BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF042F11

Length=753
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006360245.1|  PREDICTED: uncharacterized protein At4g06744...    197   8e-57   
ref|XP_009793223.1|  PREDICTED: uncharacterized protein At4g06744...    200   9e-57   Nicotiana sylvestris
ref|XP_009588943.1|  PREDICTED: uncharacterized protein At4g06744...    198   7e-56   Nicotiana tomentosiformis
ref|XP_004233445.1|  PREDICTED: uncharacterized protein At4g06744...    191   6e-54   Solanum lycopersicum
gb|KDP47121.1|  hypothetical protein JCGZ_22117                         190   4e-53   Jatropha curcas
gb|EYU44430.1|  hypothetical protein MIMGU_mgv1a005057mg                186   1e-51   Erythranthe guttata [common monkey flower]
emb|CDP02523.1|  unnamed protein product                                186   2e-51   Coffea canephora [robusta coffee]
ref|XP_006356575.1|  PREDICTED: uncharacterized protein At4g06744...    184   4e-51   Solanum tuberosum [potatoes]
ref|XP_006406513.1|  hypothetical protein EUTSA_v10020680mg             184   4e-51   Eutrema salsugineum [saltwater cress]
gb|KCW54907.1|  hypothetical protein EUGRSUZ_I00886                     177   7e-51   Eucalyptus grandis [rose gum]
emb|CDX92324.1|  BnaA05g20830D                                          182   1e-50   
dbj|BAH19934.1|  AT1G49750                                              178   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145802.1|  PREDICTED: uncharacterized protein At4g06744       182   1e-50   Brassica rapa
gb|KJB77660.1|  hypothetical protein B456_012G149500                    182   2e-50   Gossypium raimondii
ref|XP_010028214.1|  PREDICTED: uncharacterized protein At4g06744...    183   2e-50   Eucalyptus grandis [rose gum]
emb|CDX99236.1|  BnaC05g33510D                                          180   1e-49   
ref|XP_004248758.1|  PREDICTED: uncharacterized protein At4g06744...    179   2e-49   Solanum lycopersicum
ref|XP_011099103.1|  PREDICTED: uncharacterized protein At4g06744...    180   2e-49   Sesamum indicum [beniseed]
gb|KDP47120.1|  hypothetical protein JCGZ_22116                         179   2e-49   Jatropha curcas
ref|XP_004170987.1|  PREDICTED: uncharacterized protein At4g06744...    177   3e-49   
ref|NP_188563.1|  leucine-rich repeat-containing protein                179   4e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KDO59787.1|  hypothetical protein CISIN_1g011101mg                   179   4e-49   Citrus sinensis [apfelsine]
gb|AEI72268.1|  leucine-rich repeat family protein                      178   5e-49   Citrus trifoliata [hardy orange]
ref|XP_006422961.1|  hypothetical protein CICLE_v10028242mg             179   8e-49   Citrus clementina [clementine]
ref|XP_006393218.1|  hypothetical protein EUTSA_v10011424mg             178   1e-48   Eutrema salsugineum [saltwater cress]
ref|NP_175397.1|  leucine-rich repeat (LRR) family protein              178   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137107.1|  PREDICTED: uncharacterized protein At4g06744...    177   2e-48   
gb|KGN43906.1|  hypothetical protein Csa_7G073420                       177   3e-48   Cucumis sativus [cucumbers]
ref|XP_010555995.1|  PREDICTED: uncharacterized protein At4g06744...    177   3e-48   Tarenaya hassleriana [spider flower]
ref|XP_002885307.1|  leucine-rich repeat family protein                 177   3e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_002282482.2|  PREDICTED: uncharacterized protein At4g06744...    177   4e-48   Vitis vinifera
ref|XP_008454973.1|  PREDICTED: uncharacterized protein At4g06744...    176   8e-48   
ref|XP_002518709.1|  serine-threonine protein kinase, plant-type,...    175   2e-47   Ricinus communis
emb|CDY43618.1|  BnaC09g17570D                                          167   3e-47   Brassica napus [oilseed rape]
ref|XP_010519298.1|  PREDICTED: uncharacterized protein At4g06744...    173   4e-47   Tarenaya hassleriana [spider flower]
gb|KFK39280.1|  hypothetical protein AALP_AA3G224000                    173   5e-47   Arabis alpina [alpine rockcress]
ref|XP_006307323.1|  hypothetical protein CARUB_v10008944mg             174   5e-47   Capsella rubella
ref|XP_011088225.1|  PREDICTED: uncharacterized protein At4g06744...    173   6e-47   Sesamum indicum [beniseed]
ref|XP_011467740.1|  PREDICTED: uncharacterized protein At4g06744       174   6e-47   Fragaria vesca subsp. vesca
ref|XP_010263447.1|  PREDICTED: uncharacterized protein At4g06744...    173   7e-47   Nelumbo nucifera [Indian lotus]
ref|XP_011004900.1|  PREDICTED: uncharacterized protein At4g06744...    172   7e-47   Populus euphratica
ref|XP_002894215.1|  hypothetical protein ARALYDRAFT_474107             173   8e-47   
ref|XP_011004883.1|  PREDICTED: uncharacterized protein At4g06744...    171   9e-47   Populus euphratica
ref|XP_009762067.1|  PREDICTED: uncharacterized protein At4g06744...    171   2e-46   Nicotiana sylvestris
gb|KJB12258.1|  hypothetical protein B456_002G008600                    172   3e-46   Gossypium raimondii
ref|XP_009622015.1|  PREDICTED: uncharacterized protein At4g06744...    171   3e-46   Nicotiana tomentosiformis
ref|XP_007157235.1|  hypothetical protein PHAVU_002G054000g             170   4e-46   Phaseolus vulgaris [French bean]
ref|XP_010691719.1|  PREDICTED: uncharacterized protein At4g06744...    170   6e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|AIE39583.1|  LRR receptor-like protein kinase                        161   8e-46   Humulus lupulus [common hop]
gb|KFK35980.1|  hypothetical protein AALP_AA4G062700                    170   8e-46   Arabis alpina [alpine rockcress]
emb|CDY20865.1|  BnaC05g26270D                                          170   2e-45   Brassica napus [oilseed rape]
gb|KJB32334.1|  hypothetical protein B456_005G236100                    168   2e-45   Gossypium raimondii
ref|XP_009145107.1|  PREDICTED: uncharacterized protein At4g06744...    170   2e-45   Brassica rapa
ref|XP_010270780.1|  PREDICTED: uncharacterized protein At4g06744...    169   3e-45   Nelumbo nucifera [Indian lotus]
emb|CDY29337.1|  BnaA05g16040D                                          168   5e-45   Brassica napus [oilseed rape]
ref|XP_006374888.1|  hypothetical protein POPTR_0014s02430g             167   6e-45   Populus trichocarpa [western balsam poplar]
ref|XP_007201703.1|  hypothetical protein PRUPE_ppa004109mg             168   8e-45   Prunus persica
ref|XP_007042489.1|  Leucine-rich repeat family protein, putative       167   1e-44   
gb|KDP41695.1|  hypothetical protein JCGZ_16102                         166   1e-44   Jatropha curcas
ref|XP_006297641.1|  hypothetical protein CARUB_v10013659mg             166   2e-44   Capsella rubella
ref|XP_008236576.1|  PREDICTED: uncharacterized protein At4g06744...    166   2e-44   
ref|XP_010479447.1|  PREDICTED: leucine-rich repeat extensin-like...    166   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010461823.1|  PREDICTED: uncharacterized protein At4g06744...    165   8e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010500525.1|  PREDICTED: leucine-rich repeat extensin-like...    165   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_003607916.1|  Receptor protein kinase                            162   1e-43   
ref|XP_010263446.1|  PREDICTED: uncharacterized protein At4g06744...    164   1e-43   Nelumbo nucifera [Indian lotus]
ref|XP_003538630.1|  PREDICTED: uncharacterized protein At4g06744...    163   2e-43   Glycine max [soybeans]
gb|KHN05611.1|  Hypothetical protein glysoja_047056                     163   2e-43   Glycine soja [wild soybean]
ref|XP_008236564.1|  PREDICTED: uncharacterized protein At4g06744...    162   2e-43   Prunus mume [ume]
ref|XP_010270768.1|  PREDICTED: uncharacterized protein At4g06744...    163   3e-43   Nelumbo nucifera [Indian lotus]
ref|XP_007227115.1|  hypothetical protein PRUPE_ppa025707mg             163   4e-43   
ref|XP_006433575.1|  hypothetical protein CICLE_v10003526mg             162   5e-43   Citrus clementina [clementine]
emb|CDO97205.1|  unnamed protein product                                162   5e-43   Coffea canephora [robusta coffee]
ref|XP_006472980.1|  PREDICTED: uncharacterized protein At4g06744...    162   6e-43   
gb|AES90113.2|  Serine/Threonine kinase, plant-type protein, puta...    162   9e-43   Medicago truncatula
gb|KDP24991.1|  hypothetical protein JCGZ_23974                         160   1e-42   Jatropha curcas
ref|XP_004304027.1|  PREDICTED: uncharacterized protein At4g06744...    160   1e-42   Fragaria vesca subsp. vesca
ref|XP_002510174.1|  serine-threonine protein kinase, plant-type,...    161   1e-42   Ricinus communis
emb|CDP01296.1|  unnamed protein product                                160   1e-42   Coffea canephora [robusta coffee]
ref|XP_008454972.1|  PREDICTED: uncharacterized protein At4g06744...    160   1e-42   Cucumis melo [Oriental melon]
gb|KDP24986.1|  hypothetical protein JCGZ_23969                         160   2e-42   Jatropha curcas
ref|XP_004137106.1|  PREDICTED: uncharacterized protein At4g06744...    160   2e-42   
ref|XP_011029410.1|  PREDICTED: uncharacterized protein At4g06744...    160   2e-42   Populus euphratica
ref|XP_007201495.1|  hypothetical protein PRUPE_ppa014775mg             160   2e-42   
ref|XP_008220262.1|  PREDICTED: uncharacterized protein At4g06744...    160   3e-42   Prunus mume [ume]
ref|XP_007017157.1|  Leucine-rich repeat family protein                 160   3e-42   
ref|XP_010107857.1|  Uncharacterized protein L484_027444                159   3e-42   Morus notabilis
gb|KGN43905.1|  hypothetical protein Csa_7G073410                       160   3e-42   Cucumis sativus [cucumbers]
emb|CDY32853.1|  BnaC08g02750D                                          160   3e-42   Brassica napus [oilseed rape]
ref|XP_004171357.1|  PREDICTED: uncharacterized protein At4g06744...    160   4e-42   
ref|XP_004142874.1|  PREDICTED: uncharacterized protein At4g06744...    159   6e-42   Cucumis sativus [cucumbers]
ref|XP_010507626.1|  PREDICTED: uncharacterized protein At4g06744...    159   6e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009107284.1|  PREDICTED: uncharacterized protein At4g06744       159   6e-42   Brassica rapa
gb|KDO37099.1|  hypothetical protein CISIN_1g037101mg                   158   7e-42   Citrus sinensis [apfelsine]
gb|KJB14611.1|  hypothetical protein B456_002G133900                    159   9e-42   Gossypium raimondii
emb|CDY16514.1|  BnaA08g02530D                                          159   2e-41   Brassica napus [oilseed rape]
gb|KHN30415.1|  Hypothetical protein glysoja_033153                     157   2e-41   Glycine soja [wild soybean]
ref|XP_004505256.1|  PREDICTED: uncharacterized protein At4g06744...    158   2e-41   Cicer arietinum [garbanzo]
ref|XP_010487869.1|  PREDICTED: uncharacterized protein At4g06744...    158   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_003516778.2|  PREDICTED: uncharacterized protein At4g06744...    157   3e-41   Glycine max [soybeans]
gb|KJB14612.1|  hypothetical protein B456_002G134000                    157   3e-41   Gossypium raimondii
ref|XP_003528523.1|  PREDICTED: uncharacterized protein At4g06744...    157   3e-41   Glycine max [soybeans]
ref|XP_009605357.1|  PREDICTED: uncharacterized protein At4g06744...    156   3e-41   Nicotiana tomentosiformis
ref|XP_010094651.1|  Uncharacterized protein L484_008883                157   4e-41   Morus notabilis
gb|KHN12808.1|  Hypothetical protein glysoja_008771                     151   6e-41   Glycine soja [wild soybean]
ref|XP_011069732.1|  PREDICTED: uncharacterized protein At4g06744...    155   1e-40   Sesamum indicum [beniseed]
ref|XP_010688602.1|  PREDICTED: uncharacterized protein At4g06744       156   1e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011000139.1|  PREDICTED: uncharacterized protein At4g06744...    154   2e-40   Populus euphratica
gb|ADN33724.1|  LRR-family protein                                      155   2e-40   Cucumis melo subsp. melo
ref|XP_002300228.2|  hypothetical protein POPTR_0001s30990g             154   2e-40   
ref|XP_002518710.1|  serine-threonine protein kinase, plant-type,...    154   3e-40   
ref|XP_009396708.1|  PREDICTED: uncharacterized protein At4g06744...    154   3e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008444596.1|  PREDICTED: uncharacterized protein At4g06744...    155   3e-40   
ref|XP_007160878.1|  hypothetical protein PHAVU_001G024400g             154   3e-40   Phaseolus vulgaris [French bean]
ref|XP_008393778.1|  PREDICTED: uncharacterized protein At4g06744...    154   5e-40   
ref|XP_007157716.1|  hypothetical protein PHAVU_002G092300g             153   7e-40   Phaseolus vulgaris [French bean]
gb|KHN22492.1|  Hypothetical protein glysoja_041167                     153   7e-40   Glycine soja [wild soybean]
ref|XP_003545325.1|  PREDICTED: uncharacterized protein At4g06744...    153   8e-40   Glycine max [soybeans]
ref|XP_008798694.1|  PREDICTED: uncharacterized protein At4g06744...    154   9e-40   
gb|KEH30896.1|  Serine/Threonine kinase, plant-type protein, puta...    153   9e-40   Medicago truncatula
ref|XP_010664550.1|  PREDICTED: uncharacterized protein At4g06744...    152   1e-39   Vitis vinifera
ref|XP_002284965.1|  PREDICTED: uncharacterized protein At4g06744...    152   1e-39   Vitis vinifera
ref|XP_010094650.1|  Uncharacterized protein L484_008882                152   2e-39   Morus notabilis
gb|KDP41694.1|  hypothetical protein JCGZ_16101                         152   2e-39   Jatropha curcas
ref|XP_009395500.1|  PREDICTED: uncharacterized protein At4g06744...    152   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006346520.1|  PREDICTED: uncharacterized protein At4g06744...    151   3e-39   Solanum tuberosum [potatoes]
ref|XP_010466072.1|  PREDICTED: uncharacterized protein At4g06744...    152   3e-39   Camelina sativa [gold-of-pleasure]
gb|KJB32335.1|  hypothetical protein B456_005G236200                    151   3e-39   Gossypium raimondii
ref|XP_009417193.1|  PREDICTED: uncharacterized protein At4g06744...    152   3e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006354850.1|  PREDICTED: uncharacterized protein At4g06744...    150   4e-39   Solanum tuberosum [potatoes]
ref|XP_006422962.1|  hypothetical protein CICLE_v10028712mg             150   4e-39   
ref|XP_009768848.1|  PREDICTED: uncharacterized protein At4g06744...    151   4e-39   Nicotiana sylvestris
ref|XP_003550327.1|  PREDICTED: uncharacterized protein At4g06744...    151   4e-39   Glycine max [soybeans]
ref|XP_007017156.1|  LRR-family protein                                 151   5e-39   
gb|KCW68710.1|  hypothetical protein EUGRSUZ_F02313                     150   5e-39   Eucalyptus grandis [rose gum]
gb|KDO59786.1|  hypothetical protein CISIN_1g048561mg                   150   6e-39   Citrus sinensis [apfelsine]
ref|XP_008236575.1|  PREDICTED: uncharacterized protein At4g06744...    150   6e-39   Prunus mume [ume]
ref|XP_011074595.1|  PREDICTED: uncharacterized protein At4g06744...    150   8e-39   
ref|XP_006487027.1|  PREDICTED: uncharacterized protein At4g06744...    150   1e-38   Citrus sinensis [apfelsine]
ref|XP_004499033.1|  PREDICTED: uncharacterized protein At4g06744...    149   1e-38   Cicer arietinum [garbanzo]
ref|XP_009617390.1|  PREDICTED: uncharacterized protein At4g06744...    150   1e-38   
gb|EPS58531.1|  hypothetical protein M569_16282                         148   2e-38   Genlisea aurea
ref|XP_011000899.1|  PREDICTED: uncharacterized protein At4g06744...    149   2e-38   Populus euphratica
ref|XP_010061722.1|  PREDICTED: uncharacterized protein At4g06744...    149   2e-38   Eucalyptus grandis [rose gum]
ref|XP_010928365.1|  PREDICTED: uncharacterized protein At4g06744...    149   3e-38   Elaeis guineensis
ref|XP_009359966.1|  PREDICTED: uncharacterized protein At4g06744...    149   3e-38   Pyrus x bretschneideri [bai li]
ref|XP_010927582.1|  PREDICTED: uncharacterized protein At4g06744...    149   3e-38   
ref|XP_003529407.1|  PREDICTED: uncharacterized protein At4g06744...    149   3e-38   Glycine max [soybeans]
ref|XP_007042487.1|  Leucine-rich repeat family protein, putative       148   4e-38   
gb|KHN43047.1|  Hypothetical protein glysoja_007577                     149   4e-38   Glycine soja [wild soybean]
ref|XP_002313863.2|  hypothetical protein POPTR_0009s10140g             148   5e-38   
ref|XP_010554992.1|  PREDICTED: uncharacterized protein At4g06744       147   5e-38   Tarenaya hassleriana [spider flower]
ref|XP_008796513.1|  PREDICTED: uncharacterized protein At4g06744...    147   6e-38   
ref|XP_009394537.1|  PREDICTED: uncharacterized protein At4g06744...    148   7e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007157715.1|  hypothetical protein PHAVU_002G092200g             148   8e-38   Phaseolus vulgaris [French bean]
ref|XP_004238131.2|  PREDICTED: probable inactive receptor kinase...    152   1e-37   
ref|XP_008456159.1|  PREDICTED: uncharacterized protein At4g06744...    145   1e-37   Cucumis melo [Oriental melon]
ref|XP_009345138.1|  PREDICTED: uncharacterized protein At4g06744...    147   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_009784047.1|  PREDICTED: uncharacterized protein At4g06744...    147   2e-37   Nicotiana sylvestris
ref|XP_004291077.1|  PREDICTED: uncharacterized protein At4g06744...    147   2e-37   Fragaria vesca subsp. vesca
ref|XP_010932202.1|  PREDICTED: uncharacterized protein At4g06744...    147   2e-37   Elaeis guineensis
ref|XP_009592678.1|  PREDICTED: uncharacterized protein At4g06744...    146   3e-37   Nicotiana tomentosiformis
ref|XP_008342943.1|  PREDICTED: uncharacterized protein At4g06744...    146   3e-37   
ref|XP_004505255.1|  PREDICTED: uncharacterized protein At4g06744...    145   6e-37   Cicer arietinum [garbanzo]
ref|XP_008799889.1|  PREDICTED: uncharacterized protein At4g06744...    145   8e-37   Phoenix dactylifera
ref|XP_004953109.1|  PREDICTED: uncharacterized protein At4g06744...    145   9e-37   Setaria italica
ref|XP_002452450.1|  hypothetical protein SORBIDRAFT_04g026020          145   1e-36   Sorghum bicolor [broomcorn]
ref|XP_003589141.1|  hypothetical protein MTR_1g018910                  144   1e-36   Medicago truncatula
gb|EYU37650.1|  hypothetical protein MIMGU_mgv11b016249mg               145   1e-36   Erythranthe guttata [common monkey flower]
ref|XP_003555862.1|  PREDICTED: uncharacterized protein At4g06744...    144   2e-36   Glycine max [soybeans]
ref|XP_004231393.1|  PREDICTED: uncharacterized protein At4g06744       143   3e-36   Solanum lycopersicum
ref|XP_003575361.1|  PREDICTED: uncharacterized protein At4g06744...    143   5e-36   Brachypodium distachyon [annual false brome]
ref|XP_006653860.1|  PREDICTED: uncharacterized protein At4g06744...    142   8e-36   Oryza brachyantha
ref|XP_004141388.1|  PREDICTED: uncharacterized protein At4g06744...    142   1e-35   Cucumis sativus [cucumbers]
ref|XP_009413340.1|  PREDICTED: uncharacterized protein At4g06744...    142   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004140710.1|  PREDICTED: uncharacterized protein At4g06744...    142   1e-35   Cucumis sativus [cucumbers]
ref|XP_008452581.1|  PREDICTED: uncharacterized protein At4g06744...    141   2e-35   Cucumis melo [Oriental melon]
ref|XP_004168435.1|  PREDICTED: uncharacterized protein At4g06744...    142   2e-35   
dbj|BAJ86461.1|  predicted protein                                      141   2e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT03089.1|  hypothetical protein F775_11041                         141   3e-35   
gb|AFW62989.1|  leucine-rich repeat (LRR) family protein                140   3e-35   
ref|NP_001148637.1|  LOC100282253                                       140   5e-35   
ref|XP_004976154.1|  PREDICTED: uncharacterized protein At4g06744...    140   5e-35   Setaria italica
gb|AEV41070.1|  uncharacterized protein At4g06744 precursor             140   6e-35   Oryza minuta
gb|AEV41116.1|  uncharacterized protein At4g06744 precursor             140   6e-35   Oryza officinalis
ref|XP_007199295.1|  hypothetical protein PRUPE_ppa023082mg             139   7e-35   
gb|ACF84038.1|  unknown                                                 140   7e-35   Zea mays [maize]
ref|XP_006653579.1|  PREDICTED: uncharacterized protein At4g06744...    140   9e-35   Oryza brachyantha
ref|XP_006647518.1|  PREDICTED: uncharacterized protein At4g06744...    139   1e-34   Oryza brachyantha
ref|NP_001241706.1|  uncharacterized protein LOC100856884               139   1e-34   
gb|ACF79045.1|  unknown                                                 139   1e-34   Zea mays [maize]
gb|EYU25462.1|  hypothetical protein MIMGU_mgv1a024676mg                138   1e-34   Erythranthe guttata [common monkey flower]
ref|XP_010523006.1|  PREDICTED: uncharacterized protein At4g06744...    139   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_010066095.1|  PREDICTED: uncharacterized protein At4g06744...    138   2e-34   Eucalyptus grandis [rose gum]
ref|XP_008677766.1|  PREDICTED: uncharacterized protein LOC100856...    139   2e-34   
emb|CAE02949.1|  OSJNBa0014K14.21                                       139   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010065987.1|  PREDICTED: uncharacterized protein At4g06744...    138   2e-34   Eucalyptus grandis [rose gum]
ref|XP_002446758.1|  hypothetical protein SORBIDRAFT_06g021870          139   2e-34   Sorghum bicolor [broomcorn]
ref|NP_849339.1|  Leucine-rich repeat-containing protein                138   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003575360.1|  PREDICTED: uncharacterized protein At4g06744...    138   3e-34   
ref|XP_010664552.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    138   3e-34   Vitis vinifera
ref|XP_008663372.1|  PREDICTED: uncharacterized protein At4g06744...    139   4e-34   
dbj|BAD21636.1|  leucine-rich repeat-like protein                       137   4e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004953107.1|  PREDICTED: uncharacterized protein At4g06744...    137   6e-34   
gb|ACG34018.1|  protein binding protein                                 137   8e-34   Zea mays [maize]
gb|AEV40972.1|  uncharacterized protein At4g06744 precursor             137   9e-34   Oryza punctata
ref|XP_003580786.1|  PREDICTED: uncharacterized protein At4g06744       137   1e-33   Brachypodium distachyon [annual false brome]
ref|XP_010455221.1|  PREDICTED: uncharacterized protein At4g06744...    136   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010421726.1|  PREDICTED: uncharacterized protein At4g06744       136   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010438766.1|  PREDICTED: uncharacterized protein At4g06744       135   1e-33   Camelina sativa [gold-of-pleasure]
gb|AEV41023.1|  uncharacterized protein At4g06744 precursor             136   1e-33   Oryza minuta
gb|EAY86685.1|  hypothetical protein OsI_08067                          135   2e-33   Oryza sativa Indica Group [Indian rice]
gb|EAY86686.1|  hypothetical protein OsI_08068                          135   2e-33   Oryza sativa Indica Group [Indian rice]
gb|EMS59107.1|  hypothetical protein TRIUR3_04108                       135   2e-33   Triticum urartu
gb|KFK39606.1|  hypothetical protein AALP_AA3G265800                    135   2e-33   Arabis alpina [alpine rockcress]
ref|XP_009141268.1|  PREDICTED: uncharacterized protein At4g06744...    135   2e-33   Brassica rapa
ref|XP_002874478.1|  leucine-rich repeat family protein                 134   4e-33   
ref|XP_004960235.1|  PREDICTED: uncharacterized protein At4g06744...    135   5e-33   
gb|AFW72330.1|  leucine-rich repeat (LRR) family protein                130   7e-33   
ref|XP_004167460.1|  PREDICTED: uncharacterized protein At4g06744...    134   7e-33   
ref|NP_001150111.1|  protein binding protein precursor                  134   1e-32   
ref|XP_002447298.1|  hypothetical protein SORBIDRAFT_06g032310          134   1e-32   Sorghum bicolor [broomcorn]
gb|EMT08852.1|  hypothetical protein F775_11606                         134   1e-32   
gb|ACG42798.1|  leucine-rich repeat, plant specific                     134   1e-32   Zea mays [maize]
ref|NP_001141186.1|  leucine-rich repeat (LRR) family protein pre...    133   1e-32   Zea mays [maize]
gb|EMT04546.1|  hypothetical protein F775_44003                         133   1e-32   
ref|XP_006397360.1|  hypothetical protein EUTSA_v10028721mg             133   1e-32   Eutrema salsugineum [saltwater cress]
gb|EMS61305.1|  hypothetical protein TRIUR3_11917                       132   3e-32   Triticum urartu
dbj|BAJ91151.1|  predicted protein                                      132   7e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW54905.1|  hypothetical protein EUGRSUZ_I00883                     131   1e-31   Eucalyptus grandis [rose gum]
ref|XP_006648837.1|  PREDICTED: uncharacterized protein At4g06744...    131   1e-31   Oryza brachyantha
ref|XP_008456145.1|  PREDICTED: uncharacterized protein At4g06744...    130   1e-31   Cucumis melo [Oriental melon]
dbj|BAJ86489.1|  predicted protein                                      130   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABS78922.1|  At4g06744-like protein                                  125   2e-31   Arabidopsis lyrata subsp. petraea
ref|NP_001141180.1|  uncharacterized protein LOC100273267 precursor     130   2e-31   Zea mays [maize]
gb|ABS78920.1|  At4g06744-like protein                                  124   3e-31   Arabidopsis lyrata subsp. petraea
gb|ABS78905.1|  At4g06744-like protein                                  124   3e-31   Arabidopsis lyrata subsp. petraea
ref|XP_004140807.1|  PREDICTED: uncharacterized protein LOC101203557    133   3e-31   
gb|ABS78915.1|  At4g06744-like protein                                  124   3e-31   Arabidopsis lyrata subsp. lyrata
gb|ABS78911.1|  At4g06744-like protein                                  124   3e-31   Arabidopsis lyrata subsp. lyrata
gb|ABS78901.1|  At4g06744-like protein                                  124   3e-31   Arabidopsis lyrata subsp. petraea
gb|ABS78900.1|  At4g06744-like protein                                  124   3e-31   Arabidopsis lyrata subsp. petraea
gb|ABS78910.1|  At4g06744-like protein                                  124   3e-31   Arabidopsis lyrata subsp. lyrata
gb|EEC78222.1|  hypothetical protein OsI_17861                          128   7e-31   Oryza sativa Indica Group [Indian rice]
gb|ABS78902.1|  At4g06744-like protein                                  123   8e-31   Arabidopsis lyrata subsp. petraea
ref|NP_001054210.2|  Os04g0670100                                       128   9e-31   
ref|XP_010227187.1|  PREDICTED: probable LRR receptor-like serine...    132   1e-30   
gb|AIE88270.1|  hypothetical protein OG_BBa0063K01.1                    128   1e-30   Oryza glaberrima
gb|ABS78906.1|  At4g06744-like protein                                  123   1e-30   Arabidopsis lyrata subsp. petraea
gb|EAZ32358.1|  hypothetical protein OsJ_16568                          128   1e-30   Oryza sativa Japonica Group [Japonica rice]
emb|CAJ86091.1|  H0818H01.13                                            128   1e-30   Oryza sativa [red rice]
gb|EEC73254.1|  hypothetical protein OsI_07372                          126   1e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_006289202.1|  hypothetical protein CARUB_v10002650mg             127   1e-30   Capsella rubella
ref|XP_006855188.1|  hypothetical protein AMTR_s00051p00142580          127   2e-30   Amborella trichopoda
ref|XP_002282474.2|  PREDICTED: uncharacterized protein At4g06744       127   3e-30   Vitis vinifera
gb|ABS78899.1|  At4g06744-like protein                                  121   6e-30   Arabidopsis halleri subsp. halleri
emb|CAN61023.1|  hypothetical protein VITISV_001143                     120   6e-28   Vitis vinifera
ref|XP_009144429.1|  PREDICTED: pollen-specific leucine-rich repe...    112   3e-25   Brassica rapa
emb|CDY72552.1|  BnaCnng78240D                                          112   5e-25   Brassica napus [oilseed rape]
emb|CDY18974.1|  BnaC01g20940D                                          111   6e-25   Brassica napus [oilseed rape]
ref|XP_006851044.1|  hypothetical protein AMTR_s00025p00231860          113   9e-25   
gb|AFW62990.1|  leucine-rich repeat (LRR) family protein                110   1e-24   
emb|CDY49661.1|  BnaC09g41390D                                          109   2e-24   Brassica napus [oilseed rape]
ref|XP_006451101.1|  hypothetical protein CICLE_v100107082mg            107   6e-24   
ref|XP_007152809.1|  hypothetical protein PHAVU_004G161500g             110   1e-23   Phaseolus vulgaris [French bean]
ref|XP_009627507.1|  PREDICTED: leucine-rich repeat extensin-like...    108   2e-23   Nicotiana tomentosiformis
ref|XP_006476103.1|  PREDICTED: leucine-rich repeat extensin-like...    109   3e-23   
ref|XP_009627506.1|  PREDICTED: leucine-rich repeat extensin-like...    108   3e-23   Nicotiana tomentosiformis
gb|KDO74484.1|  hypothetical protein CISIN_1g045950mg                   106   3e-23   Citrus sinensis [apfelsine]
ref|XP_006420010.1|  hypothetical protein CICLE_v10005037mg             106   5e-23   Citrus clementina [clementine]
ref|XP_009760538.1|  PREDICTED: leucine-rich repeat extensin-like...    108   6e-23   Nicotiana sylvestris
ref|XP_002515589.1|  LRX1, putative                                     107   6e-23   
ref|XP_006489595.1|  PREDICTED: leucine-rich repeat extensin-like...    105   9e-23   Citrus sinensis [apfelsine]
emb|CBI32375.3|  unnamed protein product                                104   1e-22   Vitis vinifera
ref|XP_007034837.1|  Leucine-rich repeat (LRR) family protein, pu...    104   2e-22   
ref|XP_004512961.1|  PREDICTED: leucine-rich repeat extensin-like...    107   2e-22   Cicer arietinum [garbanzo]
gb|ACU18125.1|  unknown                                                 103   2e-22   Glycine max [soybeans]
ref|XP_008776836.1|  PREDICTED: leucine-rich repeat extensin-like...    105   3e-22   
ref|XP_006384469.1|  hypothetical protein POPTR_0004s153601g            104   6e-22   
ref|XP_010088853.1|  Leucine-rich repeat extensin-like protein 4        105   7e-22   
ref|XP_006282938.1|  hypothetical protein CARUB_v100074500mg            103   8e-22   
emb|CDX94809.1|  BnaC03g43790D                                          103   9e-22   
ref|XP_010249819.1|  PREDICTED: leucine-rich repeat extensin-like...    104   9e-22   
ref|XP_006353562.1|  PREDICTED: leucine-rich repeat extensin-like...    104   1e-21   
ref|XP_006366874.1|  PREDICTED: leucine-rich repeat extensin-like...    104   1e-21   
gb|KEH27082.1|  LRR extensin-like protein                               104   1e-21   
ref|XP_010501433.1|  PREDICTED: leucine-rich repeat extensin-like...  99.4    1e-21   
ref|XP_008796915.1|  PREDICTED: leucine-rich repeat extensin-like...    104   1e-21   
ref|XP_003620502.1|  Extensin-like protein                              104   1e-21   
ref|XP_008786172.1|  PREDICTED: leucine-rich repeat extensin-like...    103   2e-21   
emb|CDX93014.1|  BnaA03g37360D                                          102   2e-21   
ref|XP_010925532.1|  PREDICTED: leucine-rich repeat extensin-like...    102   2e-21   
ref|XP_004252054.1|  PREDICTED: leucine-rich repeat extensin-like...    103   2e-21   
ref|XP_006389464.1|  hypothetical protein POPTR_0024s00730g             102   2e-21   
gb|KFK40601.1|  hypothetical protein AALP_AA2G016700                    103   2e-21   
ref|XP_009608702.1|  PREDICTED: leucine-rich repeat extensin-like...    103   3e-21   
ref|XP_006389336.1|  hypothetical protein POPTR_0028s00200g             102   3e-21   
ref|XP_006300268.1|  hypothetical protein CARUB_v100163570mg            101   3e-21   
ref|XP_002888025.1|  hypothetical protein ARALYDRAFT_475099             103   4e-21   
ref|XP_003556064.1|  PREDICTED: leucine-rich repeat extensin-like...    100   4e-21   
ref|XP_010251965.1|  PREDICTED: leucine-rich repeat extensin-like...    103   4e-21   
ref|XP_010533784.1|  PREDICTED: leucine-rich repeat extensin-like...    103   4e-21   
ref|XP_011005677.1|  PREDICTED: pollen-specific leucine-rich repe...    103   4e-21   
ref|XP_010259122.1|  PREDICTED: leucine-rich repeat extensin-like...    100   4e-21   
ref|XP_011001177.1|  PREDICTED: pollen-specific leucine-rich repe...    103   4e-21   
ref|XP_010533785.1|  PREDICTED: leucine-rich repeat extensin-like...    103   4e-21   
dbj|BAF48663.1|  leucine-rich repeat/extensin                           102   4e-21   
gb|KDP32304.1|  hypothetical protein JCGZ_13229                         102   4e-21   
ref|XP_002440709.1|  hypothetical protein SORBIDRAFT_09g005520          100   5e-21   
ref|XP_009390486.1|  PREDICTED: leucine-rich repeat extensin-like...    102   5e-21   
ref|XP_002279192.1|  PREDICTED: leucine-rich repeat extensin-like...    100   5e-21   
ref|XP_010450227.1|  PREDICTED: leucine-rich repeat extensin-like...    102   5e-21   
ref|XP_009403414.1|  PREDICTED: leucine-rich repeat extensin-like...    102   5e-21   
ref|XP_006414930.1|  hypothetical protein EUTSA_v100275740mg            100   5e-21   
emb|CBI26296.3|  unnamed protein product                                100   6e-21   
ref|XP_002314669.2|  hypothetical protein POPTR_0010s09310g           99.8    6e-21   
ref|XP_010450228.1|  PREDICTED: leucine-rich repeat extensin-like...    102   6e-21   
emb|CDY12948.1|  BnaA09g13260D                                          102   6e-21   
ref|XP_010256147.1|  PREDICTED: leucine-rich repeat extensin-like...  99.8    6e-21   
ref|XP_010440602.1|  PREDICTED: leucine-rich repeat extensin-like...    102   6e-21   
ref|XP_010450229.1|  PREDICTED: leucine-rich repeat extensin-like...    102   7e-21   
ref|XP_009113078.1|  PREDICTED: leucine-rich repeat extensin-like...    102   7e-21   
ref|XP_009113077.1|  PREDICTED: leucine-rich repeat extensin-like...    102   7e-21   
ref|XP_009135898.1|  PREDICTED: leucine-rich repeat extensin-like...    102   7e-21   
ref|XP_011093910.1|  PREDICTED: leucine-rich repeat extensin-like...    102   7e-21   
ref|NP_176434.1|  leucine-rich repeat extensin-like protein 2           102   7e-21   
ref|NP_189091.1|  leucine-rich repeat extensin-like protein 4           100   7e-21   
ref|XP_006379216.1|  hypothetical protein POPTR_0009s11130g             102   8e-21   
sp|O48809.1|LRX2_ARATH  RecName: Full=Leucine-rich repeat extensi...    102   8e-21   
ref|XP_002863246.1|  hypothetical protein ARALYDRAFT_497051             101   8e-21   
ref|XP_007042323.1|  Leucine-rich repeat family protein                 101   9e-21   
ref|XP_010488556.1|  PREDICTED: leucine-rich repeat extensin-like...    100   1e-20   
ref|NP_001150408.1|  receptor-like protein kinase precursor           99.4    1e-20   
gb|ACL53978.1|  unknown                                               99.4    1e-20   
gb|KJB54162.1|  hypothetical protein B456_009G023700                    100   1e-20   
ref|XP_002885650.1|  predicted protein                                  100   1e-20   
gb|EYU25784.1|  hypothetical protein MIMGU_mgv1a026389mg              99.0    1e-20   
ref|XP_009402787.1|  PREDICTED: pollen-specific leucine-rich repe...    101   1e-20   
ref|XP_009381253.1|  PREDICTED: leucine-rich repeat extensin-like...    100   1e-20   
ref|XP_010927122.1|  PREDICTED: leucine-rich repeat extensin-like...    101   1e-20   
emb|CDP14269.1|  unnamed protein product                                101   1e-20   
ref|XP_004960846.1|  PREDICTED: leucine-rich repeat extensin-like...  99.0    2e-20   
ref|NP_193070.1|  leucine-rich repeat extensin-like protein 3           100   2e-20   
ref|XP_010435287.1|  PREDICTED: leucine-rich repeat extensin-like...    100   2e-20   
gb|KJB54163.1|  hypothetical protein B456_009G023700                    100   2e-20   
ref|XP_008793507.1|  PREDICTED: leucine-rich repeat extensin-like...    100   2e-20   
ref|XP_011030644.1|  PREDICTED: leucine-rich repeat extensin-like...  98.6    2e-20   
ref|XP_010431693.1|  PREDICTED: leucine-rich repeat extensin-like...    100   2e-20   
ref|XP_009408826.1|  PREDICTED: leucine-rich repeat extensin-like...    100   2e-20   
ref|XP_010932003.1|  PREDICTED: pollen-specific leucine-rich repe...    100   2e-20   
ref|XP_002281292.2|  PREDICTED: leucine-rich repeat extensin-like...    100   2e-20   
ref|XP_011078360.1|  PREDICTED: leucine-rich repeat extensin-like...  99.4    2e-20   
ref|XP_011078162.1|  PREDICTED: leucine-rich repeat extensin-like...    100   2e-20   
ref|XP_010473462.1|  PREDICTED: leucine-rich repeat extensin-like...    100   2e-20   
ref|XP_004496690.1|  PREDICTED: leucine-rich repeat extensin-like...  98.2    2e-20   
ref|XP_010513507.1|  PREDICTED: leucine-rich repeat extensin-like...    100   3e-20   
ref|XP_010473463.1|  PREDICTED: leucine-rich repeat extensin-like...    100   3e-20   
ref|XP_008775577.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    100   3e-20   
emb|CDX88190.1|  BnaA06g27810D                                        98.2    3e-20   
ref|XP_007013226.1|  Leucine-rich repeat family protein                 100   3e-20   
gb|KJB79256.1|  hypothetical protein B456_013G040400                  99.0    3e-20   
ref|XP_011019702.1|  PREDICTED: leucine-rich repeat extensin-like...  98.6    4e-20   
emb|CDY19550.1|  BnaC09g13530D                                          100   4e-20   
ref|XP_009151086.1|  PREDICTED: leucine-rich repeat extensin-like...  97.8    4e-20   
ref|XP_002308630.2|  hypothetical protein POPTR_0006s26190g           98.6    4e-20   
ref|XP_011019700.1|  PREDICTED: leucine-rich repeat extensin-like...  98.6    4e-20   
ref|XP_011043443.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  99.8    4e-20   
ref|XP_011019699.1|  PREDICTED: leucine-rich repeat extensin-like...  98.6    5e-20   
ref|XP_004287084.1|  PREDICTED: leucine-rich repeat extensin-like...  99.8    5e-20   
ref|XP_004173680.1|  PREDICTED: leucine-rich repeat extensin-like...  98.2    5e-20   
ref|XP_001759047.1|  predicted protein                                98.2    5e-20   
gb|KDP27758.1|  hypothetical protein JCGZ_19787                       99.8    5e-20   
ref|XP_008463374.1|  PREDICTED: leucine-rich repeat extensin-like...  99.8    6e-20   
ref|XP_006371912.1|  hypothetical protein POPTR_0018s06150g           98.6    6e-20   
dbj|BAF48665.1|  leucine-rich repeat/extensin 1                       99.4    6e-20   
ref|XP_009385321.1|  PREDICTED: pollen-specific leucine-rich repe...  99.0    6e-20   
ref|XP_008438627.1|  PREDICTED: leucine-rich repeat extensin-like...  97.1    6e-20   
ref|NP_001131493.1|  leucine-rich repeat (LRR) family protein pre...  97.4    7e-20   
ref|XP_010999749.1|  PREDICTED: pollen-specific leucine-rich repe...  99.8    7e-20   
ref|XP_006300825.1|  hypothetical protein CARUB_v10019913mg           99.0    7e-20   
ref|XP_010252148.1|  PREDICTED: leucine-rich repeat extensin-like...  99.4    7e-20   
emb|CDY02276.1|  BnaA03g38910D                                        98.6    8e-20   
ref|XP_009758506.1|  PREDICTED: leucine-rich repeat extensin-like...  99.0    8e-20   
gb|KJB47441.1|  hypothetical protein B456_008G026700                  98.6    8e-20   
ref|XP_007143301.1|  hypothetical protein PHAVU_007G060800g           96.7    9e-20   
ref|XP_010501434.1|  PREDICTED: leucine-rich repeat extensin-like...  97.8    1e-19   
ref|XP_006381178.1|  hypothetical protein POPTR_0006s08110g           96.3    1e-19   
gb|KGN56949.1|  hypothetical protein Csa_3G146350                     96.3    1e-19   
ref|XP_004139428.1|  PREDICTED: leucine-rich repeat extensin-like...  98.6    1e-19   
ref|XP_006394807.1|  hypothetical protein EUTSA_v10004209mg           97.1    1e-19   
ref|XP_008344101.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  97.8    1e-19   
ref|XP_008458246.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  98.6    1e-19   
ref|XP_009417528.1|  PREDICTED: leucine-rich repeat extensin-like...  98.6    1e-19   
emb|CDO99097.1|  unnamed protein product                              97.1    1e-19   
ref|XP_004134434.1|  PREDICTED: leucine-rich repeat extensin-like...  96.3    1e-19   
ref|XP_010049719.1|  PREDICTED: leucine-rich repeat extensin-like...  98.6    1e-19   
gb|EEE62542.1|  hypothetical protein OsJ_17340                        95.9    1e-19   
ref|XP_010938335.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  95.9    1e-19   
gb|KDO40432.1|  hypothetical protein CISIN_1g045837mg                 97.4    1e-19   
ref|XP_008800833.1|  PREDICTED: pollen-specific leucine-rich repe...  98.6    1e-19   
emb|CDX89681.1|  BnaC03g45950D                                        98.2    2e-19   
gb|KGN60627.1|  hypothetical protein Csa_2G004760                     98.2    2e-19   
gb|EYU21900.1|  hypothetical protein MIMGU_mgv1a006829mg              96.3    2e-19   
ref|XP_006286011.1|  hypothetical protein CARUB_v10007539mg           95.9    2e-19   
ref|XP_009352479.1|  PREDICTED: leucine-rich repeat extensin-like...  97.4    2e-19   
ref|XP_009385615.1|  PREDICTED: leucine-rich repeat extensin-like...  97.8    2e-19   
ref|XP_009336917.1|  PREDICTED: leucine-rich repeat extensin-like...  98.2    2e-19   
ref|XP_010559035.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  95.5    2e-19   
gb|EYU41449.1|  hypothetical protein MIMGU_mgv1a007525mg              95.9    2e-19   
emb|CDX80525.1|  BnaC07g29190D                                        95.9    2e-19   
ref|XP_002867451.1|  leucine-rich repeat family protein               95.5    2e-19   
gb|KCW60691.1|  hypothetical protein EUGRSUZ_H03422                   95.1    2e-19   
ref|XP_006654107.1|  PREDICTED: leucine-rich repeat extensin-like...  95.1    2e-19   
ref|XP_009415697.1|  PREDICTED: leucine-rich repeat extensin-like...  97.4    3e-19   
gb|EYU24926.1|  hypothetical protein MIMGU_mgv1a006719mg              95.9    3e-19   
gb|EAY96763.1|  hypothetical protein OsI_18683                        95.5    3e-19   
ref|XP_002457818.1|  hypothetical protein SORBIDRAFT_03g014350        95.5    3e-19   
ref|NP_001054807.1|  Os05g0180300                                     95.5    3e-19   
gb|EPS61338.1|  hypothetical protein M569_13456                       95.1    3e-19   
ref|XP_009413897.1|  PREDICTED: leucine-rich repeat extensin-like...  94.7    3e-19   
ref|NP_194567.1|  leucine-rich repeat (LRR) family protein            95.1    3e-19   
ref|XP_010476158.1|  PREDICTED: leucine-rich repeat extensin-like...  97.1    3e-19   
dbj|BAJ85515.1|  predicted protein                                    95.1    3e-19   
ref|XP_010251730.1|  PREDICTED: pollen-specific leucine-rich repe...  96.7    4e-19   
ref|XP_010024229.1|  PREDICTED: leucine-rich repeat extensin-like...  94.7    4e-19   
ref|XP_010914722.1|  PREDICTED: pollen-specific leucine-rich repe...  97.1    4e-19   
ref|XP_010418239.1|  PREDICTED: leucine-rich repeat extensin-like...  97.1    4e-19   
ref|XP_009136284.1|  PREDICTED: pollen-specific leucine-rich repe...  97.4    4e-19   
ref|XP_010458626.1|  PREDICTED: leucine-rich repeat extensin-like...  97.1    4e-19   
gb|KDO79655.1|  hypothetical protein CISIN_1g041736mg                 95.9    4e-19   
ref|XP_006450582.1|  hypothetical protein CICLE_v10010264mg           95.9    4e-19   
ref|XP_008242638.1|  PREDICTED: leucine-rich repeat extensin-like...  96.7    5e-19   
ref|XP_009599187.1|  PREDICTED: pollen-specific leucine-rich repe...  96.3    5e-19   
gb|KJB06895.1|  hypothetical protein B456_001G004000                  95.9    5e-19   
ref|XP_006476177.1|  PREDICTED: leucine-rich repeat extensin-like...  95.9    5e-19   
ref|XP_002514492.1|  LRX2, putative                                   96.7    6e-19   
gb|KJB77687.1|  hypothetical protein B456_012G150700                  95.9    6e-19   
gb|KDP40220.1|  hypothetical protein JCGZ_02218                       94.0    6e-19   
ref|XP_004148723.1|  PREDICTED: leucine-rich repeat extensin-like...  96.3    6e-19   
ref|XP_006412962.1|  hypothetical protein EUTSA_v10027136mg           94.0    7e-19   
gb|EEE61292.1|  hypothetical protein OsJ_15379                        94.7    7e-19   
gb|KGN65364.1|  hypothetical protein Csa_1G383520                     96.3    7e-19   
ref|XP_004170319.1|  PREDICTED: leucine-rich repeat extensin-like...  96.3    7e-19   
ref|XP_008224262.1|  PREDICTED: leucine-rich repeat extensin-like...  94.0    7e-19   
ref|XP_006391867.1|  hypothetical protein EUTSA_v10023291mg           96.3    7e-19   
gb|KJB72347.1|  hypothetical protein B456_011G172700                  94.0    7e-19   
gb|KJB06894.1|  hypothetical protein B456_001G004000                  95.9    7e-19   
ref|XP_009119384.1|  PREDICTED: pollen-specific leucine-rich repe...  96.3    7e-19   
gb|EMT25064.1|  hypothetical protein F775_07652                       93.6    7e-19   
ref|XP_006285388.1|  hypothetical protein CARUB_v10006785mg           96.3    7e-19   
ref|XP_009626397.1|  PREDICTED: leucine-rich repeat extensin-like...  94.0    7e-19   
ref|XP_006494306.1|  PREDICTED: pollen-specific leucine-rich repe...  96.7    8e-19   
gb|KJB06897.1|  hypothetical protein B456_001G004000                  95.9    8e-19   
ref|XP_004512856.1|  PREDICTED: leucine-rich repeat extensin-like...  95.9    8e-19   
ref|XP_006838987.1|  hypothetical protein AMTR_s00002p00271610        95.1    8e-19   
ref|XP_007013716.1|  Leucine-rich repeat family protein               95.9    8e-19   
ref|XP_010664614.1|  PREDICTED: pollen-specific leucine-rich repe...  95.1    8e-19   
gb|KDO52192.1|  hypothetical protein CISIN_1g035831mg                 94.4    8e-19   
ref|XP_010525315.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  94.0    8e-19   
ref|NP_001050725.1|  Os03g0637600                                     94.0    9e-19   
gb|EAY91133.1|  hypothetical protein OsI_12740                        94.0    9e-19   
ref|XP_010520859.1|  PREDICTED: leucine-rich repeat extensin-like...  94.4    1e-18   
ref|XP_002982230.1|  hypothetical protein SELMODRAFT_54019            94.0    1e-18   
ref|XP_002455064.1|  hypothetical protein SORBIDRAFT_03g003730        95.1    1e-18   
ref|XP_010527189.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  95.9    1e-18   
gb|KJB06896.1|  hypothetical protein B456_001G004000                  95.9    1e-18   
gb|KFK27830.1|  hypothetical protein AALP_AA8G435400                  94.4    1e-18   
ref|XP_006360809.1|  PREDICTED: leucine-rich repeat extensin-like...  93.6    1e-18   
gb|EEC70617.1|  hypothetical protein OsI_01869                        94.7    1e-18   
ref|XP_006414071.1|  hypothetical protein EUTSA_v10024510mg           95.9    1e-18   
ref|XP_006304470.1|  hypothetical protein CARUB_v10011166mg           95.5    1e-18   
ref|XP_010466571.1|  PREDICTED: leucine-rich repeat extensin-like...  94.7    1e-18   
ref|XP_010488313.1|  PREDICTED: leucine-rich repeat extensin-like...  94.4    1e-18   
ref|XP_002984203.1|  hypothetical protein SELMODRAFT_423462           93.6    1e-18   
ref|XP_003532491.1|  PREDICTED: leucine-rich repeat extensin-like...  95.5    1e-18   
ref|XP_003568808.1|  PREDICTED: leucine-rich repeat extensin-like...  93.6    1e-18   
gb|KFK29358.1|  hypothetical protein AALP_AA7G123800                  93.6    1e-18   
ref|XP_002972291.1|  hypothetical protein SELMODRAFT_412903           93.6    1e-18   
gb|KFK36221.1|  hypothetical protein AALP_AA4G093700                  95.9    1e-18   
gb|KJB79255.1|  hypothetical protein B456_013G040300                  94.7    1e-18   
ref|XP_006480071.1|  PREDICTED: pollen-specific leucine-rich repe...  95.9    1e-18   
ref|XP_010925096.1|  PREDICTED: leucine-rich repeat extensin-like...  94.0    1e-18   
ref|NP_179188.1|  pollen-specific leucine-rich repeat extensin-li...  95.1    1e-18   
ref|XP_007226551.1|  hypothetical protein PRUPE_ppa024854mg           95.1    2e-18   
gb|AIE39576.1|  leucine-rich repeat extensin-like protein             91.3    2e-18   
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...  95.5    2e-18   
ref|XP_010254179.1|  PREDICTED: leucine-rich repeat extensin-like...  95.5    2e-18   
ref|XP_007227690.1|  hypothetical protein PRUPE_ppa1027218m2g         93.2    2e-18   
ref|XP_002519151.1|  protein binding protein, putative                95.5    2e-18   
emb|CDY34233.1|  BnaA01g24500D                                        92.8    2e-18   
ref|XP_006289956.1|  hypothetical protein CARUB_v10003584mg           93.6    2e-18   
ref|XP_010449482.1|  PREDICTED: leucine-rich repeat extensin-like...  95.1    2e-18   
emb|CDY46593.1|  BnaCnng14150D                                        92.4    2e-18   
ref|XP_002314670.2|  hypothetical protein POPTR_0010s09320g           92.4    2e-18   
ref|XP_006489442.1|  PREDICTED: leucine-rich repeat extensin-like...  92.8    2e-18   
ref|XP_008219840.1|  PREDICTED: leucine-rich repeat extensin-like...  94.4    2e-18   
ref|XP_009110797.1|  PREDICTED: leucine-rich repeat extensin-like...  93.2    2e-18   
gb|KDO42769.1|  hypothetical protein CISIN_1g036320mg                 92.8    2e-18   
ref|NP_172668.1|  leucine-rich repeat extensin-like protein 1         94.7    2e-18   
ref|XP_006409498.1|  hypothetical protein EUTSA_v10023190mg           94.0    2e-18   



