQGYKNKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  307

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSS+ S  KTKRKS A ++S + 
Sbjct  308  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSSTGS--KTKRKSGAGETSNQS  365

Query  356  FM  351
            FM
Sbjct  366  FM  367



>emb|CBI21101.3| unnamed protein product [Vitis vinifera]
Length=219

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 3/123 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  99   SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  158

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKA+LVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS A E SS +
Sbjct  159  YPTEEDKAKLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKSNAGENSSGD  216

Query  359  HFM  351
             FM
Sbjct  217  RFM  219



>gb|KCW81344.1| hypothetical protein EUGRSUZ_C02727 [Eucalyptus grandis]
Length=222

 Score =   205 bits (522),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK WWQ+HSKWP
Sbjct  103  TERSLMERVRQELKHELKQGYKEKIIDIREEILRKRRAGKLPGDTTSVLKQWWQTHSKWP  162

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS A ++S++ 
Sbjct  163  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKSNAGENSSDR  220

Query  356  FM  351
            FM
Sbjct  221  FM  222



>ref|XP_009355804.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Pyrus 
x bretschneideri]
Length=448

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEIMRKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  327  SERSLMERVRQELKHELKQGYKEKIVDIREEIMRKRRAGKLPGDTTSVLKAWWQSHSKWP  386

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR +A E SS + 
Sbjct  387  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRSNAGENSSDDR  446

Query  356  FM  351
            F+
Sbjct  447  FI  448



>ref|XP_006473945.1| PREDICTED: homeobox protein knotted-1-like LET12-like isoform 
X2 [Citrus sinensis]
Length=342

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  223  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  282

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K+KRKS A KSS E+
Sbjct  283  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTAS--KSKRKSNAGKSSNEN  340

Query  356  FM  351
            FM
Sbjct  341  FM  342



>ref|XP_010656543.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X2 [Vitis 
vinifera]
Length=441

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 112/122 (92%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  322  TERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  381

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGL LKQINNWFINQRKRNWH+NPSSS+    KTKRKS A + + +H
Sbjct  382  YPTEEDKARLVQETGLHLKQINNWFINQRKRNWHSNPSSSAVL--KTKRKSNAGEINNDH  439

Query  356  FM  351
            F+
Sbjct  440  FL  441



>ref|XP_010265706.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Nelumbo 
nucifera]
Length=477

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 114/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  358  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  417

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K+KRKS A ++S E 
Sbjct  418  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTAL--KSKRKSNAGENSGER  475

Query  356  FM  351
            FM
Sbjct  476  FM  477



>gb|KDO59338.1| hypothetical protein CISIN_1g019151mg [Citrus sinensis]
Length=336

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  217  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  276

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K+KRKS A KSS E+
Sbjct  277  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTAS--KSKRKSNAGKSSNEN  334

Query  356  FM  351
            FM
Sbjct  335  FM  336



>emb|CBI25599.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 112/122 (92%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  294  TERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  353

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGL LKQINNWFINQRKRNWH+NPSSS+    KTKRKS A + + +H
Sbjct  354  YPTEEDKARLVQETGLHLKQINNWFINQRKRNWHSNPSSSAVL--KTKRKSNAGEINNDH  411

Query  356  FM  351
            F+
Sbjct  412  FL  413



>gb|KDO59339.1| hypothetical protein CISIN_1g019151mg [Citrus sinensis]
Length=344

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  225  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  284

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K+KRKS A KSS E+
Sbjct  285  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTAS--KSKRKSNAGKSSNEN  342

Query  356  FM  351
            FM
Sbjct  343  FM  344



>ref|XP_006453704.1| hypothetical protein CICLE_v10008821mg [Citrus clementina]
 gb|ESR66944.1| hypothetical protein CICLE_v10008821mg [Citrus clementina]
Length=344

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  225  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  284

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K+KRKS A KSS E+
Sbjct  285  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTAS--KSKRKSNAGKSSNEN  342

Query  356  FM  351
            FM
Sbjct  343  FM  344



>ref|XP_010244782.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X1 [Nelumbo 
nucifera]
Length=480

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKHDLKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSH+KWP
Sbjct  361  SERSLMERVRQELKHDLKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHAKWP  420

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K+KRKS A ++S E 
Sbjct  421  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTAL--KSKRKSNAGENSGER  478

Query  356  FM  351
            F+
Sbjct  479  FL  480



>ref|XP_004514060.1| PREDICTED: homeobox protein knotted-1-like LET12-like isoform 
X1 [Cicer arietinum]
Length=368

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 114/123 (93%), Gaps = 3/123 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYK KI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  248  SERSLMERVRQELKHELKQGYKNKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  307

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSA-AEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSS+ S  KTKRKS+ A ++S +
Sbjct  308  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSSTGS--KTKRKSSGAGETSNQ  365

Query  359  HFM  351
             FM
Sbjct  366  SFM  368



>gb|KHN13973.1| Homeobox protein knotted-1-like 4 [Glycine soja]
Length=156

 Score =   201 bits (510),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYK+KI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  36   TERSLMERVRQELKHELKQGYKDKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  95

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSSS S  K K   A E +S + 
Sbjct  96   YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSSSGSKSKRKSSGAGE-TSNQS  154

Query  356  FM  351
            FM
Sbjct  155  FM  156



>ref|XP_010929107.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGD+TSLLKAWWQSHSKWP
Sbjct  303  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDSTSLLKAWWQSHSKWP  362

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTE+DKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K+KRKS A   + EH
Sbjct  363  YPTEDDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTAL--KSKRKSNAGDHNAEH  420

Query  356  FM  351
            FM
Sbjct  421  FM  422



>ref|XP_010265705.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Nelumbo 
nucifera]
Length=478

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  358  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  417

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K KR +A E S  E 
Sbjct  418  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTALKSKRKRSNAGENSG-ER  476

Query  356  FM  351
            FM
Sbjct  477  FM  478



>gb|KHN01262.1| Homeobox protein knotted-1-like 3 [Glycine soja]
Length=281

 Score =   204 bits (518),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYK+KI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  161  TERSLMERVRQELKHELKQGYKDKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  220

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSSS S  K K   A E SS + 
Sbjct  221  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSSSGSKSKRKSSGAGE-SSNQS  279

Query  356  FM  351
            FM
Sbjct  280  FM  281



>ref|XP_004508615.1| PREDICTED: homeobox protein knotted-1-like 4-like [Cicer arietinum]
Length=308

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 111/122 (91%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVR ELKH+LKQGYKEKI D+REEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  190  TERSLMERVRLELKHELKQGYKEKIVDVREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  249

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH N  SS++S  KTKRKSA E SS + 
Sbjct  250  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANSPSSTNS--KTKRKSAGE-SSNQS  306

Query  356  FM  351
            FM
Sbjct  307  FM  308



>ref|XP_010648713.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Vitis 
vinifera]
Length=427

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 3/123 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  307  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  366

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKA+LVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS A E SS +
Sbjct  367  YPTEEDKAKLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKSNAGENSSGD  424

Query  359  HFM  351
             FM
Sbjct  425  RFM  427



>gb|KEH38097.1| class II knotted-like homeobox protein [Medicago truncatula]
Length=367

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 3/123 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYK KI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  247  SERSLMERVRQELKHELKQGYKSKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  306

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSA-AEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSS+ S  KTKRKS+ A ++S +
Sbjct  307  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSSTGS--KTKRKSSGAGETSNQ  364

Query  359  HFM  351
             F+
Sbjct  365  SFI  367



>ref|XP_007155117.1| hypothetical protein PHAVU_003G174900g [Phaseolus vulgaris]
 gb|ESW27111.1| hypothetical protein PHAVU_003G174900g [Phaseolus vulgaris]
Length=347

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQ+HSKWP
Sbjct  228  TERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQAHSKWP  287

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTN  SSSS++ K+KRKSA E SS + 
Sbjct  288  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNNPSSSSNT-KSKRKSAGE-SSNQS  345

Query  356  FM  351
            FM
Sbjct  346  FM  347



>ref|XP_011458838.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=443

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 114/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  324  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  383

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS A ++S++ 
Sbjct  384  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKSNAGENSSDR  441

Query  356  FM  351
            F+
Sbjct  442  FV  443



>gb|AAM53320.1| KNAT3 homeodomain protein [Arabidopsis thaliana]
 gb|AAN15458.1| KNAT3 homeodomain protein [Arabidopsis thaliana]
Length=306

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  186  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  245

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KRKS A + S  E
Sbjct  246  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNSGRE  303

Query  359  HF  354
             F
Sbjct  304  RF  305



>ref|XP_010656542.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X1 [Vitis 
vinifera]
Length=442

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  322  TERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  381

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGL LKQINNWFINQRKRNWH+NPSSS+    K KR +A E ++ +H
Sbjct  382  YPTEEDKARLVQETGLHLKQINNWFINQRKRNWHSNPSSSAVLKTKRKRSNAGEINN-DH  440

Query  356  FM  351
            F+
Sbjct  441  FL  442



>ref|XP_010048922.1| PREDICTED: homeobox protein knotted-1-like 4 isoform X1 [Eucalyptus 
grandis]
 gb|KCW81342.1| hypothetical protein EUGRSUZ_C02727 [Eucalyptus grandis]
Length=434

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK WWQ+HSKWP
Sbjct  315  TERSLMERVRQELKHELKQGYKEKIIDIREEILRKRRAGKLPGDTTSVLKQWWQTHSKWP  374

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS A ++S++ 
Sbjct  375  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKSNAGENSSDR  432

Query  356  FM  351
            FM
Sbjct  433  FM  434



>ref|XP_009355805.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Pyrus 
x bretschneideri]
Length=447

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 3/123 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEIMRKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  327  SERSLMERVRQELKHELKQGYKEKIVDIREEIMRKRRAGKLPGDTTSVLKAWWQSHSKWP  386

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS A E SS +
Sbjct  387  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKSNAGENSSDD  444

Query  359  HFM  351
             F+
Sbjct  445  RFI  447



>gb|KDO59340.1| hypothetical protein CISIN_1g019151mg [Citrus sinensis]
Length=345

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  225  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  284

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K KR +A  KSS E+
Sbjct  285  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTASKSKRKRSNAG-KSSNEN  343

Query  356  FM  351
            FM
Sbjct  344  FM  345



>gb|KDP33547.1| hypothetical protein JCGZ_07118 [Jatropha curcas]
Length=442

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKIADIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  322  SERSLMERVRQELKHELKQGYKEKIADIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  381

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR +A + S  + 
Sbjct  382  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRSNAGDNSG-DR  440

Query  356  FM  351
            FM
Sbjct  441  FM  442



>ref|XP_006453705.1| hypothetical protein CICLE_v10008821mg [Citrus clementina]
 gb|ESR66945.1| hypothetical protein CICLE_v10008821mg [Citrus clementina]
Length=345

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  225  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  284

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K KR +A  KSS E+
Sbjct  285  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTASKSKRKRSNAG-KSSNEN  343

Query  356  FM  351
            FM
Sbjct  344  FM  345



>ref|XP_010234555.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X1 [Brachypodium 
distachyon]
Length=282

