BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF042G19

Length=604
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB77571.1|  hypothetical protein B456_012G144100                  72.0    3e-11   Gossypium raimondii
gb|KJB77575.1|  hypothetical protein B456_012G144500                  71.2    6e-11   Gossypium raimondii
gb|KJB77573.1|  hypothetical protein B456_012G144300                  69.7    2e-10   Gossypium raimondii
ref|XP_010065736.1|  PREDICTED: L-type lectin-domain containing r...  61.6    8e-08   Eucalyptus grandis [rose gum]
gb|KCW63379.1|  hypothetical protein EUGRSUZ_G01018                   60.1    2e-07   Eucalyptus grandis [rose gum]
gb|KCW63373.1|  hypothetical protein EUGRSUZ_G01009                   59.7    3e-07   Eucalyptus grandis [rose gum]
gb|KEH24603.1|  lectin receptor kinase                                58.9    5e-07   Medicago truncatula
ref|XP_010068305.1|  PREDICTED: L-type lectin-domain containing r...  58.2    1e-06   Eucalyptus grandis [rose gum]
gb|KCW63380.1|  hypothetical protein EUGRSUZ_G01019                   57.4    2e-06   Eucalyptus grandis [rose gum]
ref|XP_010068309.1|  PREDICTED: L-type lectin-domain containing r...  57.4    2e-06   
ref|XP_006596640.1|  PREDICTED: L-type lectin-domain containing r...  57.0    2e-06   Glycine max [soybeans]
gb|KHN04262.1|  L-type lectin-domain containing receptor kinase IX.1  57.0    2e-06   Glycine soja [wild soybean]
gb|KCW63366.1|  hypothetical protein EUGRSUZ_G01001                   57.0    2e-06   Eucalyptus grandis [rose gum]
gb|KJB77581.1|  hypothetical protein B456_012G145000                  56.6    3e-06   Gossypium raimondii
gb|KCW76069.1|  hypothetical protein EUGRSUZ_D00437                   56.2    5e-06   Eucalyptus grandis [rose gum]
ref|XP_010052163.1|  PREDICTED: L-type lectin-domain containing r...  55.8    5e-06   Eucalyptus grandis [rose gum]
emb|CBI35556.3|  unnamed protein product                              55.8    6e-06   Vitis vinifera
gb|KCW63374.1|  hypothetical protein EUGRSUZ_G01010                   55.5    6e-06   Eucalyptus grandis [rose gum]
ref|XP_010068306.1|  PREDICTED: L-type lectin-domain containing r...  55.5    8e-06   Eucalyptus grandis [rose gum]
gb|KJB77579.1|  hypothetical protein B456_012G144800                  55.1    9e-06   Gossypium raimondii
emb|CAN76415.1|  hypothetical protein VITISV_038497                   55.1    1e-05   Vitis vinifera
ref|XP_010054301.1|  PREDICTED: L-type lectin-domain containing r...  55.1    1e-05   Eucalyptus grandis [rose gum]
ref|XP_010648053.1|  PREDICTED: seed lectin-like                      54.7    1e-05   Vitis vinifera
gb|KCW63372.1|  hypothetical protein EUGRSUZ_G01008                   54.7    1e-05   Eucalyptus grandis [rose gum]
ref|XP_010065734.1|  PREDICTED: L-type lectin-domain containing r...  53.9    3e-05   Eucalyptus grandis [rose gum]
gb|KCW63376.1|  hypothetical protein EUGRSUZ_G01015                   53.5    3e-05   Eucalyptus grandis [rose gum]
gb|KJB77580.1|  hypothetical protein B456_012G144900                  53.5    3e-05   Gossypium raimondii
ref|XP_009412463.1|  PREDICTED: L-type lectin-domain containing r...  53.5    4e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW63375.1|  hypothetical protein EUGRSUZ_G01011                   53.1    4e-05   Eucalyptus grandis [rose gum]
ref|XP_002264871.2|  PREDICTED: L-type lectin-domain containing r...  53.1    5e-05   Vitis vinifera
ref|XP_010040314.1|  PREDICTED: L-type lectin-domain containing r...  53.1    5e-05   Eucalyptus grandis [rose gum]
ref|XP_011073633.1|  PREDICTED: L-type lectin-domain containing r...  52.8    6e-05   
ref|XP_002262748.2|  PREDICTED: L-type lectin-domain containing r...  52.8    6e-05   Vitis vinifera
gb|KCW76080.1|  hypothetical protein EUGRSUZ_D00455                   52.0    7e-05   Eucalyptus grandis [rose gum]
ref|XP_011073632.1|  PREDICTED: L-type lectin-domain containing r...  52.4    9e-05   
gb|EYU18390.1|  hypothetical protein MIMGU_mgv1a022756mg              52.4    9e-05   Erythranthe guttata [common monkey flower]
ref|XP_010689175.1|  PREDICTED: L-type lectin-domain containing r...  52.0    1e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009589837.1|  PREDICTED: L-type lectin-domain containing r...  52.0    1e-04   
emb|CAN64986.1|  hypothetical protein VITISV_035640                   52.0    1e-04   Vitis vinifera
ref|XP_007159169.1|  hypothetical protein PHAVU_002G214900g           52.0    1e-04   Phaseolus vulgaris [French bean]
dbj|BAJ90155.1|  predicted protein                                    51.6    2e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008777395.1|  PREDICTED: L-type lectin-domain containing r...  51.6    2e-04   
ref|XP_008777396.1|  PREDICTED: L-type lectin-domain containing r...  51.2    2e-04   
gb|EYU18391.1|  hypothetical protein MIMGU_mgv1a022316mg              51.2    2e-04   Erythranthe guttata [common monkey flower]
ref|XP_010090631.1|  L-type lectin-domain containing receptor kin...  51.2    2e-04   Morus notabilis
gb|EYU18392.1|  hypothetical protein MIMGU_mgv1a002656mg              50.8    2e-04   Erythranthe guttata [common monkey flower]
ref|XP_010905482.1|  PREDICTED: L-type lectin-domain containing r...  50.8    2e-04   
ref|XP_010096782.1|  L-type lectin-domain containing receptor kin...  50.8    2e-04   
gb|KJB77582.1|  hypothetical protein B456_012G145100                  50.8    3e-04   Gossypium raimondii
ref|NP_001060894.1|  Os08g0125200                                     50.8    3e-04   
ref|XP_010068308.1|  PREDICTED: L-type lectin-domain containing r...  50.8    3e-04   
ref|XP_009781157.1|  PREDICTED: L-type lectin-domain containing r...  50.8    3e-04   Nicotiana sylvestris
ref|XP_008365117.1|  PREDICTED: L-type lectin-domain containing r...  50.4    3e-04   
dbj|BAJ86458.1|  predicted protein                                    50.4    4e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ05441.1|  hypothetical protein OsI_27655                        50.4    4e-04   Oryza sativa Indica Group [Indian rice]
ref|NP_001060891.1|  Os08g0124500                                     50.4    4e-04   
ref|XP_003631707.1|  PREDICTED: L-type lectin-domain containing r...  50.4    4e-04   Vitis vinifera
ref|XP_011459854.1|  PREDICTED: probable L-type lectin-domain con...  50.1    4e-04   Fragaria vesca subsp. vesca
ref|XP_003541778.2|  PREDICTED: L-type lectin-domain containing r...  50.1    5e-04   
gb|EEE67085.1|  hypothetical protein OsJ_24069                        47.0    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002310341.1|  hypothetical protein POPTR_0007s15010g           49.7    6e-04   
ref|XP_004494968.1|  PREDICTED: L-type lectin-domain containing r...  49.7    6e-04   Cicer arietinum [garbanzo]
ref|XP_010054304.1|  PREDICTED: L-type lectin-domain containing r...  49.7    7e-04   Eucalyptus grandis [rose gum]
ref|XP_010054312.1|  PREDICTED: L-type lectin-domain containing r...  49.7    7e-04   Eucalyptus grandis [rose gum]
gb|KCW76070.1|  hypothetical protein EUGRSUZ_D00438                   49.7    7e-04   Eucalyptus grandis [rose gum]
ref|XP_010905484.1|  PREDICTED: L-type lectin-domain containing r...  49.3    8e-04   
ref|XP_007159171.1|  hypothetical protein PHAVU_002G2150000g          49.3    8e-04   Phaseolus vulgaris [French bean]
ref|XP_010052167.1|  PREDICTED: anti-H(O) lectin 1-like               48.9    0.001   
ref|XP_010905481.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...  49.3    0.001   
emb|CBI25097.3|  unnamed protein product                              48.9    0.001   Vitis vinifera