>ref|XP_006360245.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Solanum 
tuberosum]
Length=387

 Score =   197 bits (501),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 123/168 (73%), Gaps = 4/168 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
             NN+L+GCLPYEIG+LK ++VFDAS N+LTGPIPQSFGCLE++E+++L+ NQLYG VPE+
Sbjct  219  FNNQLTGCLPYEIGMLKLASVFDASKNKLTGPIPQSFGCLEQMEVMDLSYNQLYGEVPET  278

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LCK+  LEEL+L  NYFTQIGPECR L+E+ VLDI  NCI+DL NQR  + C+ FFL  +
Sbjct  279  LCKISSLEELTLKYNYFTQIGPECRKLVEENVLDIGMNCIIDLKNQRKPEECETFFLQKR  338

Query  392  KCPDHKSLLYVPCDI-DESPRKAGphphphrpykkhkRGSSTTYAALK  252
             C D KSL YVPC I D S R +           +     STTYAALK
Sbjct  339  NCRDMKSLSYVPCKIHDFSSRNSSSGRAHTTGDART---RSTTYAALK  383



>ref|XP_009793223.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=511

 Score =   200 bits (509),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 125/168 (74%), Gaps = 10/168 (6%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIGLLK +TVFDAS+N+LTGPIP SFGCL  +E+LN++ NQLYG VPES
Sbjct  347  LNNQLSGCLPYEIGLLKLATVFDASVNKLTGPIPHSFGCLRDMELLNVSYNQLYGPVPES  406

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LCKL  LE+L+L  NYFTQ+GPECR L+++KVLDI  NCILDL NQR  + C+ FFL  +
Sbjct  407  LCKLGHLEKLTLKFNYFTQVGPECRKLIKEKVLDISMNCILDLENQRKPEECESFFLQPR  466

Query  392  KCPDHKSLLYVPCDIDE--SPRKAGphphphrpykkhkRGSSTTYAAL  255
            KCPD +SL  VPC+IDE  S R+               R  STTYAA+
Sbjct  467  KCPDMESLSKVPCNIDEFSSGRRP--------HRHLRARARSTTYAAI  506


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 55/102 (54%), Gaps = 11/102 (11%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPI-PQSFGCLEKLEILNLTNNQLYGSVPES  573
            NNKL+G  P  +    N T  D   NQLTGP+ PQ F     L++L L NN   G +PE+
Sbjct  253  NNKLAGPFPKAVLGATNLTYLDVRFNQLTGPVDPQVFTL--DLDVLFLNNNGFSGEIPET  310

Query  572  LCKLKDLEELSLSGNYFT-----QIGPECRNLLEKKVLDIDN  462
              +   L  ++L+ N FT      IG  CRN+LE  VL ++N
Sbjct  311  FGRTAAL-FITLANNRFTGQIPKSIGNACRNILE--VLFLNN  349



>ref|XP_009588943.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=515

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 125/167 (75%), Gaps = 5/167 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L GCLPYEIGLLK +TVFDAS+N+LTGPIP SFGCL  +++LN++ NQLYG VPES
Sbjct  348  LNNQLYGCLPYEIGLLKLATVFDASVNKLTGPIPHSFGCLRDMQLLNISYNQLYGPVPES  407