 Score =   202 bits (513),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LK+WWQSHSKWP
Sbjct  166  SERSLMERVRQELKHELKQGYKEKLVDIREEILRKRRAGKLPGDTTSTLKSWWQSHSKWP  225

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSS  366
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K KR +A + +S
Sbjct  226  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTNVKSKRKRSNAGDSNS  282



>ref|XP_008394136.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Malus 
domestica]
Length=450

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEIMRKRRAGKLPG+TTS+LKAWWQSHSKWP
Sbjct  329  SERSLMERVRQELKHELKQGYKEKIVDIREEIMRKRRAGKLPGNTTSVLKAWWQSHSKWP  388

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGL LKQINNWFINQRKRNWH+NPS+S+    K KR +A E SS + 
Sbjct  389  YPTEEDKARLVQETGLHLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRSNAGENSSGDR  448

Query  356  FM  351
            F+
Sbjct  449  FI  450



>ref|XP_009362327.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Pyrus 
x bretschneideri]
Length=439

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 3/123 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  319  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  378

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS A E SS E
Sbjct  379  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKSNAGENSSGE  436

Query  359  HFM  351
             F+
Sbjct  437  RFI  439



>ref|XP_007138444.1| hypothetical protein PHAVU_009G209500g [Phaseolus vulgaris]
 gb|ESW10438.1| hypothetical protein PHAVU_009G209500g [Phaseolus vulgaris]
Length=363

 Score =   204 bits (519),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  243  TERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  302

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSSS S  K K   A E +S + 
Sbjct  303  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSSSGSKSKRKSSGAGE-TSNQS  361

Query  356  FM  351
            FM
Sbjct  362  FM  363



>ref|XP_008378414.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Malus 
domestica]
Length=439

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 3/123 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  319  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  378

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS A E SS E
Sbjct  379  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKSNAGENSSGE  436

Query  359  HFM  351
             F+
Sbjct  437  RFI  439



>ref|XP_009362326.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Pyrus 
x bretschneideri]
Length=450

 Score =   206 bits (525),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 3/123 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  330  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  389

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS A E SS E
Sbjct  390  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKSNAGENSSGE  447

Query  359  HFM  351
             F+
Sbjct  448  RFI  450



>ref|XP_006450341.1| hypothetical protein CICLE_v10008269mg [Citrus clementina]
 ref|XP_006483430.1| PREDICTED: homeobox protein knotted-1-like 3-like isoform X2 
[Citrus sinensis]
 gb|ESR63581.1| hypothetical protein CICLE_v10008269mg [Citrus clementina]
 gb|KDO46772.1| hypothetical protein CISIN_1g013045mg [Citrus sinensis]
Length=449

 Score =   206 bits (525),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 114/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  330  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  389

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS A ++S++ 
Sbjct  390  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKSNAGENSSDR  447

Query  356  FM  351
            +M
Sbjct  448  YM  449



>ref|XP_003533879.2| PREDICTED: homeobox protein knotted-1-like LET12-like isoform 
X1 [Glycine max]
Length=369

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYK+KI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  249  TERSLMERVRQELKHELKQGYKDKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  308

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSSS S  K K   A E SS + 
Sbjct  309  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSSSGSKSKRKSSGAGE-SSNQS  367

Query  356  FM  351
            FM
Sbjct  368  FM  369



>emb|CDX88165.1| BnaA06g27560D [Brassica napus]
Length=299

 Score =   202 bits (514),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  179  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  238

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KRKS A + S  E
Sbjct  239  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNSGRE  296

Query  359  HF  354
             F
Sbjct  297  RF  298



>ref|XP_006450342.1| hypothetical protein CICLE_v10008269mg [Citrus clementina]
 ref|XP_006483429.1| PREDICTED: homeobox protein knotted-1-like 3-like isoform X1 
[Citrus sinensis]
 gb|ESR63582.1| hypothetical protein CICLE_v10008269mg [Citrus clementina]
 gb|KDO46773.1| hypothetical protein CISIN_1g013045mg [Citrus sinensis]
Length=450

 Score =   206 bits (524),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  330  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  389

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSS  366
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR +A E SS
Sbjct  390  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRSNAGENSS  446



>gb|KHN22519.1| Homeobox protein knotted-1-like 3 [Glycine soja]
Length=305

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 115/139 (83%), Gaps = 3/139 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  168  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  227

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S++   K KR  A + ++   
Sbjct  228  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTALKSKRKRVKADQGANIGL  287

Query  356  FM*QRDRSNKTKHIPSVFL  300
             M    +  +  HI  V L
Sbjct  288  LM---LKGQQIVHIVLVML  303



>gb|ABH03531.1| class II knotted-like homeobox protein [Prunus persica]
 gb|ACJ71731.1| class II knotted-like homeobox transcription factor [Prunus persica]
Length=448

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  328  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  387

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSS  366
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR +A E SS
Sbjct  388  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRSNAGENSS  444



>gb|KHN02035.1| Homeobox protein knotted-1-like 3 [Glycine soja]
Length=201

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  88   SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  147

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS  384
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR S
Sbjct  148  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRYS  198



>ref|XP_007222132.1| hypothetical protein PRUPE_ppa005712mg [Prunus persica]
 gb|EMJ23331.1| hypothetical protein PRUPE_ppa005712mg [Prunus persica]
Length=447

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 2/121 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  328  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  387

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS A ++S++ 
Sbjct  388  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKSNAGENSSDR  445

Query  356  F  354
            F
Sbjct  446  F  446



>gb|ACJ09316.1| KNAT3-like transcription factor [Juglans nigra]
Length=482

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LK GYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  363  TERSLMERVRQELKHELKLGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  422

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS A ++S + 
Sbjct  423  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKSNAGENSHDR  480

Query  356  FM  351
            FM
Sbjct  481  FM  482



>ref|XP_003573667.2| PREDICTED: homeobox protein knotted-1-like 13 isoform X2 [Brachypodium 
distachyon]
Length=281

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 110/118 (93%), Gaps = 2/118 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LK+WWQSHSKWP
Sbjct  166  SERSLMERVRQELKHELKQGYKEKLVDIREEILRKRRAGKLPGDTTSTLKSWWQSHSKWP  225

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSST  363
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K+KRKS A  S++
Sbjct  226  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTNV--KSKRKSNAGDSNS  281



>ref|XP_009775738.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X1 [Nicotiana 
sylvestris]
Length=343

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 109/121 (90%), Gaps = 2/121 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ER LMERVRQELK + KQGYKEKI DIREEI+RKRRAGKLPGDTTS LKAWW+SHSKWP
Sbjct  224  SERFLMERVRQELKQEFKQGYKEKIVDIREEILRKRRAGKLPGDTTSALKAWWKSHSKWP  283

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKA+LVQETGLQLKQ+NNWFINQRKRNWHT P  SSSS+ K+KRKSA EKS  +H
Sbjct  284  YPTEEDKAKLVQETGLQLKQVNNWFINQRKRNWHTTP--SSSSTQKSKRKSAGEKSRNDH  341

Query  356  F  354
            F
Sbjct  342  F  342



>ref|XP_007136985.1| hypothetical protein PHAVU_009G090500g [Phaseolus vulgaris]
 gb|ESW08979.1| hypothetical protein PHAVU_009G090500g [Phaseolus vulgaris]
Length=428

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -2

Query  713  ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY  534
            ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWPY
Sbjct  309  ERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWPY  368

Query  533  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEHF  354
            PTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR +A + S+  H 
Sbjct  369  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRSNADDNSAVHHM  428



>ref|XP_007138445.1| hypothetical protein PHAVU_009G209500g [Phaseolus vulgaris]
 gb|ESW10439.1| hypothetical protein PHAVU_009G209500g [Phaseolus vulgaris]
Length=362

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/97 (97%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  243  TERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  302

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNP  426
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNP
Sbjct  303  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNP  339



>ref|XP_010519640.1| PREDICTED: homeobox protein knotted-1-like 3 [Tarenaya hassleriana]
Length=290

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  182  TERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  241

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K KR
Sbjct  242  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKNKRKR  290



>ref|XP_008219701.1| PREDICTED: homeobox protein knotted-1-like 3 [Prunus mume]
Length=415

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  295  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  354

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSS  366
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR +A E S 
Sbjct  355  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRSNAGENSG  411



>ref|XP_011036632.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Populus 
euphratica]
 ref|XP_011036633.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Populus 
euphratica]
Length=427

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  308  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  367

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS A  ++ + 
Sbjct  368  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKSNAGDNNGDR  425

Query  356  FM  351
            F+
Sbjct  426  FV  427



>ref|XP_011084049.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X1 [Sesamum 
indicum]
Length=384

 Score =   202 bits (515),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 114/122 (93%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  264  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  323

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+S   KTKRK+ A +K++ +
Sbjct  324  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTSQ--KTKRKNGAGDKTAND  381

Query  359  HF  354
             F
Sbjct  382  RF  383



>ref|XP_009770425.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 2/114 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  283  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  342

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAE  375
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP  S+S+S K+KRKSA E
Sbjct  343  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNP--STSTSQKSKRKSAGE  394



>ref|XP_009622163.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X2 [Nicotiana 
tomentosiformis]
Length=397

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 2/114 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  283  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  342

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAE  375
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP  S+S+S K+KRKSA E
Sbjct  343  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNP--STSTSQKSKRKSAGE  394



>ref|XP_010913372.1| PREDICTED: homeobox protein knotted-1-like 11 isoform X2 [Elaeis 
guineensis]
Length=460

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 111/122 (91%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLM+RVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS LKAWWQSHSKWP
Sbjct  341  SERSLMDRVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSTLKAWWQSHSKWP  400

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTE+DKARLVQETGLQLKQINNWFINQRKRNWH NPSSSS+   K+KRKS A  ++ E 
Sbjct  401  YPTEDDKARLVQETGLQLKQINNWFINQRKRNWHNNPSSSSAL--KSKRKSNAGDNNAER  458

Query  356  FM  351
            FM
Sbjct  459  FM  460



>ref|XP_006587139.1| PREDICTED: homeobox protein knotted-1-like LET12-like isoform 
X2 [Glycine max]
Length=368

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 114/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYK+KI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  249  TERSLMERVRQELKHELKQGYKDKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  308

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSSS S  K+KRKS A +SS + 
Sbjct  309  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSSSGS--KSKRKSGAGESSNQS  366

Query  356  FM  351
            FM
Sbjct  367  FM  368



>ref|XP_010493771.1| PREDICTED: homeobox protein knotted-1-like 3 [Camelina sativa]
Length=294

 Score =   199 bits (507),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  186  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  245

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K KR
Sbjct  246  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKNKRKR  294



>emb|CDX78407.1| BnaA03g03190D [Brassica napus]
Length=386

 Score =   202 bits (514),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 111/119 (93%), Gaps = 1/119 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  268  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  327

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++S +K +R +A E S  E
Sbjct  328  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTASKNK-RRSNAGENSGRE  385



>ref|XP_010541588.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Tarenaya 
hassleriana]
Length=419

 Score =   203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 112/122 (92%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  299  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  358