>gb|KJB77571.1| hypothetical protein B456_012G144100 [Gossypium raimondii]
Length=660

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 19/120 (16%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDST-----------SPPNTAPPREAKKK----  460
            YL E V FGFS  TGS +E HT+ SW F ST           +PP T+PP   K+K    
Sbjct  246  YLPEWVTFGFSGTTGSCYELHTIYSWNFSSTLQVVTPTNTTINPPATSPPANPKRKSRTW  305

Query  459  -WNIGKVIGLCSVVLVIFGKCAVIYVVCEKRRRSKKNDNNVITLGGKVKLTTPQESTLEE  283
             W +  +IG  S  L++ G   +++  C +R  S+K D  +     +  +T P++ + +E
Sbjct  306  LWVVLAIIGAISASLLVLG---LVWFYCRRRNYSRKEDGTMSVNVNREMVTAPRKFSYKE  362



>gb|KJB77575.1| hypothetical protein B456_012G144500, partial [Gossypium raimondii]
Length=641

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 39/120 (33%), Positives = 61/120 (51%), Gaps = 19/120 (16%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDST-----------SPPNTAPPREAKKK----  460
            YL E V FGFS  TGS++E HT+ SW F ST           +PP T+PP   K+K    
Sbjct  228  YLPEWVTFGFSGTTGSYYELHTIYSWNFSSTLQVVMPTNTTINPPATSPPANPKRKSRTW  287

Query  459  -WNIGKVIGLCSVVLVIFGKCAVIYVVCEKRRRSKKNDNNVITLGGKVKLTTPQESTLEE  283
             W +  +IG  S  L++ G   +++  C +   S+K D  +     +  +T P++ + +E
Sbjct  288  LWVVLAIIGAISASLLVLG---LVWFYCRRGDDSRKEDGTMSVNVNREMVTAPRKFSYKE  344



>gb|KJB77573.1| hypothetical protein B456_012G144300, partial [Gossypium raimondii]
Length=617

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 19/120 (16%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDST-----------SPPNTAPPREAKKK----  460
            YL E V FGFS  TGS FE HT+ SW F ST           +PP T+PP   K+K    
Sbjct  195  YLPEWVTFGFSGTTGSCFELHTIYSWNFSSTLQVVMPTNTTINPPETSPPANPKRKSRTW  254

Query  459  -WNIGKVIGLCSVVLVIFGKCAVIYVVCEKRRRSKKNDNNVITLGGKVKLTTPQESTLEE  283
             W +  +IG  S  L++ G   +++  C +   S+K D  +     +  +T P++ + +E
Sbjct  255  LWVVLAIIGAISASLLVLG---LVWFYCRRGDYSRKEDGTMSVNVNREMVTAPRKFSYKE  311



>ref|XP_010065736.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
 ref|XP_010065737.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
 ref|XP_010065738.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=717

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 42/77 (55%), Gaps = 13/77 (17%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDST-------------SPPNTAPPREAKKK  460
            R YL E V FGFSA TG  FE HT+ SW+F+S+             +P +T    +  K 
Sbjct  244  REYLPEWVVFGFSATTGQLFEAHTIFSWEFNSSLQILDDVNGTTNVTPVDTPTRGKKSKS  303

Query  459  WNIGKVIGLCSVVLVIF  409
            W  G ++GL S+VL+I 
Sbjct  304  WVKGAILGLSSLVLIIL  320



>gb|KCW63379.1| hypothetical protein EUGRSUZ_G01018 [Eucalyptus grandis]
Length=514

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 49/96 (51%), Gaps = 13/96 (14%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDST-------------SPPNTAPPREAKKK  460
            R YL E V FGFSA TG  FE HT+ SW+F+S+             +P +T    +  K 
Sbjct  46   REYLPEWVVFGFSATTGQLFEAHTIFSWEFNSSLQILDDVNGTTNVTPVDTPTRGKKSKS  105

Query  459  WNIGKVIGLCSVVLVIFGKCAVIYVVCEKRRRSKKN  352
            W  G ++GL S+VL+I       Y    KR R+ ++
Sbjct  106  WVKGAILGLSSLVLIILVPGFGWYGYKLKRNRNDRS  141



>gb|KCW63373.1| hypothetical protein EUGRSUZ_G01009 [Eucalyptus grandis]
Length=679

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 41/75 (55%), Gaps = 13/75 (17%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDS-----------TSPPNTAPPREAK--KKWN  454
            YL E V FGFSAATG  FE HT+ SW+F+S           T+      PR+ K  K W 
Sbjct  228  YLPEWVVFGFSAATGQLFEAHTIFSWEFNSSLRILDNVNGTTNATTIDTPRQGKKSKSWV  287

Query  453  IGKVIGLCSVVLVIF  409
             G ++GL S+V +I 
Sbjct  288  KGAILGLSSLVFLIL  302



>gb|KEH24603.1| lectin receptor kinase [Medicago truncatula]
Length=668

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 56/107 (52%), Gaps = 25/107 (23%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDS---------TSPPNTAP-----PREAKK  463
            R YL E+V FGFSAATG  FE +T++SW F+S         +SP +T P     P   K 
Sbjct  227  RDYLPERVIFGFSAATGLMFEMNTIKSWSFNSSLEIQDDKLSSPISTTPSPSPIPNSLKI  286