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LCKL  L++L+L  NYFTQ+GPECR L+++K+LDI  NC+LDL NQR  + C+ FFL  +
Sbjct  408  LCKLSHLQKLTLKFNYFTQVGPECRKLIKEKILDISMNCVLDLENQRKPEECEAFFLQPR  467

Query  392  KCPDHKSLLYVPCDIDE-SPRKAGphphphrpykkhkRGSSTTYAAL  255
            KCPD +SL  VPC+IDE S R++              R  STTYAA+
Sbjct  468  KCPDMESLSKVPCNIDEFSSRQSS----GRAYRHHRARAHSTTYAAI  510


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 55/102 (54%), Gaps = 11/102 (11%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPI-PQSFGCLEKLEILNLTNNQLYGSVPES  573
            NNKL+G  P  +    N T  D   NQLTGP+ PQ F     L++L L NN   G +PE+
Sbjct  254  NNKLAGPFPKAVLGATNLTYLDVRFNQLTGPVDPQVFTL--DLDVLFLNNNGFSGEIPET  311

Query  572  LCKLKDLEELSLSGNYFT-----QIGPECRNLLEKKVLDIDN  462
              +   L  ++L+ N FT      IG  CRN+LE  VL ++N
Sbjct  312  FGRTAAL-FITLANNRFTGEIPKSIGNACRNILE--VLFLNN  350



>ref|XP_004233445.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum lycopersicum]
Length=464

 Score =   191 bits (486),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 124/168 (74%), Gaps = 5/168 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
             NN+L+GCLPYEIG+LK ++VFDAS N+LTGPIPQSFGCL ++E+++L+ NQLYG VPE+
Sbjct  297  FNNQLTGCLPYEIGMLKLASVFDASKNKLTGPIPQSFGCLVQMEVMDLSYNQLYGEVPET  356

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LCK+  LEEL+L  NYFTQIGPECR L+E+ VL+I  NCI+DL NQR  + C+ FFL  +
Sbjct  357  LCKISSLEELTLKYNYFTQIGPECRKLVEENVLNIGMNCIIDLENQRKPEECEAFFLQKR  416

Query  392  KCPDHKSLLYVPCDIDE-SPRKAGphphphrpykkhkRGSSTTYAALK  252
             C D KSL Y+PC + E S R +       R +    +  STTYAA+K
Sbjct  417  NCRDMKSLSYIPCKLHEFSSRNSS----ARRAHTGDAKARSTTYAAVK  460



>gb|KDP47121.1| hypothetical protein JCGZ_22117 [Jatropha curcas]
Length=497

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GCLPYEIG LK +TVFD S N+LTGPIP SFGCL K+EILNL  N+ YG VPE 
Sbjct  327  LNNSFTGCLPYEIGNLKKATVFDVSRNKLTGPIPHSFGCLPKIEILNLATNEFYGPVPEL  386

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+LK L+ LSLSGNYFTQ+GPECR L++ K LD+  NCILDLP+QRSA  C+DFF   +
Sbjct  387  VCELKTLQNLSLSGNYFTQVGPECRKLIKAKRLDVRKNCILDLPDQRSAAQCRDFFSKNR  446

Query  392  KCPDHKSLLYVPC  354
            KCP+ KSL  VPC
Sbjct  447  KCPNEKSLTIVPC  459



>gb|EYU44430.1| hypothetical protein MIMGU_mgv1a005057mg [Erythranthe guttata]
Length=498

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIG LK ST+FDAS N+LTGPIP SFGC+EKL  LN++ N L G VPES
Sbjct  331  LNNQLSGCLPYEIGKLKKSTLFDASANRLTGPIPHSFGCMEKLRYLNVSYNHLSGEVPES  390

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L+DL+EL+L+ NYFTQ+GP CR L++   LDI  NC+LDLP+QRSA  C+ FFL  Q
Sbjct  391  LCRLRDLDELTLNHNYFTQVGPACRKLIKSGKLDIRVNCVLDLPSQRSAAECEAFFLKQQ  450

Query  392  KCPDHKSLLYVPCDIDES  339
             CP+ +S+  VPC ID S
Sbjct  451  YCPNRESMNIVPCKIDYS  468


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 53/98 (54%), Gaps = 7/98 (7%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            NNKL+G  P  +    N T  D   NQLTG +P +   L+ L++L L NNQ  G++PE+L
Sbjct  237  NNKLAGEFPKPVLAATNLTFLDLRFNQLTGKLPPAVFTLD-LDVLFLNNNQFTGNIPETL  295

Query  569  CKLKDLEELSLSGNYFT-----QIGPECRNLLEKKVLD  471
             K   L  L+L+ N FT      IG     L+E  +L+
Sbjct  296  GKTPVL-YLTLANNKFTGTIPHSIGDAANTLIESLLLN  332



>emb|CDP02523.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 116/169 (69%), Gaps = 8/169 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLP EIG L  + + D SINQLTGPIPQSFGCL+ ++ LNL+ NQ YG+VPES
Sbjct  322  LNNSLSGCLPCEIGFLNKTHIVDVSINQLTGPIPQSFGCLKDIQQLNLSYNQFYGAVPES  381

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC L DLE L L  NYFTQ+GPECR L+EKKVL++  NCILDLP QRS + CK FF  + 
Sbjct  382  LCILGDLEVLDLKFNYFTQVGPECRKLIEKKVLNVTMNCILDLPCQRSPEECKAFFSKHW  441

Query  392  KCPDHKSLLYVPCDIDES--PRKAGphphphrpykkhkRGSSTTYAALK  252
             CPD KSL YVPC I+ S  P +A  H              S TYAALK
Sbjct  442  TCPDPKSLNYVPCGINVSKGPPQASDHVPKRARP------PSPTYAALK  484



>ref|XP_006356575.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=444

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIGLL  +TVFDAS NQLTG IP SFGCL K+EILNL  NQ YG+VPE 
Sbjct  282  LNNQLTGCLPYEIGLLSKATVFDASKNQLTGKIPHSFGCLAKMEILNLAQNQFYGAVPEL  341

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +CKL +L+ L+LS NYFT++GPEC+ L++KKVLD+  NCI  LP QRSA+ C  FF   +
Sbjct  342  VCKLCNLKNLTLSYNYFTEVGPECKKLIQKKVLDVRMNCIPGLPMQRSAEECAAFFCKPR  401

Query  392  KCPDHKSLLYVPCDIDES  339
             CPD KS+ +VPC I  S
Sbjct  402  SCPDEKSMGFVPCSIGSS  419



>ref|XP_006406513.1| hypothetical protein EUTSA_v10020680mg [Eutrema salsugineum]
 gb|ESQ47966.1| hypothetical protein EUTSA_v10020680mg [Eutrema salsugineum]
Length=464

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPY+IG L  +TVFD   NQLTGPIP SFGCLEK+E LNL  N  YG++PE 
Sbjct  297  LNNKLTGCLPYQIGKLNQATVFDVEFNQLTGPIPYSFGCLEKMEQLNLARNNFYGTIPEM  356

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L+ +SLS NYFTQ+GP+CR L++KK+LD+  NCILDLPNQR+   C  FF+  Q
Sbjct  357  VCELSALKNVSLSFNYFTQVGPKCRKLIKKKILDVRMNCILDLPNQRTPWECAKFFMRKQ  416

Query  392  KCPDHKSLLYVPCDID  345
             CP+ KS  Y+PC  D
Sbjct  417  NCPNSKSFFYIPCGKD  432



>gb|KCW54907.1| hypothetical protein EUGRSUZ_I00886 [Eucalyptus grandis]
Length=240

 Score =   177 bits (450),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIGLLK +T FDASINQLTGPIP SFGCL+++  LNL+ + LYG VPE+
Sbjct  74   LNNQLSGCLPYEIGLLKKTTTFDASINQLTGPIPHSFGCLQQMNQLNLSYSHLYGPVPET  133

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L  L  L+L+ NYFTQ+GPECR L+ KK L++  NCIL LP+QRS   C  FF    
Sbjct  134  VCMLPKLSALTLNNNYFTQVGPECRKLILKKKLNVRMNCILGLPSQRSPAECDAFFSKKV  193

Query  392  KCPDHKSLLYVPCDIDE  342
            KCP+ +S+ Y+PC I +
Sbjct  194  KCPNERSMRYLPCKISQ  210



>emb|CDX92324.1| BnaA05g20830D [Brassica napus]
Length=459

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPY+IG L  +TVFD   NQLTGPIP SFGCL+K+E LNL  N+ YG++PE 
Sbjct  292  LNNKLTGCLPYQIGKLNQATVFDVEFNQLTGPIPYSFGCLDKMEQLNLARNKFYGTIPEI  351

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L+ +SLS NYFTQ+GP+CR L++KK+LD+  NCILDLP QR+   C  FF+  Q
Sbjct  352  VCELSALKNVSLSFNYFTQVGPKCRELIKKKILDVRMNCILDLPYQRTPWECAKFFMRKQ  411

Query  392  KCPDHKSLLYVPCD  351
            KCP  KS  Y+PCD
Sbjct  412  KCPKSKSFFYMPCD  425



>dbj|BAH19934.1| AT1G49750 [Arabidopsis thaliana]
Length=275

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPY+IG L  +TVFD   NQLTGPIP SFGCLE +E LNL  N+ YG++PE 
Sbjct  105  LNNKLTGCLPYQIGNLTRATVFDVGFNQLTGPIPYSFGCLETMEQLNLAGNKFYGTIPEI  164

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C++  L+ +SLS NYFTQ+GP+CR L+++K++D+  NCILDLPNQ++   C  FF+  Q
Sbjct  165  VCEIACLQNVSLSNNYFTQVGPKCRKLIKRKIMDVSMNCILDLPNQKTPSECAKFFMRKQ  224

Query  392  KCPDHKSLLYVPCD  351
             CP+ KSL  VPCD
Sbjct  225  TCPNSKSLFTVPCD  238



>ref|XP_009145802.1| PREDICTED: uncharacterized protein At4g06744 [Brassica rapa]
Length=459

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPY+IG L  +TVFD   NQLTGPIP SFGCL+K+E LNL  N+ YG++PE 
Sbjct  292  LNNKLTGCLPYQIGKLNQATVFDVEFNQLTGPIPYSFGCLDKMEQLNLARNKFYGTIPEI  351

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L+ +SLS NYFTQ+GP+CR L++KK+LD+  NCILDLP QR+   C  FF+  Q
Sbjct  352  VCELSALKNVSLSFNYFTQVGPKCRELIKKKILDVRMNCILDLPYQRTPWECAKFFMRKQ  411

Query  392  KCPDHKSLLYVPCD  351
            KCP  KS  Y+PCD
Sbjct  412  KCPKSKSFFYMPCD  425



>gb|KJB77660.1| hypothetical protein B456_012G149500 [Gossypium raimondii]
Length=449

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIG L  STVFDAS N+LTGPIP SFGCL+K++IL+LTNNQ YG VPE+
Sbjct  282  LNNQLTGCLPYEIGNLTQSTVFDASSNKLTGPIPYSFGCLKKMQILSLTNNQFYGEVPET  341

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +CKL  L +LSLS NYFT +GP CR L+EKK LD+  NCI  LPNQRS + C +FFL  +
Sbjct  342  VCKLPMLNKLSLSNNYFTHVGPACRGLIEKKKLDVKKNCIYGLPNQRSEKECVEFFLKKK  401

Query  392  KCPDHKSLLYVPC  354
             CP  ++  +VPC
Sbjct  402  DCPRMETFYWVPC  414



>ref|XP_010028214.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=513

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIGLLK +T FDASINQLTGPIP SFGCL+++  LNL+ N LYG VPE+
Sbjct  347  LNNQLSGCLPYEIGLLKKTTTFDASINQLTGPIPHSFGCLQQMNQLNLSCNHLYGPVPET  406

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L  L  L+L+ NYFTQ+GPECR L+ KK LD+  NCIL LP+QRS   C  FF    
Sbjct  407  VCVLPKLSALTLNNNYFTQVGPECRKLILKKKLDVRMNCILGLPSQRSPAECDAFFSKKV  466

Query  392  KCPDHKSLLYVPCDIDES  339
            KCP+ KS+ YVPC I +S
Sbjct  467  KCPNEKSMRYVPCKISQS  484


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 55/101 (54%), Gaps = 9/101 (9%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            NNKL G  P  +    N T  D   N LTGPIP     L+ LE+L L NN+  G++PE+L
Sbjct  253  NNKLRGAFPLTVLGATNLTFLDLRFNNLTGPIPAQVFTLD-LEVLFLNNNEFNGAIPENL  311

Query  569  CKLKDLEELSLSGNYFT-----QIGPECRNLLEKKVLDIDN  462
             K   +  L+L+ N FT      IG   ++LLE  VL ++N
Sbjct  312  GK-TPVSYLTLANNKFTGPIPRSIGQTSKSLLE--VLFLNN  349



>emb|CDX99236.1| BnaC05g33510D [Brassica napus]
Length=458

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPY+IG L  +TVFD   N LTGPIP SFGCL+K+E LNL  N+ YG++PE 
Sbjct  291  LNNKLTGCLPYQIGKLNQATVFDVEFNLLTGPIPYSFGCLDKMEQLNLARNKFYGTIPEI  350

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L+ +SLS NYFTQ+GP+CR L++KK+LD+  NCILDLP QR+   C  FF+  Q
Sbjct  351  VCELSALKNISLSFNYFTQVGPKCRELIKKKILDVRMNCILDLPYQRTPWECAKFFMRKQ  410

Query  392  KCPDHKSLLYVPCD  351
            KCP  KS  Y+PCD
Sbjct  411  KCPKSKSFFYMPCD  424



>ref|XP_004248758.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum lycopersicum]
Length=442

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIGLL  +TVFD S NQLTG IP SFGCL K+EILNL  NQ YG+VPE 
Sbjct  280  LNNQLTGCLPYEIGLLSKATVFDVSKNQLTGKIPHSFGCLAKIEILNLAQNQFYGAVPEL  339

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +CKL +L+ L+LS NYF ++GPEC+ L+EK+VLDI  NCI  LP QRSA+ C  FF   +
Sbjct  340  VCKLCNLKNLTLSYNYFNEVGPECKKLIEKRVLDIKMNCIPGLPMQRSAEECAAFFCKPR  399

Query  392  KCPDHKSLLYVPCDI  348
             CPD KSL +VPC +
Sbjct  400  SCPDEKSLGFVPCSV  414



>ref|XP_011099103.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=487

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 109/143 (76%), Gaps = 3/143 (2%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            NN+LSGCLP EIGLL+ +TVFDAS N LTGPIP SFGCL+ +   N++ NQLYG+VPE L
Sbjct  323  NNQLSGCLPPEIGLLQKATVFDASANHLTGPIPHSFGCLKNMLFFNMSYNQLYGAVPEPL  382

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            C L  L EL+L  NYFTQ+GP+CR L+  K LDI  NCILDLP+QRSA  C+ FFL+ Q 
Sbjct  383  CNLGSLIELTLKFNYFTQVGPKCRKLIMSKKLDISMNCILDLPSQRSAAECETFFLNQQS  442

Query  389  CPDHKSLL-YVPCDID--ESPRK  330
            CPD +SL+ Y+PC ID  ESP +
Sbjct  443  CPDPQSLINYMPCKIDNHESPEE  465



>gb|KDP47120.1| hypothetical protein JCGZ_22116 [Jatropha curcas]
Length=455

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N+ +GCLPYEIG LK +TVFD S N LTGPIP SF CL K++ILNL NN  YG VPE 
Sbjct  287  LKNQFTGCLPYEIGNLKKATVFDVSCNMLTGPIPHSFACLAKIQILNLANNGFYGPVPEM  346

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L +L+ LSLSGN+FTQ+GPECR L+  K +D+  NCILDLP QRSA  CK+FF   +
Sbjct  347  VCQLPNLQNLSLSGNFFTQVGPECRKLIMLKRIDVGQNCILDLPYQRSADECKEFFSKRR  406

Query  392  KCPDHKSLLYVPC  354
             CP+ KSL YVPC
Sbjct  407  TCPNEKSLTYVPC  419



>ref|XP_004170987.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Cucumis 
sativus]
Length=357

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            +NKLSGCLP EIGLL+N+ +FDAS N LTGPIP SF CL K+++LN  NN LYG+VPE +
Sbjct  192  DNKLSGCLPMEIGLLENTILFDASKNSLTGPIPFSFSCLAKMQVLNFANNTLYGAVPEGV  251

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            CKL D+++L+L  N+ TQ+GP CR+L+ KKVLD+  NCIL LP Q+S + C  FF H + 
Sbjct  252  CKLPDIQQLTLRNNFITQVGPICRSLISKKVLDVSGNCILGLPEQKSEEECTHFFTHVEL  311

Query  389  CPDHKSLLYVPC  354
            CPD KS+ Y+PC
Sbjct  312  CPDEKSMKYIPC  323



>ref|NP_188563.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 dbj|BAB02456.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76223.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=493

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPY+IG L  +TVFD  +NQLTGPIP SFGCL+K+E LNL  N  YG++PE 
Sbjct  326  LNNKLTGCLPYQIGNLNRATVFDVELNQLTGPIPYSFGCLKKMEQLNLARNNFYGTIPEI  385

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L+ LSLS NYFTQ+GP+CR L+++K+LD+  NCILDL NQR+   C  FFL  Q
Sbjct  386  VCELSALKNLSLSYNYFTQVGPKCRTLIKRKILDVGMNCILDLTNQRTPWECAKFFLRKQ  445

Query  392  KCPDHKSLLYVPCDID  345
             CP+ KS  Y+PC  D
Sbjct  446  SCPNFKSFFYLPCGKD  461



>gb|KDO59787.1| hypothetical protein CISIN_1g011101mg [Citrus sinensis]
Length=493

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GCLPYEIG L NSTVFD   N+LTGPIP SFGCL  ++ LNL  NQ YG VPE 
Sbjct  327  LNNFFTGCLPYEIGFLSNSTVFDVGNNRLTGPIPHSFGCLSSMQYLNLAMNQFYGPVPEI  386

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L  LSLS NYFTQ+GPECR L+++KVLD+  NCILDLPNQRS + C  FF   +
Sbjct  387  VCQLPKLVNLSLSYNYFTQVGPECRKLIKRKVLDVRMNCILDLPNQRSREECGKFFSESK  446

Query  392  KCPDHKSLLYVPCDIDES  339
            KCP+ +SL  VPC  + S
Sbjct  447  KCPNERSLTLVPCARNRS  464



>gb|AEI72268.1| leucine-rich repeat family protein [Citrus trifoliata]
Length=448

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GCLPYEIG L NSTVFD   N+LTGPIP SFGCL  ++ LNL  NQ YG VPE 
Sbjct  282  LNNFFTGCLPYEIGFLSNSTVFDVGNNRLTGPIPHSFGCLSGMQFLNLAMNQFYGPVPEI  341

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L  LSLS NYFTQ+GPECR L+++KVLD+  NCILDLPNQRS + C  FF   +
Sbjct  342  VCQLPKLVNLSLSYNYFTQVGPECRKLIKRKVLDVRMNCILDLPNQRSPEECGKFFSESK  401

Query  392  KCPDHKSLLYVPC  354
            KCP+ +SL  VPC
Sbjct  402  KCPNERSLTLVPC  414



>ref|XP_006422961.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
 gb|ESR36201.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
Length=504

 Score =   179 bits (453),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GCLPYEIG L NSTVFD   N+LTGPIP SFGCL  ++ LNL  NQ YG VPE 
Sbjct  338  LNNFFTGCLPYEIGFLSNSTVFDVGNNRLTGPIPHSFGCLSSMQYLNLAMNQFYGPVPEI  397

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L  LSLS NYFTQ+GPECR L+++KVLD+  NCILDLPNQRS + C  FF   +
Sbjct  398  VCQLPKLVNLSLSYNYFTQVGPECRKLIKRKVLDVRMNCILDLPNQRSREECGKFFSESK  457

Query  392  KCPDHKSLLYVPC  354
            KCP+ +SL  VPC
Sbjct  458  KCPNERSLTLVPC  470



>ref|XP_006393218.1| hypothetical protein EUTSA_v10011424mg [Eutrema salsugineum]
 gb|ESQ30504.1| hypothetical protein EUTSA_v10011424mg [Eutrema salsugineum]
Length=496

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPY+IG L  +TVFD   NQLTGPIP SFGCL+K+E LNL  N+ YG++PE 
Sbjct  326  LNNQLTGCLPYQIGKLNRATVFDVGFNQLTGPIPYSFGCLDKMEQLNLARNKFYGAIPEI  385

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C++  L+ LSLS NYFTQ+GP+CR L+++ +LD+  NCILDLPNQ+++Q C DFF+  Q
Sbjct  386  VCEISCLKNLSLSYNYFTQVGPKCRQLIKRNILDVRMNCILDLPNQKTSQECADFFMRKQ  445

Query  392  KCPDHKSLLYVPC  354
             CP+ KS+  +PC
Sbjct  446  TCPNSKSMFRIPC  458



>ref|NP_175397.1| leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
 gb|AAG13059.1|AC011807_18 Unknown protein [Arabidopsis thaliana]
 gb|AAS47632.1| At1g49750 [Arabidopsis thaliana]
 gb|AAS76756.1| At1g49750 [Arabidopsis thaliana]
 dbj|BAH19559.1| AT1G49750 [Arabidopsis thaliana]
 gb|AEE32471.1| leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
Length=494

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPY+IG L  +TVFD   NQLTGPIP SFGCLE +E LNL  N+ YG++PE 
Sbjct  324  LNNKLTGCLPYQIGNLTRATVFDVGFNQLTGPIPYSFGCLETMEQLNLAGNKFYGTIPEI  383

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C++  L+ +SLS NYFTQ+GP+CR L+++K++D+  NCILDLPNQ++   C  FF+  Q
Sbjct  384  VCEIACLQNVSLSNNYFTQVGPKCRKLIKRKIMDVSMNCILDLPNQKTPSECAKFFMRKQ  443

Query  392  KCPDHKSLLYVPCD  351
             CP+ KSL  VPCD
Sbjct  444  TCPNSKSLFTVPCD  457



>ref|XP_004137107.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=459

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            +NKLSGCLP EIGLL+N+ +FDAS N LTGPIP SF CL K+++LN  NN LYG+VPE +
Sbjct  294  DNKLSGCLPMEIGLLENTILFDASKNSLTGPIPFSFSCLAKMQVLNFANNTLYGAVPEGV  353

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            CKL D+++L+L  N+ TQ+GP CR+L+ KKVLD+  NCIL LP Q+S + C  FF H + 
Sbjct  354  CKLPDIQQLTLRNNFITQVGPICRSLISKKVLDVSGNCILGLPEQKSEEECTHFFTHVEL  413

Query  389  CPDHKSLLYVPC  354
            CPD KS+ Y+PC
Sbjct  414  CPDEKSMKYIPC  425



>gb|KGN43906.1| hypothetical protein Csa_7G073420 [Cucumis sativus]
Length=488

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            +NKLSGCLP EIGLL+N+ +FDAS N LTGPIP SF CL K+++LN  NN LYG+VPE +
Sbjct  323  DNKLSGCLPMEIGLLENTILFDASKNSLTGPIPFSFSCLAKMQVLNFANNTLYGAVPEGV  382

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            CKL D+++L+L  N+ TQ+GP CR+L+ KKVLD+  NCIL LP Q+S + C  FF H + 
Sbjct  383  CKLPDIQQLTLRNNFITQVGPICRSLISKKVLDVSGNCILGLPEQKSEEECTHFFTHVEL  442

Query  389  CPDHKSLLYVPC  354
            CPD KS+ Y+PC
Sbjct  443  CPDEKSMKYIPC  454



>ref|XP_010555995.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=481

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPYEIG L  +TVFD   NQLTGPIP SFGCL K+E LNL  N+ YG+VPE 
Sbjct  312  LNNALTGCLPYEIGKLNQATVFDVGFNQLTGPIPYSFGCLGKMEQLNLARNKFYGAVPEI  371

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L  ++ LSLS NYFTQ+GP+CR L++K+VLD+  NCILDLPNQRS   C  FF+  +
Sbjct  372  VCDLPRIQNLSLSYNYFTQVGPKCRELIKKRVLDVRMNCILDLPNQRSPDDCAKFFMRKE  431

Query  392  KCPDHKSLLYVPC  354
             CP+ +S+ ++PC
Sbjct  432  SCPNPESVFWMPC  444



>ref|XP_002885307.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61566.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPY+IG L  +TVFD   NQLTG IP SFGCL K+E LNL  N  YG++PE 
Sbjct  327  LNNKLTGCLPYQIGNLNRATVFDVESNQLTGLIPYSFGCLNKMEQLNLARNNFYGTIPEI  386

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L+ LSLS NYFTQ+GP+CR L+++K+LD+  NCILDL NQR+   C  FFL  Q
Sbjct  387  VCELSALKNLSLSSNYFTQVGPKCRTLIKRKILDVGMNCILDLANQRAPWECAKFFLRKQ  446

Query  392  KCPDHKSLLYVPCDID  345
             CP++KS  YVPC  D
Sbjct  447  SCPNYKSFFYVPCGKD  462



>ref|XP_002282482.2| PREDICTED: uncharacterized protein At4g06744-like [Vitis vinifera]
Length=507

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIG LK++TVFD   NQLTGPIP SFGCL+ ++ILNL  NQ YG VPE+
Sbjct  348  LNNQLSGCLPYEIGYLKDATVFDVGFNQLTGPIPHSFGCLDSIQILNLAANQFYGPVPET  407

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L +L  LSLS NYFTQ+GP+CR L+ +K LD+  NCIL LP Q+    C  FF   +
Sbjct  408  LCELPNLYNLSLSHNYFTQVGPKCRKLITEKKLDVRMNCILGLPQQKPEHACSHFFSQVR  467

Query  392  KCPDHKSLLYVPC  354
            +CPD KS + VPC
Sbjct  468  QCPDPKSFIKVPC  480



>ref|XP_008454973.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=520

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            NNKLSGCLP EIGLL+N+ +FDAS N LTGPIP SF CL K+++LN  +N LYG+VPE +
Sbjct  355  NNKLSGCLPMEIGLLENTILFDASNNSLTGPIPYSFACLAKIQLLNFADNTLYGAVPEGV  414

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            CKL +++ L+L  N+ TQ+GP CR+L+ KKVLD+  NCIL LP QRS + C  FF H + 
Sbjct  415  CKLPNIQNLTLRNNFITQVGPVCRSLISKKVLDVSGNCILGLPEQRSEEECTHFFTHVEL  474

Query  389  CPDHKSLLYVPC  354
            CPD KS+ Y+PC
Sbjct  475  CPDEKSMKYIPC  486



>ref|XP_002518709.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43634.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=510

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GCLPYEIG L  + VFD S N+LTGPIP SFGCL  +EILNL  NQ YG VPE 
Sbjct  337  LNNGFTGCLPYEIGFLTKTRVFDVSCNKLTGPIPHSFGCLSMIEILNLAKNQFYGPVPEI  396

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +CKL +L+ LSLSGNYFTQ+GPECR L+  + LD+ NNCIL LPNQR  + C +FF   +
Sbjct  397  VCKLPNLQNLSLSGNYFTQVGPECRKLISLRRLDVRNNCILGLPNQRPPKACTEFFSKPK  456

Query  392  KCPDHKSLLYVPC  354
            +C + +S+ Y+PC
Sbjct  457  QCANERSMNYIPC  469



>emb|CDY43618.1| BnaC09g17570D [Brassica napus]
Length=210

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPY+IG L  +TVFD   N LTGPIP SFGCL+K+E  NL  N+ +G++PE 
Sbjct  40   LNNQLTGCLPYQIGKLNRATVFDVGYNNLTGPIPYSFGCLDKMEQFNLARNKFFGTIPEI  99

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C++  L+ LSLS N+FTQ+GP+CRNL+++ +LD+  NCILDLPNQ++   C +FF+   
Sbjct  100  VCEISSLKNLSLSYNFFTQVGPKCRNLIKRNILDVRMNCILDLPNQKTPLECANFFMRKL  159

Query  392  KCPDHKSLLYVPC  354
             CP+ KS+  +PC
Sbjct  160  TCPNSKSMFRIPC  172



>ref|XP_010519298.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=451

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L+N+L+GCLPYEIG L  +TVFD   N LTGPIP SFGCL+K+E LNL  N  YG++PE+
Sbjct  284  LSNRLTGCLPYEIGKLNLATVFDVGSNLLTGPIPYSFGCLDKMEQLNLARNTFYGTIPET  343