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S  K KRKS A +K + E
Sbjct  359  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVS--KNKRKSNAGDKIAAE  416

Query  359  HF  354
             F
Sbjct  417  RF  418



>emb|CDX80491.1| BnaC07g29530D [Brassica napus]
Length=444

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 109/122 (89%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEIMRKRRAGKLPGDTTS+LK WWQSHSKWP
Sbjct  324  SERSLMERVRQELKHELKQGYKEKIVDIREEIMRKRRAGKLPGDTTSVLKGWWQSHSKWP  383

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KRKS A + S  E
Sbjct  384  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNSGRE  441

Query  359  HF  354
             F
Sbjct  442  RF  443



>gb|AAM63298.1| KNAT3 homeodomain protein [Arabidopsis thaliana]
Length=431

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  311  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  370

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KRKS A + S  E
Sbjct  371  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNSGRE  428

Query  359  HF  354
             F
Sbjct  429  RF  430



>ref|XP_006287910.1| hypothetical protein CARUB_v10001144mg [Capsella rubella]
 gb|EOA20808.1| hypothetical protein CARUB_v10001144mg [Capsella rubella]
Length=391

 Score =   202 bits (514),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  273  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  332

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S +K +R +A E S  E
Sbjct  333  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNK-RRSNAGENSGRE  390



>ref|XP_009151045.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Brassica 
rapa]
Length=421

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  301  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  360

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KRKS A + S  E
Sbjct  361  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNSGRE  418

Query  359  HF  354
             F
Sbjct  419  RF  420



>ref|XP_009131190.1| PREDICTED: LOW QUALITY PROTEIN: homeobox protein knotted-1-like 
4 [Brassica rapa]
Length=391

 Score =   202 bits (514),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 111/119 (93%), Gaps = 1/119 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  273  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  332

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++S +K +R +A E S  E
Sbjct  333  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTASKNK-RRSNAGENSGRE  390



>ref|NP_197904.1| homeobox protein knotted-1-like 3 [Arabidopsis thaliana]
 sp|P48000.1|KNAT3_ARATH RecName: Full=Homeobox protein knotted-1-like 3; AltName: Full=Protein 
KNAT3 [Arabidopsis thaliana]
 emb|CAA63130.1| KNAT3 homeobox protein [Arabidopsis thaliana]
 gb|AAC98441.1| KNAT3 homeodomain protein [Arabidopsis thaliana]
 gb|AED93413.1| homeobox protein knotted-1-like 3 [Arabidopsis thaliana]
Length=431

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  311  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  370

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KRKS A + S  E
Sbjct  371  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNSGRE  428

Query  359  HF  354
             F
Sbjct  429  RF  430



>ref|XP_004138713.1| PREDICTED: homeobox protein knotted-1-like 3-like [Cucumis sativus]
Length=462

 Score =   204 bits (518),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LK GYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  342  SERSLMERVRHELKHELKNGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  401

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKA+LVQETGLQLKQINNWFINQRKRNWHTNPS+S++   K KR +A E +  +H
Sbjct  402  YPTEEDKAKLVQETGLQLKQINNWFINQRKRNWHTNPSTSTTLKTKRKRSNAGEATGNDH  461



>ref|XP_002872145.1| hypothetical protein ARALYDRAFT_489374 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48404.1| hypothetical protein ARALYDRAFT_489374 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   203 bits (516),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  309  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  368

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KRKS A + S  E
Sbjct  369  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNSGRE  426

Query  359  HF  354
             F
Sbjct  427  RF  428



>ref|XP_011039618.1| PREDICTED: homeobox protein knotted-1-like 4 isoform X2 [Populus 
euphratica]
Length=433

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTT++LKAWWQSHSKWP
Sbjct  314  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTTVLKAWWQSHSKWP  373

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K+KRKS A  ++ + 
Sbjct  374  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KSKRKSNAGDNNGDR  431

Query  356  FM  351
            F+
Sbjct  432  FV  433



>ref|XP_010047186.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Eucalyptus 
grandis]
 gb|KCW79009.1| hypothetical protein EUGRSUZ_C00434 [Eucalyptus grandis]
Length=368

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 109/122 (89%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQ+HSKWP
Sbjct  249  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQTHSKWP  308

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K+KRKS A     E 
Sbjct  309  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVP--KSKRKSHAGDPDKER  366

Query  356  FM  351
             M
Sbjct  367  PM  368



>gb|KFK27790.1| hypothetical protein AALP_AA8G429800 [Arabis alpina]
Length=413

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  293  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  352

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KRKS A + S  E
Sbjct  353  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNSGRE  410

Query  359  HF  354
             F
Sbjct  411  RF  412



>ref|XP_006287805.1| hypothetical protein CARUB_v10001020mg [Capsella rubella]
 gb|EOA20703.1| hypothetical protein CARUB_v10001020mg [Capsella rubella]
Length=427

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 108/117 (92%), Gaps = 2/117 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  307  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  366

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSS  366
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KRKS A  +S
Sbjct  367  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNS  421



>ref|XP_010454842.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Camelina 
sativa]
Length=439

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  319  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  378

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KRKS A + S  E
Sbjct  379  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNSGRE  436

Query  359  HF  354
             F
Sbjct  437  RF  438



>ref|XP_002871452.1| KNAT4 homeobox protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47711.1| KNAT4 homeobox protein [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  273  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  332

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S +K +R +A E S  E
Sbjct  333  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNK-RRSNAGENSGRE  390



>emb|CDY05371.1| BnaC02g40790D [Brassica napus]
Length=404

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 110/121 (91%), Gaps = 1/121 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  284  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  343

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K ++ +A + S  E 
Sbjct  344  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKNK-RKNNAGDSSGRER  402

Query  356  F  354
            F
Sbjct  403  F  403



>ref|XP_006394770.1| hypothetical protein EUTSA_v10004250mg [Eutrema salsugineum]
 dbj|BAJ34052.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ32056.1| hypothetical protein EUTSA_v10004250mg [Eutrema salsugineum]
Length=434

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  314  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  373

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KRKS A + S  E
Sbjct  374  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNSGRE  431

Query  359  HF  354
             F
Sbjct  432  RF  433



>ref|XP_009610663.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X1 [Nicotiana 
tomentosiformis]
Length=338

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 109/121 (90%), Gaps = 3/121 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ER LMERVRQELK + KQGYKEKI DIREEI+RKRRAGKLPGDTTS LKAWW+SHSKWP
Sbjct  220  SERFLMERVRQELKQEFKQGYKEKIVDIREEILRKRRAGKLPGDTTSALKAWWKSHSKWP  279

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKA+LVQETGLQLKQ+NNWFINQRKRNWHT    SSSS+ K+KRKSA EKS T+H
Sbjct  280  YPTEEDKAKLVQETGLQLKQVNNWFINQRKRNWHTT---SSSSAQKSKRKSAGEKSRTDH  336

Query  356  F  354
            F
Sbjct  337  F  337



>ref|XP_010942157.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X1 [Elaeis 
guineensis]
Length=419

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 112/122 (92%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELK++LKQGYK KI DIREEI+RKRRAGKLPG TTSLLK+WWQSHSKWP
Sbjct  300  SERSLMERVRQELKNELKQGYKNKIVDIREEILRKRRAGKLPGGTTSLLKSWWQSHSKWP  359

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTE+DKARLVQETGLQLKQINNWFINQRKRNWH+NP+S+++   K+KRKS A  ++ EH
Sbjct  360  YPTEDDKARLVQETGLQLKQINNWFINQRKRNWHSNPASTTAL--KSKRKSNAGDNNAEH  417

Query  356  FM  351
            FM
Sbjct  418  FM  419



>ref|XP_006399606.1| hypothetical protein EUTSA_v10013773mg [Eutrema salsugineum]
 dbj|BAJ34424.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41059.1| hypothetical protein EUTSA_v10013773mg [Eutrema salsugineum]
Length=388

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  270  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  329

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S +K +R +A E S  E
Sbjct  330  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNK-RRSNAGENSGRE  387



>ref|XP_010047185.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Eucalyptus 
grandis]
 gb|KCW79008.1| hypothetical protein EUGRSUZ_C00434 [Eucalyptus grandis]
Length=369

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQ+HSKWP
Sbjct  249  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQTHSKWP  308

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAE  375
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KR  A +
Sbjct  309  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVPKSKRKRSHAGD  362



>ref|XP_010421369.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Camelina 
sativa]
Length=441

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  321  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  380

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KRKS A + S  E
Sbjct  381  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNSGRE  438

Query  359  HF  354
             F
Sbjct  439  RF  440



>ref|XP_011036630.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Populus 
euphratica]
 ref|XP_011036631.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Populus 
euphratica]
Length=428

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  308  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  367

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSS  366
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR +A + + 
Sbjct  368  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRSNAGDNNG  424



>ref|XP_002324890.2| Homeobox protein knotted-1 like 3 [Populus trichocarpa]
 gb|EEF03455.2| Homeobox protein knotted-1 like 3 [Populus trichocarpa]
Length=426

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  306  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  365

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSS  366
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR +A + + 
Sbjct  366  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRSNAGDNNG  422



>emb|CDY05480.1| BnaA02g32110D [Brassica napus]
Length=420

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 110/121 (91%), Gaps = 1/121 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  300  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  359

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K ++ +A + S  E 
Sbjct  360  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKNK-RKNNAGDSSGRER  418

Query  356  F  354
            F
Sbjct  419  F  419



>gb|KJB65883.1| hypothetical protein B456_010G117100 [Gossypium raimondii]
Length=434

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 108/113 (96%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVR+ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQ+HSKWP
Sbjct  321  TERSLMERVRRELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQAHSKWP  380

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPS+S++   KTKRKS A
Sbjct  381  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSTSTAL--KTKRKSIA  431



>ref|XP_008394137.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Malus 
domestica]
Length=449

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 3/123 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEIMRKRRAGKLPG+TTS+LKAWWQSHSKWP
Sbjct  329  SERSLMERVRQELKHELKQGYKEKIVDIREEIMRKRRAGKLPGNTTSVLKAWWQSHSKWP  388

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGL LKQINNWFINQRKRNWH+NPS+S+    K+KRKS A E SS +
Sbjct  389  YPTEEDKARLVQETGLHLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKSNAGENSSGD  446

Query  359  HFM  351
             F+
Sbjct  447  RFI  449



>gb|EPS71753.1| hypothetical protein M569_03005 [Genlisea aurea]
Length=214

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQ+HSKWP
Sbjct  95   SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQAHSKWP  154

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNP  426
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP
Sbjct  155  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNP  191



>ref|XP_009770424.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X1 [Nicotiana 
sylvestris]
Length=398

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 109/113 (96%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  283  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  342

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP  S+S+S K+KRKS+A
Sbjct  343  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNP--STSTSQKSKRKSSA  393



>ref|XP_009622162.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X1 [Nicotiana 
tomentosiformis]
Length=398

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 109/113 (96%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  283  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  342

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP  S+S+S K+KRKS+A
Sbjct  343  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNP--STSTSQKSKRKSSA  393