Query  462  KWN-------IGKVIGLCSVVLVIFGKCAVIYVVCEKRRRSKKNDNN  343
              N       +G  +G+ S+ L++   C +++    KR + KK D+N
Sbjct  287  SSNKRTVWAGLGVGVGIASIFLILGCFCFLMW----KRAKEKKEDSN  329



>ref|XP_010068305.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=710

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 40/75 (53%), Gaps = 13/75 (17%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDST-------------SPPNTAPPREAKKKWN  454
            YL E V FGFSA TG  FE HT+ SW+F+S+             +P NT    +  K W 
Sbjct  241  YLPEWVVFGFSATTGDSFEAHTIFSWEFNSSLQILDNVNGTTNVTPVNTPTRGKKNKSWV  300

Query  453  IGKVIGLCSVVLVIF  409
             G ++GL S+V +I 
Sbjct  301  KGAILGLSSLVFLIL  315



>gb|KCW63380.1| hypothetical protein EUGRSUZ_G01019 [Eucalyptus grandis]
Length=664

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLV  415
            YL E V FGFSA+TG   E HT+ SW+F+S+      P  +  K W  G ++GL  +VL+
Sbjct  225  YLPEWVVFGFSASTGQSLEAHTILSWKFNSSLQILDTPSGQKIKSWARGVILGLSPLVLL  284

Query  414  IF  409
            I 
Sbjct  285  IL  286



>ref|XP_010068309.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=596

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLV  415
            YL E V FGFSA+TG   E HT+ SW+F+S+      P  +  K W  G ++GL  +VL+
Sbjct  157  YLPEWVVFGFSASTGQSLEAHTILSWKFNSSLQILDTPSGQKIKSWARGVILGLSPLVLL  216

Query  414  IF  409
            I 
Sbjct  217  IL  218



>ref|XP_006596640.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Glycine max]
Length=655

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = -2

Query  591  LSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGL-CSVVLV  415
            L E V  GFSAATG + E++ + SW+F ST    TA  R   +K N+  ++ + CS VLV
Sbjct  225  LPEWVVVGFSAATGQYTERNIIHSWEFSSTLNSFTA-SRHGNEKHNVLLIVVVTCSTVLV  283

Query  414  IFGKCAVIYVVCEKRRRSKKNDNN  343
            +       +V   KRR+ K +++N
Sbjct  284  VVAASFAAWVTITKRRKGKVDNDN  307



>gb|KHN04262.1| L-type lectin-domain containing receptor kinase IX.1 [Glycine 
soja]
Length=655

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = -2

Query  591  LSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGL-CSVVLV  415
            L E V  GFSAATG + E++ + SW+F ST    TA  R   +K N+  ++ + CS VLV
Sbjct  225  LPEWVVVGFSAATGQYTERNIIHSWEFSSTLNSFTA-SRHGNEKHNVLLIVVVTCSTVLV  283

Query  414  IFGKCAVIYVVCEKRRRSKKNDNN  343
            +       +V   KRR+ K +++N
Sbjct  284  VVAASFAAWVTITKRRKGKVDNDN  307



>gb|KCW63366.1| hypothetical protein EUGRSUZ_G01001 [Eucalyptus grandis]
Length=601

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 46/93 (49%), Gaps = 13/93 (14%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDST-------------SPPNTAPPREAKKKWN  454
            YL E V FGFSA TG  FE HT+ SW+F+S+             +P NT    +  K W 
Sbjct  158  YLPEWVVFGFSATTGDSFEAHTIFSWEFNSSLQILDNVNGTTNVTPVNTPTRGKKNKSWV  217

Query  453  IGKVIGLCSVVLVIFGKCAVIYVVCEKRRRSKK  355
             G ++GL S+V +I       Y    KR ++ +
Sbjct  218  KGAILGLSSLVFLILVAGFGWYAYKLKRNKNDR  250



>gb|KJB77581.1| hypothetical protein B456_012G145000, partial [Gossypium raimondii]
Length=626

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 15/121 (12%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDST---------SPPNTAP-----PREAKKKW  457
            YL E V FGFS ATGS  E HT+ SW F S          +PPN AP     P+   K W
Sbjct  256  YLPEWVTFGFSGATGSSIELHTIYSWSFSSNLQVSTNKTINPPNVAPGPPINPKRKSKTW  315

Query  456  NIGKVIGLCSVVLVIFGKCAVIYVVCEKRRRSKKNDNNVITLGGKVKLTTPQESTLEES*  277
             +  V+ +   +  +    +++++ C +R+  +  ++  +++   V++ T   S L E  
Sbjct  316  -LWVVLAIAGGISALLPVLSLVWLFCRRRKYRRMREDGTMSVNVDVEMMTALGSLLGEGG  374

Query  276  F  274
            F
Sbjct  375  F  375



>gb|KCW76069.1| hypothetical protein EUGRSUZ_D00437 [Eucalyptus grandis]
Length=663

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 42/78 (54%), Gaps = 5/78 (6%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLV  415
            YL E V FGFSA TGS FE HT+ +W+F S    N        K W +  ++G CS +L+
Sbjct  213  YLPEWVTFGFSATTGSLFELHTIEAWEFSS----NVQVAGTKSKSW-LWSILGSCSFILL  267

Query  414  IFGKCAVIYVVCEKRRRS  361
            I     + +    KR+R+
Sbjct  268  ILVLAFIWFRQRSKRKRA  285



>ref|XP_010052163.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=706

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 42/78 (54%), Gaps = 5/78 (6%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLV  415
            YL E V FGFSA TGS FE HT+ +W+F S    N        K W +  ++G CS +L+
Sbjct  256  YLPEWVTFGFSATTGSLFELHTIEAWEFSS----NVQVAGTKSKSW-LWSILGSCSFILL  310

Query  414  IFGKCAVIYVVCEKRRRS  361
            I     + +    KR+R+
Sbjct  311  ILVLAFIWFRQRSKRKRA  328



>emb|CBI35556.3| unnamed protein product [Vitis vinifera]
Length=546

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 6/89 (7%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDS-TSPPNTAPPREAKKKWNIGKVIGLCSV  424
            R YL E V FGFS ATG+    H + SW+ ++ TS PN+ P R+ K K  +G  +G C+ 
Sbjct  247  RLYLPEWVSFGFSGATGNASAIHAIYSWKAETPTSNPNSNPSRKIKVKLVVGLTVGGCAF  306

Query  423  VLVIFGKCAVIYVVCEKRRRSKKNDNNVI  337
            V    G  +++  +  K RR K  DN VI
Sbjct  307  V----GGLSLVLFLFLKSRRGKV-DNPVI  330



>gb|KCW63374.1| hypothetical protein EUGRSUZ_G01010 [Eucalyptus grandis]
Length=380

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 40/75 (53%), Gaps = 13/75 (17%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDS-----------TSPPNTAPPREAKKK--WN  454
            YL E V FGFSA TG  FE HT+ SW+F+S           T+      PR+ KK   W 
Sbjct  176  YLPEWVVFGFSAMTGLLFEAHTIFSWEFNSSLRILDNVNGTTNVTTIDTPRQRKKSKFWV  235