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L  ++ LSLS NYFT +GP+CR L++KKVLD+  NCIL LPNQRSA  C  FF+  Q
Sbjct  344  VCNLPRIQNLSLSYNYFTHVGPKCRELIKKKVLDVRMNCILGLPNQRSATECSKFFMRKQ  403

Query  392  KCPDHKSLLYVPC  354
             CP+ KS  ++PC
Sbjct  404  PCPNPKSFFWIPC  416



>gb|KFK39280.1| hypothetical protein AALP_AA3G224000 [Arabis alpina]
Length=480

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPY+IG L  +TVFD   N+LTGPIP SFGCLE +E LNL  N+ YG++PE 
Sbjct  313  LNNKLTGCLPYQIGKLNRATVFDVESNELTGPIPYSFGCLENMEQLNLARNKFYGTIPEI  372

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L+ LSLS NYFTQ+GP+CR L++ K+LD+  NCILDL NQRS   C  FFL  Q
Sbjct  373  VCELSALKNLSLSFNYFTQVGPKCRKLIKTKILDVRMNCILDLANQRSPWECAKFFLRKQ  432

Query  392  KCPDHKSLLYVPC  354
             C + KS  Y+PC
Sbjct  433  NCHNFKSFFYIPC  445



>ref|XP_006307323.1| hypothetical protein CARUB_v10008944mg [Capsella rubella]
 gb|EOA40221.1| hypothetical protein CARUB_v10008944mg [Capsella rubella]
Length=496

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPY+IG LK +TVFD   NQLTGPIP SFGCL+ +E LNL  N+ YG++PE 
Sbjct  326  LNNQLTGCLPYQIGNLKQATVFDVGGNQLTGPIPYSFGCLDSMEQLNLARNKFYGTIPEI  385

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C++  L+ LSLS NYFTQ GP+CR L+E KVLD+  NCILDLPNQ + Q C DFF   Q
Sbjct  386  VCEIACLKNLSLSYNYFTQAGPKCRKLIESKVLDVRMNCILDLPNQNTPQQCADFFKRRQ  445

Query  392  KCPDHKSLLYVPC  354
             C D KSL  VPC
Sbjct  446  TCADPKSLFIVPC  458



>ref|XP_011088225.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=460

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 111/170 (65%), Gaps = 2/170 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L+N+LSGCLP EIGLL+ +TVFDAS N LTGPIPQSF CL +++ILNL NNQLYG VPE 
Sbjct  292  LDNQLSGCLPCEIGLLEKATVFDASRNLLTGPIPQSFACLAQMQILNLANNQLYGPVPEL  351

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +CKL +L  LSLS NYFT++GPECR L+ K VLD+  NCI  LP QRS   C  FF   +
Sbjct  352  VCKLANLGNLSLSYNYFTKVGPECRKLINKNVLDLTMNCIPGLPGQRSPAQCHAFFSKAR  411

Query  392  KCPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDR  243
             CPD  S  ++PC+ +   R+               +  S +YAAL   R
Sbjct  412  SCPDEGSFSWMPCNANS--RRNSLELSDSVSTSTGSKEPSRSYAALHPHR  459



>ref|XP_011467740.1| PREDICTED: uncharacterized protein At4g06744 [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP EIG L  +T+FD S NQLTGPIPQSF CL K+EIL L NNQ YG+VPE 
Sbjct  340  LNNRLSGCLPMEIGKLNQATLFDVSYNQLTGPIPQSFACLTKMEILVLDNNQFYGAVPEL  399

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +CKL  L  LSL+ NYFTQ+GP CR L++K  L +DNNCILDL  QR    C  FF   +
Sbjct  400  VCKLPSLMNLSLANNYFTQVGPACRKLIKKGFLHVDNNCILDLKYQRPKSECASFFSKPR  459

Query  392  KCPDHKSLLYVPC  354
             CP+ +SLLY+PC
Sbjct  460  YCPNERSLLYIPC  472



>ref|XP_010263447.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=467

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 106/141 (75%), Gaps = 4/141 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIGLL+++TVFDA  N LTGPIP SFGCLEK+E+LNL  NQLYG +PE+
Sbjct  294  LNNQLSGCLPYEIGLLRSATVFDAGNNLLTGPIPCSFGCLEKMELLNLAGNQLYGQIPEA  353

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L++L  LSLS NYFT +GP CRNL++  VL+++NNCI  LPNQRS   C  F  H  
Sbjct  354  VCALRNLVNLSLSDNYFTSVGPTCRNLIKNGVLNVNNNCIHGLPNQRSVGECSAF--HPG  411

Query  392  KC--PDHKSLLYVPCDIDESP  336
             C  P   S  ++PC++ +SP
Sbjct  412  SCPYPPSYSFSFIPCELPQSP  432



>ref|XP_011004900.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=406

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 100/143 (70%), Gaps = 6/143 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L GCLP+EIG L  + VFD   N+LTGPIP SF CL+K+E LNL  N+ YG+VPE 
Sbjct  238  LNNELEGCLPFEIGKLDKTVVFDVGSNKLTGPIPHSFACLKKMENLNLAKNKFYGTVPEM  297

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L  L  LSLS NYFTQ+GPECR L+ K++LD+  NCILDLP QRSA  C  FF   +
Sbjct  298  VCDLPRLANLSLSYNYFTQVGPECRKLISKRILDVRMNCILDLPGQRSAADCAKFFSKQR  357

Query  392  KCPDHKSLLYVPCDIDESPRKAG  324
             CP+ +SL Y+PC      RK G
Sbjct  358  TCPNERSLSYIPC------RKGG  374



>ref|XP_002894215.1| hypothetical protein ARALYDRAFT_474107 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70474.1| hypothetical protein ARALYDRAFT_474107 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPY+IG L  +TVFD   NQLTGPIP SFGCLE +E LNL  N+ YG++PE 
Sbjct  308  LNNQLTGCLPYQIGNLTRATVFDVGFNQLTGPIPYSFGCLETMEQLNLAGNKFYGTIPEI  367

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C++  L+ +SLS NYFTQ+GP+CRNL+++K++D+  NCILDLPNQ++   C +FF+  Q
Sbjct  368  VCEIACLKNVSLSYNYFTQVGPKCRNLIKRKIMDVSMNCILDLPNQKTPSECANFFMRKQ  427

Query  392  KCPDHKSLLYVPC  354
             C + KSL  VPC
Sbjct  428  TCLNSKSLFTVPC  440



>ref|XP_011004883.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Populus 
euphratica]
Length=394

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 99/143 (69%), Gaps = 6/143 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L GCLPYEIG L  + VFD   N+LTGPIP SF CLEK+EILNL  N+ YG VPE 
Sbjct  226  LNNELEGCLPYEIGKLDKTVVFDVGSNKLTGPIPLSFACLEKMEILNLAMNKFYGPVPEM  285

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L  L  LSLS NYFTQ+G ECR L+ K++LD+  NCILDLP QRSA  C  FF   +
Sbjct  286  VCDLPRLANLSLSYNYFTQVGHECRKLISKRILDVRMNCILDLPGQRSAADCAKFFSKQR  345

Query  392  KCPDHKSLLYVPCDIDESPRKAG  324
             CP+ +SL Y+PC      RK G
Sbjct  346  TCPNERSLNYIPC------RKGG  362



>ref|XP_009762067.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=462

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIGLL  + +FD S N+LTG IP SFGCL  ++ILNL  NQ YG VPE 
Sbjct  292  LNNQLTGCLPYEIGLLTKARIFDVSKNKLTGKIPHSFGCLANMQILNLAQNQFYGPVPEL  351

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +CKL +L+ LSLS NYFT++GPEC+ L+++KVLD+  NCI  LP QRSA  C  FF   +
Sbjct  352  VCKLSNLKNLSLSYNYFTEVGPECKKLIQRKVLDVRMNCIPGLPMQRSAAECAAFFCKPR  411

Query  392  KCPDHKSLLYVPCDI  348
             CPD KSL  VPC I
Sbjct  412  SCPDEKSLGIVPCTI  426



>gb|KJB12258.1| hypothetical protein B456_002G008600 [Gossypium raimondii]
Length=497

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIG L+N+TVFD  +N+LTGPIP SFGCL+K+E LNL  N+ YG VPE 
Sbjct  324  LNNELTGCLPYEIGYLQNATVFDVGMNKLTGPIPHSFGCLKKMEQLNLAGNEFYGEVPEI  383

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L +L+ LSLS NYFTQ+GP CR+L+ KK L++ NNCILDLP QRS   C  FF    
Sbjct  384  VCRLSNLQNLSLSSNYFTQVGPACRDLVMKKKLNVKNNCILDLPEQRSKADCAMFFSRKL  443

Query  392  KCPDHKSLLYVPC  354
             C   +S  ++PC
Sbjct  444  ICDRTESFKWIPC  456



>ref|XP_009622015.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=466

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIGLL  + +FD S N+LTG IP SFGCL K++ILNL  NQ YG VPE 
Sbjct  295  LNNQLTGCLPYEIGLLTKARIFDVSKNKLTGKIPHSFGCLAKMQILNLAQNQFYGPVPEL  354

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +CKL +L+ LSLS NYFT++G EC+ L+E+KVLD+  NCI  LP QRSA  C  FF   +
Sbjct  355  VCKLSNLKNLSLSYNYFTEVGSECKKLIERKVLDVRMNCIPGLPMQRSAAECAAFFCKPR  414

Query  392  KCPDHKSLLYVPCDI  348
             CPD KSL  VPC I
Sbjct  415  SCPDEKSLEIVPCRI  429



>ref|XP_007157235.1| hypothetical protein PHAVU_002G054000g [Phaseolus vulgaris]
 gb|ESW29229.1| hypothetical protein PHAVU_002G054000g [Phaseolus vulgaris]
Length=433

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 98/136 (72%), Gaps = 3/136 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N   GCLPY+IGLL  +TVFD S N LTGPIP+SFGCLE +  LNL  NQ+YG VPE+
Sbjct  267  LGNHFQGCLPYQIGLLNKATVFDVSKNWLTGPIPRSFGCLESIRYLNLEQNQMYGEVPET  326

Query  572  LCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C+L  L     LSLS NYFTQ+GP CR L+E  VLD+ NNCIL LPNQR+ + C  FF 
Sbjct  327  VCELPGLRNRGNLSLSDNYFTQVGPACRRLIEANVLDVRNNCILGLPNQRTHEQCSQFFS  386

Query  401  HYQKCPDHKSLLYVPC  354
            + + CP+ KSL YVPC
Sbjct  387  NLKPCPNPKSLNYVPC  402



>ref|XP_010691719.1| PREDICTED: uncharacterized protein At4g06744-like [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYEIG LK + VFD S N LTGPIP+SFGCLEK++ L + NN+ +G+VPE 
Sbjct  299  LNNHLSGCLPYEIGYLKKARVFDVSTNYLTGPIPRSFGCLEKMQNLVMANNEFFGAVPEE  358

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L  L++LSL  NYFTQ+GPEC  L+ K VLD+ NNCIL LPNQ+S ++C  FF   +
Sbjct  359  VCMLPHLKQLSLCNNYFTQVGPECMKLVHKGVLDVTNNCILGLPNQKSKEMCASFFKRPK  418

Query  392  KCPDHKSLLYVPC  354
             C + KSL  VPC
Sbjct  419  TCGEEKSLTIVPC  431



>gb|AIE39583.1| LRR receptor-like protein kinase, partial [Humulus lupulus]
Length=141

 Score =   161 bits (408),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L+N+ SGCLPY IG LKN T+FDAS N +TGPIP SFGCL K+E+LNL NNQLYG VPES
Sbjct  14   LDNQFSGCLPYGIGKLKNLTLFDASTNLITGPIPHSFGCLSKIELLNLANNQLYGEVPES  73

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +CKL +L   +LSGNY TQ+GP CR L+  K L++D NCI DLP QRS + C  FF    
Sbjct  74   VCKLPNLSNFTLSGNYITQVGPMCRKLINSKRLNVDWNCIRDLPKQRSFEDCGHFFSKDH  133

Query  392  KCPDHKS  372
            +CP+  S
Sbjct  134  QCPECSS  140



>gb|KFK35980.1| hypothetical protein AALP_AA4G062700 [Arabis alpina]
Length=490

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPY+IG L  +TVFD  +NQLTGPIP SFGCL+K+E LNL  N+ YG++PE 
Sbjct  322  LNNQLTGCLPYQIGNLNQATVFDVEVNQLTGPIPYSFGCLDKMEQLNLARNKFYGTIPEI  381

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L  LSLS NYFTQ+GP+CR L++  +LD+  NCILDLPNQ++   C  FF+  Q
Sbjct  382  VCELSCLMNLSLSYNYFTQVGPKCRTLIKSNILDVRMNCILDLPNQKTPMECAKFFMKKQ  441

Query  392  KCPDHKSLLYVPC  354
             CP+  S+  VPC
Sbjct  442  TCPNSHSMFLVPC  454



>emb|CDY20865.1| BnaC05g26270D [Brassica napus]
Length=516

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPY+IG L  +TVFD   N LTGPIP SFGCL+K+E LNL  N+ +G++PE 
Sbjct  347  LNNQLTGCLPYQIGKLNRATVFDVGYNNLTGPIPYSFGCLDKMEQLNLARNKFFGTIPEI  406

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C++  L+ LSLS N+FTQ+GP+CRNL++K +LD+  NCILDLPNQ++   C +FF+   
Sbjct  407  VCEISSLKNLSLSYNFFTQVGPKCRNLIKKNILDVRMNCILDLPNQKTPLECANFFMQKH  466

Query  392  KCPDHKSLLYVPC  354
             CP+ KS+  +PC
Sbjct  467  ICPNSKSMFRIPC  479



>gb|KJB32334.1| hypothetical protein B456_005G236100 [Gossypium raimondii]
Length=433

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPYEIG L  +TVFD   N+LTGPIP SFGCL+K+E+LNL  N+ YG VPE 
Sbjct  266  LNNKLTGCLPYEIGNLSQATVFDVGSNKLTGPIPYSFGCLKKIELLNLACNEFYGEVPEI  325

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+LK+L+ LSLS NYFTQ+GP CR+L+ KK LD+ NNCILDLP QRS   C  FF    
Sbjct  326  VCQLKNLQNLSLSYNYFTQVGPACRDLIMKKKLDVKNNCILDLPFQRSEAECTAFFSRNL  385

Query  392  KCPDHKSLLYVPC  354
             C    S  +VPC
Sbjct  386  YCDRKDSFKWVPC  398



>ref|XP_009145107.1| PREDICTED: uncharacterized protein At4g06744-like [Brassica rapa]
Length=555

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPY+IG L  +TVFD   N LTGPIP SFGCL+K+E LNL  N+ +G++PE 
Sbjct  385  LNNQLTGCLPYQIGKLNRATVFDVEYNNLTGPIPYSFGCLDKMEQLNLARNKFFGTIPEI  444

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C++  L+ LSLS N+FTQ+GP+CRNL+++ +LD+  NCILDLPNQ++   C +FF+   
Sbjct  445  VCEISSLKNLSLSYNFFTQVGPKCRNLIKRNILDVRMNCILDLPNQKTPLECANFFMRKH  504

Query  392  KCPDHKSLLYVPC  354
             CP+ KS+  +PC
Sbjct  505  TCPNSKSMFRIPC  517



>ref|XP_010270780.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=495

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 100/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIG LK +TVFDA  N LTGPIP SFGCLE++++LN T N+LYG VPE 
Sbjct  330  LNNQLSGCLPYEIGFLKKATVFDAGNNHLTGPIPYSFGCLERMQLLNFTGNKLYGPVPEV  389

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L  L   SLS NYFTQ+GP+CR L++K  LDI NNCILDLP+QR A  C+ FF    
Sbjct  390  VCGLPSLANFSLSDNYFTQVGPKCRELIKKGKLDIRNNCILDLPSQRPADHCEKFFSSNP  449

Query  392  K-CPDHKSLLYVPCDI  348
            K C D K+   +PC +
Sbjct  450  KYCSDLKTNTMIPCRL  465



>emb|CDY29337.1| BnaA05g16040D [Brassica napus]
Length=475

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPY+IG L  +TVFD   N LTGPIP SFGCL+K+E  NL  N+ +G++PE 
Sbjct  305  LNNQLTGCLPYQIGKLNRATVFDVGYNNLTGPIPYSFGCLDKMEQFNLARNKFFGTIPEI  364

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C++  L+ LSLS N+FTQ+GP+CRNL+++ +LD+  NCILDLPNQ++   C +FF+   
Sbjct  365  VCEISSLKNLSLSYNFFTQVGPKCRNLIKRNILDVRMNCILDLPNQKTPLECANFFMRKL  424

Query  392  KCPDHKSLLYVPC  354
             CP+ KS+  +PC
Sbjct  425  TCPNSKSMFRIPC  437



>ref|XP_006374888.1| hypothetical protein POPTR_0014s02430g [Populus trichocarpa]
 gb|ERP52685.1| hypothetical protein POPTR_0014s02430g [Populus trichocarpa]
Length=430

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 100/142 (70%), Gaps = 3/142 (2%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            NN+L+GCLPYE+GLLK + VFDAS N+LTGP+P +  CLEK+E+LN T NQL+G VPE +
Sbjct  282  NNQLTGCLPYEVGLLKEAIVFDASNNKLTGPLPVALSCLEKVELLNFTGNQLFGMVPEVV  341

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            C+L+ L   SLS NYFT +GP CR+L  K VLDI NNCI  LP QRS   C DF  H + 
Sbjct  342  CELEKLRNFSLSANYFTTLGPMCRDLFYKGVLDITNNCIPGLPFQRSVVECLDFIAHPKS  401

Query  389  CPDHKSLLYVPCDIDESPRKAG  324
            CP   S  ++PC+   SP  +G
Sbjct  402  CPRMWSYTFIPCN---SPFSSG  420



>ref|XP_007201703.1| hypothetical protein PRUPE_ppa004109mg [Prunus persica]
 gb|EMJ02902.1| hypothetical protein PRUPE_ppa004109mg [Prunus persica]
Length=529

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L NKL+GCLPYEIG L  +TVFD S N LTGPIP SF CL K+E LNL +N+ YG VPE 
Sbjct  366  LGNKLTGCLPYEIGYLNQATVFDVSSNLLTGPIPHSFSCLAKIEYLNLASNRFYGPVPEQ  425

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L   SL+ NYFT++GPECR L++KK+LD+  NCIL  PNQ++   C  FF   +
Sbjct  426  VCTLSNLGNFSLANNYFTEVGPECRKLMKKKLLDVRQNCILGEPNQKTKAQCNAFFSKPR  485

Query  392  KCPDHKSLLYVPC  354
            KCP+ K + YVPC
Sbjct  486  KCPNEKEMTYVPC  498



>ref|XP_007042489.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
 gb|EOX98320.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
Length=497

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIG L  +TVFD   N+LTGPIP SFGCL K+E+LNL NN+ YG+VPE 
Sbjct  328  LNNQLTGCLPYEIGYLSKATVFDVGSNKLTGPIPNSFGCLRKIELLNLANNEFYGAVPEI  387

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  +E LSL+ NYFTQ+GP CR L+ KK LD+ NNCILDLPNQ+S   C  FF    
Sbjct  388  VCQLPKIENLSLANNYFTQVGPACRKLIWKKKLDVRNNCILDLPNQKSKDECAKFFSRPP  447

Query  392  -KCPDHKSLLYVPC  354
              C   +S  +VPC
Sbjct  448  LGCERKESFKWVPC  461



>gb|KDP41695.1| hypothetical protein JCGZ_16102 [Jatropha curcas]
Length=424

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIGLLK +TVFDA  NQLTGP+P S  CLE +E LN   N L+G VPE 
Sbjct  275  LNNQLTGCLPYEIGLLKEATVFDAGNNQLTGPLPLSLACLENVEQLNFAGNMLFGMVPEL  334

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L+ L  LSLS NYF  +GP CR L+EK V+DI NNCI DLP QRS + C DFF H +
Sbjct  335  VCELQSLVNLSLSDNYFITVGPLCRILIEKGVVDIRNNCIPDLPFQRSVEECADFFAHPK  394

Query  392  KCPDHKSLLYVPC  354
             CP   S  Y PC
Sbjct  395  FCPRMWSYTYSPC  407



>ref|XP_006297641.1| hypothetical protein CARUB_v10013659mg [Capsella rubella]
 gb|EOA30539.1| hypothetical protein CARUB_v10013659mg [Capsella rubella]
Length=458

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPY+IG L  +TVFD   N+LTGPIP SFGCL K+E LNL  N+ YG++PE 
Sbjct  291  LNNKLTGCLPYQIGNLNRATVFDVESNELTGPIPYSFGCLNKMEQLNLARNKFYGTIPEI  350

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L  L+ LSLS NYFTQ+GP+CR L++KK+LD+  NCILDL NQR+   C  FFL  Q
Sbjct  351  LCELSSLKNLSLSSNYFTQVGPKCRTLIKKKILDVGMNCILDLANQRTPWECTKFFLRKQ  410

Query  392  KCPDHKSLLYVPCDID  345
            KCP+ K+  Y+PC  D
Sbjct  411  KCPNFKTFFYIPCGKD  426



>ref|XP_008236576.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=481

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N L+GCLPYEIG L  +TVFD S N LTGPIP SF CL K++ LNL NN  YG VPE 
Sbjct  318  LGNSLTGCLPYEIGYLNQATVFDVSSNFLTGPIPHSFSCLAKIDYLNLANNSFYGPVPEQ  377

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L    L+ NYFT++GPECR L++KKVLD+  NCIL  PNQ++   C  FF   +
Sbjct  378  VCTLSNLRNFYLANNYFTEVGPECRKLIKKKVLDVRQNCILGQPNQKTKAQCTAFFSKPR  437

Query  392  KCPDHKSLLYVPC  354
            KCP+ K + YVPC
Sbjct  438  KCPNEKEMTYVPC  450



>ref|XP_010479447.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=502

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 103/143 (72%), Gaps = 0/143 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPY+IG L  +TVFD   N+LTGPIP SFGCL+K+E L+L  N  YG++PE 
Sbjct  332  LNNQLTGCLPYQIGNLNRATVFDVESNRLTGPIPYSFGCLDKMEQLSLARNNFYGTIPEI  391

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C++  L+ LSLS NYFTQ GP+CR L+E+K+LD+  NCILDLPNQ+  + C  FF   Q
Sbjct  392  VCEIACLKNLSLSYNYFTQAGPKCRKLIERKILDVRMNCILDLPNQKRPEECAVFFKRKQ  451

Query  392  KCPDHKSLLYVPCDIDESPRKAG  324
             C D KSL  VPC  + +  K G
Sbjct  452  TCSDPKSLFIVPCGKNPNRLKPG  474



>ref|XP_010461823.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=490

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPY+IG L  +TVFD   N+LTGPIP SFGCL+K+E L+L  N  YG++PE 
Sbjct  320  LNNQLTGCLPYQIGNLNQATVFDVESNRLTGPIPYSFGCLDKMEQLSLARNNFYGTIPEI  379

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C++  L+ LSLS NYFTQ GP+CR L+E+K+LD+  NCILDLPNQ+  + C  FF   Q
Sbjct  380  VCEIACLKNLSLSYNYFTQAGPKCRKLIERKILDVRMNCILDLPNQKRPEECAVFFKRKQ  439

Query  392  KCPDHKSLLYVPC  354
             C D KSL  VPC
Sbjct  440  TCSDPKSLFIVPC  452



>ref|XP_010500525.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=504

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPY+IG L  +TVFD   N+LTGPIP SFGCL+K+E L+L  N  YG++PE 
Sbjct  334  LNNQLTGCLPYQIGNLNRATVFDVESNRLTGPIPYSFGCLDKMEQLSLARNNFYGTIPEI  393

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C++  L+ LSLS NYFTQ GP+CR L+E+K+LD+  NCILDLPNQ+  + C  FF   Q
Sbjct  394  VCEIACLKNLSLSYNYFTQAGPKCRKLIERKILDVRMNCILDLPNQKRPEECAVFFKRKQ  453

Query  392  KCPDHKSLLYVPC  354
             C D KSL  VPC
Sbjct  454  TCSDPKSLFIVPC  466



>ref|XP_003607916.1| Receptor protein kinase [Medicago truncatula]
Length=366

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L NK  GCLPYEIG LK +TVFD S N LTGPIP SFGCLEK++ LNL +N+ YG+VPES
Sbjct  197  LGNKFEGCLPYEIGYLKKATVFDVSQNSLTGPIPASFGCLEKIQFLNLAHNKFYGTVPES  256

Query  572  LCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C L  ++    LSL+GNYFT++ P C +LL+ K+LD+ NNCI  LPNQRS Q C +F  
Sbjct  257  VCVLSGIKNNGNLSLAGNYFTKLEPACWSLLKSKILDVSNNCIPGLPNQRSKQECYEFQC  316

Query  401  HYQKCPDHKSLLYVPC  354
              + C + +SL YVPC
Sbjct  317  KIKPCSNPQSLSYVPC  332



>ref|XP_010263446.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=474

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIGLLK +TVFDA  N LTGPIP SFGCL+++++L+   N+LYG VPE 
Sbjct  308  LNNQLSGCLPYEIGLLKKATVFDAGNNHLTGPIPYSFGCLKRMQLLSFAGNKLYGQVPEV  367

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF-LHY  396
            +C L  L  LSLS NYFTQ+GP+CR+L++K  L ++NNCILDL +QRS   C+ FF    
Sbjct  368  VCALPKLANLSLSDNYFTQVGPKCRHLIKKGRLHLENNCILDLKSQRSPAECEKFFSSSM  427

Query  395  QKCPDHKSLLYVPCDIDESPRKA  327
            + C   K+   +PC +    +KA
Sbjct  428  EYCSYEKTFNVIPCKLRHHSKKA  450



>ref|XP_003538630.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=437

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 94/136 (69%), Gaps = 3/136 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N   GCLP++IG L  +TVFD S N LTGPIP SF CL  ++ LNL +NQ YG VPE 
Sbjct  274  LGNHFQGCLPFQIGYLVKATVFDVSKNSLTGPIPHSFACLASIQFLNLEHNQFYGEVPEM  333

Query  572  LCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC+L  L     LSLS NYFTQ+GP CRNL++ KVLD+ NNCIL LPNQR    C +FF 
Sbjct  334  LCQLPGLRNNGSLSLSDNYFTQVGPACRNLIKNKVLDVSNNCILGLPNQRPHGQCTEFFS  393

Query  401  HYQKCPDHKSLLYVPC  354
              + CP+ K+L YVPC
Sbjct  394  KIKPCPNPKNLHYVPC  409



>gb|KHN05611.1| Hypothetical protein glysoja_047056 [Glycine soja]
Length=418

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 93/136 (68%), Gaps = 3/136 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N   GCLP++IG L  +TVFD S N LTGPIP SF CL  ++ LNL  NQ YG VPE 
Sbjct  255  LGNHFQGCLPFQIGYLVKATVFDVSKNSLTGPIPHSFACLASIQFLNLERNQFYGEVPEM  314

Query  572  LCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC+L  L     LSLS NYFTQ+GP CRNL++ KVLD+ NNCIL LPNQR    C +FF 
Sbjct  315  LCQLPGLRNNGSLSLSDNYFTQVGPACRNLIKNKVLDVSNNCILGLPNQRPHGQCTEFFS  374

Query  401  HYQKCPDHKSLLYVPC  354
              + CP+ K+L YVPC
Sbjct  375  KIKPCPNPKNLHYVPC  390



>ref|XP_008236564.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=416

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N+LSGCLPYEIG LK +TVFD S N LTGPIP SF CL KLE L+L +NQ YG VP++
Sbjct  240  LGNRLSGCLPYEIGYLKKATVFDVSSNILTGPIPNSFACLGKLEYLSLASNQFYGRVPDA  299

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +CK ++LE  S + NYFT+IGP C  L+ K++LD+  NCI  LPNQ++A  C  FF   +
Sbjct  300  VCKFRNLERFSAANNYFTRIGPACLALIRKRILDVRGNCIPGLPNQKTAAQCAAFFSIPR  359

Query  392  KCPDHKSLLYVPC  354
             CP  ++L  +PC
Sbjct  360  TCPRPRTLSIIPC  372



>ref|XP_010270768.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=475

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 99/142 (70%), Gaps = 4/142 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKLSGCLPYEIGLL ++TVFD   N LTGPIP SF CLEK+E+L L  NQ YG +PE 
Sbjct  302  LNNKLSGCLPYEIGLLTSATVFDVGNNFLTGPIPCSFACLEKMEVLKLAGNQFYGKIPEE  361