>ref|XP_006601171.1| PREDICTED: homeobox protein knotted-1-like 3-like isoform X2 
[Glycine max]
Length=411

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  297  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  356

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAE  375
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S++   K KR +A +
Sbjct  357  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTALKSKRKRSNAGD  410



>gb|KHN29600.1| Homeobox protein knotted-1-like 3 [Glycine soja]
Length=174

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  713  ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY  534
            ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWPY
Sbjct  66   ERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWPY  125

Query  533  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            PTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S++   K KR
Sbjct  126  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTALKSKRKR  173



>ref|XP_009129978.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Brassica 
rapa]
Length=420

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 109/121 (90%), Gaps = 1/121 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  300  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  359

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS    +K ++ +A + S  E 
Sbjct  360  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSPVLKNK-RKNNAGDSSGRER  418

Query  356  F  354
            F
Sbjct  419  F  419



>ref|XP_006848824.1| hypothetical protein AMTR_s00026p00162850 [Amborella trichopoda]
 gb|ERN10405.1| hypothetical protein AMTR_s00026p00162850 [Amborella trichopoda]
Length=482

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 110/122 (90%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  363  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  422

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTE++K RLVQETGLQLKQINNWFINQRKRNWH+NPSSSS+   K+KRKS A     + 
Sbjct  423  YPTEDEKVRLVQETGLQLKQINNWFINQRKRNWHSNPSSSSAV--KSKRKSHAGDDDGDR  480

Query  356  FM  351
            FM
Sbjct  481  FM  482



>ref|XP_008784810.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X1 [Phoenix 
dactylifera]
Length=424

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 111/121 (92%), Gaps = 2/121 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELK++L+QGYK KI DIREEI+RKRRAGKLPG TTSLLKAWWQSHSKWP
Sbjct  305  SERSLMERVRQELKNELQQGYKNKIVDIREEILRKRRAGKLPGGTTSLLKAWWQSHSKWP  364

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTE+DKARLVQETGLQLKQINNWFINQRKRNWHTNPSS+++   K+KRKS A  ++ EH
Sbjct  365  YPTEDDKARLVQETGLQLKQINNWFINQRKRNWHTNPSSTTAM--KSKRKSNAGDNNAEH  422

Query  356  F  354
            F
Sbjct  423  F  423



>gb|AEC04754.1| knotted-like homeobox KNOX5 [Fragaria vesca]
Length=368

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 106/111 (95%), Gaps = 2/111 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  192  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  251

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS  384
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS
Sbjct  252  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKS  300



>ref|XP_010453146.1| PREDICTED: homeobox protein knotted-1-like 4 isoform X1 [Camelina 
sativa]
Length=395

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  277  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  336

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S +K +R +A E S  E
Sbjct  337  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNK-RRSNAGENSGRE  394



>ref|XP_008806313.1| PREDICTED: homeobox protein knotted-1-like 2 isoform X2 [Phoenix 
dactylifera]
Length=173

 Score =   194 bits (492),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGD+TSLLK+WWQSHSKWP
Sbjct  65   SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDSTSLLKSWWQSHSKWP  124

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTE+DKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K KR
Sbjct  125  YPTEDDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTALKSKRKR  173



>ref|XP_010491801.1| PREDICTED: homeobox protein knotted-1-like 4 isoform X1 [Camelina 
sativa]
Length=389

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  271  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  330

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S +K +R +A E S  E
Sbjct  331  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNK-RRSNAGENSGRE  388



>dbj|BAA08554.1| OSH45 [Oryza sativa Japonica Group]
Length=171

 Score =   193 bits (491),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 2/110 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LKAWWQSH+KWP
Sbjct  63   SERSLMERVRQELKHELKQGYKEKLIDIREEILRKRRAGKLPGDTTSTLKAWWQSHAKWP  122

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+S   KTKRK
Sbjct  123  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTSV--KTKRK  170



>dbj|BAC57787.1| OSH45 [Oryza sativa Japonica Group]
 dbj|BAD01204.1| OSH45 [Oryza sativa Japonica Group]
Length=181

 Score =   194 bits (492),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 2/110 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LKAWWQSH+KWP
Sbjct  63   SERSLMERVRQELKHELKQGYKEKLIDIREEILRKRRAGKLPGDTTSTLKAWWQSHAKWP  122

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+S   KTKRK
Sbjct  123  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTSV--KTKRK  170



>ref|XP_010419661.1| PREDICTED: homeobox protein knotted-1-like 4 isoform X1 [Camelina 
sativa]
Length=395

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  277  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  336

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S +K +R +A E S  E
Sbjct  337  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNK-RRSNAGENSGRE  394



>ref|XP_002515465.1| homeobox protein knotted-1, putative [Ricinus communis]
 gb|EEF46914.1| homeobox protein knotted-1, putative [Ricinus communis]
Length=456

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 113/134 (84%), Gaps = 3/134 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKIADIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  318  SERSLMERVRHELKHELKQGYKEKIADIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  377

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KR  +   +STE 
Sbjct  378  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKSKRKRNCS---NSTEL  434

Query  356  FM*QRDRSNKTKHI  315
               Q + S    HI
Sbjct  435  CGGQLNLSEGEPHI  448



>ref|XP_006596082.1| PREDICTED: homeobox protein knotted-1-like 3-like isoform X2 
[Glycine max]
Length=413

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  299  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  358

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAE  375
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR +A +
Sbjct  359  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRSNAGD  412



>ref|XP_008802010.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X3 [Phoenix 
dactylifera]
Length=473

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 110/122 (90%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLM+RVRQELKH+L+QGYKEKI DIREEI+RKRRAGKLPGDTTS LKAWWQSHSKWP
Sbjct  354  TERSLMDRVRQELKHELRQGYKEKIVDIREEILRKRRAGKLPGDTTSTLKAWWQSHSKWP  413

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTE+DKARLVQETGLQLKQINNWFINQRKRNWH NPSSSS+   K+KRKS A  ++   
Sbjct  414  YPTEDDKARLVQETGLQLKQINNWFINQRKRNWHNNPSSSSTL--KSKRKSNAGDNNAGR  471

Query  356  FM  351
            FM
Sbjct  472  FM  473



>gb|ABZ10963.1| class 1 knox protein [Kalanchoe x houghtonii]
Length=408

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  300  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  359

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  360  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  408



>ref|XP_011039616.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Populus 
euphratica]
Length=434

 Score =   201 bits (511),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTT++LKAWWQSHSKWP
Sbjct  314  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTTVLKAWWQSHSKWP  373

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSS  366
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KR +A + + 
Sbjct  374  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKSKRKRSNAGDNNG  430



>ref|XP_006601172.1| PREDICTED: homeobox protein knotted-1-like 3-like isoform X3 
[Glycine max]
Length=410

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 108/113 (96%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  297  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  356

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S++   K+KRKS A
Sbjct  357  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTAL--KSKRKSNA  407



>ref|NP_001061467.2| Os08g0292900 [Oryza sativa Japonica Group]
 dbj|BAF23381.2| Os08g0292900 [Oryza sativa Japonica Group]
Length=194

 Score =   194 bits (492),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 2/110 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LKAWWQSH+KWP
Sbjct  86   SERSLMERVRQELKHELKQGYKEKLIDIREEILRKRRAGKLPGDTTSTLKAWWQSHAKWP  145

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+S   KTKRK
Sbjct  146  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTSV--KTKRK  193



>ref|XP_008452885.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Cucumis 
melo]
 ref|XP_008452886.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Cucumis 
melo]
 ref|XP_008452887.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Cucumis 
melo]
Length=470

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LK GYKEKI DIREEI+RKRRAGKLPGDTTS+LK WWQSHSKWP
Sbjct  350  SERSLMERVRQELKHELKAGYKEKIVDIREEILRKRRAGKLPGDTTSVLKQWWQSHSKWP  409

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSS  366
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K KR +A E SS
Sbjct  410  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTNLKSKRKRSNAGENSS  466



>ref|XP_010234556.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X3 [Brachypodium 
distachyon]
Length=274

 Score =   196 bits (498),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LK+WWQSHSKWP
Sbjct  166  SERSLMERVRQELKHELKQGYKEKLVDIREEILRKRRAGKLPGDTTSTLKSWWQSHSKWP  225

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K KR
Sbjct  226  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTNVKSKRKR  274



>ref|XP_004170654.1| PREDICTED: homeobox protein knotted-1-like 3-like [Cucumis sativus]
Length=461

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 110/121 (91%), Gaps = 3/121 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LK GYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  342  SERSLMERVRHELKHELKNGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  401

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKA+LVQETGLQLKQINNWFINQRKRNWHTNPS+S++   KTKRKS A E +  +
Sbjct  402  YPTEEDKAKLVQETGLQLKQINNWFINQRKRNWHTNPSTSTTL--KTKRKSNAGEATGND  459

Query  359  H  357
            H
Sbjct  460  H  460



>ref|XP_010244783.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X2 [Nelumbo 
nucifera]
Length=469

 Score =   201 bits (512),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKHDLKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSH+KWP
Sbjct  361  SERSLMERVRQELKHDLKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHAKWP  420

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K KR
Sbjct  421  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTALKSKRKR  469



>ref|XP_006470682.1| PREDICTED: homeobox protein knotted-1-like LET12-like isoform 
X1 [Citrus sinensis]
Length=185

 Score =   193 bits (490),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 106/114 (93%), Gaps = 2/114 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  65   SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  124

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAE  375
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K+KRKS  E
Sbjct  125  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTAS--KSKRKSWTE  176



>ref|XP_006659277.1| PREDICTED: homeobox protein knotted-1-like 13-like [Oryza brachyantha]
Length=194

 Score =   193 bits (491),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 105/110 (95%), Gaps = 2/110 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LKAWWQSH+KWP
Sbjct  86   SERSLMERVRQELKHELKQGYKEKLIDIREEILRKRRAGKLPGDTTSTLKAWWQSHAKWP  145

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+SS+   KTKRK
Sbjct  146  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSSNV--KTKRK  193



>ref|XP_008452888.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Cucumis 
melo]
Length=469

 Score =   201 bits (512),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 112/121 (93%), Gaps = 2/121 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LK GYKEKI DIREEI+RKRRAGKLPGDTTS+LK WWQSHSKWP
Sbjct  350  SERSLMERVRQELKHELKAGYKEKIVDIREEILRKRRAGKLPGDTTSVLKQWWQSHSKWP  409

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K+KRKS A ++S++ 
Sbjct  410  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTNL--KSKRKSNAGENSSDR  467

Query  356  F  354
            F
Sbjct  468  F  468



>ref|XP_007013698.1| Homeobox protein knotted-1-like 3 [Theobroma cacao]
 gb|EOY31317.1| Homeobox protein knotted-1-like 3 [Theobroma cacao]
Length=353

 Score =   198 bits (504),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 104/111 (94%), Gaps = 4/111 (4%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI D+REEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  192  TERSLMERVRQELKHELKQGYKEKIVDVREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  251

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS  384
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNW +NPS+S     K+KRKS
Sbjct  252  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWQSNPSTSL----KSKRKS  298