Query  453  IGKVIGLCSVVLVIF  409
             G ++GL S+V +I 
Sbjct  236  KGPILGLSSLVFLIL  250



>ref|XP_010068306.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=690

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 40/77 (52%), Gaps = 13/77 (17%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDST------------SPPNTAPPREAKKKW  457
            R YL E V FGFSA TG   E HT+ SW+F+S+              P   P R  K K 
Sbjct  244  REYLPEWVVFGFSATTGQLVEAHTIFSWEFNSSLQILDDVNGTTNVTPVDTPTRGKKSKS  303

Query  456  NI-GKVIGLCSVVLVIF  409
             + G ++GL S+VL+I 
Sbjct  304  RVKGAILGLSSLVLIIL  320



>gb|KJB77579.1| hypothetical protein B456_012G144800 [Gossypium raimondii]
Length=781

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 63/128 (49%), Gaps = 30/128 (23%)
 Frame = -2

Query  597  GYLSEQVCFGFSAATG--SFFEKHTVRSWQFDST---------SPPNTAP-----PREAK  466
            GYL E V FGFS A G  +  E +T+ SW F ST          PP TAP     PR   
Sbjct  324  GYLPEWVTFGFSGAAGFNTITELNTIYSWNFSSTLQVSMNTTIHPPATAPSLPVNPRRKS  383

Query  465  KKWNIGKVIGLCSVVLVIFGKCA------VIYVVCEKRRRSKKNDNNVITLGGKV-KLTT  307
            K W       LC V+ V+ G  A      ++++ C + + +K  D+  +++  ++ K+T 
Sbjct  384  KTW-------LCLVLAVVGGIFALLLVPGLVWLFCRRGKYNKMRDDGPMSVNVEMEKVTA  436

Query  306  PQESTLEE  283
            P++ + +E
Sbjct  437  PRQFSYKE  444



>emb|CAN76415.1| hypothetical protein VITISV_038497 [Vitis vinifera]
Length=665

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 4/87 (5%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDST-SPPNTAPPREAKKKWNIGKVIGLCSV  424
            R YL E V  GFS +TG++F+ + + SW F ST  PP++  P + KK    G V+GL   
Sbjct  241  REYLPEYVTMGFSGSTGTYFQINKICSWNFSSTLEPPSSVEPGKGKKT---GLVVGLSVC  297

Query  423  VLVIFGKCAVIYVVCEKRRRSKKNDNN  343
              V+ G   + +    ++R + ++  +
Sbjct  298  AFVVVGGFGLAWFYLWRKRNTGRDQED  324



>ref|XP_010054301.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=581

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 5/78 (6%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLV  415
            YL E V FGFSA TG++FE HT+ +W+F S    N        K W +  ++G CS +L+
Sbjct  169  YLPEWVTFGFSATTGTYFELHTIEAWEFSS----NVQVTGTKSKSW-LWSILGSCSFILL  223

Query  414  IFGKCAVIYVVCEKRRRS  361
            I     + +    KR+R+
Sbjct  224  ILVLAFIWFRQRSKRKRA  241



>ref|XP_010648053.1| PREDICTED: seed lectin-like [Vitis vinifera]
Length=425

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 52/102 (51%), Gaps = 8/102 (8%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDST-SPPNTAPPREAKKKWNIGKVIGLCSV  424
            R YL E V  GFS +TGS+F+ + + SW F ST  PP++  P E KK      V+GL   
Sbjct  241  REYLPEYVTMGFSGSTGSYFQINKICSWNFSSTLEPPSSVEPGEGKK---TELVVGLSVC  297

Query  423  VLVIFGKCAVIYVVCEKRRRSKKNDNNVITLGGKVKLTTPQE  298
              V+ G   + +    ++R ++++  +    GG   L   ++
Sbjct  298  AFVVVGGFGLAWFYLWRKRNTERDQED----GGDSDLDMDED  335



>gb|KCW63372.1| hypothetical protein EUGRSUZ_G01008 [Eucalyptus grandis]
Length=492

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 47/96 (49%), Gaps = 13/96 (14%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDST------------SPPNTAPPREAKKKW  457
            R YL E V FGFSA TG   E HT+ SW+F+S+              P   P R  K K 
Sbjct  46   REYLPEWVVFGFSATTGQLVEAHTIFSWEFNSSLQILDDVNGTTNVTPVDTPTRGKKSKS  105

Query  456  NI-GKVIGLCSVVLVIFGKCAVIYVVCEKRRRSKKN  352
             + G ++GL S+VL+I       Y    KR R+ ++
Sbjct  106  RVKGAILGLSSLVLIILVAGFGWYGYKLKRNRNDRS  141



>ref|XP_010065734.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
 ref|XP_010065735.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=681

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/62 (42%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLV  415
            YL E V FGF+A TG  FE HT+ SW+F+S+         +  K W  G ++GL S+V +
Sbjct  246  YLPEWVVFGFAATTGQLFEAHTIFSWEFNSS----LRTLDKKSKSWVKGAILGLISLVFL  301

Query  414  IF  409
            I 
Sbjct  302  IL  303



>gb|KCW63376.1| hypothetical protein EUGRSUZ_G01015 [Eucalyptus grandis]
Length=613

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 38/67 (57%), Gaps = 5/67 (7%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDS-----TSPPNTAPPREAKKKWNIGKVIGLC  430
            YL E V FGFSA+TG F E HT+ +W+F S      +P   A   +  + W  G +IGL 
Sbjct  198  YLPEWVVFGFSASTGQFLEAHTIFTWEFKSGPHMFDTPTCHATREKQGESWYRGVIIGLS  257

Query  429  SVVLVIF  409
            S++ +I 
Sbjct  258  SLMSLIL  264



>gb|KJB77580.1| hypothetical protein B456_012G144900 [Gossypium raimondii]
Length=668

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/119 (29%), Positives = 59/119 (50%), Gaps = 16/119 (13%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDST---------SPPNTAP-----PREAKKKW  457
            YL E V FGFS ATGS  E HT+ SW F S          +PPN AP     P+   K W
Sbjct  198  YLPEWVTFGFSGATGSSIELHTIYSWSFSSNLQVSMNKTINPPNVAPGPPINPKRKSKTW  257

Query  456  NIGKVIGLCSVVLVIFGKCAVIYVVCEKRRRSKKNDNNVITLGGKVK-LTTPQESTLEE  283
             +  V+ +   +  +    +++++ C +R+  +  ++  + +   V+ +T P++ +  E
Sbjct  258  -LWVVLAIAGGISALLPVLSLVWLFCRRRKYRRMREDGTMPVNVDVEMMTAPRKFSYRE  315



>ref|XP_009412463.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Musa acuminata subsp. malaccensis]
Length=691