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF-FLHY  396
            +C L +L  LSLS NYF  +GP CR+L+++ VLD+ NNCI  LPNQR A  C DF + H 
Sbjct  362  VCGLGNLANLSLSDNYFRYLGPTCRSLIKRGVLDVSNNCIHGLPNQRPAAECWDFYYFHL  421

Query  395  QKCPD---HKSLLYVPCDIDES  339
            + CP      +   VPC+I+ S
Sbjct  422  KHCPSSLPRYNANVVPCNINHS  443



>ref|XP_007227115.1| hypothetical protein PRUPE_ppa025707mg, partial [Prunus persica]
 gb|EMJ28314.1| hypothetical protein PRUPE_ppa025707mg, partial [Prunus persica]
Length=482

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIGLLK + VFDA  NQLTGP+P S  CLE  E LN   N LYG VPE 
Sbjct  278  LNNQLTGCLPYEIGLLKEAIVFDAGNNQLTGPLPFSLACLENAEQLNFAGNLLYGMVPEV  337

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L++L +LSLS NYFT +GP CR L+ + VLD+ NNCI DLP Q+S + C DFF H +
Sbjct  338  VCGLQNLVDLSLSDNYFTNVGPLCRMLIGRGVLDVRNNCIPDLPFQKSIEECADFFAHPR  397

Query  392  KCPDHKSLLYVPC  354
             CP   S  Y+PC
Sbjct  398  FCPYMGSYTYIPC  410



>ref|XP_006433575.1| hypothetical protein CICLE_v10003526mg [Citrus clementina]
 gb|ESR46815.1| hypothetical protein CICLE_v10003526mg [Citrus clementina]
Length=429

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 94/142 (66%), Gaps = 0/142 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            +NN+L+GCLPYEIG LK + VFD   NQLTG +P S  CLEK+E LN  NN L+G VPE+
Sbjct  285  VNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEA  344

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L   SLS NYFT  GP CR L+EK VLD+ NNCI DLP QRS   C DFF H +
Sbjct  345  VCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPR  404

Query  392  KCPDHKSLLYVPCDIDESPRKA  327
             CP   S  Y+PC     P  A
Sbjct  405  FCPHMWSYTYIPCKPYYIPEMA  426



>emb|CDO97205.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLP EIGLL  +TVFD S N LTGPIP SF CL K+EILNL  NQ +G VP+ 
Sbjct  285  LNNQLTGCLPCEIGLLNKATVFDVSRNLLTGPIPWSFACLAKMEILNLAKNQFFGVVPDP  344

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L +LE   LS NYFT +GPEC  L+++KVLD+  NCI  LPNQRS   C  FF   +
Sbjct  345  ICQLPNLESFDLSSNYFTGVGPECWKLIQRKVLDVTMNCIPGLPNQRSKAECDAFFCKPR  404

Query  392  KCPDHKSLLYVPC  354
             C +  SL +VPC
Sbjct  405  SCSNQGSLTWVPC  417



>ref|XP_006472980.1| PREDICTED: uncharacterized protein At4g06744-like [Citrus sinensis]
Length=429

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 94/142 (66%), Gaps = 0/142 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            +NN+L+GCLPYEIG LK + VFD   NQLTG +P S  CLEK+E LN  NN L+G VPE+
Sbjct  285  VNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEA  344

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L   SLS NYFT  GP CR L+EK VLD+ NNCI DLP QRS   C DFF H +
Sbjct  345  VCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVSECADFFAHPR  404

Query  392  KCPDHKSLLYVPCDIDESPRKA  327
             CP   S  Y+PC     P  A
Sbjct  405  FCPHMWSYTYIPCKPYFIPEMA  426



>gb|AES90113.2| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=460

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L NK  GCLPYEIG LK +TVFD S N LTGPIP SFGCLEK++ LNL +N+ YG+VPES
Sbjct  291  LGNKFEGCLPYEIGYLKKATVFDVSQNSLTGPIPASFGCLEKIQFLNLAHNKFYGTVPES  350

Query  572  LCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C L  ++    LSL+GNYFT++ P C +LL+ K+LD+ NNCI  LPNQRS Q C +F  
Sbjct  351  VCVLSGIKNNGNLSLAGNYFTKLEPACWSLLKSKILDVSNNCIPGLPNQRSKQECYEFQC  410

Query  401  HYQKCPDHKSLLYVPC  354
              + C + +SL YVPC
Sbjct  411  KIKPCSNPQSLSYVPC  426



>gb|KDP24991.1| hypothetical protein JCGZ_23974 [Jatropha curcas]
Length=413

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GC+PYE+G LK   +FDAS N LTGP+P S GCL K+E LNLT N LYG VPE 
Sbjct  253  LNNLLTGCIPYELGFLKELVLFDASNNLLTGPLPCSLGCLTKIEQLNLTGNLLYGQVPEV  312

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L++L  LSLS NYFT++GP C  L++  VLDI  NCIL LPNQRS   C  FFLH +
Sbjct  313  VCALENLANLSLSNNYFTKLGPLCWKLVKSGVLDIRQNCILGLPNQRSFHECFIFFLHPR  372

Query  392  KCPDHKSLL-YVPCDIDE  342
             CP H +LL ++PC + +
Sbjct  373  YCPYHPTLLNFIPCKVHQ  390



>ref|XP_004304027.1| PREDICTED: uncharacterized protein At4g06744-like [Fragaria vesca 
subsp. vesca]
Length=411

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GC+PYE+G L+++TVFDA  NQLTGP+P S GCL+K+E LN  +N LYG VPE 
Sbjct  258  LNNLLTGCIPYELGFLRDATVFDAGNNQLTGPLPCSLGCLDKIEQLNFADNFLYGRVPEV  317

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L +L  LSLS NYFT +G  CR L+EK VLDI NNCI DL +QRSA+ C  FFLH +
Sbjct  318  LCELGNLANLSLSNNYFTGVGTACRKLIEKGVLDIRNNCIQDLADQRSAEECALFFLHPK  377

Query  392  KCPDHKSLLYVPC  354
             C   ++   +PC
Sbjct  378  SCLHPETYSLIPC  390



>ref|XP_002510174.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF52361.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=437

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIGLLK + VFDA  N+LTG +P S  CL+K+E LN   N L+G VPE 
Sbjct  290  LNNQLTGCLPYEIGLLKEAVVFDAGNNRLTGSLPLSLACLQKVEQLNFAGNLLFGMVPEL  349

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +CK+++L  LSLS NYFT +GP CR L+ K VLD+ NNCI DLP QRS   C +FF H +
Sbjct  350  VCKMENLVNLSLSDNYFTTVGPWCRILIAKGVLDVRNNCIPDLPFQRSIMECANFFAHPR  409

Query  392  KCPDHKSLLYVPC  354
             CP   S  Y+PC
Sbjct  410  FCPHMWSYTYIPC  422



>emb|CDP01296.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L+N L+GCLPYE+G LK + VFDA  NQLTGPIP S GCL+K+E+LN   N LYG VPE 
Sbjct  266  LDNLLTGCLPYELGFLKEAVVFDAGNNQLTGPIPFSLGCLKKVEVLNFAGNYLYGMVPEV  325

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L  LSLS NYFT +GP C NL++K VLD+  NCI  LP QRS   C  FF   +
Sbjct  326  VCALGNLANLSLSDNYFTTVGPICWNLIKKGVLDVRKNCIAGLPFQRSVWECAHFFARPR  385

Query  392  KCPDHKSLLYVPC  354
             CP   +  Y+PC
Sbjct  386  YCPYWAAFTYIPC  398



>ref|XP_008454972.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=428

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            +NKLSGCLP EIGLL+N+ +F+AS N LTGPIP SF CL K++ILN ++N LYG+VPE +
Sbjct  270  DNKLSGCLPMEIGLLENTVLFNASKNSLTGPIPYSFCCLTKMQILNFSDNNLYGAVPEDV  329

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            CKL +L+  +L  N+FTQ+GP CR+L+ K VLD+  NCIL LP QR  + C  FF     
Sbjct  330  CKLPNLQRFNLRNNFFTQVGPICRSLIWKDVLDVSGNCILGLPKQRPEKECTYFFSKPHS  389

Query  389  CPDHKSLLYVPC  354
            CPD KS+  +PC
Sbjct  390  CPDDKSMKIIPC  401



>gb|KDP24986.1| hypothetical protein JCGZ_23969 [Jatropha curcas]
Length=413

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GC+PYE+G LK   +FDAS N LTGP+P S GCL K+E LNLT N LYG VPE 
Sbjct  253  LNNLLTGCIPYELGFLKELVLFDASNNLLTGPLPCSLGCLTKIEQLNLTGNLLYGQVPEV  312

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L++L  LSLS NYFT++GP C  L++  VLDI  NCIL LPNQRS   C  FFLH +
Sbjct  313  VCALENLANLSLSNNYFTKVGPLCWKLVKSGVLDIRQNCILGLPNQRSFHECFIFFLHPR  372

Query  392  KCPDHKSLL-YVPCDIDE  342
             CP H +L  ++PC + +
Sbjct  373  YCPYHPTLFNFIPCKVHQ  390



>ref|XP_004137106.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=398

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            +NKLSGCLP EIGLL+N+ +F+AS N LTGPIP SF CL K+EILN   N LYG++PE +
Sbjct  239  DNKLSGCLPMEIGLLENTVLFNASKNCLTGPIPYSFCCLTKMEILNFFGNNLYGAIPEDV  298

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            CKL +L++ +LS N+ TQ+GP CR+L+ K +LD+  NCIL LP QR  + C +FF     
Sbjct  299  CKLPNLQKFNLSNNFITQVGPVCRSLIWKNILDVSGNCILGLPKQRPEKECTNFFSKAHS  358

Query  389  CPDHKSLLYVPC  354
            CPD KS+  +PC
Sbjct  359  CPDEKSMKIIPC  370



>ref|XP_011029410.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=430

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 96/137 (70%), Gaps = 0/137 (0%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            NN+L+GCLPYE+GLLK + VFDAS N+LTGP+P +  CLEK+E+L+ T NQL+G VPE +
Sbjct  282  NNQLTGCLPYEVGLLKEAIVFDASNNELTGPLPVALSCLEKVELLSFTCNQLFGMVPEVI  341

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            C+LK L   SLS NYFT +GP CR L  + VLD+ NNCI  LP QRS   C DF  H + 
Sbjct  342  CELKKLRNFSLSDNYFTALGPVCRELFYEGVLDVTNNCIPGLPFQRSVVECLDFIAHPKS  401

Query  389  CPDHKSLLYVPCDIDES  339
            CP   S  ++PC +  S
Sbjct  402  CPWMWSYTFIPCKLPFS  418



>ref|XP_007201495.1| hypothetical protein PRUPE_ppa014775mg [Prunus persica]
 gb|EMJ02694.1| hypothetical protein PRUPE_ppa014775mg [Prunus persica]
Length=427

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N+LSGCLPYEIG LK +TVFD S N LTGPIP SF CL KLE L+L +NQ YG VPE+
Sbjct  251  LGNRLSGCLPYEIGYLKQATVFDVSSNILTGPIPNSFACLGKLEYLSLASNQFYGRVPEA  310

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L+ LE  + + NYFT+IGP C  L+ KK+LD+  NC+  LPNQ++A  C  FF   +
Sbjct  311  VCGLRHLERFNAANNYFTRIGPACMTLIRKKILDVRGNCLPGLPNQKTAAQCAAFFSIPR  370

Query  392  KCPDHKSLLYVPC  354
             CP    L  +PC
Sbjct  371  TCPRRTRLSIIPC  383



>ref|XP_008220262.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=464

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIGLLK + VFDA  NQLTGP+P S  CLE +E LN   N  YG VPE 
Sbjct  313  LNNQLTGCLPYEIGLLKEAIVFDAGNNQLTGPLPFSLACLESVEQLNFAGNLFYGMVPEV  372

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L++L  LSLS NYFT +GP CR L+ + VLD+ NNCI DLP Q+S + C DFF   +
Sbjct  373  VCGLQNLVNLSLSDNYFTNVGPLCRMLIGRGVLDVRNNCIPDLPFQKSIEECADFFARPR  432

Query  392  KCPDHKSLLYVPC  354
             CP   S +Y+PC
Sbjct  433  LCPYMGSYIYIPC  445



>ref|XP_007017157.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY14382.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=441

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LN++L+GC+PYEIGLLK + VFDA  NQLTGP+P S  CLE LE LNL  N L+G+VPE 
Sbjct  293  LNDQLTGCIPYEIGLLKEAVVFDAGNNQLTGPLPFSLACLENLEQLNLAGNLLFGTVPEV  352

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L  L  LSLS NYF  +GP CR L+E++VLD+ NNCI  LP QRS   C +FF H  
Sbjct  353  LCELGKLVNLSLSDNYFIHVGPLCRILIERRVLDVRNNCIPGLPFQRSIVECANFFAHPM  412

Query  392  KCPDHKSLLYVPC  354
             CP   S  ++PC
Sbjct  413  FCPRMWSYTFIPC  425



>ref|XP_010107857.1| Uncharacterized protein L484_027444 [Morus notabilis]
 gb|EXC17257.1| Uncharacterized protein L484_027444 [Morus notabilis]
Length=420

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 94/143 (66%), Gaps = 0/143 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPYE+GLLK + VFDA  N LTGP+P S GCL K+E+LN   N LYG +PE 
Sbjct  253  LNNLLTGCLPYELGLLKEAVVFDAGNNLLTGPLPCSLGCLRKIEVLNFAGNLLYGKIPEQ  312

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C +  L   SL  NYFT +GPECR +++ +VLD+  NCI  LP QRSA+ C  FFL  +
Sbjct  313  ICAVGSLVNFSLFDNYFTSVGPECRKMIKSRVLDVRKNCIRGLPEQRSAEECASFFLKPR  372

Query  392  KCPDHKSLLYVPCDIDESPRKAG  324
             C    S  ++PC++  S    G
Sbjct  373  SCSHPSSFTFMPCEVQPSSESDG  395



>gb|KGN43905.1| hypothetical protein Csa_7G073410 [Cucumis sativus]
Length=468

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            +NKLSGCLP EIGLL+N+ +F+AS N LTGPIP SF CL K+EILN   N LYG++PE +
Sbjct  309  DNKLSGCLPMEIGLLENTVLFNASKNCLTGPIPYSFCCLTKMEILNFFGNNLYGAIPEDV  368

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            CKL +L++ +LS N+ TQ+GP CR+L+ K +LD+  NCIL LP QR  + C +FF     
Sbjct  369  CKLPNLQKFNLSNNFITQVGPVCRSLIWKNILDVSGNCILGLPKQRPEKECTNFFSKAHS  428

Query  389  CPDHKSLLYVPC  354
            CPD KS+  +PC
Sbjct  429  CPDEKSMKIIPC  440



>emb|CDY32853.1| BnaC08g02750D [Brassica napus]
Length=481

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPY+IG L  +TVFD   NQLTG IP SFGCL K+E LNL  N+ YG++PE 
Sbjct  311  LNNTLTGCLPYQIGKLNRATVFDVGFNQLTGLIPYSFGCLAKIEQLNLARNKFYGTIPEI  370

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L+ LSLS NYFTQ GP+CR L+++ +LD   NCI+ LPNQ++AQ C  FF+H Q
Sbjct  371  VCELSSLKNLSLSYNYFTQAGPKCRELIKRSILDARMNCIIGLPNQKTAQECATFFMHRQ  430

Query  392  KCPDHKSLLYVPC  354
             CPD KS+  VPC
Sbjct  431  TCPDPKSMYLVPC  443



>ref|XP_004171357.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=466

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            +NKLSGCLP EIGLL+N+ +F+AS N LTGPIP SF CL K+EILN   N LYG++PE +
Sbjct  307  DNKLSGCLPMEIGLLENTVLFNASKNCLTGPIPYSFCCLTKMEILNFFGNNLYGAIPEDV  366

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            CKL +L++ +LS N+ TQ+GP CR+L+ K +LD+  NCIL LP QR  + C +FF     
Sbjct  367  CKLPNLQKFNLSNNFITQVGPVCRSLIWKNILDVSGNCILGLPKQRPEKECTNFFSKAHS  426

Query  389  CPDHKSLLYVPC  354
            CPD KS+  +PC
Sbjct  427  CPDEKSMKIIPC  438



>ref|XP_004142874.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 ref|XP_004156371.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN62484.1| hypothetical protein Csa_2G356090 [Cucumis sativus]
Length=438

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 103/170 (61%), Gaps = 0/170 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N+L+GCLP+EIG L  +TVFDA+ N LTGPIPQSFGCL  L+ILNL NNQ YG++PES
Sbjct  266  LKNRLTGCLPFEIGYLVKATVFDANTNILTGPIPQSFGCLFSLQILNLANNQFYGTIPES  325

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L D+  ++LS NYFT+IGP CR L+  + L I  NCI     Q++   C  FF   +
Sbjct  326  ICRLPDIYNITLSNNYFTRIGPVCRKLVIAQRLHIQGNCIPGFRLQKTQSQCAAFFAKPR  385

Query  392  KCPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDR  243
             CP   +  YVPC +  +                    S  +YAAL++ R
Sbjct  386  TCPRANTFSYVPCVLPTAAEAVQLDKAKVTSVDDMVPPSPRSYAALEMPR  435



>ref|XP_010507626.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=458

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPY+IG L  +TVFD   N+LTGPIP SFGCL K+E L L  N+ YG++PE 
Sbjct  291  LNNKLTGCLPYQIGNLNRATVFDVESNELTGPIPYSFGCLNKMEQLILARNKFYGTIPEI  350

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L  L+ LSLS NYFTQ+GP+CR L+++K+LD+  NCI DL NQR+   C  FF+  Q
Sbjct  351  LCELSSLKNLSLSSNYFTQVGPKCRTLIKRKILDVGRNCIQDLANQRTWWECARFFMRRQ  410

Query  392  KCPDHKSLLYVPCDID  345
             CP+ KS  Y+PC  D
Sbjct  411  NCPNSKSFFYIPCGKD  426



>ref|XP_009107284.1| PREDICTED: uncharacterized protein At4g06744 [Brassica rapa]
Length=475

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPY+IG L  +TVFD   NQLTG IP SFGCL K+E LNL  N+ YG++PE 
Sbjct  305  LNNSLTGCLPYQIGKLNQATVFDVGFNQLTGLIPYSFGCLAKMEQLNLARNKFYGTIPEI  364

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L+ LSLS NYFTQ GP+CR L+++ +LD+  NCILDLPNQ++A  C  FF+  Q
Sbjct  365  VCELSSLKNLSLSYNYFTQAGPKCRELIKRNILDVRMNCILDLPNQKTASECSTFFMQRQ  424

Query  392  KCPDHKSLLYVPC  354
             CPD KS+  +PC
Sbjct  425  TCPDPKSMYLIPC  437



>gb|KDO37099.1| hypothetical protein CISIN_1g037101mg, partial [Citrus sinensis]
Length=395

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 91/132 (69%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            +NN+L+GCLPYEIG LK + VFD   NQLTG +P S  CLEK+E LN  NN L+G VPE+
Sbjct  264  VNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEA  323

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L   SLS NYFT  GP CR L+EK VLD+ NNCI DLP QRS   C DFF H +
Sbjct  324  VCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPR  383

Query  392  KCPDHKSLLYVP  357
             CP   S  Y+P
Sbjct  384  FCPHMWSYTYIP  395



>gb|KJB14611.1| hypothetical protein B456_002G133900 [Gossypium raimondii]
Length=441

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 98/138 (71%), Gaps = 0/138 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L NKLSGCLP+EIG L  +TVFD   N+LTGPIP+SFGC+ KL++LN+ +N+ YG+VPE 
Sbjct  276  LGNKLSGCLPFEIGYLNRTTVFDVGSNRLTGPIPESFGCMAKLQLLNMAHNRFYGAVPEV  335

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L +    +LS NYFTQ+GP+CR L++ + L+++ NCI+ LP QRSA  C +FF   +
Sbjct  336  LCRLPNAFNFTLSNNYFTQVGPQCRRLIKLRRLNVNRNCIMGLPFQRSATDCANFFSKPR  395

Query  392  KCPDHKSLLYVPCDIDES  339
             C    +   +PC +  +
Sbjct  396  SCARESTFSIIPCRLPAA  413



>emb|CDY16514.1| BnaA08g02530D [Brassica napus]
Length=475

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPY+IG L  +TVFD   NQLTG IP SFGCL K+E LNL  N+ YG++PE 
Sbjct  305  LNNSLTGCLPYQIGKLNRATVFDVGFNQLTGLIPYSFGCLAKMEQLNLARNKFYGTIPEI  364

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L+ LSLS NYFTQ GP+CR L+++ +LD+  NCILDLPNQ+ A  C  FF+  Q
Sbjct  365  VCELSSLKNLSLSYNYFTQAGPKCRELIKRNILDVRMNCILDLPNQKMASECSTFFMQRQ  424

Query  392  KCPDHKSLLYVPC  354
             CPD KS+  +PC
Sbjct  425  TCPDPKSMYLIPC  437



>gb|KHN30415.1| Hypothetical protein glysoja_033153 [Glycine soja]
Length=384

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 90/136 (66%), Gaps = 3/136 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N   GCLPY+IG L  +TVFD S N LTGPIP SF CL+ ++ LNL  NQ YG VPE 
Sbjct  220  LGNHFQGCLPYQIGYLDKATVFDVSKNSLTGPIPHSFACLQSIQYLNLDRNQFYGEVPEM  279

Query  572  LCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC L  L     LSLS NYFTQ+GP CRNL++  VLD+  NCIL LPNQR    C +FF 
Sbjct  280  LCLLPGLRNNGNLSLSDNYFTQVGPACRNLIKTNVLDVSYNCILGLPNQRPHGQCTEFFS  339

Query  401  HYQKCPDHKSLLYVPC  354
              + CP+ K L YVPC
Sbjct  340  KIKPCPNPKYLHYVPC  355



>ref|XP_004505256.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=470

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 97/136 (71%), Gaps = 3/136 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L NK  GCLP+EIG LK +TVFD S N LTGPIP SFGCLEK++ LNL +N+ YG+VPES
Sbjct  300  LGNKFEGCLPFEIGYLKKATVFDVSQNLLTGPIPASFGCLEKIQFLNLASNKFYGTVPES  359

Query  572  LCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C L  +     LSLS NYFT IGP C +L++ ++LD+  NCI  +PNQRS + C +F  
Sbjct  360  VCVLPGIRNNGNLSLSDNYFTSIGPACWSLIKYRILDVSKNCIPGIPNQRSPRECYEFQC  419

Query  401  HYQKCPDHKSLLYVPC  354
              + C +H+SL YVPC
Sbjct  420  KKKACSNHESLSYVPC  435



>ref|XP_010487869.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=459

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPY+IG L  +TVFD   N+LTGPIP SFGCL K+E LNL  N+ YG++PE 
Sbjct  291  LNNKLTGCLPYQIGNLNRATVFDVESNELTGPIPYSFGCLNKMEQLNLARNKFYGTIPEI  350

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L  L+ LSLS NYFTQ+GP+CR L+++K+LD+  NCI  L NQR+   C  FF+  +
Sbjct  351  LCELSSLKNLSLSSNYFTQVGPKCRTLIKRKILDVGMNCIRGLANQRTWWECARFFMRRK  410

Query  392  KCPDHKSLLYVPCDID  345
             CP+ KS  Y+PC  D
Sbjct  411  NCPNSKSFFYIPCGKD  426



>ref|XP_003516778.2| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=463

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 90/136 (66%), Gaps = 3/136 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N   GCLPY+IG L  +TVFD S N LTGPIP SF CL+ ++ LNL  NQ YG VPE 
Sbjct  299  LGNHFQGCLPYQIGYLDKATVFDVSKNSLTGPIPHSFACLQSIQYLNLDRNQFYGEVPEM  358

Query  572  LCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC L  L     LSLS NYFTQ+GP CRNL++  VLD+  NCIL LPNQR    C +FF 
Sbjct  359  LCLLPGLRNNGNLSLSDNYFTQVGPACRNLIKTNVLDVSYNCILGLPNQRPHGQCTEFFS  418

Query  401  HYQKCPDHKSLLYVPC  354
              + CP+ K L YVPC
Sbjct  419  KIKPCPNPKYLHYVPC  434



>gb|KJB14612.1| hypothetical protein B456_002G134000 [Gossypium raimondii]
Length=422

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LN++L+GC+PYEIGLLK + VFDA  NQLTG +P S  C+E LE LN   N L+G+VPE 
Sbjct  274  LNDQLTGCIPYEIGLLKEAVVFDAGNNQLTGHLPFSLACMENLEQLNFAGNLLFGAVPEV  333

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L  L  LSLS NYF  +GP CR L+E+ VLD+ NNCI DLP QRS + C +FF H +
Sbjct  334  VCELGKLMNLSLSENYFIHVGPMCRILIERGVLDVRNNCIPDLPFQRSVEECANFFAHPR  393

Query  392  KCPDHKSLLYVPC  354
             CP   S  Y+PC
Sbjct  394  FCPRMWSYNYIPC  406



>ref|XP_003528523.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
 gb|KHN43048.1| Hypothetical protein glysoja_007578 [Glycine soja]
Length=417

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 97/142 (68%), Gaps = 2/142 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPYEIG LKN T+FD   N LTGPIP SFGCL+K+E LNL  N LYG VPE 
Sbjct  253  LNNLLTGCLPYEIGFLKNLTLFDVGGNLLTGPIPWSFGCLKKVEQLNLARNFLYGQVPEV  312

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L   SLS NYFT++GP C+ L+++ VLD+  NCI  LP+QRS + C  FFL  +
Sbjct  313  VCALGNLANFSLSYNYFTKVGPLCKMLIQRGVLDVRKNCIFGLPDQRSVRECMAFFLIPK  372

Query  392  KCPDHKSLL-YVPCDIDESPRK  330
             C  H +L  +VPC I     K
Sbjct  373  SC-SHPALFNFVPCQIQHHWTK  393



>ref|XP_009605357.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=382

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYE+G LK + VFDA  N+LTGP+P S GCLEK+E+LN   N+LYG VP+ 
Sbjct  233  LNNLLSGCLPYELGFLKQAVVFDAGNNRLTGPLPFSLGCLEKVEVLNFAGNKLYGIVPDV  292

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L  LSLS NYFT +GP C +L+   VLD+ NNCI  LP QRS   C +FF + +
Sbjct  293  ICALGNLANLSLSDNYFTGVGPICLSLIRNGVLDLKNNCIPGLPFQRSFAECVEFFAYPR  352

Query  392  KCPDHKSLLYVPC  354
             CP   +  Y+PC
Sbjct  353  YCPHMATYSYIPC  365



>ref|XP_010094651.1| Uncharacterized protein L484_008883 [Morus notabilis]
 gb|EXB56502.1| Uncharacterized protein L484_008883 [Morus notabilis]
Length=437

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 93/138 (67%), Gaps = 0/138 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIG L  +TVFD   N LTGPIPQSFGCL  L+ LNL +NQLYG +PES
Sbjct  271  LNNRLTGCLPYEIGFLGQATVFDVGGNLLTGPIPQSFGCLRNLQYLNLAHNQLYGLIPES  330

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L +    +LS N+FTQ+G +CR L+    L++  NCIL LP+Q+S   C  FF   +
Sbjct  331  LCRLPNAYNFTLSYNFFTQVGVQCRRLIRAGTLNVRRNCILGLPDQKSTAECGRFFSRAR  390

Query  392  KCPDHKSLLYVPCDIDES  339
             CP   +   V C+I  +
Sbjct  391  TCPRENTFSIVTCNISAT  408



>gb|KHN12808.1| Hypothetical protein glysoja_008771 [Glycine soja]
Length=224

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIG L+ +TVFDA  NQLTGP+P S  CLEK+E+LN   N LYG VPE 
Sbjct  81   LNNQLTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNFGGNLLYGMVPEV  140

Query  572  LC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHY  396
            +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +FF   
Sbjct  141  VCVGLVNLVNFSLSDNYFTHVGPFCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEFFATP  200