>ref|NP_196667.2| homeobox protein knotted-1-like 4 [Arabidopsis thaliana]
 sp|P48001.3|KNAT4_ARATH RecName: Full=Homeobox protein knotted-1-like 4; AltName: Full=Protein 
KNAT4 [Arabidopsis thaliana]
 dbj|BAC42914.1| putative homeobox protein knotted-1 like4 KNAT4 [Arabidopsis 
thaliana]
 gb|AED91630.1| homeobox protein knotted-1-like 4 [Arabidopsis thaliana]
Length=393

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  275  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  334

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSS  366
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S +K +R +A E S 
Sbjct  335  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNK-RRSNAGENSG  390



>emb|CAA63131.1| KNAT4 homeobox protein [Arabidopsis thaliana]
Length=393

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  275  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  334

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSS  366
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S +K +R +A E S 
Sbjct  335  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNK-RRSNAGENSG  390



>emb|CDX85732.1| BnaA02g00810D [Brassica napus]
Length=393

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  275  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  334

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTE  360
            YPTEEDK RLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K +R +A E S  E
Sbjct  335  YPTEEDKVRLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVPKNK-RRSNAGENSGRE  392



>gb|KJB82790.1| hypothetical protein B456_013G213900 [Gossypium raimondii]
Length=440

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +E+SLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  321  SEKSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  380

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNW++NPS+S+ S  K+KRKS A +++ + 
Sbjct  381  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWNSNPSTSTVS--KSKRKSNAGENNGDR  438

Query  356  FM  351
            FM
Sbjct  439  FM  440



>gb|KHG25122.1| Homeobox protein knotted-1-like 3 [Gossypium arboreum]
Length=295

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 103/110 (94%), Gaps = 4/110 (4%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS LKAWWQSHSKWP
Sbjct  189  TERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSFLKAWWQSHSKWP  248

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKA+LVQETGLQLKQINNWFINQRKRNWH+NPS+S     K+KRK
Sbjct  249  YPTEEDKAKLVQETGLQLKQINNWFINQRKRNWHSNPSTSL----KSKRK  294



>ref|XP_006287804.1| hypothetical protein CARUB_v10001020mg [Capsella rubella]
 gb|EOA20702.1| hypothetical protein CARUB_v10001020mg [Capsella rubella]
Length=424

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  307  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  366

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K KR
Sbjct  367  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKNKRKR  415



>gb|KJB53875.1| hypothetical protein B456_009G012300 [Gossypium raimondii]
 gb|KJB53876.1| hypothetical protein B456_009G012300 [Gossypium raimondii]
Length=295

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 103/110 (94%), Gaps = 4/110 (4%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS LKAWWQSHSKWP
Sbjct  189  TERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSFLKAWWQSHSKWP  248

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKA+LVQETGLQLKQINNWFINQRKRNWH+NPS+S     K+KRK
Sbjct  249  YPTEEDKAKLVQETGLQLKQINNWFINQRKRNWHSNPSTSL----KSKRK  294



>ref|XP_008354343.1| PREDICTED: homeobox protein knotted-1-like 6 isoform X1 [Malus 
domestica]
Length=154

 Score =   192 bits (487),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 106/113 (94%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+L+QGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  35   SERSLMERVRQELKHELEQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  94

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N   SS+S  K+KRKS A
Sbjct  95   YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSN--ISSTSVLKSKRKSNA  145



>gb|KHG00601.1| Homeobox protein knotted-1-like 3 [Gossypium arboreum]
Length=440

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +E+SLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  321  SEKSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  380

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNW++NPS+S+ S  K+KRKS A +++ + 
Sbjct  381  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWNSNPSTSTVS--KSKRKSNAGENNGDR  438

Query  356  FM  351
            FM
Sbjct  439  FM  440



>gb|EEC83301.1| hypothetical protein OsI_28664 [Oryza sativa Indica Group]
 gb|EEE68418.1| hypothetical protein OsJ_26781 [Oryza sativa Japonica Group]
Length=212

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 2/110 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LKAWWQSH+KWP
Sbjct  94   SERSLMERVRQELKHELKQGYKEKLIDIREEILRKRRAGKLPGDTTSTLKAWWQSHAKWP  153

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+S   KTKRK
Sbjct  154  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTSV--KTKRK  201



>ref|XP_010047187.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X3 [Eucalyptus 
grandis]
 gb|KCW79010.1| hypothetical protein EUGRSUZ_C00434 [Eucalyptus grandis]
 gb|KCW79011.1| hypothetical protein EUGRSUZ_C00434 [Eucalyptus grandis]
Length=357

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQ+HSKWP
Sbjct  249  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQTHSKWP  308

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KR
Sbjct  309  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVPKSKRKR  357



>gb|EYU30578.1| hypothetical protein MIMGU_mgv1a023757mg, partial [Erythranthe 
guttata]
Length=217

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 104/110 (95%), Gaps = 3/110 (3%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  111  TERSLMERVRLELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  170

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K+KRK
Sbjct  171  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTP---KSKRK  217



>ref|XP_006470684.1| PREDICTED: homeobox protein knotted-1-like LET12-like isoform 
X3 [Citrus sinensis]
Length=173

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  65   SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  124

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K KR
Sbjct  125  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTASKSKRKR  173



>emb|CAC03454.1| HOMEOBOX PROTEIN KNOTTED-1 LIKE 4 (KNAT4) [Arabidopsis thaliana]
Length=419

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  275  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  334

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S  K KR+   E  + E 
Sbjct  335  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVS--KNKRRRYMESLNLEG  392

Query  356  FM  351
            F+
Sbjct  393  FL  394



>emb|CDP10515.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 115/122 (94%), Gaps = 2/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLK+WWQSHSKWP
Sbjct  198  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKSWWQSHSKWP  257

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSSSS   K+KRKSA EKSS E 
Sbjct  258  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSSSQ--KSKRKSAGEKSSNEQ  315

Query  356  FM  351
            FM
Sbjct  316  FM  317



>gb|KFK25380.1| hypothetical protein AALP_AA8G105800 [Arabis alpina]
Length=391

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  273  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  332

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S +K +R +A + S  E
Sbjct  333  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNK-RRSNAGDNSGRE  390



>ref|XP_010265707.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X3 [Nelumbo 
nucifera]
Length=466

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  358  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  417

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K KR
Sbjct  418  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTALKSKRKR  466



>gb|EYU30574.1| hypothetical protein MIMGU_mgv1a023272mg, partial [Erythranthe 
guttata]
Length=230

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 104/110 (95%), Gaps = 3/110 (3%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  123  TERSLMERVRLELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  182

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K+KRK
Sbjct  183  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTP---KSKRK  229



>ref|XP_011084050.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X2 [Sesamum 
indicum]
 ref|XP_011084051.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X3 [Sesamum 
indicum]
Length=372

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 2/110 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  264  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  323

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+S   KTKRK
Sbjct  324  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTSQ--KTKRK  371



>sp|Q0J6N4.2|KNOSD_ORYSJ RecName: Full=Homeobox protein knotted-1-like 13; AltName: Full=Homeobox 
protein OSH45 [Oryza sativa Japonica Group]
 dbj|BAA08553.1| OSH45 [Oryza sativa Japonica Group]
Length=374

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LKAWWQSH+KWP
Sbjct  259  SERSLMERVRQELKHELKQGYKEKLIDIREEILRKRRAGKLPGDTTSTLKAWWQSHAKWP  318

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+S   KTKRKS A
Sbjct  319  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTSV--KTKRKSNA  369



>ref|XP_009151046.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Brassica 
rapa]
Length=409

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  301  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  360

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K KR
Sbjct  361  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKNKRKR  409



>gb|KFK27789.1| hypothetical protein AALP_AA8G429800 [Arabis alpina]
Length=401

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  293  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  352

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K KR
Sbjct  353  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKNKRKR  401



>ref|XP_002265494.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X3 [Vitis 
vinifera]
Length=430

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 104/110 (95%), Gaps = 2/110 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  322  TERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  381

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKARLVQETGL LKQINNWFINQRKRNWH+NPSSS+    KTKRK
Sbjct  382  YPTEEDKARLVQETGLHLKQINNWFINQRKRNWHSNPSSSAVL--KTKRK  429



>ref|XP_004973169.1| PREDICTED: homeobox protein knotted-1-like 13-like [Setaria italica]
Length=377

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 109/113 (96%), Gaps = 1/113 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LKAWWQSHSKWP
Sbjct  261  SERSLMERVRQELKHELKQGYKEKLIDIREEILRKRRAGKLPGDTTSTLKAWWQSHSKWP  320

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSSS+++ K+KRKS A
Sbjct  321  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSSTNA-KSKRKSNA  372



>ref|XP_010541589.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Tarenaya 
hassleriana]
Length=407

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  299  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  358

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S +K KR
Sbjct  359  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNKRKR  407



>ref|XP_002309651.2| hypothetical protein POPTR_0006s27560g [Populus trichocarpa]
 gb|EEE93174.2| hypothetical protein POPTR_0006s27560g [Populus trichocarpa]
Length=424

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 106/111 (95%), Gaps = 2/111 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  312  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  371

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS  384
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K+KRKS
Sbjct  372  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVL--KSKRKS  420



>ref|NP_001031938.1| homeobox protein knotted-1-like 3 [Arabidopsis thaliana]
 gb|AED93414.1| homeobox protein knotted-1-like 3 [Arabidopsis thaliana]
Length=419

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  311  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  370

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K KR
Sbjct  371  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKNKRKR  419



>gb|KHN07049.1| Homeobox protein knotted-1-like 3, partial [Glycine soja]
Length=290

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 105/111 (95%), Gaps = 2/111 (2%)
 Frame = -2

Query  713  ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY  534
            ERSLMERVR ELKH+LKQGYK+KI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWPY
Sbjct  178  ERSLMERVRHELKHELKQGYKDKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWPY  237

Query  533  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSA  381
            PTEEDKARLVQETGLQLKQINNWFINQRKRNWH++PS+S+    K+KRKSA
Sbjct  238  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHSSPSTSTVL--KSKRKSA  286



>ref|XP_008242897.1| PREDICTED: homeobox protein knotted-1-like 4 isoform X1 [Prunus 
mume]
Length=369

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 109/119 (92%), Gaps = 2/119 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  250  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  309

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N   SS+S  K+KRKS A   S++
Sbjct  310  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSN--ISSTSVLKSKRKSNAGDISSQ  366



>ref|XP_006394769.1| hypothetical protein EUTSA_v10004250mg [Eutrema salsugineum]
 gb|ESQ32055.1| hypothetical protein EUTSA_v10004250mg [Eutrema salsugineum]
Length=422

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  314  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  373

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K KR
Sbjct  374  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKNKRKR  422



>ref|XP_009355806.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X3 [Pyrus 
x bretschneideri]
Length=435

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEIMRKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  327  SERSLMERVRQELKHELKQGYKEKIVDIREEIMRKRRAGKLPGDTTSVLKAWWQSHSKWP  386

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  387  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  435



>ref|XP_010421370.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Camelina 
sativa]
Length=429

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  321  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  380

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K KR
Sbjct  381  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKNKRKR  429