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 11/90 (12%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNT---APP---REAKKKWNIGKVI  439
            R  L E+V  GFSAATG+  E + + SW F+S+  P T   APP   R++K    +G VI
Sbjct  229  RDVLPEKVAVGFSAATGNRIETNALLSWSFNSSLQPKTTLPAPPAAKRKSKMGLAVGGVI  288

Query  438  GLCSVVLVIFGKCAVIYVVCEKRRRSKKND  349
            G  +V++V+ G   +I      RRR+   D
Sbjct  289  G-AAVLMVLLGSLGLILW----RRRTTGRD  313



>gb|KCW63375.1| hypothetical protein EUGRSUZ_G01011 [Eucalyptus grandis]
Length=593

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLV  415
            YL E V FGF+A TG  FE HT+ SW+F+S+         +  K W  G ++GL S+V +
Sbjct  158  YLPEWVVFGFAATTGQLFEAHTIFSWEFNSS----LRTLDKKSKSWVKGAILGLISLVFL  213

Query  414  IF  409
            I 
Sbjct  214  IL  215



>ref|XP_002264871.2| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Vitis vinifera]
Length=696

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 4/81 (5%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSP-PNTAPPREAKKKWNIGKVIGLCSV  424
            R YL E V  GFS ATG++F+ + + SW F ST   P++  P E KK    G ++GL   
Sbjct  241  REYLPEYVTMGFSGATGTYFQINKICSWNFSSTLEFPSSVEPGEGKKT---GLMVGLSVG  297

Query  423  VLVIFGKCAVIYVVCEKRRRS  361
              V+ G   +++    K+R +
Sbjct  298  AFVVVGGLGLVWYYMWKKRNT  318



>ref|XP_010040314.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
 gb|KCW45310.1| hypothetical protein EUGRSUZ_L01021 [Eucalyptus grandis]
Length=596

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 15/96 (16%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDST--------------SPPNTAPPREAK-KK  460
            YL E V FGFSA TG  FE H++ SW+F+S+              +PP+    R  K + 
Sbjct  157  YLPEWVVFGFSATTGQAFEAHSIFSWEFNSSLRILDTVNGTNNTVNPPDGGLTRGKKSES  216

Query  459  WNIGKVIGLCSVVLVIFGKCAVIYVVCEKRRRSKKN  352
            W  G ++GL S+V +I       Y    KR R+ ++
Sbjct  217  WVRGAILGLSSLVFLILVAGFGWYGYRLKRNRNDQS  252



>ref|XP_011073633.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1 
isoform X2 [Sesamum indicum]
Length=615

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 7/82 (9%)
 Frame = -2

Query  591  LSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLVI  412
            L E V  G SAATG + E+HT+ SW+F S           A  K  IG ++GL     V+
Sbjct  197  LPEYVTVGISAATGMYVEQHTLESWEFSSNL-------EIAASKGKIGLILGLTLSGCVL  249

Query  411  FGKCAVIYVVCEKRRRSKKNDN  346
                 V++VV  KRR   +N N
Sbjct  250  AAGVIVVFVVWRKRRHGVRNKN  271



>ref|XP_002262748.2| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Vitis vinifera]
Length=688

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 49/107 (46%), Gaps = 24/107 (22%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDS-------------------TSPPNTAPP  478
            R YL E V FGFS ATG+    H + SW F S                   TS PN+ P 
Sbjct  215  RLYLPEWVSFGFSGATGNASAIHAIYSWSFSSSLQTDENKTNPTSPEAETPTSNPNSNPS  274

Query  477  REAKKKWNIGKVIGLCSVVLVIFGKCAVIYVVCEKRRRSKKNDNNVI  337
            R+ K K  +G  +G C+ V    G  +++  +  K RR K  DN VI
Sbjct  275  RKIKVKLVVGLTVGGCAFV----GGLSLVLFLFLKSRRGKV-DNPVI  316



>gb|KCW76080.1| hypothetical protein EUGRSUZ_D00455 [Eucalyptus grandis]
Length=269

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 5/81 (6%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLV  415
            YL E V FGFSAATGS +E HT+ +W+F S    N     + +K W +   +G  S +L+
Sbjct  159  YLPEWVSFGFSAATGSDYEFHTLEAWEFRS----NVLVAGKKRKLW-LWATLGSGSFILL  213

Query  414  IFGKCAVIYVVCEKRRRSKKN  352
            +    +V +  C KR+ + K+
Sbjct  214  VLVLASVWFRHCSKRKGTYKS  234



>ref|XP_011073632.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1 
isoform X1 [Sesamum indicum]
Length=692

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 7/82 (9%)
 Frame = -2

Query  591  LSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLVI  412
            L E V  G SAATG + E+HT+ SW+F S           A  K  IG ++GL     V+
Sbjct  274  LPEYVTVGISAATGMYVEQHTLESWEFSSNL-------EIAASKGKIGLILGLTLSGCVL  326

Query  411  FGKCAVIYVVCEKRRRSKKNDN  346
                 V++VV  KRR   +N N
Sbjct  327  AAGVIVVFVVWRKRRHGVRNKN  348



>gb|EYU18390.1| hypothetical protein MIMGU_mgv1a022756mg [Erythranthe guttata]
Length=680

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDST  502
            R YL E V  GFSAATGS+FE+HT++SW F ST
Sbjct  225  REYLPEYVAVGFSAATGSWFEEHTIKSWAFSST  257



>ref|XP_010689175.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Beta vulgaris subsp. vulgaris]
Length=657

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 49/86 (57%), Gaps = 10/86 (12%)
 Frame = -2

Query  591  LSEQVCFGFSAATGSFFEKHTVRSWQF-------DSTSPPNTAPPREAKKKWNIGKVIGL  433
            + E V  GFSA+TG+F E+HT+ SW+F       D     +    ++  + W +  ++ L
Sbjct  232  IPEWVKIGFSASTGTFIERHTLLSWEFYSSLEVTDELDGTHNIHKKKRLEDW-VSWIVPL  290

Query  432  CSVVLVIFGKCAVIYVVCEKRRRSKK  355
            C+ + V+ G   +I+ +C+KR++ KK
Sbjct  291  CAFIFVLGG--IIIFFLCQKRKQMKK  314



>ref|XP_009589837.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Nicotiana tomentosiformis]
Length=712

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 40/82 (49%), Gaps = 27/82 (33%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDST-----------------SPPNT-----  487
            R YL E V FGFSA+TG  F+K+ V+SW F+S+                 SPP T     
Sbjct  227  RNYLPENVTFGFSASTGQLFQKNNVKSWDFNSSLSFDPNEDPENAEQPSASPPITQVQDP  286

Query  486  -APPR----EAKKKWNIGKVIG  436
              PP      A+KK N G V+G
Sbjct  287  KGPPSNQEISARKKGNKGLVVG  308



>emb|CAN64986.1| hypothetical protein VITISV_035640 [Vitis vinifera]
Length=620

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 4/81 (5%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSP-PNTAPPREAKKKWNIGKVIGLCSV  424
            R YL E V  GFSAATG  F+ + + SW+F ST   P++  P E KK    G ++GL   
Sbjct  165  REYLPENVSIGFSAATGDLFQMNKICSWKFSSTLEFPSSVEPGEGKKT---GLMVGLSVG  221