Query  395  QKCPDHKSLLYVPCDI  348
            + CP       +PC +
Sbjct  201  RMCPFMWFHGLIPCKL  216



>ref|XP_011069732.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=424

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 89/133 (67%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYE+GLLK + VFDA  N LTGP+P S  CLEKLE+LN   N LYG +PE 
Sbjct  272  LNNLLSGCLPYELGLLKQAVVFDAGNNYLTGPLPFSLACLEKLEVLNFAGNLLYGHIPEV  331

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC L +L  LSLS NYFT +GP C  L++  VLD+  NCI  LP QRS   C  FF H +
Sbjct  332  LCGLGNLANLSLSDNYFTGVGPVCWRLIKNGVLDVKKNCIPGLPFQRSVAECAAFFAHPR  391

Query  392  KCPDHKSLLYVPC  354
             CP   +  ++PC
Sbjct  392  YCPYMPTYAHIPC  404



>ref|XP_010688602.1| PREDICTED: uncharacterized protein At4g06744 [Beta vulgaris subsp. 
vulgaris]
Length=461

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            +NN+L+GCLPYE+G LK  TVFD S NQLTGP+P S  CLE++ +L+++ N LYG VP+ 
Sbjct  324  MNNQLTGCLPYELGFLKQVTVFDISRNQLTGPLPFSLACLERVALLDVSENLLYGMVPDM  383

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L +L +L LS NYFTQ+GP CRNL+ + +LD+ NNC+ DLP QRS   C  FF   +
Sbjct  384  LCQLPNLGKLDLSDNYFTQVGPACRNLISRGILDVKNNCVPDLPYQRSVFECASFFAVPK  443

Query  392  KCPDHKSLLYVPC  354
             CP   +   +PC
Sbjct  444  NCPYMDTFKIIPC  456



>ref|XP_011000139.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=421

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 94/139 (68%), Gaps = 0/139 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPYE+G L+   +FDA  N LTGP+P S GCL KLE  NLT N LYG VPE 
Sbjct  257  LNNLLTGCLPYELGFLRELVLFDAGNNLLTGPLPCSLGCLAKLEQFNLTGNLLYGQVPEV  316

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L  L  LSLS NYFT++GP CR L++  VLDI  NCI DLP+QRS   C+ F L  +
Sbjct  317  VCALGKLVNLSLSSNYFTELGPTCRKLVDSGVLDIKKNCIHDLPDQRSVLECEAFSLQRR  376

Query  392  KCPDHKSLLYVPCDIDESP  336
             CP+ +S   +PC +  SP
Sbjct  377  YCPNPESFNLIPCKVPSSP  395



>gb|ADN33724.1| LRR-family protein [Cucumis melo subsp. melo]
Length=439

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 104/171 (61%), Gaps = 5/171 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N+L+GCLP+EIG L  +TVFDA+ N LTGPIPQSFGCL  L+ILNL +NQ YG++PES
Sbjct  266  LKNRLTGCLPFEIGYLVKATVFDANTNILTGPIPQSFGCLFSLQILNLADNQFYGTIPES  325

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L D+  ++LS NYFT+IGP CR L+  + L I  NCI     Q++   C  FF   +
Sbjct  326  ICRLPDIYNITLSNNYFTRIGPVCRKLVTAQRLHIQGNCIPGFRLQKTQSQCAAFFAKPR  385

Query  392  KCPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDRP  240
             CP   +  YVPC +   P  A                S  +YAAL  +RP
Sbjct  386  TCPRANTFSYVPCVL---PTAAQLDKATVTSVDDMVPPSPRSYAAL--ERP  431



>ref|XP_002300228.2| hypothetical protein POPTR_0001s30990g [Populus trichocarpa]
 gb|EEE85033.2| hypothetical protein POPTR_0001s30990g [Populus trichocarpa]
Length=421

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 91/139 (65%), Gaps = 0/139 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPYE+G L    +FDA  N LTGP+P S GCL KLE  NLT N LYG VPE 
Sbjct  257  LNNLLAGCLPYELGFLSELVLFDAGNNLLTGPLPCSLGCLAKLEQFNLTGNLLYGQVPEV  316

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L  L  LSLS NYFT++GP CR L+   VLDI  NCI DLP+QRS   C  F LH +
Sbjct  317  VCALGKLVNLSLSSNYFTELGPTCRKLVNSGVLDIKKNCIHDLPDQRSVLECDAFSLHPR  376

Query  392  KCPDHKSLLYVPCDIDESP  336
             CP+  S   +PC +  SP
Sbjct  377  YCPNPASFNLIPCKVPSSP  395



>ref|XP_002518710.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43635.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=418

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GC+PYEIG LK   +FDAS N LTGP+P S GCL K+E LNL  N LYG VPE 
Sbjct  255  LNNLLTGCIPYEIGFLKELALFDASNNLLTGPLPCSLGCLAKIEQLNLAGNFLYGQVPEV  314

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L  LSLS NYFT+IGP C  L++  VLDI NNCI  LP+QRS   C  FFLH +
Sbjct  315  VCALGNLANLSLSNNYFTKIGPLCWKLVKTGVLDIRNNCIHGLPDQRSWHECFFFFLHPK  374

Query  392  KCPDHKSLLYVPCDI  348
             CP      ++PC I
Sbjct  375  YCPYPSFFHFIPCKI  389



>ref|XP_009396708.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 97/145 (67%), Gaps = 8/145 (6%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIG L  +TVFDA  NQ+TGPIP SFGCL KLE LNL  N LYG VP+ 
Sbjct  278  LNNRLSGCLPYEIGFLSIATVFDAGFNQMTGPIPWSFGCLLKLEQLNLAGNLLYGEVPDV  337

Query  572  LCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C+L    +L  LSLSGNYFT +G  C +L++ KVLD+  NCI  LP QRS   C  F+ 
Sbjct  338  VCRLAKDGNLANLSLSGNYFTWLGHSCWDLVKTKVLDVRQNCIPGLPEQRSPAECSTFWW  397

Query  401  HYQKC-PDHKSLLYVPCDIDESPRK  330
              ++C P H     +PC + + P K
Sbjct  398  GPKQCLPSHD----IPCSLPKGPTK  418



>ref|XP_008444596.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=507

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 104/171 (61%), Gaps = 5/171 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N+L+GCLP+EIG L  +TVFDA+ N LTGPIPQSFGCL  L+ILNL +NQ YG++PES
Sbjct  338  LKNRLTGCLPFEIGYLVKATVFDANTNILTGPIPQSFGCLFSLQILNLADNQFYGTIPES  397

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L D+  ++LS NYFT+IGP CR L+  + L I  NCI     Q++   C  FF   +
Sbjct  398  ICRLPDIYNITLSNNYFTRIGPVCRKLVTAQRLHIQGNCIPGFRLQKTQSQCAAFFAKPR  457

Query  392  KCPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDRP  240
             CP   +  YVPC +   P  A                S  +YAAL  +RP
Sbjct  458  TCPRANTFSYVPCVL---PTAAQLDKATVTSVDDMVPPSPRSYAAL--ERP  503



>ref|XP_007160878.1| hypothetical protein PHAVU_001G024400g [Phaseolus vulgaris]
 gb|ESW32872.1| hypothetical protein PHAVU_001G024400g [Phaseolus vulgaris]
Length=427

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 95/136 (70%), Gaps = 1/136 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIG L+ +TVFDA  NQLTGP+P S  CLEK+E+LNL  N LYG VPE 
Sbjct  285  LNNQLTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNLGGNLLYGMVPEV  344

Query  572  LCK-LKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHY  396
            +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +FF   
Sbjct  345  VCAGLVNLVNFSLSDNYFTHVGPLCRILIQRGVLDVRNNCIPDLPFQRSVIECAEFFATP  404

Query  395  QKCPDHKSLLYVPCDI  348
            + CP      ++PC +
Sbjct  405  RMCPFMWFYSFIPCKL  420



>ref|XP_008393778.1| PREDICTED: uncharacterized protein At4g06744-like [Malus domestica]
Length=463

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIGLLK + V D   NQLTGP+P S  CLE +E LN   N L+G VPE 
Sbjct  314  LNNQLTGCLPYEIGLLKQALVLDVGNNQLTGPLPFSLACLENVEQLNFAGNLLHGMVPEV  373

Query  572  LC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHY  396
            +C +L+ LE  SLS NYFT +GP CR+L+ K VLD+ NNC+ DLP QR  + C DFF H 
Sbjct  374  VCHELQSLENFSLSDNYFTNVGPICRSLIGKGVLDVTNNCVPDLPFQRPVEECADFFAHP  433

Query  395  QKCPDHKSLLYVPC  354
            + CP   +  Y+PC
Sbjct  434  RFCPFMWTYTYIPC  447



>ref|XP_007157716.1| hypothetical protein PHAVU_002G092300g [Phaseolus vulgaris]
 gb|ESW29710.1| hypothetical protein PHAVU_002G092300g [Phaseolus vulgaris]
Length=413

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 98/142 (69%), Gaps = 1/142 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPY+IG L N  + D   N LTGPIP SFGCL+K+E LNL  N LYG VPE 
Sbjct  253  LNNLLTGCLPYDIGFLGNVRLLDVGGNLLTGPIPWSFGCLKKVEQLNLARNFLYGQVPEV  312

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L  LSLS NYFT++GP C++L+++ VLD+ NNCI+ LP+QRSA+ C  FF   +
Sbjct  313  VCALGNLANLSLSYNYFTKVGPSCKSLIQRGVLDVRNNCIVGLPDQRSAKECMAFFSIPR  372

Query  392  KCPDHKSLLYVPCDIDES-PRK  330
             C    S   +PC I  + PR+
Sbjct  373  SCLHPASFNIIPCQIHWTKPRE  394



>gb|KHN22492.1| Hypothetical protein glysoja_041167 [Glycine soja]
Length=410

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 94/136 (69%), Gaps = 1/136 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIG L+ +TVFDA  NQLTGP+P S  CLEK+E+LNL  N LYG VPE 
Sbjct  267  LNNQLTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNLGGNMLYGMVPEV  326

Query  572  LC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHY  396
            +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +FF   
Sbjct  327  VCVGLVNLVNFSLSDNYFTHVGPLCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEFFATP  386

Query  395  QKCPDHKSLLYVPCDI  348
            + CP       +PC +
Sbjct  387  RMCPFMWFHGLIPCKL  402



>ref|XP_003545325.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=435

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 94/136 (69%), Gaps = 1/136 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIG L+ +TVFDA  NQLTGP+P S  CLEK+E+LNL  N LYG VPE 
Sbjct  292  LNNQLTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNLGGNMLYGMVPEV  351

Query  572  LC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHY  396
            +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +FF   
Sbjct  352  VCVGLVNLVNFSLSDNYFTHVGPLCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEFFATP  411

Query  395  QKCPDHKSLLYVPCDI  348
            + CP       +PC +
Sbjct  412  RMCPFMWFHGLIPCKL  427



>ref|XP_008798694.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=469

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 97/146 (66%), Gaps = 9/146 (6%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYE+GLLK +TVFDA  N +TGPIP SFGCL+K+E LNL  N LYG VP+ 
Sbjct  288  LNNQLSGCLPYEVGLLKKATVFDAGTNYITGPIPLSFGCLKKVEQLNLAQNLLYGEVPDV  347

Query  572  LCKLKD---LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC+L D   L  LSLS NYFT +G  C  L+++ +LD+  NCI  LP QRS   C  F  
Sbjct  348  LCRLADVGHLANLSLSSNYFTWVGTSCWQLIKRGILDVRKNCIRGLPEQRSPAECAQFLK  407

Query  401  HYQKCPDHKSLLYVPCDIDESPRKAG  324
              + CP    L ++PC I   PRK G
Sbjct  408  QPKYCP---YLPHIPCRI---PRKDG  427



>gb|KEH30896.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=413

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 93/140 (66%), Gaps = 0/140 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIG LKN  +FDA  N LTGP+P S GCL+K+E LN   N LYG VPE 
Sbjct  254  LNNQLTGCLPYEIGFLKNLQLFDAGNNLLTGPLPFSLGCLKKVEQLNFARNMLYGQVPEV  313

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +LE L+LS NYF ++GP CR L++  VLD+  NCI DLP+QR  + C  F+   +
Sbjct  314  VCSLGNLENLTLSYNYFNRVGPLCRKLIKSGVLDVKKNCIFDLPDQRPMEDCVKFYAVPR  373

Query  392  KCPDHKSLLYVPCDIDESPR  333
             C    S   +PC +   PR
Sbjct  374  TCLGSGSFTVIPCQLPMKPR  393



>ref|XP_010664550.1| PREDICTED: uncharacterized protein At4g06744 isoform X2 [Vitis 
vinifera]
Length=425

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 100/170 (59%), Gaps = 3/170 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N+LSGCLPYEIG L+ +TVFDA  N LTGPIPQSF CL+KL++L+L +NQ YG +P+S
Sbjct  259  LKNRLSGCLPYEIGFLQMATVFDAGFNTLTGPIPQSFACLKKLQLLSLAHNQFYGRIPDS  318

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L +    +LS NYF  IGP C+ L+    LD+  NCI  LPNQRSA  C  F+   +
Sbjct  319  LCRLPNAYNFTLSYNYFNSIGPYCKRLVNIGRLDVRRNCITGLPNQRSAAECTAFYSVSR  378

Query  392  KCPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDR  243
             CP   S   + C    +P  +                S  TY AL+  R
Sbjct  379  TCPRPGSFNVITC---SNPAASLSSAQVASLQAMAPAPSPVTYKALEPPR  425



>ref|XP_002284965.1| PREDICTED: uncharacterized protein At4g06744 isoform X1 [Vitis 
vinifera]
 emb|CAN61024.1| hypothetical protein VITISV_001144 [Vitis vinifera]
 emb|CBI19481.3| unnamed protein product [Vitis vinifera]
Length=437

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 100/170 (59%), Gaps = 3/170 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N+LSGCLPYEIG L+ +TVFDA  N LTGPIPQSF CL+KL++L+L +NQ YG +P+S
Sbjct  271  LKNRLSGCLPYEIGFLQMATVFDAGFNTLTGPIPQSFACLKKLQLLSLAHNQFYGRIPDS  330

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L +    +LS NYF  IGP C+ L+    LD+  NCI  LPNQRSA  C  F+   +
Sbjct  331  LCRLPNAYNFTLSYNYFNSIGPYCKRLVNIGRLDVRRNCITGLPNQRSAAECTAFYSVSR  390

Query  392  KCPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDR  243
             CP   S   + C    +P  +                S  TY AL+  R
Sbjct  391  TCPRPGSFNVITC---SNPAASLSSAQVASLQAMAPAPSPVTYKALEPPR  437



>ref|XP_010094650.1| Uncharacterized protein L484_008882 [Morus notabilis]
 gb|EXB56501.1| Uncharacterized protein L484_008882 [Morus notabilis]
Length=415

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 97/144 (67%), Gaps = 2/144 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIG LK + VFD   N+LTGP+P S  CLEK+E LN   N LYG VPE 
Sbjct  260  LNNELTGCLPYEIGFLKEAVVFDVGNNRLTGPLPFSLACLEKVEQLNFAGNLLYGMVPEV  319

Query  572  LC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHY  396
            +C +LK+L   SLS NYFT +GP CR L+E+ VLD+  NCI DLP QRS + C  FF + 
Sbjct  320  VCDELKNLANFSLSDNYFTYVGPLCRRLIERGVLDVRRNCIPDLPYQRSMEECGAFFSYP  379

Query  395  QK-CPDHKSLLYVPCDIDESPRKA  327
            ++ CP   S  ++PC     PR +
Sbjct  380  RRFCPYMWSYNHIPCQPPHYPRYS  403



>gb|KDP41694.1| hypothetical protein JCGZ_16101 [Jatropha curcas]
Length=438

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 91/141 (65%), Gaps = 0/141 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N+L+GCLP+EIG L+ +TV D   N LTGPIPQSFGCL KL+ILNL +N  YG +PE 
Sbjct  274  LGNRLTGCLPFEIGYLQKATVLDFGTNLLTGPIPQSFGCLAKLQILNLAHNMFYGPIPEV  333

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L +    +L+ NYFTQ+GP+CR L+  + L+++ NCI  L  QR A  C  FF   +
Sbjct  334  LCRLPNAFNFTLTYNYFTQVGPQCRRLIRARRLNVNRNCIFGLTGQRPAAECARFFARPR  393

Query  392  KCPDHKSLLYVPCDIDESPRK  330
             C    S   +PC +  S  K
Sbjct  394  TCARESSFSLIPCSLPASSMK  414



>ref|XP_009395500.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=448

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 94/139 (68%), Gaps = 6/139 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKLSGCLPYEIGLL  +TVFDA  NQ+TGPIP SFGCL K+E LNL  N LYG VP+ 
Sbjct  285  LNNKLSGCLPYEIGLLSIATVFDAGFNQVTGPIPWSFGCLLKVEQLNLAGNLLYGEVPDV  344

Query  572  LCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C+L    +L  LSLSGNYFT +G  C +L++ KVLD+ +NCI+ LP QR    C  F  
Sbjct  345  VCRLAKDGNLANLSLSGNYFTSLGLSCWDLVKSKVLDVRHNCIVGLPEQRPPSECSKFLW  404

Query  401  HYQKCPDHKSLLYVPCDID  345
              + CP      Y+PC + 
Sbjct  405  RPKHCPVSH---YIPCSLS  420



>ref|XP_006346520.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=397

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 96/142 (68%), Gaps = 1/142 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GC+PYE+GLLK + V D   N LTGP+P+S GCLE +E LN   N LYG VPE 
Sbjct  235  LNNLLTGCIPYELGLLKKAIVIDVGFNTLTGPLPRSLGCLESVEQLNFAGNLLYGQVPEV  294

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C LK+L   +LS NYFT++GP CR L++  VL+++ NCI  LPNQRS   C  F +  +
Sbjct  295  ICSLKNLVNFTLSYNYFTKVGPLCRELIDNGVLNVEKNCINGLPNQRSILECVLFRMQIK  354

Query  392  KCPDHKSLLYVPCDIDE-SPRK  330
             CP  KSL  +PC+I   SP +
Sbjct  355  LCPLQKSLRIIPCNISNFSPHR  376



>ref|XP_010466072.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=469

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 98/136 (72%), Gaps = 0/136 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPY+IG L  +TVFD   N+LTGP+P SFGCL K+E L L  N+ YG++PE 
Sbjct  302  LNNKLTGCLPYQIGNLNQATVFDVESNELTGPVPYSFGCLNKMEQLILARNKFYGAIPEI  361

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L  L+ LSLS NYFTQ+GP+CR L+++++LD+  NCI  L NQR+   C  FF+  Q
Sbjct  362  LCELSSLKNLSLSSNYFTQVGPKCRTLIKRRILDVGRNCIRGLANQRTWWECARFFMRRQ  421

Query  392  KCPDHKSLLYVPCDID  345
             CP+ KS   +PC  D
Sbjct  422  NCPNSKSFFNIPCGKD  437



>gb|KJB32335.1| hypothetical protein B456_005G236200 [Gossypium raimondii]
Length=413

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL+GCLPYE+G LK   +FD   N LTGP+P S  CL+K+E+LNL NN  Y  VPE 
Sbjct  250  LNNKLTGCLPYEVGFLKELKLFDVEDNLLTGPLPCSLSCLDKIELLNLANNLFYWEVPEE  309

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC L +LE L+LSGNYFT++GP CR L++  +LD+  NC+ DLP+QRS   C +F+L Y 
Sbjct  310  LCALVNLENLTLSGNYFTKVGPACRKLIKNGILDMTQNCVPDLPHQRSLLECTEFYLKYI  369

Query  392  K-CPDHKSLLYVPC  354
            + CP  ++   +PC
Sbjct  370  RFCPYPETYKIIPC  383



>ref|XP_009417193.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=456

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 100/147 (68%), Gaps = 9/147 (6%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N+LSGCLPYE GLLK +TVFDA  NQ+TGPIP SFGCL+K+E LNL  N LYG VP+ 
Sbjct  279  LGNRLSGCLPYETGLLKRATVFDAGSNQITGPIPLSFGCLQKVEQLNLAGNLLYGEVPDV  338

Query  572  LCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C+L     L  LSLS NYFT + P C  L+++KVLD+  NCI  LPNQR  + C  +FL
Sbjct  339  VCQLAKYGHLANLSLSDNYFTSVAPSCAGLIQQKVLDVRKNCIPGLPNQRPPEACA-WFL  397

Query  401  HYQK--CPDHKSLLYVPCDIDESPRKA  327
            +  K  CP+ +   Y+PC +  + R A
Sbjct  398  NRPKITCPNAQ---YIPCHLPWAGRDA  421



>ref|XP_006354850.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=384

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 87/132 (66%), Gaps = 0/132 (0%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            NN LSGCLPYEIG L  + VFDA  N+LTGP+P S GCLE +E+LN   NQ+YG VP+ +
Sbjct  236  NNLLSGCLPYEIGFLNEAIVFDAGNNRLTGPLPFSLGCLENVEMLNFARNQMYGIVPDVI  295

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            C L +L  LSLS NYFT  GP C  L+E  VLD+ NNCI   P QRS   C  FF + + 
Sbjct  296  CALGNLANLSLSDNYFTGFGPICLRLIENGVLDLRNNCIPGFPFQRSIAECVAFFAYPRY  355

Query  389  CPDHKSLLYVPC  354
            CP   +  Y+PC
Sbjct  356  CPHMATYTYIPC  367



>ref|XP_006422962.1| hypothetical protein CICLE_v10028712mg [Citrus clementina]
 gb|ESR36202.1| hypothetical protein CICLE_v10028712mg [Citrus clementina]
Length=360

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPYE+G L+ + VFDAS N+LTGP+P S GCLEK+E LNL+ N LYG VPE 
Sbjct  197  LNNLLTGCLPYELGFLREARVFDASNNRLTGPLPCSLGCLEKIERLNLSGNLLYGQVPEV  256

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC L +L  LSLS NYFT +GP CR L++  VLD++ NCI  LP+QRS   C  FFL  +
Sbjct  257  LCALDNLVNLSLSNNYFTGVGPLCRKLIKNGVLDVNRNCIHYLPDQRSTHECALFFLQPR  316

Query  392  KCPDHKSLLYVPCD  351
             C       ++PC 
Sbjct  317  FCFYPSWYNFIPCS  330



>ref|XP_009768848.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=408

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYE+GLL  + VFDA  N+LTGP+P S GCLE +E+LN   NQLYG VPE 
Sbjct  262  LNNLLSGCLPYELGLLNEAVVFDAGNNRLTGPLPFSLGCLENMEVLNFAGNQLYGMVPEV  321

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L  LSLS N+F  +GP C +L+++ V+D+  NCI  LP+QRS   C  FF   +
Sbjct  322  ICSLGNLANLSLSHNFFIGVGPICLSLIKEGVVDVRKNCIPGLPSQRSTAECVAFFAQPR  381

Query  392  KCPDHKSLLYVPC  354
             CP  ++  Y+PC
Sbjct  382  YCPYMETYSYIPC  394



>ref|XP_003550327.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=443

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIG L+ +TVFDA  NQLTGP+P S  CLEK+E+LN   N LYG VPE 
Sbjct  300  LNNQLTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNFGGNLLYGMVPEV  359

Query  572  LC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHY  396
            +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +FF   
Sbjct  360  VCVGLVNLVNFSLSDNYFTHVGPFCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEFFATP  419

Query  395  QKCPDHKSLLYVPCDI  348
            + CP       +PC +
Sbjct  420  RMCPFMWFHGLIPCKL  435



>ref|XP_007017156.1| LRR-family protein [Theobroma cacao]
 gb|EOY14381.1| LRR-family protein [Theobroma cacao]
Length=441

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L NKLSGCLP+EIG L  +TVFD   N+LTGPIPQSFGC+ +L++LN+ +N+ YG +PE 
Sbjct  276  LGNKLSGCLPFEIGYLNRTTVFDVGSNRLTGPIPQSFGCMARLQLLNMAHNKFYGPIPEV  335

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L      +LS NYFTQ+GP+CR L+  + L+++ NCI+ LPNQRSA  C  FF   +
Sbjct  336  LCRLPRAFNFTLSNNYFTQVGPQCRRLIRLRRLNVNRNCIMGLPNQRSAADCGRFFARPR  395

Query  392  KCPDHKSLLYVPCDIDES  339
             C    +   +PC +  +
Sbjct  396  TCARESTFSIIPCRLPAA  413



>gb|KCW68710.1| hypothetical protein EUGRSUZ_F02313 [Eucalyptus grandis]
Length=362

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 89/136 (65%), Gaps = 3/136 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+ SGCLPYEIGLL  + V DA  NQLTGP+P S  CLEK+E LNL  N  YG VPE 
Sbjct  211  LNNRFSGCLPYEIGLLDETVVLDAGNNQLTGPLPLSLFCLEKVEQLNLGGNLFYGMVPEP  270

Query  572  LCKL---KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C L   ++L  LSLS NYF  +GP CR L+EK +L++ NNCI DLP QR    C  FF 
Sbjct  271  ICWLGLNRNLVNLSLSDNYFQHVGPWCRALIEKGILNVRNNCIPDLPFQRPVADCARFFA  330

Query  401  HYQKCPDHKSLLYVPC  354
              + CP   S  YVPC
Sbjct  331  QPRPCPRMWSYSYVPC  346



>gb|KDO59786.1| hypothetical protein CISIN_1g048561mg, partial [Citrus sinensis]
Length=382

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPYE+G L+ + VFDAS N+LTGP+P S GCLEK+E LNL+ N LYG VPE 
Sbjct  219  LNNLLTGCLPYELGFLREARVFDASNNRLTGPLPCSLGCLEKIERLNLSGNLLYGQVPEV  278

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC L +L  LSLS NYFT +GP CR L++  VLD++ NCI  LP+QRS   C  FFL  +
Sbjct  279  LCALDNLVNLSLSNNYFTGVGPLCRKLIKNGVLDVNRNCIHYLPDQRSTHECALFFLQPR  338

Query  392  KCPDHKSLLYVPCD  351
             C       ++PC 
Sbjct  339  FCFYPSWYNFIPCS  352



>ref|XP_008236575.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=423

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 97/143 (68%), Gaps = 2/143 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            +NN ++GC+PYE+G LK++T+FDA  NQLTGP+P S GCLEK+E LN   N LYG VPE 
Sbjct  269  MNNLITGCIPYELGFLKDATLFDAGNNQLTGPLPCSLGCLEKIEQLNFAGNLLYGKVPEV  328

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L +L  LSLS NYFT +GP CR L++  VLD+  NCI DL +QRS + C  F  H +
Sbjct  329  VCELGNLANLSLSNNYFTMVGPICRKLIKSGVLDLRKNCIRDLADQRSVEECASFSSHPR  388

Query  392  KCPDHKSLLYVPCDIDESPRKAG  324
             C   +S   +PC +   P+  G
Sbjct  389  SCLHPESFSVMPCKV--PPKSKG  409



>ref|XP_011074595.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=411

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 88/133 (66%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L+N LSGCLPYE+GLLK + VFDA  N LTGP+P S GCLEKLE+LN   N LYGSVP+ 
Sbjct  262  LDNMLSGCLPYELGLLKEAVVFDAGNNNLTGPLPFSLGCLEKLEVLNFAGNLLYGSVPDV  321

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC L++L  LSLS NY TQ GP C  L++  VLD+  NCI   P QRS   C  FF   +
Sbjct  322  LCGLRNLMNLSLSDNYLTQAGPSCMRLIKNGVLDVRKNCIPGQPFQRSVAECAAFFARPR  381

Query  392  KCPDHKSLLYVPC  354
             CP   +   VPC
Sbjct  382  NCPYMDTYSQVPC  394



>ref|XP_006487027.1| PREDICTED: uncharacterized protein At4g06744-like [Citrus sinensis]
Length=418

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPYE+G L+ + VFDAS N+LTGP+P S GCLEK+E LNL+ N LYG VPE 
Sbjct  255  LNNLLTGCLPYELGFLREARVFDASNNRLTGPLPCSLGCLEKIERLNLSGNLLYGQVPEV  314

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC L +L  LSLS NYFT +GP CR L++  VLD++ NCI  LP+QRS   C  FFL  +
Sbjct  315  LCALDNLVNLSLSNNYFTGVGPLCRKLIKNGVLDVNRNCIHYLPDQRSTHECALFFLQPR  374

Query  392  KCPDHKSLLYVPCD  351
             C       ++PC 
Sbjct  375  FCFYPSWYNFIPCS  388



>ref|XP_004499033.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=382

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPYEIG L+ + VFD   NQLTGP+P S  CLEK+E++NL  N  YG VP+ 
Sbjct  236  LNNDLTGCLPYEIGYLEEAIVFDVGNNQLTGPLPLSLSCLEKVEVVNLAGNMFYGMVPDV  295