>gb|AEI17370.1| knox-like protein 3 [Arabidopsis lyrata]
Length=441

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  309  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  368

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K KR
Sbjct  369  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKNKRKR  417



>ref|XP_010454843.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Camelina 
sativa]
Length=427

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  319  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  378

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K KR
Sbjct  379  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKNKRKR  427



>ref|XP_011469909.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=335

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 109/119 (92%), Gaps = 2/119 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQ+HSKWP
Sbjct  216  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQTHSKWP  275

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N   S++S  K+KRKS A   +++
Sbjct  276  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSN--LSTTSVLKSKRKSNAGDGNSQ  332



>ref|XP_002285407.2| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Vitis 
vinifera]
Length=415

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  307  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  366

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKA+LVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  367  YPTEEDKAKLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  415



>ref|XP_009125259.1| PREDICTED: homeobox protein knotted-1-like 4 isoform X1 [Brassica 
rapa]
Length=393

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRR+GKLPGDTTS+LKAWWQSHSKWP
Sbjct  275  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRSGKLPGDTTSVLKAWWQSHSKWP  334

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTE  360
            YPTEEDK RLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K +R +A E S  E
Sbjct  335  YPTEEDKVRLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVPKNK-RRSNAGENSGRE  392



>ref|XP_011458839.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=432

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  324  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  383

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  384  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  432



>emb|CDY51104.1| BnaCnng20070D [Brassica napus]
Length=393

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  275  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  334

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTE  360
            YPTEEDK RLVQETGL+LKQINNWFINQRKRNWH+NPSSS+   +K +R +A E S  E
Sbjct  335  YPTEEDKVRLVQETGLELKQINNWFINQRKRNWHSNPSSSTVPKNK-RRSNAGENSGRE  392



>ref|XP_011036634.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X3 [Populus 
euphratica]
 ref|XP_011036635.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X3 [Populus 
euphratica]
Length=416

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  308  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  367

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  368  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  416



>gb|KJB06462.1| hypothetical protein B456_001G035700 [Gossypium raimondii]
Length=443

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  328  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  387

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+ S  K+KRKS A
Sbjct  388  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVS--KSKRKSNA  438



>gb|KJB65885.1| hypothetical protein B456_010G117100 [Gossypium raimondii]
Length=429

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 2/110 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVR+ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQ+HSKWP
Sbjct  321  TERSLMERVRRELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQAHSKWP  380

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPS+S++   KTKRK
Sbjct  381  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSTSTAL--KTKRK  428



>ref|XP_006450343.1| hypothetical protein CICLE_v10008269mg [Citrus clementina]
 gb|ESR63583.1| hypothetical protein CICLE_v10008269mg [Citrus clementina]
 gb|KDO46776.1| hypothetical protein CISIN_1g013045mg [Citrus sinensis]
Length=441

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  330  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  389

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS  384
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR S
Sbjct  390  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRYS  440



>ref|XP_009366122.1| PREDICTED: homeobox protein knotted-1-like 2 isoform X1 [Pyrus 
x bretschneideri]
Length=370

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 106/113 (94%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  251  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  310

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTN SS+S    K+KRKS A
Sbjct  311  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNISSTSVL--KSKRKSNA  361



>ref|XP_009341800.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009341835.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Pyrus 
x bretschneideri]
Length=371

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 106/113 (94%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  252  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  311

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTN SS+S    K+KRKS A
Sbjct  312  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNISSTSVL--KSKRKSNA  362



>gb|KJB82793.1| hypothetical protein B456_013G213900 [Gossypium raimondii]
Length=441

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +E+SLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  321  SEKSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  380

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNW++NPS+S+ S  K KR +A E +  + 
Sbjct  381  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWNSNPSTSTVSKSKRKRSNAGENNG-DR  439

Query  356  FM  351
            FM
Sbjct  440  FM  441



>ref|XP_009770426.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X3 [Nicotiana 
sylvestris]
Length=391

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  283  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  342

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+S   K KR
Sbjct  343  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTSQKSKRKR  391



>ref|XP_003550200.1| PREDICTED: homeobox protein knotted-1-like 3-like isoform X1 
[Glycine max]
Length=405

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  297  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  356

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S++   K KR
Sbjct  357  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTALKSKRKR  405



>ref|XP_010665744.1| PREDICTED: homeobox protein knotted-1-like 3 [Beta vulgaris subsp. 
vulgaris]
Length=390

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYK+KI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  282  SERSLMERVRQELKHELKQGYKDKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  341

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K KR
Sbjct  342  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTALKSKRKR  390



>gb|KHG04438.1| Homeobox protein knotted-1-like 3 [Gossypium arboreum]
Length=430

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 2/110 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVR+ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQ+HSKWP
Sbjct  322  TERSLMERVRRELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQAHSKWP  381

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPS+S++   KTKRK
Sbjct  382  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPSTSTAL--KTKRK  429



>ref|XP_009622164.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X3 [Nicotiana 
tomentosiformis]
 dbj|BAF95776.1| class 2 knotted1-like protein [Nicotiana tabacum]
Length=391

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  283  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  342

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+S   K KR
Sbjct  343  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTSQKSKRKR  391



>gb|ABZ10965.1| class 1 knox protein [Kalanchoe x houghtonii]
Length=409

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 3/122 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYK+KI DIREEI+RKRRAGKLPGDTTS LKAWW+SHSKWP
Sbjct  289  SERSLMERVRQELKHELKQGYKDKIVDIREEILRKRRAGKLPGDTTSHLKAWWRSHSKWP  348

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS-AAEKSSTE  360
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N S++++S  K+KRKS A E S+ E
Sbjct  349  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNSSTATTS--KSKRKSNAGETSNNE  406

Query  359  HF  354
             F
Sbjct  407  RF  408



>gb|KHG13359.1| Homeobox protein knotted-1-like 3 [Gossypium arboreum]
Length=483

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 111/127 (87%), Gaps = 2/127 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  323  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  382

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+ S  K+KRKS   K   + 
Sbjct  383  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVS--KSKRKSRGLKGEDQI  440

Query  356  FM*QRDR  336
                R+R
Sbjct  441  CCNMRNR  447



>ref|XP_010929108.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X2 [Elaeis 
guineensis]
Length=411

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGD+TSLLKAWWQSHSKWP
Sbjct  303  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDSTSLLKAWWQSHSKWP  362

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTE+DKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K KR
Sbjct  363  YPTEDDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTALKSKRKR  411



>ref|XP_006345637.1| PREDICTED: homeobox protein knotted-1-like 3-like [Solanum tuberosum]
Length=361

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  253  SERSLMERVRQELKHELKQGYKEKLVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  312

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKA+LVQETGLQLKQINNWFINQRKRNWH+NPSSS++   K KR
Sbjct  313  YPTEEDKAKLVQETGLQLKQINNWFINQRKRNWHSNPSSSTALKSKRKR  361



>ref|XP_009129979.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Brassica 
rapa]
Length=408

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  300  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  359

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS    +K K+
Sbjct  360  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSPVLKNKRKK  408



>dbj|BAA08552.1| OSH45 [Oryza sativa Japonica Group]
Length=375

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 106/113 (94%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LKAWWQSH+KWP
Sbjct  259  SERSLMERVRQELKHELKQGYKEKLIDIREEILRKRRAGKLPGDTTSTLKAWWQSHAKWP  318

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+S   KTKRK A 
Sbjct  319  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTSV--KTKRKRAG  369



>ref|XP_007222130.1| hypothetical protein PRUPE_ppa005712mg [Prunus persica]
 gb|EMJ23329.1| hypothetical protein PRUPE_ppa005712mg [Prunus persica]
Length=436

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  328  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  387

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  388  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  436



>ref|XP_009358509.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X1 [Pyrus 
x bretschneideri]
Length=369

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 106/113 (94%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  250  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  309

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N SS+S    K+KRKS A
Sbjct  310  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNISSTSVL--KSKRKSNA  360



>ref|XP_008802008.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X1 [Phoenix 
dactylifera]
Length=489

 Score =   199 bits (506),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLM+RVRQELKH+L+QGYKEKI DIREEI+RKRRAGKLPGDTTS LKAWWQSHSKWP
Sbjct  354  TERSLMDRVRQELKHELRQGYKEKIVDIREEILRKRRAGKLPGDTTSTLKAWWQSHSKWP  413

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSST  363
            YPTE+DKARLVQETGLQLKQINNWFINQRKRNWH NPSSSS+   K KR+ A  +S  
Sbjct  414  YPTEDDKARLVQETGLQLKQINNWFINQRKRNWHNNPSSSSTLKSKRKRRQAEVRSDV  471



>ref|XP_010491802.1| PREDICTED: homeobox protein knotted-1-like 4 isoform X2 [Camelina 
sativa]
Length=379

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  271  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  330

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S +K +R
Sbjct  331  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNKRRR  379



>gb|KDO46774.1| hypothetical protein CISIN_1g013045mg [Citrus sinensis]
Length=423

 Score =   197 bits (502),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  315  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  374

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  375  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  423



>ref|XP_007222131.1| hypothetical protein PRUPE_ppa005712mg [Prunus persica]
 gb|EMJ23330.1| hypothetical protein PRUPE_ppa005712mg [Prunus persica]
Length=439

 Score =   198 bits (503),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  328  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  387

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  388  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  436



>ref|XP_009338420.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X1 [Pyrus 
x bretschneideri]
Length=369

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 106/113 (94%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  250  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  309

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N SS+S    K+KRKS A
Sbjct  310  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNISSTSVL--KSKRKSNA  360



>ref|XP_008336944.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X1 [Malus 
domestica]
Length=368

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 106/113 (94%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  249  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  308

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N SS+S    K+KRKS A
Sbjct  309  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNISSTSVL--KSKRKSNA  359



>ref|XP_008354344.1| PREDICTED: homeobox protein knotted-1-like 6 isoform X2 [Malus 
domestica]
Length=143

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+L+QGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  35   SERSLMERVRQELKHELEQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  94

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N SS+S    K KR
Sbjct  95   YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNISSTSVLKSKRKR  143



>ref|XP_006581338.1| PREDICTED: homeobox protein knotted-1-like 3-like isoform X2 
[Glycine max]
Length=411

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  713  ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY  534
            ERSLMERVR ELKH+LKQGYK+KI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWPY
Sbjct  292  ERSLMERVRHELKHELKQGYKDKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWPY  351

Query  533  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            PTEEDKARLVQETGLQLKQINNWFINQRKRNWH++PS+S+    K KR +A   S+ ++
Sbjct  352  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHSSPSTSTVLKSKRKRSNAGLNSADQY  410



>ref|XP_006581339.1| PREDICTED: homeobox protein knotted-1-like 3-like isoform X3 
[Glycine max]
Length=410

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 109/120 (91%), Gaps = 2/120 (2%)
 Frame = -2

Query  713  ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY  534
            ERSLMERVR ELKH+LKQGYK+KI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWPY
Sbjct  292  ERSLMERVRHELKHELKQGYKDKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWPY  351