Query  423  VLVIFGKCAVIYVVCEKRRRS  361
              V+     +++    K+R +
Sbjct  222  AFVVVAGLGLVWYYMWKKRNT  242



>ref|XP_007159169.1| hypothetical protein PHAVU_002G214900g [Phaseolus vulgaris]
 gb|ESW31163.1| hypothetical protein PHAVU_002G214900g [Phaseolus vulgaris]
Length=695

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 8/67 (12%)
 Frame = -2

Query  591  LSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGL-----CS  427
            L E V FGFS+ATG  +E+HT+ SW F+ST       P++ K    IG VIGL       
Sbjct  249  LPEWVQFGFSSATGFTYEEHTLSSWSFNSTL---EMEPQKQKGGSKIGLVIGLSVGLGVG  305

Query  426  VVLVIFG  406
            V++VIFG
Sbjct  306  VLIVIFG  312



>dbj|BAJ90155.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 29/44 (66%), Gaps = 2/44 (5%)
 Frame = -2

Query  591  LSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKK  460
            L E+V  GFSAATG F E+H + SW F ST PP   P R+ +KK
Sbjct  231  LPEEVAVGFSAATGDFSEQHQILSWSFSSTLPP--LPKRKNRKK  272



>ref|XP_008777395.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Phoenix dactylifera]
Length=819

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 12/77 (16%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDSTS--------PPNTAPPR---EAKKKWN  454
            R +L E V  GFSA+TG  +E H++ SW F+S++         P  +P     EAKKK  
Sbjct  408  RDHLPENVAIGFSASTGELYESHSIYSWDFNSSNLGSQDLAPSPGLSPTNETFEAKKKSK  467

Query  453  IGKVIGL-CSVVLVIFG  406
            +  V+GL C + +++ G
Sbjct  468  MSLVVGLACGIGILLCG  484



>ref|XP_008777396.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Phoenix dactylifera]
Length=681

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 47/89 (53%), Gaps = 11/89 (12%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDSTS--PPNTAPPR---------EAKKKWN  454
            R YL E V  G SA+TG+ +E H++ SW F+S++  P + AP           EAKKK  
Sbjct  231  REYLPENVAIGLSASTGTRYESHSIYSWDFNSSNLGPQDLAPSPGPSPTNETFEAKKKSK  290

Query  453  IGKVIGLCSVVLVIFGKCAVIYVVCEKRR  367
            +  V+GL   + ++     +++    ++R
Sbjct  291  MSLVVGLAVGIAILLCGLGLLWSAVWRKR  319



>gb|EYU18391.1| hypothetical protein MIMGU_mgv1a022316mg [Erythranthe guttata]
Length=713

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/66 (44%), Positives = 35/66 (53%), Gaps = 10/66 (15%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDST--------SPPNTAPP--REAKKKWNI  451
            R YL E V  GFSAATG +FE+HT++SW F ST          P       RE KK   +
Sbjct  223  RDYLPEYVTVGFSAATGDWFEEHTIKSWAFSSTLQIKNVTFENPGVVVTDVREEKKSSGV  282

Query  450  GKVIGL  433
              V+GL
Sbjct  283  TLVVGL  288



>ref|XP_010090631.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis]
 gb|EXC36487.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis]
Length=652

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = -2

Query  591  LSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTA-PPREAKKKWNIGKVIGLCSVVLV  415
            L E V FGFSAAT  F E+H ++SW+F S+   +     RE  KK  +   + +    +V
Sbjct  230  LPEWVTFGFSAATSHFSERHILKSWEFSSSLELDVKEKEREDTKKKTLLVGLIVSGTGVV  289

Query  414  IFGKCAVIYVVCEKRRRSKKNDNNVITL  331
            I G   V  V+  KR+R  + +   + L
Sbjct  290  IIGMVIVFMVMFRKRKRKNRGEAETVNL  317



>gb|EYU18392.1| hypothetical protein MIMGU_mgv1a002656mg [Erythranthe guttata]
Length=649

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDSTS  499
            R YL E V  GFSAATG  FE HTV+SW+F S+S
Sbjct  221  RDYLPENVTVGFSAATGDLFETHTVKSWEFYSSS  254



>ref|XP_010905482.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Elaeis guineensis]
Length=617

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 42/80 (53%), Gaps = 5/80 (6%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVV  421
            R YL E V  GFSAATG ++E H + SW F  TS   T+ P   KKK  +G V+GL    
Sbjct  235  RQYLPENVAVGFSAATGQYWESHCIYSWDF--TSSDLTSQP---KKKGKVGLVVGLAVGT  289

Query  420  LVIFGKCAVIYVVCEKRRRS  361
             ++     +  +V   +R S
Sbjct  290  GILLCGLGLAGIVVWHKRAS  309



>ref|XP_010096782.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis]
 gb|EXB65804.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis]
Length=750

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLC--SVV  421
            YL E V FGFSAA G F  +H +RSW F S     T P +E+      G V+GL   + V
Sbjct  232  YLPELVSFGFSAANGLFTSRHILRSWSFKSHDFV-TKPGKESSDSKKTGLVVGLSVGAFV  290

Query  420  LVIFGKCAVIYVVCEKRRRSK  358
            +++   C +  V+ +KR + +
Sbjct  291  ILVTVLCLIGLVLWKKRTKKE  311



>gb|KJB77582.1| hypothetical protein B456_012G145100 [Gossypium raimondii]
Length=542

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 15/110 (14%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDS---------TSPPNTAP-----PREAKKKW  457
            YL E V FGFS +TG   E HT+ SW F S         ++PPN AP     P+   K W
Sbjct  72   YLPEWVTFGFSGSTGRLSELHTIYSWDFSSSLQVSMNPTSNPPNVAPGPPINPKRKSKTW  131

Query  456  NIGKVIGLCSVVLVIFGKCAVIYVVCEKRRRSKKNDNNVITLGGKVKLTT  307
                V+ +   +  +     +  + C++R+  +  +N  ++    +++ T
Sbjct  132  Q-WVVLAIAGGIFALLLVLGLASLFCKRRKYRRMRENGTMSANVDMEMVT  180



>ref|NP_001060894.1| Os08g0125200 [Oryza sativa Japonica Group]
 dbj|BAD09254.1| putative receptor-type protein kinase LRK1 [Oryza sativa Japonica 
Group]
 dbj|BAF22808.1| Os08g0125200 [Oryza sativa Japonica Group]
 gb|EAZ41368.1| hypothetical protein OsJ_25884 [Oryza sativa Japonica Group]
 dbj|BAG92096.1| unnamed protein product [Oryza sativa Japonica Group]
Length=543