Query  572  LCK-LKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHY  396
            LC+ L++L   SL  NYFT +GP CR L+E+ +LD+  NCILDLP QRS   C DFF   
Sbjct  296  LCEGLENLVNFSLYDNYFTHVGPFCRMLIERGILDVGKNCILDLPFQRSVIECADFFSRP  355

Query  395  QKCPDHKSLLYVPCDI  348
            + CP      + PC++
Sbjct  356  KMCPFMWFHSFFPCNV  371



>ref|XP_009617390.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=420

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGC PYE+GLL  + VFDA  N+LTGP+P S GCLE +E+LN   NQLYG VPE 
Sbjct  264  LNNLLSGCFPYELGLLNEAVVFDAGNNRLTGPLPFSLGCLENMEVLNFAGNQLYGMVPEV  323

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L++L  LSLS N+F  +GP C +L+++ V+D+  NCI  LP+QRS   C  +F   +
Sbjct  324  VCSLRNLANLSLSNNFFIGVGPICLSLIKEGVVDVRKNCIPGLPSQRSTAECVAYFAQPR  383

Query  392  KCPDHKSLLYVPC  354
             CP  ++  Y+PC
Sbjct  384  YCPYMETYSYIPC  396



>gb|EPS58531.1| hypothetical protein M569_16282, partial [Genlisea aurea]
Length=344

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 86/134 (64%), Gaps = 0/134 (0%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            NN L+GCLPY++GLLK   V DA+ NQLTGP+P S  CLEK+EILNL  N+LYGSVP+ L
Sbjct  209  NNSLTGCLPYQLGLLKEVVVIDAAENQLTGPLPTSIACLEKVEILNLAGNRLYGSVPDLL  268

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            C+L  L  LSLS NYFT  G  C  L+   VLD+ NNCI  LP QR    C  FF     
Sbjct  269  CRLSKLTNLSLSDNYFTVAGDSCMGLIRSGVLDLTNNCIPGLPFQRPPMECAAFFAGQPS  328

Query  389  CPDHKSLLYVPCDI  348
            CP+      +PC I
Sbjct  329  CPNQYIFSKIPCRI  342



>ref|XP_011000899.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=423

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 93/137 (68%), Gaps = 0/137 (0%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            +N L+GCLPYE+G L+N  +FDAS N LTG +P S GCL KLE  NL +N LYG VPE L
Sbjct  258  HNLLTGCLPYELGFLRNLVLFDASNNFLTGHLPCSLGCLAKLEQFNLASNLLYGQVPEVL  317

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            C L  L  LSLS NYFT++GP+C  L ++ VLDI  NCI DLP QRSA+ C  F LH + 
Sbjct  318  CALGKLVNLSLSSNYFTKLGPKCGELEKRGVLDIRKNCIPDLPGQRSARECAAFSLHPRY  377

Query  389  CPDHKSLLYVPCDIDES  339
            C +  S  Y+PC +  S
Sbjct  378  CSNPASFNYIPCKVPSS  394



>ref|XP_010061722.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=455

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 89/136 (65%), Gaps = 3/136 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+ SGCLPYEIGLL  + V DA  NQLTGP+P S  CLEK+E LNL  N  YG VPE 
Sbjct  304  LNNRFSGCLPYEIGLLDETVVLDAGNNQLTGPLPLSLFCLEKVEQLNLGGNLFYGMVPEP  363

Query  572  LCKL---KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C L   ++L  LSLS NYF  +GP CR L+EK +L++ NNCI DLP QR    C  FF 
Sbjct  364  ICWLGLNRNLVNLSLSDNYFQHVGPWCRALIEKGILNVRNNCIPDLPFQRPVADCARFFA  423

Query  401  HYQKCPDHKSLLYVPC  354
              + CP   S  YVPC
Sbjct  424  QPRPCPRMWSYSYVPC  439



>ref|XP_010928365.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=457

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 94/144 (65%), Gaps = 8/144 (6%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIGLL  +TVFDA  NQ+TGPIP SFGCL+K+E LNL  N LYG+VP+ 
Sbjct  286  LNNRLSGCLPYEIGLLSEATVFDAGFNQITGPIPLSFGCLQKVEQLNLAGNLLYGNVPDV  345

Query  572  LCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C+L     L  LSLSGNYFT IG  C  L++  VLD+  NCI   P+QR    C  FF 
Sbjct  346  VCRLAKTGQLANLSLSGNYFTSIGYSCWELIKSGVLDVRQNCIPGFPDQRRPDECWWFFT  405

Query  401  H--YQKCPDHKSLLYVPCDIDESP  336
            H  +  CP      Y+PC    +P
Sbjct  406  HPRHYFCPFFH---YIPCKCPVAP  426



>ref|XP_009359966.1| PREDICTED: uncharacterized protein At4g06744-like [Pyrus x bretschneideri]
Length=468

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYEIGLLK + V D   NQLTGP+P S  CLE +E LN   N L+G VPE 
Sbjct  319  LNNQLTGCLPYEIGLLKQAVVLDFGNNQLTGPLPFSLACLENVEQLNFAGNLLHGMVPEV  378

Query  572  LC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHY  396
            LC +L+ L   SLS NYFT +GP CR+L+ K VLD+ NNC+ DL  QR  + C DFF H 
Sbjct  379  LCHELQSLANFSLSDNYFTNVGPICRSLIGKGVLDVTNNCVPDLLFQRPVEECADFFAHP  438

Query  395  QKCPDHKSLLYVPCDI  348
            + CP   +  Y+PC +
Sbjct  439  RFCPFMWTYTYIPCKL  454



>ref|XP_010927582.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=469

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 104/181 (57%), Gaps = 17/181 (9%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYE+GLLK +TVFDA  N +TGPIP SFGCL+K+E LNL  N LYG VP+ 
Sbjct  293  LNNELSGCLPYEVGLLKKATVFDAGTNHITGPIPLSFGCLKKVEQLNLAQNFLYGEVPDV  352

Query  572  LCKLKD---LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C+L D   L  LSLS NYFT +G  C  LLE+ +LD+  NCI  LP+QRS   C  F  
Sbjct  353  VCRLADVGHLANLSLSSNYFTWLGTSCWRLLERGILDVRKNCIRGLPDQRSPAECFWFLK  412

Query  401  HYQKCPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGSS--------TTYAALKVD  246
              + CP      ++PC +   P K G   H          G          TTY AL   
Sbjct  413  QPKYCP---YFPHIPCRL---PWKDGGAVHSAAAMLPAVGGGRDKAPASRYTTYTALHNR  466

Query  245  R  243
            R
Sbjct  467  R  467



>ref|XP_003529407.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=449

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 95/136 (70%), Gaps = 3/136 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N+  GCLP+EIG LK + VFD S N LTGPIP SFGCL+K++ LNL +N+LYG VP++
Sbjct  284  LKNQFEGCLPFEIGYLKKAVVFDISENLLTGPIPLSFGCLKKIQFLNLAHNKLYGCVPDN  343

Query  572  LCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC++  +     LSL+ NYF +IGP C +L++ KVLD+  NCI  LPNQ+S + C  F+ 
Sbjct  344  LCQIPSIRNNGNLSLANNYFNEIGPSCWSLIKSKVLDVSGNCIPGLPNQKSPKECYQFYK  403

Query  401  HYQKCPDHKSLLYVPC  354
              + CP+  S  YVPC
Sbjct  404  TKKTCPNPNSFYYVPC  419



>ref|XP_007042487.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
 gb|EOX98318.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
Length=415

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKLSGCLPYE+G LK   VFD   N LTGP+P S  CLEK+++LN  +N LY  VPE 
Sbjct  253  LNNKLSGCLPYELGFLKELEVFDVENNLLTGPLPWSLACLEKIKLLNFASNLLYWEVPEL  312

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC L +LE LSLS NYFT++GP CR L++  VL++  NCI DLP+Q+S   C +F+L Y 
Sbjct  313  LCALGNLENLSLSDNYFTKVGPICRKLIKNGVLNVRQNCIHDLPDQKSLHECAEFYLKYI  372

Query  392  K-CPDHKSLLYVPC  354
            + CP   +   +PC
Sbjct  373  RLCPYPATYKIIPC  386



>gb|KHN43047.1| Hypothetical protein glysoja_007577 [Glycine soja]
Length=456

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 95/136 (70%), Gaps = 3/136 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N+  GCLP+EIG LK + VFD S N LTGPIP SFGCL+K++ LNL +N+LYG VP++
Sbjct  291  LKNQFEGCLPFEIGYLKKAVVFDISENLLTGPIPLSFGCLKKIQFLNLAHNKLYGCVPDN  350

Query  572  LCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC++  +     LSL+ NYF +IGP C +L++ KVLD+  NCI  LPNQ+S + C  F+ 
Sbjct  351  LCQIPSIRNNGNLSLANNYFNEIGPSCWSLIKSKVLDVSGNCIPGLPNQKSPKECYQFYK  410

Query  401  HYQKCPDHKSLLYVPC  354
              + CP+  S  YVPC
Sbjct  411  TKKTCPNPNSFYYVPC  426



>ref|XP_002313863.2| hypothetical protein POPTR_0009s10140g [Populus trichocarpa]
 gb|EEE87818.2| hypothetical protein POPTR_0009s10140g [Populus trichocarpa]
Length=424

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            +N L+GCLPYE+G L+   +FDAS N LTGP+P S GCL KLE  NL +N LYG VPE +
Sbjct  258  HNLLTGCLPYELGFLRKLVLFDASYNFLTGPLPCSLGCLAKLEQFNLASNLLYGQVPEVV  317

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            C L  L  LSLS NYFT++GP+C  L    VLDI  NCI DLP QRSA+ C  F LH + 
Sbjct  318  CALGKLVNLSLSSNYFTKLGPKCTKLERSGVLDIRKNCIPDLPGQRSARECAAFSLHRRY  377

Query  389  CPDHKSLLYVPCDI  348
            C +  S  ++PC +
Sbjct  378  CSNPASFNFIPCKV  391



>ref|XP_010554992.1| PREDICTED: uncharacterized protein At4g06744 [Tarenaya hassleriana]
Length=392

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 93/141 (66%), Gaps = 7/141 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPYEIG LK + VFD   N+LTGP+P S  CLEK E LN   N L+G+VPE+
Sbjct  240  LNNDLTGCLPYEIGFLKEARVFDVGQNRLTGPLPTSLTCLEKAEQLNFAGNSLFGTVPET  299

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
             C L++L   SLS NYFT++GP CR L+ K VLD+ NNCI  LPNQRS + C DF    +
Sbjct  300  ACVLRNLANFSLSDNYFTRVGPFCRILIRKGVLDVRNNCIPLLPNQRSVKECVDFLAKPK  359

Query  392  KCPDHKSLLYVPCDIDESPRK  330
             C    S ++ P  +   PRK
Sbjct  360  YC----SHMWFPSSV---PRK  373



>ref|XP_008796513.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Phoenix 
dactylifera]
Length=402

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 95/138 (69%), Gaps = 6/138 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPY++GLLK +TVFDA  NQ+TGPIP SFGCL K+E LNL  N LYG VP+ 
Sbjct  226  LNNSLSGCLPYQVGLLKKATVFDAGTNQITGPIPLSFGCLLKVEQLNLARNLLYGKVPDV  285

Query  572  LCKLKD---LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C+L D   L  LSLS NYFT +G  C  L+++ +LD+ +NCI  LP+QRS + C  F  
Sbjct  286  VCRLADYGHLANLSLSSNYFTLLGFSCWELIDRGILDVRHNCIPGLPDQRSPEECAWFLK  345

Query  401  HYQKCPDHKSLLYVPCDI  348
              + CP    L Y+PC I
Sbjct  346  QPKYCP---VLPYIPCYI  360



>ref|XP_009394537.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 89/138 (64%), Gaps = 6/138 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNK SGCLPYEIG L  +TVFD   NQ TGPIP SFGCL K+E LNL  N LYG VP+ 
Sbjct  277  LNNKFSGCLPYEIGSLTTATVFDVGFNQFTGPIPWSFGCLLKVEQLNLAGNLLYGEVPDV  336

Query  572  LCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C+L    +L  LSLSGNYFT +G  C +L+++KVLD+  NCI   P QR    C  F  
Sbjct  337  VCRLAKDGNLANLSLSGNYFTSLGHSCWDLIKRKVLDVRQNCIPWFPEQRRPVECWRFLW  396

Query  401  HYQKCPDHKSLLYVPCDI  348
            H + CP      Y+PC +
Sbjct  397  HRKFCPFFH---YIPCGL  411



>ref|XP_007157715.1| hypothetical protein PHAVU_002G092200g [Phaseolus vulgaris]
 gb|ESW29709.1| hypothetical protein PHAVU_002G092200g [Phaseolus vulgaris]
Length=449

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 91/146 (62%), Gaps = 3/146 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L NK  GCLP EIG LK + VFD S N LTGPIP SFGCL+ ++ LNL  N+ YG VP++
Sbjct  286  LGNKFDGCLPVEIGNLKRAVVFDVSKNLLTGPIPHSFGCLKSIQYLNLAQNKFYGCVPDN  345

Query  572  LCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C++  L     LSL+ NYF  +GP C +L++ KVLD+  NCI  LPNQRS   C  F+ 
Sbjct  346  VCQISSLRNNGNLSLADNYFNDVGPSCWSLIKSKVLDVSKNCIRGLPNQRSPYECSQFYK  405

Query  401  HYQKCPDHKSLLYVPCDIDESPRKAG  324
                CP+  S  YVPC  + S    G
Sbjct  406  RKTTCPNPSSFYYVPCRGNPSSETTG  431



>ref|XP_004238131.2| PREDICTED: probable inactive receptor kinase At5g67200 [Solanum 
lycopersicum]
Length=1206

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 88/132 (67%), Gaps = 0/132 (0%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESL  570
            NN L+GCLPYEIG L  + VFDA  N+LTGP+P S GCLE +E+LN   NQ+YG VP+ +
Sbjct  236  NNLLTGCLPYEIGFLNEAVVFDAGNNRLTGPLPFSLGCLENIEMLNFAGNQMYGMVPDVI  295

Query  569  CKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK  390
            C L++L  LSLS NYFT  GP C  L+E  VLD+ NNCI   P QRS   C  FF + + 
Sbjct  296  CALENLANLSLSDNYFTGFGPICLRLIENGVLDLRNNCIPGFPFQRSIAECVAFFAYPRY  355

Query  389  CPDHKSLLYVPC  354
            CP   S  Y+PC
Sbjct  356  CPHMASYTYIPC  367



>ref|XP_008456159.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=315

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
             +N+L GCLPYEIG L+N+ +FDA  N+LTGPIP SF CL K E+L L +NQLYG VPE 
Sbjct  150  FDNQLEGCLPYEIGSLENAVLFDAGKNRLTGPIPLSFACLAKAELLYLADNQLYGPVPEE  209

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +CKL +L   +L  N+FTQ+GPEC+ L++KK+LD+ NNCI  LP QRS   C +F    +
Sbjct  210  ICKLPNLGNFTLRNNFFTQVGPECKKLIKKKILDVSNNCIPGLPKQRSKTECLEFAYRPK  269

Query  392  KCPDHKSLLYVPC  354
             C + KS  Y+PC
Sbjct  270  YCGNDKSFTYIPC  282



>ref|XP_009345138.1| PREDICTED: uncharacterized protein At4g06744-like [Pyrus x bretschneideri]
Length=426

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 97/143 (68%), Gaps = 2/143 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN ++GC+PYE+G L+++T+FDA  N LTGP+P S GCL+K+E LN   N LYG +PE 
Sbjct  272  LNNLITGCIPYELGFLRDATLFDAGNNLLTGPLPCSLGCLDKMEELNFAGNLLYGKLPEV  331

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L +L  LSLS NYFT +GP CR L+E  VLD+  NCI  L +QRSA+ C  FF + +
Sbjct  332  LCELGNLVNLSLSNNYFTSVGPMCRKLIENGVLDLRKNCIQHLADQRSAEECALFFGNPR  391

Query  392  KCPDHKSLLYVPCDIDESPRKAG  324
             CP   +   +PC +   P+  G
Sbjct  392  SCPHPATFSLLPCKV--PPKSKG  412



>ref|XP_009784047.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=426

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GC+PYE+GLLK + V D   N LTGP+P SFGCLE +E LN   N LYG VPE 
Sbjct  264  LNNLLTGCIPYELGLLKKAIVIDVGYNMLTGPLPCSFGCLESVEQLNFAGNLLYGQVPEV  323

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L   +LS NYFT++GP CR L++K +L+++ NCIL LPNQRS   C  F    +
Sbjct  324  VCSLTNLVNFTLSYNYFTKVGPLCRELIKKGILNVEKNCILGLPNQRSIVECLIFRGQIK  383

Query  392  KCPDHKSLLYVPCDI  348
             CP  K+   +PC I
Sbjct  384  LCPLQKTYNVIPCKI  398



>ref|XP_004291077.1| PREDICTED: uncharacterized protein At4g06744-like [Fragaria vesca 
subsp. vesca]
Length=430

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYE+GLLK + V DAS NQLTGP+P S  CL+K+E L+   N L+G VP+ 
Sbjct  281  LNNQLTGCLPYELGLLKEAIVLDASNNQLTGPLPFSLACLDKVEQLSFAGNLLFGLVPDV  340

Query  572  LCK-LKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHY  396
            +C+ L +L   SLS NYF  +GP C+ L+++ +LD+ NNCI  LP QRS + C  FF H 
Sbjct  341  ICELLVNLANFSLSDNYFIHVGPICQRLIQRGLLDVTNNCIPGLPFQRSVEECAGFFAHP  400

Query  395  QKCPDHKSLLYVPCD  351
            + CP+  S  Y+PC 
Sbjct  401  RFCPNMWSYTYIPCS  415



>ref|XP_010932202.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=465

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 91/138 (66%), Gaps = 6/138 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLP+EIGLL  +TVFDA  NQ+TGPIP SFGCL K+E LNL  N LYG VP+ 
Sbjct  289  LNNLLSGCLPHEIGLLSKATVFDAGTNQITGPIPLSFGCLMKVEQLNLAQNLLYGEVPDV  348

Query  572  LCKLKD---LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C L D   L  LSLS NYFT +G  C  L+E+ +LD+  NCI  LPNQRS + C  F  
Sbjct  349  VCLLADFGKLANLSLSSNYFTSLGKSCWKLIERGILDVRRNCIPWLPNQRSPEECGWFLK  408

Query  401  HYQKCPDHKSLLYVPCDI  348
              + CP      Y+PC I
Sbjct  409  QRKYCPVSP---YIPCHI  423



>ref|XP_009592678.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=425

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GC+PYE+GLLK +TV D   N LTGP+P S GCLE +E LN   N LYG VPE 
Sbjct  263  LNNLLTGCIPYELGLLKKATVIDVGYNMLTGPLPCSLGCLESVEQLNFAGNLLYGQVPEV  322

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L   +LS NYFT++GP CR L++K +L+++ NCI  LPNQRS   C  F    +
Sbjct  323  VCSLTNLVNFTLSNNYFTKVGPLCRELIKKGILNVEKNCIFGLPNQRSIVECLIFRGQIK  382

Query  392  KCPDHKSLLYVPCDI  348
             CP  K+   +PC I
Sbjct  383  LCPLQKTYSVIPCKI  397



>ref|XP_008342943.1| PREDICTED: uncharacterized protein At4g06744-like [Malus domestica]
Length=424

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 96/143 (67%), Gaps = 2/143 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN ++GC+PYE+G L+++T+FDA  N LTGP+P S GCL+K+E LN   N LYG  PE 
Sbjct  272  LNNLITGCIPYELGFLRDATLFDAGNNXLTGPLPCSLGCLDKMEELNFAGNLLYGKXPEV  331

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L +L  LSLS NYFT +GP CR L++  VLD+  NCI  L +QRS + C  FF+  +
Sbjct  332  VCELGNLVNLSLSNNYFTSVGPICRQLIKNGVLDLRKNCIQHLADQRSVEECALFFVKPR  391

Query  392  KCPDHKSLLYVPCDIDESPRKAG  324
             CPD  +   +PC +   P+  G
Sbjct  392  SCPDPSTFSLLPCKV--PPKSKG  412



>ref|XP_004505255.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=407

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L GCLPYEIG L+N  +FDA  N+LTGP+P SFGCL+ +E LN  +N LYG VPE 
Sbjct  249  LNNLLDGCLPYEIGFLENVKLFDAGSNRLTGPLPFSFGCLKNVEQLNFASNMLYGQVPEV  308

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L  LSLS NYF ++GP C+ L+   V+D+ NNCILD+P+QR  + C  F+   +
Sbjct  309  VCALGNLANLSLSYNYFNRVGPICKKLIRSGVVDVRNNCILDVPDQRPLKECVAFYSVPR  368

Query  392  KCPDHKSLLYVPC  354
             C   ++   +PC
Sbjct  369  TCLRSRTFSIIPC  381



>ref|XP_008799889.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=447

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 93/145 (64%), Gaps = 11/145 (8%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIGLL  +TVFDA  NQ+TGPIP SFGCL+K+E LNL  N LYG+VP+ 
Sbjct  277  LNNRLSGCLPYEIGLLSEATVFDAGFNQITGPIPLSFGCLQKVEQLNLAGNFLYGNVPDV  336

Query  572  LCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C+L     L  LSLSGNYFT IG  C  L++  VLD+  NCI   P QR    C  FF 
Sbjct  337  VCRLAKTGQLANLSLSGNYFTWIGHSCWELVKSGVLDVRQNCIPGFPEQRHPDECWWFFA  396

Query  401  ---HYQKCPDHKSLLYVPCDIDESP  336
               HY  CP    L ++PC     P
Sbjct  397  QPKHY--CP---FLHFIPCKCPVPP  416



>ref|XP_004953109.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=433

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 89/136 (65%), Gaps = 4/136 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP E+G+L  +TV DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++
Sbjct  268  LNNQLSGCLPNELGMLHKATVIDAGMNQLTGPIPASFSCLSSVEQLNLGGNRLYGQVPDA  327

Query  572  LCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LCKL      L  L+LSGNYFT +GP C  L++  VLD+ NNCI  L NQR    C  F 
Sbjct  328  LCKLAGPAGRLANLTLSGNYFTSVGPACAALIKDGVLDVKNNCIPGLANQRRPVECAVFH  387

Query  404  LHYQKCPDHKSLLYVP  357
             H + CP   + +  P
Sbjct  388  SHPKTCPAASAQVACP  403



>ref|XP_002452450.1| hypothetical protein SORBIDRAFT_04g026020 [Sorghum bicolor]
 gb|EES05426.1| hypothetical protein SORBIDRAFT_04g026020 [Sorghum bicolor]
Length=433

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 86/127 (68%), Gaps = 4/127 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++
Sbjct  268  LNNQLSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLSSVEQLNLAGNRLYGQVPDA  327

Query  572  LCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LCKL      L  L+LSGNYFT +GP C  L++  VLD+ NNCI  L NQR A  C  F 
Sbjct  328  LCKLAGPAGRLANLTLSGNYFTSVGPACATLIKDGVLDVKNNCIPGLANQRRAAECAAFQ  387

Query  404  LHYQKCP  384
               + CP
Sbjct  388  SQPKTCP  394



>ref|XP_003589141.1| hypothetical protein MTR_1g018910 [Medicago truncatula]
 gb|ABD32635.1| Leucine-rich repeat, plant specific [Medicago truncatula]
 gb|ACJ86225.1| unknown [Medicago truncatula]
 gb|AES59392.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
 gb|AFK35532.1| unknown [Medicago truncatula]
Length=378

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLP+EIG  + + VFD   NQLTGP+P S  CLEK+E++NL  N  YG VP+ 
Sbjct  232  LNNELTGCLPHEIGYFQEAVVFDVGNNQLTGPLPMSLSCLEKVEVVNLAGNMFYGMVPDF  291

Query  572  LCK-LKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHY  396
            +C  L++L   SLS NYFT +GP CR L+++ VLD+  NCI DLP QRS   C DFF   
Sbjct  292  VCAGLENLVNFSLSDNYFTHVGPFCRMLIQRGVLDVGKNCIHDLPFQRSLIECADFFTRP  351

Query  395  QKCPDHKSLLYVPCDI  348
            + CP      + PC+ 
Sbjct  352  KICPFTWFHGFYPCNF  367



>gb|EYU37650.1| hypothetical protein MIMGU_mgv11b016249mg [Erythranthe guttata]
Length=440

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 95/141 (67%), Gaps = 3/141 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLP EIGLL+ +TVFDAS N LTG IP SF CL  +EIL+L +NQLYG VPE 
Sbjct  272  LNNGLSGCLPCEIGLLEKATVFDASRNYLTGRIPLSFTCLGMIEILDLADNQLYGHVPEL  331

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L +L  LSLS NYFT IGP+C  L+EK VL +  NCI  LP+QR+   C+ FF   +
Sbjct  332  VCELPNLVTLSLSYNYFTGIGPKCLELVEKNVLHLRMNCIPGLPDQRTRAQCRAFFSTAK  391

Query  392  KCPDHKSLLYVPCDIDESPRK  330
             CP      ++PC      R+
Sbjct  392  GCPRSN---WIPCSSGGVIRR  409



>ref|XP_003555862.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
 gb|KHN32258.1| Hypothetical protein glysoja_039284 [Glycine soja]
Length=454

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 91/136 (67%), Gaps = 3/136 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N   GCLP+EIG LK   VFD S N LTGPIP SFGCL+ ++ LNL  N+LYG VP++
Sbjct  288  LGNHFEGCLPFEIGYLKKVVVFDVSKNLLTGPIPLSFGCLKSIQFLNLAQNKLYGCVPDN  347

Query  572  LCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC++  +     LSL+ NYF +IGP C +L++ KVLD+  NCI  LP+Q+S + C  F+ 
Sbjct  348  LCQIPSIRNNGNLSLADNYFKEIGPSCWSLIKSKVLDVSRNCIPGLPDQKSPKECYQFYK  407

Query  401  HYQKCPDHKSLLYVPC  354
              + CP+  S  YVPC
Sbjct  408  TKKTCPNQNSFYYVPC  423



>ref|XP_004231393.1| PREDICTED: uncharacterized protein At4g06744 [Solanum lycopersicum]
Length=394

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 91/137 (66%), Gaps = 1/137 (1%)
 Frame = -2

Query  737  SGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK  558
            +GC+PYE+GLLK + V D   N LTGP+P S GCLE +E LN   N LYG VPE +C LK
Sbjct  240  TGCIPYELGLLKKAIVIDVGFNTLTGPLPCSLGCLENVEQLNFAGNLLYGQVPEVICSLK  299

Query  557  DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDH  378
            +L   +LS NYFT++GP CR L+E  VL+++ NCI  LPNQR    C  F +  + CP  
Sbjct  300  NLVNFTLSYNYFTKVGPLCRELIENGVLNVEKNCINGLPNQRPILECVLFRMRIKLCPLQ  359

Query  377  KSLLYVPCDIDE-SPRK  330
            KSL  +PC+I + SP +
Sbjct  360  KSLRIIPCNISKFSPHR  376



>ref|XP_003575361.1| PREDICTED: uncharacterized protein At4g06744-like [Brachypodium 
distachyon]
Length=436

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 92/142 (65%), Gaps = 1/142 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP+E+G+L  +TV DA  NQLTGPIP SF CL  +E LNL  N+LYG VP++
Sbjct  272  LNNQLSGCLPHELGMLTKTTVIDAGKNQLTGPIPPSFSCLSSVEQLNLGENRLYGQVPDA  331

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LCKL  L  L+L+GNYF+ +GP C  L+++ VLD+  NCI  L NQR+   C  F    +
Sbjct  332  LCKLGRLANLTLAGNYFSSVGPACSALIKEGVLDVKRNCIPGLANQRAPAECTSFMSQPK  391

Query  392  -KCPDHKSLLYVPCDIDESPRK  330
              CP   + +  P +     +K
Sbjct  392  ASCPAASAPVSCPAEAAADAKK  413



>ref|XP_006653860.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=448

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 91/139 (65%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKLSGCLPYEIGL++  TVFDA  N +TGPIP SFGCL K+E LNL  NQLYG +P+ 
Sbjct  291  LNNKLSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSFGCLGKVEELNLAGNQLYGHIPDV  350