Query  533  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEHF  354
            PTEEDKARLVQETGLQLKQINNWFINQRKRNWH++PS+S+    K+KRKS A  +S + +
Sbjct  352  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHSSPSTSTVL--KSKRKSNAGLNSADQY  409



>ref|XP_010453147.1| PREDICTED: homeobox protein knotted-1-like 4 isoform X2 [Camelina 
sativa]
Length=385

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  277  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  336

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S +K +R
Sbjct  337  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNKRRR  385



>sp|O04136.1|KNAP3_MALDO RecName: Full=Homeobox protein knotted-1-like 3; AltName: Full=KNAP3 
[Malus domestica]
 emb|CAA96512.1| knotted1-like homeobox protein [Malus domestica]
Length=427

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  319  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  378

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  379  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  427



>ref|XP_006450340.1| hypothetical protein CICLE_v10008269mg [Citrus clementina]
 ref|XP_006483431.1| PREDICTED: homeobox protein knotted-1-like 3-like isoform X3 
[Citrus sinensis]
 gb|ESR63580.1| hypothetical protein CICLE_v10008269mg [Citrus clementina]
 gb|KDO46775.1| hypothetical protein CISIN_1g013045mg [Citrus sinensis]
Length=438

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  330  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  389

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  390  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  438



>ref|XP_009362329.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X4 [Pyrus 
x bretschneideri]
Length=427

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  319  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  378

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  379  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  427



>ref|XP_008378415.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Malus 
domestica]
Length=427

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  319  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  378

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  379  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  427



>ref|XP_003544602.1| PREDICTED: homeobox protein knotted-1-like 3-like isoform X1 
[Glycine max]
Length=407

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  299  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  358

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  359  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  407



>ref|XP_010419662.1| PREDICTED: homeobox protein knotted-1-like 4 isoform X2 [Camelina 
sativa]
Length=385

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  277  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  336

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+ S +K +R
Sbjct  337  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNKRRR  385



>ref|NP_001281052.1| homeobox protein knotted-1-like 3 [Malus domestica]
 gb|ADL36720.1| HD domain class transcription factor [Malus domestica]
Length=371

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 106/113 (94%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  252  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  311

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N SS+S    K+KRKS A
Sbjct  312  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNISSTSVL--KSKRKSNA  362



>ref|XP_011039619.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X3 [Populus 
euphratica]
Length=422

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTT++LKAWWQSHSKWP
Sbjct  314  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTTVLKAWWQSHSKWP  373

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPSSS+    K KR
Sbjct  374  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKSKRKR  422



>ref|XP_006578127.1| PREDICTED: homeobox protein knotted-1-like 3-like isoform X2 
[Glycine max]
Length=413

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  713  ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY  534
            ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWPY
Sbjct  303  ERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWPY  362

Query  533  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS  384
            PTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S++   K KR S
Sbjct  363  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTALKSKRKRYS  412



>gb|KCW81341.1| hypothetical protein EUGRSUZ_C02727 [Eucalyptus grandis]
Length=426

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK WWQ+HSKWP
Sbjct  315  TERSLMERVRQELKHELKQGYKEKIIDIREEILRKRRAGKLPGDTTSVLKQWWQTHSKWP  374

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSA  381
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR  A
Sbjct  375  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRGRA  426



>ref|XP_009362328.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X3 [Pyrus 
x bretschneideri]
Length=438

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  330  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  389

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  390  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  438



>ref|XP_011078583.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X2 [Sesamum 
indicum]
Length=385

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/97 (95%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  277  TERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  336

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNP  426
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP
Sbjct  337  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNP  373



>ref|XP_008788775.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X2 [Phoenix 
dactylifera]
Length=460

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQ+HSKWP
Sbjct  352  TERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQAHSKWP  411

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTE+DKARLV+ETGLQLKQINNWFINQRKRNWH+NPSSSS+   K KR
Sbjct  412  YPTEDDKARLVEETGLQLKQINNWFINQRKRNWHSNPSSSSALKSKRKR  460



>ref|XP_006473944.1| PREDICTED: homeobox protein knotted-1-like LET12-like isoform 
X1 [Citrus sinensis]
Length=343

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 105/111 (95%), Gaps = 2/111 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  223  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  282

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS  384
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K+KRKS
Sbjct  283  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTAS--KSKRKS  331



>ref|XP_010099875.1| Homeobox protein knotted-1-like 3 [Morus notabilis]
 gb|EXB80752.1| Homeobox protein knotted-1-like 3 [Morus notabilis]
Length=442

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQ+HSKWP
Sbjct  334  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQTHSKWP  393

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  394  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  442



>ref|XP_004244941.1| PREDICTED: homeobox protein knotted-1-like 3 [Solanum lycopersicum]
Length=349

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  241  SERSLMERVRQELKHELKQGYKEKLVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  300

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKA+LV+ETGLQLKQINNWFINQRKRNWH+NPSSS++   K KR
Sbjct  301  YPTEEDKAKLVEETGLQLKQINNWFINQRKRNWHSNPSSSTALKSKRKR  349



>gb|KJB55054.1| hypothetical protein B456_009G060200 [Gossypium raimondii]
 gb|KJB55055.1| hypothetical protein B456_009G060200 [Gossypium raimondii]
Length=425

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  317  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  376

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKA+LVQETGLQLKQINNWFINQRKRNWH+NPS+S+   +K K+
Sbjct  377  YPTEEDKAKLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKNKRKK  425



>ref|XP_010048923.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Eucalyptus 
grandis]
 gb|KCW81343.1| hypothetical protein EUGRSUZ_C02727 [Eucalyptus grandis]
Length=423

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK WWQ+HSKWP
Sbjct  315  TERSLMERVRQELKHELKQGYKEKIIDIREEILRKRRAGKLPGDTTSVLKQWWQTHSKWP  374

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  375  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  423



>gb|AHX00581.1| class II knox protein [Solanum tuberosum]
Length=426

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  312  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  371

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNP  426
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP
Sbjct  372  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNP  408



>ref|XP_006359533.1| PREDICTED: homeobox protein knotted-1-like LET12-like [Solanum 
tuberosum]
Length=425

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  311  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  370

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNP  426
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP
Sbjct  371  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNP  407



>gb|KEH32161.1| class II knotted-like homeobox protein [Medicago truncatula]
Length=341

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVR ELKH+LKQGYKEKI D+REEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  223  TERSLMERVRLELKHELKQGYKEKIVDVREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  282

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTN  429
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH N
Sbjct  283  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHAN  318



>gb|KDO59337.1| hypothetical protein CISIN_1g019151mg [Citrus sinensis]
Length=345

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 105/111 (95%), Gaps = 2/111 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  225  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  284

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS  384
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K+KRKS
Sbjct  285  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTAS--KSKRKS  333



>gb|AEW69803.1| Hop-interacting protein THI041 [Solanum lycopersicum]
Length=430

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  316  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  375

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNP  426
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP
Sbjct  376  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNP  412



>ref|XP_006600707.1| PREDICTED: homeobox protein knotted-1-like LET12-like isoform 
X2 [Glycine max]
Length=345

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  225  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  284

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTN  SSSS+S   ++ SA E +S + 
Sbjct  285  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNNPSSSSNSKSKRKSSAGE-ASNQS  343

Query  356  FM  351
            FM
Sbjct  344  FM  345



>ref|XP_010323157.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X1 [Solanum 
lycopersicum]
Length=431

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  317  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  376

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNP  426
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP
Sbjct  377  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNP  413



>ref|XP_009366123.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Pyrus 
x bretschneideri]
Length=359

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  251  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  310

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTN SS+S    K KR
Sbjct  311  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNISSTSVLKSKRKR  359



>ref|XP_009341802.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009341836.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Pyrus 
x bretschneideri]
Length=360

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  252  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  311

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTN SS+S    K KR
Sbjct  312  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNISSTSVLKSKRKR  360



>ref|XP_003522507.1| PREDICTED: homeobox protein knotted-1-like 3-like isoform X1 
[Glycine max]
Length=411

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  713  ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY  534
            ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWPY
Sbjct  303  ERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWPY  362

Query  533  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            PTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S++   K KR 
Sbjct  363  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTALKSKRKRS  411



>gb|KJB06460.1| hypothetical protein B456_001G035700 [Gossypium raimondii]
 gb|KJB06461.1| hypothetical protein B456_001G035700 [Gossypium raimondii]
 gb|KJB06463.1| hypothetical protein B456_001G035700 [Gossypium raimondii]
 gb|KJB06466.1| hypothetical protein B456_001G035700 [Gossypium raimondii]
Length=436

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  328  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  387

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+ S  K KR
Sbjct  388  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVSKSKRKR  436



>gb|KDP30176.1| hypothetical protein JCGZ_16958 [Jatropha curcas]
Length=351

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 103/113 (91%), Gaps = 3/113 (3%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLME VR+ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  231  TERSLMEHVRKELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  290

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N S ++    K+KRK  A
Sbjct  291  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNSSGATL---KSKRKKQA  340



>ref|XP_006453706.1| hypothetical protein CICLE_v10008821mg [Citrus clementina]
 gb|ESR66946.1| hypothetical protein CICLE_v10008821mg [Citrus clementina]
Length=345

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 105/111 (95%), Gaps = 2/111 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  225  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  284

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS  384
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K+KRKS
Sbjct  285  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTAS--KSKRKS  333



>ref|XP_009408038.1| PREDICTED: homeobox protein knotted-1-like 13 [Musa acuminata 
subsp. malaccensis]
Length=452

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGD+TS LKAWWQSHSKWP
Sbjct  344  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDSTSTLKAWWQSHSKWP  403

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTE+DKARLVQETGLQLKQINNWFINQRKRNWH+NPSSSS+   K KR
Sbjct  404  YPTEDDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSSTMKSKRKR  452



>ref|XP_006594231.1| PREDICTED: homeobox protein knotted-1-like LET12-like isoform 
X2 [Glycine max]
Length=346

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  226  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  285

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTN  SSSS+S   ++ SA E +S + 
Sbjct  286  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNNPSSSSNSKSKRKSSAGE-TSNQS  344

Query  356  FM  351
            FM
Sbjct  345  FM  346



>ref|XP_008362878.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X1 [Malus 
domestica]
Length=371

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 106/113 (94%), Gaps = 2/113 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+L+QGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  252  SERSLMERVRQELKHELEQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  311

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAA  378
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N SS+S    K+KRKS A
Sbjct  312  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNISSTSVL--KSKRKSNA  362



>ref|XP_006473946.1| PREDICTED: homeobox protein knotted-1-like LET12-like isoform 
X3 [Citrus sinensis]
Length=331

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  223  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  282

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K KR
Sbjct  283  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTASKSKRKR  331



>gb|KHG09462.1| Homeobox protein knotted-1-like 4 [Gossypium arboreum]
Length=290

 Score =   192 bits (487),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLME VRQELKH+LKQGYKEKI D+REEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  184  TERSLMEHVRQELKHELKQGYKEKIVDVREEILRKRRAGKLPGDTTSILKAWWQSHSKWP  243

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNP  426
            YPTEEDKARL QETGLQLKQINNWFINQRKRNWH  P
Sbjct  244  YPTEEDKARLAQETGLQLKQINNWFINQRKRNWHNTP  280