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 4/79 (5%)
 Frame = -2

Query  591  LSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLVI  412
            L E+V  GFSAATGS FE+H +RSW F+ T        + ++     G  +G    ++++
Sbjct  110  LPEKVAVGFSAATGSSFEQHQLRSWYFNLTLEQKQPTGQHSRGGVVAGATVGAILFIVLL  169

Query  411  FGKCAVIYVVCEKRRRSKK  355
            F   A++     +RR+ KK
Sbjct  170  FTMVAILV----RRRQRKK  184



>ref|XP_010068308.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=612

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 39/77 (51%), Gaps = 15/77 (19%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDST--------------SPPNTAPPREAK-KK  460
            YL E V FGFSA TG  FE H++ SW+F+S+              + P+    R  K + 
Sbjct  173  YLPEWVVFGFSATTGQLFEAHSIFSWEFNSSLRILDTVNGTTNTVNTPDGGMTRGKKSES  232

Query  459  WNIGKVIGLCSVVLVIF  409
            W  G ++GL S V +I 
Sbjct  233  WVRGAILGLSSFVFLIL  249



>ref|XP_009781157.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Nicotiana sylvestris]
Length=712

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 47/96 (49%), Gaps = 28/96 (29%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDST-----------------SPPNT-----  487
            R YL E V FGFSA+TG  F+K+ V+SW F+S+                 +PP T     
Sbjct  227  RNYLPENVTFGFSASTGQLFQKNNVKSWDFNSSLGFDPNKVPEHAEQPSANPPITQVQDS  286

Query  486  -APPR----EAKKKWNIGKVIGLC-SVVLVIFGKCA  397
             APP       +KK N G V+G    + +++FG  A
Sbjct  287  KAPPSNQEISTRKKGNKGLVVGSSIGLPILVFGLIA  322



>ref|XP_008365117.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Malus domestica]
Length=697

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 10/86 (12%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGL---CSV  424
            YL + V  GFSAA+G+   +  ++SW F+ST  P   PPR +    NI   +GL     +
Sbjct  259  YLPDWVIVGFSAASGARTTQFMIKSWSFNSTLVP---PPRSSSGSNNIALAVGLGLGGFI  315

Query  423  VLVIFGKCAVIYVVCEKRRRSKKNDN  346
             LV F  C    ++ +KR R K N N
Sbjct  316  ALVSFVLC----ILWKKRARGKTNTN  337



>dbj|BAJ86458.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=731

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/101 (32%), Positives = 45/101 (45%), Gaps = 15/101 (15%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNT---------------APPREAK  466
            R YL E+V  GFSAATG + E H V SW F ST  P T                P    K
Sbjct  243  RKYLPEEVAVGFSAATGMYAELHQVFSWSFSSTLQPETRKEAQAPPPAEPPLPIPTSNDK  302

Query  465  KKWNIGKVIGLCSVVLVIFGKCAVIYVVCEKRRRSKKNDNN  343
             +  +  ++    V L+    CA + + C + R+ + ND +
Sbjct  303  SQKKLVPILLSILVPLLFLLVCAAVVLGCRRHRKKRANDES  343



>gb|EAZ05441.1| hypothetical protein OsI_27655 [Oryza sativa Indica Group]
Length=670

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/82 (33%), Positives = 44/82 (54%), Gaps = 4/82 (5%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVV  421
            +  L E+V  GFSAATGS FE+H +RSW F+ T        + ++     G  +G    +
Sbjct  234  KSALPEKVAVGFSAATGSSFEQHQLRSWYFNLTLEQKQPTGQHSRGGVVAGATVGAILFI  293

Query  420  LVIFGKCAVIYVVCEKRRRSKK  355
            +++F   A++     +RR+ KK
Sbjct  294  VLLFTMVAILV----RRRQRKK  311



>ref|NP_001060891.1| Os08g0124500 [Oryza sativa Japonica Group]
 dbj|BAD17002.1| putative receptor-type protein kinase LRK1 [Oryza sativa Japonica 
Group]
 dbj|BAF22805.1| Os08g0124500 [Oryza sativa Japonica Group]
 dbj|BAG93833.1| unnamed protein product [Oryza sativa Japonica Group]
Length=676

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/82 (33%), Positives = 44/82 (54%), Gaps = 4/82 (5%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVV  421
            +  L E+V  GFSAATGS FE+H +RSW F+ T        + ++     G  +G    +
Sbjct  240  KSALPEKVAVGFSAATGSSFEQHQLRSWYFNLTLEQKQPTGQHSRGGVVAGATVGAILFI  299

Query  420  LVIFGKCAVIYVVCEKRRRSKK  355
            +++F   A++     +RR+ KK
Sbjct  300  VLLFTMVAILV----RRRQRKK  317



>ref|XP_003631707.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Vitis vinifera]
Length=675

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 28/47 (60%), Gaps = 1/47 (2%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDST-SPPNTAPPREAKK  463
            R YL E V  GFS ATG+ F+ H + SW F ST  PPN   P + KK
Sbjct  240  REYLPEFVTIGFSGATGNSFQIHNIYSWNFSSTLQPPNPVEPGDGKK  286



>ref|XP_011459854.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase S.5 [Fragaria vesca subsp. vesca]
Length=596

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 38/73 (52%), Gaps = 7/73 (10%)
 Frame = -2

Query  579  VCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPP-------REAKKKWNIGKVIGLCSVV  421
            V  GF+A+TG+  E H VR W F S   PN +PP       R+ +  W +   + LC +V
Sbjct  204  VYVGFTASTGTLPESHQVRDWVFTSLKLPNPSPPGNDKVHKRKTRNIWLVDVPVFLCVLV  263

Query  420  LVIFGKCAVIYVV  382
            L+ F    ++ VV
Sbjct  264  LIAFTYPLIMRVV  276



>ref|XP_003541778.2| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Glycine max]
Length=807

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 38/114 (33%), Positives = 53/114 (46%), Gaps = 33/114 (29%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDST----------SPPNTAPPRE-------  472
            R YL E+V FGFSAATG  FE +T+ SW F S+           PP  APP +       
Sbjct  360  RDYLPERVIFGFSAATGFMFEMNTLLSWSFRSSLPSDEKVSNQIPPMAAPPIQNPSPSPF  419

Query  471  ------AKKKWNIGKV------IGLCSVVLVIFGKCAVIYVVCEKRRRSKKNDN  346
                   K++ N G +      IG+ +  L++   C  I+    KR + KK D+
Sbjct  420  PTANISPKQEGNKGLLKGIEAGIGIAASFLILGLVCIFIW----KRAKLKKEDS  469



>gb|EEE67085.1| hypothetical protein OsJ_24069 [Oryza sativa Japonica Group]
Length=89

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPRE  472
             L+++V FGFSA TGS+ E+H + SW F+ST+      PRE
Sbjct  41   LLTQEVAFGFSATTGSWIERHRILSWSFNSTTVAVEDQPRE  81



>ref|XP_002310341.1| hypothetical protein POPTR_0007s15010g [Populus trichocarpa]
 gb|EEE90791.1| hypothetical protein POPTR_0007s15010g [Populus trichocarpa]
Length=692

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 32/91 (35%), Positives = 47/91 (52%), Gaps = 11/91 (12%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCS--  427
            R +L E V  GFSA+TG + E H + SW F+S+         E   K   G V+GL    
Sbjct  237  REFLPEWVRIGFSASTGDWVEIHNILSWTFESS--------LEVSDKKKTGLVVGLAVGI  288

Query  426  VVLVIFGKCAVIYVVCEKRRRSK-KNDNNVI  337
             VL  FG   + +V+C ++ R++ + DN  I
Sbjct  289  GVLTTFGIGVLCFVLCWRKNRTRCEKDNEAI  319



>ref|XP_004494968.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cicer arietinum]
Length=672

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 34/104 (33%), Positives = 53/104 (51%), Gaps = 23/104 (22%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDST----------------SPPNTAPPREA  469
            R YL ++V FGFSAATG  FE +T++SW F+ST                SP   +P  ++
Sbjct  228  RDYLPDKVIFGFSAATGYMFEMNTLKSWSFNSTLQSHHDNIPQIANPAPSPIKISPKIDS  287

Query  468  KKK--W-NIGKVIGLCSVVLVIFGKCAVIYVVCEKRRRSKKNDN  346
             K   W  +G  + + S  L++   C +++    KR + KK D+
Sbjct  288  NKGTIWIGLGVGVVVASSFLILGWFCILMW----KRAKMKKEDS  327



>ref|XP_010054304.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=698

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 9/83 (11%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLV  415
            YL E V FGFSA+TGS FE HT+ +W+F ST     A  +     W+I   +G  S  L+
Sbjct  255  YLPEWVTFGFSASTGSLFELHTIVAWEFSSTV--QVAGKKSKSWLWSI---LGSGSFFLL  309

Query  414  IFGKCAVIYVVCEKRRRSKKNDN  346
            I     V+ V+  + R + K  N
Sbjct  310  IL----VLAVIWFRHRSNSKRAN  328



>ref|XP_010054312.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
 gb|KCW76084.1| hypothetical protein EUGRSUZ_D00460 [Eucalyptus grandis]
Length=689

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 5/81 (6%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLV  415
            YL E V FGFSAATG+ +E HT+ +W+F S    N     + +K W +   +G  S +L+
Sbjct  246  YLPEWVNFGFSAATGTDYELHTIEAWEFRS----NVLVAGKKRKLW-LWATLGSGSFILL  300

Query  414  IFGKCAVIYVVCEKRRRSKKN  352
            +     V +  C KR+ + K+
Sbjct  301  VLVLAFVSFRHCSKRKGTYKS  321



>gb|KCW76070.1| hypothetical protein EUGRSUZ_D00438, partial [Eucalyptus grandis]
Length=627

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 9/83 (11%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLV  415
            YL E V FGFSA+TGS FE HT+ +W+F ST     A  +     W+I   +G  S  L+
Sbjct  223  YLPEWVTFGFSASTGSLFELHTIVAWEFSSTV--QVAGKKSKSWLWSI---LGSGSFFLL  277

Query  414  IFGKCAVIYVVCEKRRRSKKNDN  346
            I     V+ V+  + R + K  N
Sbjct  278  IL----VLAVIWFRHRSNSKRAN  296



>ref|XP_010905484.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Elaeis guineensis]
Length=690

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 48/93 (52%), Gaps = 21/93 (23%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDSTS------PPNTAPPR-----EAKKKWN  454
            R +L E V  GFSA+TG+ +E H++ SW F S++      PP+  P       +AKKK  
Sbjct  230  REFLPENVSVGFSASTGTLYESHSIYSWDFISSNLSSQDLPPSPEPSPTDETFDAKKKSK  289

Query  453  IGKV-----IGLCSVVLVIFGKCAVIYVVCEKR  370
            + +V     IG+    LV+ G      V+C KR
Sbjct  290  MKEVALAVCIGILPCGLVLVGS-----VICYKR  317



>ref|XP_007159171.1| hypothetical protein PHAVU_002G2150000g, partial [Phaseolus vulgaris]
 gb|ESW31165.1| hypothetical protein PHAVU_002G2150000g, partial [Phaseolus vulgaris]
Length=410

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 9/71 (13%)
 Frame = -2

Query  591  LSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGL-CSVVLV  415
            L E V FGFS+ATG   E+HT+ SW F ST    T P   +K++  IG  +GL   V++V
Sbjct  242  LPEWVQFGFSSATGHTIEEHTLSSWSFKST--LETEP---SKRRLVIGLSVGLGVGVLIV  296

Query  414  IFGKCAVIYVV  382
            IFG   VI++V
Sbjct  297  IFG---VIFLV  304



>ref|XP_010052167.1| PREDICTED: anti-H(O) lectin 1-like [Eucalyptus grandis]
 ref|XP_010052169.1| PREDICTED: anti-H(O) lectin 1-like [Eucalyptus grandis]
Length=318

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 40/76 (53%), Gaps = 5/76 (7%)
 Frame = -2

Query  594  YLSEQVCFGFSAATGSFFEKHTVRSWQFDSTSPPNTAPPREAKKKWNIGKVIGLCSVVLV  415
            YL E V FGFSAATG+ FE HT+ +W+F S    N     +  K W +   +G  S +L+
Sbjct  246  YLPEWVNFGFSAATGTNFELHTLEAWEFRS----NVQVAGKKSKLW-LWATLGSGSFILL  300

Query  414  IFGKCAVIYVVCEKRR  367
            +       +  C KRR
Sbjct  301  VLVLAFAWFRHCSKRR  316



>ref|XP_010905481.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing 
receptor kinase IX.1-like [Elaeis guineensis]
Length=680

 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 33/90 (37%), Positives = 44/90 (49%), Gaps = 13/90 (14%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDSTS------PPNTAPPREAKKKWN---IG  448
            R  L E+V  GFSAATG+  E H + SW F S+        PN  P   +K K +    G
Sbjct  229  RQVLPEKVAVGFSAATGNQVESHCLLSWNFSSSDLSHQDYGPNPHPNTNSKHKPSFKLFG  288

Query  447  KVIGL----CSVVLVIFGKCAVIYVVCEKR  370
             VIG+    C +VL+  G+C     V  K+
Sbjct  289  LVIGIGILVCGLVLIWLGRCLYKMAVTGKK  318



>emb|CBI25097.3| unnamed protein product [Vitis vinifera]
Length=384

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 32/57 (56%), Gaps = 1/57 (2%)
 Frame = -2

Query  600  RGYLSEQVCFGFSAATGSFFEKHTVRSWQFDST-SPPNTAPPREAKKKWNIGKVIGL  433
            R YL E V  GFS ATG  F+K+ + SW F ST  PP+   P + K     G V+GL
Sbjct  130  REYLPEFVNIGFSGATGRAFQKNNIHSWNFSSTLQPPSPVEPGDGKNGKKTGFVVGL  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370