>ref|XP_007136984.1| hypothetical protein PHAVU_009G090500g [Phaseolus vulgaris]
 gb|ESW08978.1| hypothetical protein PHAVU_009G090500g [Phaseolus vulgaris]
Length=416

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  713  ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY  534
            ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWPY
Sbjct  309  ERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWPY  368

Query  533  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            PTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  369  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  416



>gb|KHN18594.1| Homeobox protein knotted-1-like 4 [Glycine soja]
Length=328

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  208  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  267

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSSTEH  357
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTN  SSSS+S   ++ SA E +S + 
Sbjct  268  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNNPSSSSNSKSKRKSSAGE-ASNQS  326

Query  356  FM  351
            FM
Sbjct  327  FM  328



>ref|XP_003549704.1| PREDICTED: homeobox protein knotted-1-like LET12-like isoform 
X1 [Glycine max]
Length=344

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  225  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  284

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHT  432
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHT
Sbjct  285  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHT  319



>ref|XP_004287231.1| PREDICTED: homeobox protein knotted-1-like 3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=324

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQ+HSKWP
Sbjct  216  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQTHSKWP  275

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N S++S    K KR
Sbjct  276  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNLSTTSVLKSKRKR  324



>ref|XP_007202255.1| hypothetical protein PRUPE_ppa007698mg [Prunus persica]
 gb|EMJ03454.1| hypothetical protein PRUPE_ppa007698mg [Prunus persica]
Length=358

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  250  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  309

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N SS+S    K KR
Sbjct  310  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNISSTSVLKSKRKR  358



>ref|XP_009358510.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X2 [Pyrus 
x bretschneideri]
Length=358

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  250  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  309

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N SS+S    K KR
Sbjct  310  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNISSTSVLKSKRKR  358



>ref|XP_008336945.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X2 [Malus 
domestica]
Length=357

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  249  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  308

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N SS+S    K KR
Sbjct  309  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNISSTSVLKSKRKR  357



>gb|ABZ10962.1| class 1 knox protein [Kalanchoe x houghtonii]
Length=412

 Score =   195 bits (496),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 110/118 (93%), Gaps = 2/118 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYK+KI DIREEI+RKRRAGKLPGDTTS LKAWW+SHSKWP
Sbjct  291  SERSLMERVRQELKHELKQGYKDKIVDIREEILRKRRAGKLPGDTTSHLKAWWRSHSKWP  350

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKSAAEKSST  363
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N S++++S  K+KRKS A  +S+
Sbjct  351  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNSSTATAS--KSKRKSNAGTTSS  406



>emb|CDP18801.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK WWQSHSKWP
Sbjct  273  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKDWWQSHSKWP  332

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS S++   K KR
Sbjct  333  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSPSTALKSKRKR  381



>ref|XP_009338421.1| PREDICTED: homeobox protein knotted-1-like LET12 isoform X2 [Pyrus 
x bretschneideri]
Length=358

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  250  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  309

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N SS+S    K KR
Sbjct  310  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNISSTSVLKSKRKR  358



>gb|KDO59341.1| hypothetical protein CISIN_1g019151mg [Citrus sinensis]
 gb|KDO59342.1| hypothetical protein CISIN_1g019151mg [Citrus sinensis]
Length=333

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  225  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  284

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K KR
Sbjct  285  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTASKSKRKR  333



>ref|XP_003542625.1| PREDICTED: homeobox protein knotted-1-like LET12-like isoform 
X1 [Glycine max]
Length=345

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  226  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  285

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHT  432
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHT
Sbjct  286  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHT  320



>ref|XP_006453707.1| hypothetical protein CICLE_v10008821mg [Citrus clementina]
 gb|ESR66947.1| hypothetical protein CICLE_v10008821mg [Citrus clementina]
Length=333

 Score =   192 bits (489),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTSLLKAWW SH+KWP
Sbjct  225  SERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWP  284

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH NPSSS++S  K KR
Sbjct  285  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTASKSKRKR  333



>gb|KEH39852.1| class II knotted-like homeobox protein [Medicago truncatula]
Length=439

 Score =   196 bits (497),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = -2

Query  713  ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY  534
            ERSLMERVRQELKH+LK GYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWPY
Sbjct  329  ERSLMERVRQELKHELKHGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWPY  388

Query  533  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            PTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NPS+S+    K KR 
Sbjct  389  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRS  437



>ref|XP_008242898.1| PREDICTED: homeobox protein knotted-1-like 4 isoform X2 [Prunus 
mume]
Length=358

 Score =   193 bits (491),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  250  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  309

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N SS+S    K KR
Sbjct  310  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNISSTSVLKSKRKR  358



>gb|ADX60161.1| ORPHAN transcription factor [Zea mays]
Length=171

 Score =   187 bits (476),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 102/109 (94%), Gaps = 3/109 (3%)
 Frame = -2

Query  713  ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY  534
            ERSL+ERVRQELK++LKQGYKEK+ DIREEIMRKRRAGKLPGDT S+LKAWWQ+HSKWPY
Sbjct  65   ERSLVERVRQELKNELKQGYKEKLVDIREEIMRKRRAGKLPGDTASVLKAWWQAHSKWPY  124

Query  533  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            PTE+DKARLVQETGLQLKQINNWFINQRKRNWH+NP   +SS  KTK+K
Sbjct  125  PTEDDKARLVQETGLQLKQINNWFINQRKRNWHSNP---TSSGEKTKKK  170



>ref|NP_001233945.1| homeobox protein knotted-1-like LET12 [Solanum lycopersicum]
 sp|O22300.1|LET12_SOLLC RecName: Full=Homeobox protein knotted-1-like LET12 [Solanum 
lycopersicum]
 gb|AAC49918.1| class II knotted-like homeodomain protein [Solanum lycopersicum]
Length=426

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  316  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  375

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNP  426
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP
Sbjct  376  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNP  412



>gb|ADD14043.1| class 2 KNOTTED-like transcription factor KNOPE4 [Prunus persica]
Length=358

 Score =   193 bits (491),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  250  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  309

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N SS+S    K KR
Sbjct  310  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNISSTSVLKGKRKR  358



>gb|KEH32160.1| class II knotted-like homeobox protein [Medicago truncatula]
Length=331

 Score =   192 bits (489),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 103/110 (94%), Gaps = 2/110 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVR ELKH+LKQGYKEKI D+REEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  223  TERSLMERVRLELKHELKQGYKEKIVDVREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  282

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH N  S SSSS KTKRK
Sbjct  283  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHAN--SPSSSSSKTKRK  330



>ref|NP_001281051.1| homeobox protein knotted-1-like 3 [Malus domestica]
 gb|ADL36705.1| HD domain class transcription factor [Malus domestica]
Length=437

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEIMRKRRAGKLPG+TTS+LKAWWQSHSKWP
Sbjct  329  SERSLMERVRQELKHELKQGYKEKIVDIREEIMRKRRAGKLPGNTTSVLKAWWQSHSKWP  388

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGL LKQINNWFINQRKRNWH+NPS+S+    K KR
Sbjct  389  YPTEEDKARLVQETGLHLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR  437



>ref|XP_008445246.1| PREDICTED: LOW QUALITY PROTEIN: homeobox protein knotted-1-like 
3 [Cucumis melo]
Length=451

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 2/110 (2%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVR ELKH+LK GYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct  343  SERSLMERVRHELKHELKNGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP  402

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTEEDKA+LVQETGLQLKQINNWFINQRKRNWHTNPS+S++   KTKRK
Sbjct  403  YPTEEDKAKLVQETGLQLKQINNWFINQRKRNWHTNPSTSTNL--KTKRK  450



>ref|XP_004498767.1| PREDICTED: homeobox protein knotted-1-like 3-like isoform X2 
[Cicer arietinum]
Length=441

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 103/110 (94%), Gaps = 2/110 (2%)
 Frame = -2

Query  713  ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY  534
            ERSLMERVRQELKH+LK GYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWPY
Sbjct  333  ERSLMERVRQELKHELKHGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWPY  392

Query  533  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRKS  384
            PTEEDK RLVQETGLQLKQINNWFINQRKRNWHTNPS+S+    K+KRKS
Sbjct  393  PTEEDKTRLVQETGLQLKQINNWFINQRKRNWHTNPSTSTVL--KSKRKS  440



>ref|XP_008788774.1| PREDICTED: homeobox protein knotted-1-like 13 isoform X1 [Phoenix 
dactylifera]
Length=464

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQ+HSKWP
Sbjct  352  TERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQAHSKWP  411

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNP  426
            YPTE+DKARLV+ETGLQLKQINNWFINQRKRNWH+NP
Sbjct  412  YPTEDDKARLVEETGLQLKQINNWFINQRKRNWHSNP  448



>ref|XP_003609525.1| Homeobox protein knotted-1-like protein [Medicago truncatula]
Length=332

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            TERSLMERVR ELKH+LKQGYKEKI D+REEI+RKRRAGKLPGDTTSLLKAWWQSHSKWP
Sbjct  223  TERSLMERVRLELKHELKQGYKEKIVDVREEILRKRRAGKLPGDTTSLLKAWWQSHSKWP  282

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTN  429
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH N
Sbjct  283  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHAN  318



>ref|XP_009125260.1| PREDICTED: homeobox protein knotted-1-like 4 isoform X2 [Brassica 
rapa]
Length=383

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRR+GKLPGDTTS+LKAWWQSHSKWP
Sbjct  275  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRSGKLPGDTTSVLKAWWQSHSKWP  334

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDK RLVQETGLQLKQINNWFINQRKRNWH+NPSSS+   +K +R
Sbjct  335  YPTEEDKVRLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVPKNKRRR  383



>ref|XP_010913371.1| PREDICTED: homeobox protein knotted-1-like 11 isoform X1 [Elaeis 
guineensis]
Length=490

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLM+RVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS LKAWWQSHSKWP
Sbjct  341  SERSLMDRVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSTLKAWWQSHSKWP  400

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKRK  387
            YPTE+DKARLVQETGLQLKQINNWFINQRKRNWH NPSSSS+   K KR+
Sbjct  401  YPTEDDKARLVQETGLQLKQINNWFINQRKRNWHNNPSSSSALKSKRKRE  450



>gb|ABO26062.1| KNOPE4 [Prunus persica]
Length=417

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP  537
            +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct  309  SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP  368

Query  536  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPssssssSHKTKR  390
            YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+N SS+S    K KR
Sbjct  369  YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNISSTSVLKGKRKR  417



>ref|XP_006656302.1| PREDICTED: homeobox protein knotted-1-like 11-like isoform X1 
[Oryza brachyantha]
Length=206

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  713  ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY  534
            ERSL+ERVRQELKH+LKQGY+EK+ DIREEI+RKRRAGKLPGDT S LKAWWQ+HSKWPY
Sbjct  88   ERSLVERVRQELKHELKQGYREKLVDIREEILRKRRAGKLPGDTASTLKAWWQAHSKWPY  147

Query  533  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNP  426
            PTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP
Sbjct  148  PTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNP  183



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410