Query  572  LC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC   K   L+ LSLS NYF  +G  C  L   +VLD+  NCIL+ PNQR A  C  F  
Sbjct  351  LCILAKTGKLQNLSLSDNYFHSVGHHCLELARSRVLDVRLNCILNFPNQRPALECARF--  408

Query  401  HYQKCPDHKSLL-YVPCDI  348
             Y   P H   + ++PCD+
Sbjct  409  -YADPPQHCPFVPHIPCDL  426



>ref|XP_004141388.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 ref|XP_004172481.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN55219.1| hypothetical protein Csa_4G641530 [Cucumis sativus]
Length=433

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 86/133 (65%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPYE+G L  + VFDA  NQLTGP+P S GCL+ +E LN   N LYG VPE 
Sbjct  281  LNNSLTGCLPYELGSLDEAIVFDAGHNQLTGPLPLSLGCLKSVEQLNFAGNLLYGMVPEM  340

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L+ L  L+LS NYFT +GP CR L+ + VL+I NNCI DLP QR    C  F    +
Sbjct  341  VCALRHLVNLTLSDNYFTVVGPLCRILIGRGVLNIRNNCIPDLPFQRPIIECAKFLAFPR  400

Query  392  KCPDHKSLLYVPC  354
             CP   S   +PC
Sbjct  401  ICPRMWSYTLMPC  413



>ref|XP_009413340.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=464

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 108/182 (59%), Gaps = 15/182 (8%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            L N+LSGCLP+E+GLLK +TVFDA  NQLTGPIP SFGCLEK+E LNL  NQL G VP+ 
Sbjct  287  LGNRLSGCLPFEVGLLKKATVFDAGSNQLTGPIPLSFGCLEKVEQLNLAGNQLCGEVPDV  346

Query  572  LCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C+L     L  LSLS NYFT + P C +L+   VLD+  NCI  LP+QRS + C  +FL
Sbjct  347  VCRLAKYGKLVNLSLSDNYFTSLAPSCISLIHSNVLDVRKNCIPWLPHQRSPEECA-WFL  405

Query  401  HYQK--CPDHKSLLYVPCDI-----DESPRKAGphphphrpykkhkRGSSTTYAAL-KVD  246
               K  CP+     Y+PC +     DE    A   P       K      TTY AL   D
Sbjct  406  KLPKVFCPNAH---YIPCHLPWEGRDELDSSASSSPAVDGGRDKSPASGYTTYQALHHHD  462

Query  245  RP  240
            +P
Sbjct  463  KP  464



>ref|XP_004140710.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN57507.1| hypothetical protein Csa_3G200180 [Cucumis sativus]
Length=450

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
             +N+L GCLP+EIG L+N+ +FDA  N+LTGPIP SF CL K E+L L +NQLYG VPE 
Sbjct  285  FDNQLEGCLPFEIGSLENAVLFDAGKNRLTGPIPLSFACLAKAELLYLADNQLYGPVPEE  344

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +CKL +L   +L  N+FTQ+G EC+ L++KK+LD+ NNCI  LP QRS + C  F    +
Sbjct  345  ICKLPNLGNFTLRNNFFTQVGAECKKLIKKKILDVSNNCIPGLPKQRSKEECLQFAYRPK  404

Query  392  KCPDHKSLLYVPC  354
             C + KS  Y+PC
Sbjct  405  YCGNDKSFTYIPC  417



>ref|XP_008452581.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=433

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 86/133 (65%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLPYE+G L  + VFDA  NQLTGP+P S GCL+ +E LN   N LYG VPE 
Sbjct  281  LNNSLTGCLPYELGSLDEAIVFDAGNNQLTGPLPLSLGCLKSVEQLNFAGNLLYGMVPEV  340

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L+ L  L+LS NYFT +GP CR L+ + VL+I NNCI DLP QR    C  F    +
Sbjct  341  VCALRHLVNLTLSDNYFTVVGPLCRILIGRGVLNIRNNCIPDLPFQRPIIECAKFLAFPR  400

Query  392  KCPDHKSLLYVPC  354
             CP   S   +PC
Sbjct  401  ICPRMWSYTLMPC  413



>ref|XP_004168435.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=453

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
             +N+L GCLP+EIG L+N+ +FDA  N+LTGPIP SF CL K E+L L +NQLYG VPE 
Sbjct  285  FDNQLEGCLPFEIGSLENAVLFDAGKNRLTGPIPLSFACLAKAELLYLADNQLYGPVPEE  344

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +CKL +L   +L  N+FTQ+G EC+ L++KK+LD+ NNCI  LP QRS + C  F    +
Sbjct  345  ICKLPNLGNFTLRNNFFTQVGAECKKLIKKKILDVSNNCIPGLPKQRSKEECLQFAYRPK  404

Query  392  KCPDHKSLLYVPC  354
             C + KS  Y+PC
Sbjct  405  YCGNDKSFTYIPC  417



>dbj|BAJ86461.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 90/139 (65%), Gaps = 9/139 (6%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYEIGLL  +TV DA  N LTG IP S+ CL  +E LNL +N LYG V +S
Sbjct  279  LNNSLSGCLPYEIGLLARATVIDAGTNHLTGTIPLSYACLRSVEQLNLADNLLYGVVHDS  338

Query  572  LCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF-  405
            LC+L     L  L+LSGNYFT +GP C +L+ +  L++D NCIL  PNQRS Q C +FF 
Sbjct  339  LCRLAYDGRLANLTLSGNYFTWLGPCCWDLIREGKLNVDRNCILWAPNQRSFQECAEFFH  398

Query  404  --LHYQKCPDHKSLLYVPC  354
                   CP  K   YVPC
Sbjct  399  ENWARMTCPVSK---YVPC  414



>gb|EMT03089.1| hypothetical protein F775_11041 [Aegilops tauschii]
Length=447

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 90/139 (65%), Gaps = 9/139 (6%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYEIGLL  +TV DA  N LTG IP S+ CL  +E LNL +N LYG V +S
Sbjct  282  LNNSLSGCLPYEIGLLARATVIDAGTNHLTGTIPLSYACLRSVEQLNLADNLLYGVVHDS  341

Query  572  LCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF-  405
            LC+L     L  L+LSGNYFT +GP C +L+ +  L++D NCIL  PNQRS Q C +FF 
Sbjct  342  LCRLAYDGRLANLTLSGNYFTWLGPCCWDLIREGKLNVDRNCILWAPNQRSFQECAEFFH  401

Query  404  --LHYQKCPDHKSLLYVPC  354
                   CP  K   YVPC
Sbjct  402  DNWARMTCPVSK---YVPC  417



>gb|AFW62989.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=391

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 87/136 (64%), Gaps = 4/136 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++
Sbjct  226  LNNQLSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDA  285

Query  572  LCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LCKL      L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C  F 
Sbjct  286  LCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQ  345

Query  404  LHYQKCPDHKSLLYVP  357
               + CP   + +  P
Sbjct  346  SQPKTCPAASTQVTCP  361



>ref|NP_001148637.1| LOC100282253 [Zea mays]
 gb|ACG32331.1| protein binding protein [Zea mays]
Length=445

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 87/136 (64%), Gaps = 4/136 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++
Sbjct  280  LNNQLSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLSSVEQLNLAGNRLYGQVPDA  339

Query  572  LCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LCKL      L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C  F 
Sbjct  340  LCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQ  399

Query  404  LHYQKCPDHKSLLYVP  357
               + CP   + +  P
Sbjct  400  SQPKTCPAASTQVTCP  415



>ref|XP_004976154.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=458

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 93/135 (69%), Gaps = 5/135 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYE+GLL+ +TV DA  NQLTG IP SF CL K+E LNL +N LYG VP++
Sbjct  289  LNNSLSGCLPYELGLLEKATVIDAGTNQLTGTIPASFACLRKVEQLNLADNLLYGEVPDA  348

Query  572  LCKLK--DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH  399
            LC+L    L+ L+LSGNYFT +G  C +L+++  L++D NCI   PNQRS + C  F   
Sbjct  349  LCRLAFGRLKNLTLSGNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHEECAKFQRQ  408

Query  398  YQKCPDHKSLLYVPC  354
             + CP +    Y+PC
Sbjct  409  TKSCPVNS---YLPC  420



>gb|AEV41070.1| uncharacterized protein At4g06744 precursor [Oryza minuta]
Length=455

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 92/139 (66%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIGL++  TVFDA  N +TGPIP SFGCL  +E LNL  NQLYG++P+ 
Sbjct  295  LNNQLSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSFGCLGLVEELNLAGNQLYGNIPDV  354

Query  572  LC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC   K   L+ LSLS NYF  +G  C  L+  KVLD+  NCIL+ PNQR A  C  F  
Sbjct  355  LCMLAKTGKLQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECARF--  412

Query  401  HYQKCPDHKSLL-YVPCDI  348
             Y   P H   + ++PCD+
Sbjct  413  -YADPPQHCPFVPHIPCDL  430



>gb|AEV41116.1| uncharacterized protein At4g06744 precursor [Oryza officinalis]
Length=462

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 92/139 (66%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIGL++  TVFDA  N +TGPIP SFGCL  +E LNL  NQLYG++P+ 
Sbjct  295  LNNQLSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSFGCLGLVEELNLAGNQLYGNIPDV  354

Query  572  LC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC   K   L+ LSLS NYF  +G  C  L+  KVLD+  NCIL+ PNQR A  C  F  
Sbjct  355  LCMLAKTGKLQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECARF--  412

Query  401  HYQKCPDHKSLL-YVPCDI  348
             Y   P H   + ++PCD+
Sbjct  413  -YADPPQHCPFVPHIPCDL  430



>ref|XP_007199295.1| hypothetical protein PRUPE_ppa023082mg, partial [Prunus persica]
 gb|EMJ00494.1| hypothetical protein PRUPE_ppa023082mg, partial [Prunus persica]
Length=398

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            +NN ++GC+PYE+G LK++T+FDA  NQLTGP+P S GCLEK+E LN   N LYG VPE 
Sbjct  235  MNNLITGCIPYELGFLKDATLFDAGNNQLTGPLPCSLGCLEKIEQLNFAGNFLYGKVPEV  294

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  417
            +C+L +L  LSLS NYFT +GP CR L++  VLD+  NCI DL +QRS + C
Sbjct  295  VCELGNLANLSLSNNYFTMVGPICRKLIKSGVLDLRKNCIRDLADQRSVEEC  346



>gb|ACF84038.1| unknown [Zea mays]
 gb|AFW62991.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=435

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 87/136 (64%), Gaps = 4/136 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++
Sbjct  270  LNNQLSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDA  329

Query  572  LCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LCKL      L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C  F 
Sbjct  330  LCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQ  389

Query  404  LHYQKCPDHKSLLYVP  357
               + CP   + +  P
Sbjct  390  SQPKTCPAASTQVTCP  405



>ref|XP_006653579.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=456

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 92/138 (67%), Gaps = 6/138 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKLSGCLPYE+GLL  +TV DA  NQLTGPIP SF CL K+E LNL +N LYG VP++
Sbjct  290  LNNKLSGCLPYELGLLAKATVIDAGTNQLTGPIPASFACLHKVEQLNLADNLLYGEVPDA  349

Query  572  LCKLK-----DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  408
            LCKL       L+ L+LS NYFT +G  C +L+++  L+++ NCI   PNQRS + C  F
Sbjct  350  LCKLAFAWTGRLKNLTLSNNYFTSLGSCCWDLIKEGKLNVERNCIPWAPNQRSHEECAAF  409

Query  407  FLHYQKCPDHKSLLYVPC  354
            F H  K        YVPC
Sbjct  410  F-HRTKTSACPVNSYVPC  426



>ref|XP_006647518.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=427

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 90/141 (64%), Gaps = 6/141 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP+EIG+L  + V DAS+NQL GPIP SF CL  +E LNL +N LYG +P++
Sbjct  261  LNNQLSGCLPHEIGMLTKAAVIDASMNQLAGPIPSSFSCLTSVEQLNLGSNSLYGEIPDA  320

Query  572  LCKLKD-----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  408
            LCKL       L  L+LS NYFT +GP C  L++  VL++ NNCI  L NQR    C  F
Sbjct  321  LCKLAAGPAGRLANLTLSSNYFTSVGPSCLPLIKDGVLNVKNNCIPGLANQRQPAECASF  380

Query  407  FLHYQKCPDHKSLLYVPCDID  345
                + CP   S  +V C ++
Sbjct  381  LSQPKTCPP-ASAAHVACPVE  400



>ref|NP_001241706.1| uncharacterized protein LOC100856884 [Zea mays]
 gb|ACF85236.1| unknown [Zea mays]
Length=458

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 87/136 (64%), Gaps = 4/136 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++
Sbjct  293  LNNQLSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDA  352

Query  572  LCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LCKL      L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C  F 
Sbjct  353  LCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQ  412

Query  404  LHYQKCPDHKSLLYVP  357
               + CP   + +  P
Sbjct  413  SQPKTCPAASTQVTCP  428



>gb|ACF79045.1| unknown [Zea mays]
 gb|ACF86020.1| unknown [Zea mays]
 gb|AFW62992.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=458

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 87/136 (64%), Gaps = 4/136 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++
Sbjct  293  LNNQLSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDA  352

Query  572  LCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LCKL      L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C  F 
Sbjct  353  LCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQ  412

Query  404  LHYQKCPDHKSLLYVP  357
               + CP   + +  P
Sbjct  413  SQPKTCPAASTQVTCP  428



>gb|EYU25462.1| hypothetical protein MIMGU_mgv1a024676mg, partial [Erythranthe 
guttata]
Length=400

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 88/142 (62%), Gaps = 4/142 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            +NN LSGCLP+E+GLL ++ VFD   N+LTG +P S GCL KLE++N   N LYGSVPE 
Sbjct  247  INNMLSGCLPHELGLLTDAVVFDGGGNRLTGLLPVSLGCLRKLEVMNFAGNLLYGSVPEV  306

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC +  L  LSLS NYFT++GP C  L++  VLD+  NC+  LP QRS   C  FF   +
Sbjct  307  LCGIGSLANLSLSDNYFTRVGPVCLGLIKSGVLDLRKNCVPGLPLQRSWAECGAFFARPR  366

Query  392  KCPDHKSLLY----VPCDIDES  339
             C  H         +PC I  S
Sbjct  367  YCVAHAPPASWRGQLPCSIPHS  388



>ref|XP_010523006.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=423

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 87/133 (65%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GCLPYE+G LK + V D   N+LTG +P S  CLEK E LN   N L+G+VPE+
Sbjct  264  LNNELTGCLPYELGFLKEARVLDVGQNRLTGRLPMSLTCLEKAEQLNFAGNFLFGAVPET  323

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L++L   SLS NYFT +GP CR L+E+ VLD+ NNCI  LPNQR  + C  F    +
Sbjct  324  VCMLQNLANFSLSDNYFTHVGPFCRILIERGVLDVRNNCIPFLPNQRPFKECLGFLARPK  383

Query  392  KCPDHKSLLYVPC  354
             C       ++PC
Sbjct  384  YCSHMWFHSFIPC  396



>ref|XP_010066095.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
 gb|KCW63891.1| hypothetical protein EUGRSUZ_G01566 [Eucalyptus grandis]
Length=382

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 87/142 (61%), Gaps = 4/142 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L GC+PYEIG L+ +TVFDA  N LTG +P S GCL+ +E LN   N LY ++PE 
Sbjct  217  LNNQLMGCIPYEIGFLRKATVFDAGDNYLTGQLPCSLGCLDMIEQLNFAGNFLYDAIPEV  276

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH--  399
            +C +  L  LSLS NYF  IGP C  L+++ VLD+  NCI  LPNQR    C  F+ H  
Sbjct  277  VCSMPKLSNLSLSDNYFNHIGPLCWKLVKRGVLDVRMNCIFGLPNQRPHYECVKFYFHSF  336

Query  398  --YQKCPDHKSLLYVPCDIDES  339
                 CP    +  +PC I+ S
Sbjct  337  WFRWVCPWQYLMSAIPCKINSS  358



>ref|XP_008677766.1| PREDICTED: uncharacterized protein LOC100856884 isoform X1 [Zea 
mays]
Length=467

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 87/136 (64%), Gaps = 4/136 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++
Sbjct  302  LNNQLSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDA  361

Query  572  LCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LCKL      L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C  F 
Sbjct  362  LCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQ  421

Query  404  LHYQKCPDHKSLLYVP  357
               + CP   + +  P
Sbjct  422  SQPKTCPAASTQVTCP  437



>emb|CAE02949.1| OSJNBa0014K14.21 [Oryza sativa Japonica Group]
 emb|CAE05560.1| OSJNBb0116K07.13 [Oryza sativa Japonica Group]
 gb|EAY94774.1| hypothetical protein OsI_16554 [Oryza sativa Indica Group]
 dbj|BAG90092.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97019.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 89/138 (64%), Gaps = 6/138 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKLSGCLPYE+GLL  +TV DA  NQLTGPIP SF CL K+E LNL +N LYG VP +
Sbjct  286  LNNKLSGCLPYELGLLAKATVIDAGTNQLTGPIPASFACLRKVEQLNLADNLLYGEVPNA  345

Query  572  LCKLK-----DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  408
            LC+L       L  L+LS NYFT +G  C +L+++  L++D NCI   PNQRS   C  F
Sbjct  346  LCELAFSWSGRLRNLTLSNNYFTSLGSCCWDLIKEGKLNVDRNCIPYAPNQRSHDECAAF  405

Query  407  FLHYQKCPDHKSLLYVPC  354
            F H  K        YVPC
Sbjct  406  F-HRTKTSACPCNTYVPC  422



>ref|XP_010065987.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=418

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 87/142 (61%), Gaps = 4/142 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L GC+PYEIG L+ +TVFDA  N LTG +P S GCL+ +E LN   N LY ++PE 
Sbjct  253  LNNQLMGCIPYEIGFLRKATVFDAGDNYLTGQLPCSLGCLDMIEQLNFAGNFLYDAIPEV  312

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH--  399
            +C +  L  LSLS NYF  IGP C  L+++ VLD+  NCI  LPNQR    C  F+ H  
Sbjct  313  VCSMPKLSNLSLSDNYFNHIGPLCWKLVKRGVLDVRMNCIFGLPNQRPHYECVKFYFHSF  372

Query  398  --YQKCPDHKSLLYVPCDIDES  339
                 CP    +  +PC I+ S
Sbjct  373  WFRWVCPWQYLMSAIPCKINSS  394



>ref|XP_002446758.1| hypothetical protein SORBIDRAFT_06g021870 [Sorghum bicolor]
 gb|EES11086.1| hypothetical protein SORBIDRAFT_06g021870 [Sorghum bicolor]
Length=455

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 92/135 (68%), Gaps = 5/135 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYE+GLL+ +TV DA  N+LTG IP SF CL K+E LNL +N LYG VP++
Sbjct  290  LNNSLSGCLPYELGLLEKATVIDAGTNRLTGTIPASFACLRKVEQLNLADNLLYGEVPDA  349

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH  399
            LC+L    L+ L+LSGNYFT +G  C +L+++  L++D NCI   PNQRS   C  F   
Sbjct  350  LCRLAFSHLKNLTLSGNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHDECAKFLRK  409

Query  398  YQKCPDHKSLLYVPC  354
             + CP +    Y+PC
Sbjct  410  PKTCPVNN---YLPC  421



>ref|NP_849339.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana]
 sp|Q8W3M4.1|Y4744_ARATH RecName: Full=Uncharacterized protein At4g06744; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB83614.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE82560.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=404

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 89/137 (65%), Gaps = 4/137 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+P+EIG L  ++V D   N+LTGP+P S  CLEK+E LN   N L+G+VPE+
Sbjct  247  LNNDFTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAVPEA  306

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH  399
            +C L   +L  LSLS NYFT +GP CR LLEK VLD+ NNCI   P QRS Q C +FF+ 
Sbjct  307  VCMLLRDNLVNLSLSDNYFTHVGPWCRGLLEKGVLDVGNNCIPFFPGQRSMQECAEFFVK  366

Query  398  YQK--CPDHKSLLYVPC  354
             +K  CP      +  C
Sbjct  367  PKKYYCPHMWFHSFFSC  383



>ref|XP_003575360.1| PREDICTED: uncharacterized protein At4g06744-like [Brachypodium 
distachyon]
Length=423

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 87/137 (64%), Gaps = 1/137 (1%)
 Frame = -2

Query  737  SGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK  558
            SGCLP+E+G+L  +TV DA  NQLTGPIPQSF CL  +E LNL  N+LYG VP++LCKL 
Sbjct  264  SGCLPHELGMLTKTTVIDAGKNQLTGPIPQSFSCLSSVEQLNLGENRLYGQVPDALCKLG  323

Query  557  DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ-KCPD  381
             L  L+L+GNYF+ +GP C  L++  VLD+  NCI  L NQR+   C  F    +  CP 
Sbjct  324  RLANLTLAGNYFSSVGPACSALVKDGVLDVKRNCIPGLANQRAPAECASFMSQPKASCPA  383

Query  380  HKSLLYVPCDIDESPRK  330
              + +  P +     +K
Sbjct  384  ASAPVSCPAEAAADAKK  400



>ref|XP_010664552.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At4g06744-like 
[Vitis vinifera]
Length=459

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 83/127 (65%), Gaps = 0/127 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN L+GCLP EIG LK + VFD   N+LTGPIP S GCLEK+E LN      YG VPE 
Sbjct  301  LNNMLTGCLPLEIGFLKEARVFDVGNNRLTGPIPFSLGCLEKVEELNFAGKLFYGMVPEV  360

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            LC+L +L  LSL  NYF Q+G  CR+L+ K +LDI  NCI DLP QRS   C D F + +
Sbjct  361  LCQLPNLLNLSLYDNYFMQVGLACRSLIWKGLLDIRKNCIPDLPFQRSVAECADLFQYPR  420

Query  392  KCPDHKS  372
             CP   S
Sbjct  421  FCPYMNS  427



>ref|XP_008663372.1| PREDICTED: uncharacterized protein At4g06744-like [Zea mays]
 gb|AFW58791.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=548

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 91/135 (67%), Gaps = 5/135 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYE+GLL  +TV DA  N+LTG IP SF CL K+E LNL +N LYG VP++
Sbjct  384  LNNSLSGCLPYELGLLAKATVIDAGTNRLTGTIPASFACLRKVEQLNLADNLLYGEVPDA  443

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH  399
            LC+L    L+ L+LS NYFT +G  C +L+++  L++D NCI   PNQRS + C  F   
Sbjct  444  LCRLAFSHLKNLTLSDNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHEECARFLRK  503

Query  398  YQKCPDHKSLLYVPC  354
             + CP +    YVPC
Sbjct  504  PKTCPVNN---YVPC  515



>dbj|BAD21636.1| leucine-rich repeat-like protein [Oryza sativa Japonica Group]
 dbj|BAG96332.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89227.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96570.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96587.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96588.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96789.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96794.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96849.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96872.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97586.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99736.1| unnamed protein product [Oryza sativa Japonica Group]
Length=438

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 85/128 (66%), Gaps = 5/128 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP+E+G+L  + VFDA +NQLTGPIP SF CL  +E LNL  N+LYG +P++
Sbjct  272  LNNQLSGCLPHELGMLTKAAVFDAGMNQLTGPIPSSFSCLTSVEQLNLGGNRLYGEIPDA  331

Query  572  LCKLKD-----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  408
            LCKL       L  L+LS NYFT +GP C +L++  VL++ NNCI    NQR    C  F
Sbjct  332  LCKLAAVPAGRLANLTLSSNYFTSVGPACLSLIKDGVLNVRNNCIPGFANQRRPAECASF  391

Query  407  FLHYQKCP  384
                + CP
Sbjct  392  HSQPKACP  399



>ref|XP_004953107.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=404

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 84/127 (66%), Gaps = 4/127 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP+E+G+L  ++V +  +NQLTGPIP SF CL  +E LNL  N+LYG VP++
Sbjct  239  LNNQLSGCLPHELGMLHKASVINVGMNQLTGPIPSSFSCLSSVEQLNLGGNRLYGQVPDA  298

Query  572  LCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LCKL      L  L+L GNYFT +GP C  L++  VLD+ NNCI  L NQR    C  F 
Sbjct  299  LCKLAGPAGRLANLTLPGNYFTSVGPACAALIKDGVLDVKNNCIPGLANQRHPAECAAFH  358

Query  404  LHYQKCP  384
               + CP
Sbjct  359  SQPKTCP  365



>gb|ACG34018.1| protein binding protein [Zea mays]
 tpg|DAA37048.1| TPA: leucine-rich repeat (LRR) family protein [Zea mays]
Length=442

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 92/135 (68%), Gaps = 5/135 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLP+E+GLL+ +TV DA  N+LTG IP SF CL K+E LNL  N LYG VP++
Sbjct  283  LNNSLSGCLPHELGLLEKATVIDAGANRLTGTIPASFACLRKVEQLNLAGNLLYGEVPDA  342

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH  399
            LC+L   +L+ L+LS NYFT +G  C +L+++  L++D NCI   PNQRS + C  F   
Sbjct  343  LCRLAFSNLKNLTLSDNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHEDCAKFLRQ  402

Query  398  YQKCPDHKSLLYVPC  354
             + CP +    YVPC
Sbjct  403  PKSCPVNN---YVPC  414



>gb|AEV40972.1| uncharacterized protein At4g06744 precursor [Oryza punctata]
Length=457

 Score =   137 bits (344),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 89/139 (64%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYEIGL++  TVFDA  N +TGPIP S GCL  +E LNL  NQLYG +P+ 
Sbjct  293  LNNHLSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSLGCLGLVEELNLAGNQLYGHIPDV  352

Query  572  LC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC   K   L+ LSLS NYF  +G  C  L+  KVLD+  NCIL+ PNQR A  C  F  
Sbjct  353  LCMLAKTGKLQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECARF--  410

Query  401  HYQKCPDHKSLL-YVPCDI  348
             Y   P H   + ++PCD+
Sbjct  411  -YADPPQHCPFVPHIPCDL  428



>ref|XP_003580786.1| PREDICTED: uncharacterized protein At4g06744 [Brachypodium distachyon]
Length=443

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 88/139 (63%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+ SGCLPYEIGL++  TVFDA  N++ GPIP SFGCL  +E LNL  NQLYG VP+ 
Sbjct  279  LNNRFSGCLPYEIGLVEGLTVFDAGGNEIKGPIPLSFGCLSDVEQLNLAGNQLYGHVPDV  338

Query  572  LCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC L     L  LSLS NYF  +G  C  L+  +VLD+  NCIL  P QR A  C  F+ 
Sbjct  339  LCALAKTGKLGNLSLSDNYFHSVGRLCMELVRSRVLDVKKNCILGFPRQRPAMECAAFYA  398

Query  401  HYQK-CPDHKSLLYVPCDI  348
               K CP    + ++PCD+
Sbjct  399  DPSKHCP---FIPHIPCDL  414



>ref|XP_010455221.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=407

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 89/137 (65%), Gaps = 4/137 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+PYEIG L  ++V D   N+LTGP+P S  CLEK+E LN   N L+G++PE+
Sbjct  250  LNNDFTGCIPYEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAIPEA  309

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH  399
            +C +   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q C +FF+ 
Sbjct  310  VCMVLRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAEFFVK  369

Query  398  YQK--CPDHKSLLYVPC  354
             +K  CP      +  C
Sbjct  370  PKKYYCPHMWYHSFFSC  386



>ref|XP_010421726.1| PREDICTED: uncharacterized protein At4g06744 [Camelina sativa]
Length=407

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 90/137 (66%), Gaps = 4/137 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+PYEIG L  ++V D   N+LTGP+P S  CLEK+E LN   N L+G++PE+
Sbjct  250  LNNDFTGCIPYEIGFLMGASVIDIGGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAIPEA  309

Query  572  LCK-LKD-LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH  399
            +C  L+D L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q C +FF+ 
Sbjct  310  VCMVLRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAEFFVK  369

Query  398  YQK--CPDHKSLLYVPC  354
             +K  CP      +  C
Sbjct  370  PKKYYCPHMWYHSFFSC  386



>ref|XP_010438766.1| PREDICTED: uncharacterized protein At4g06744 [Camelina sativa]
Length=407

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 89/137 (65%), Gaps = 4/137 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+PYEIG L  ++V D   N+LTGP+P S  CLEK+E LN   N L+G++PE+
Sbjct  250  LNNDFTGCIPYEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAIPEA  309

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH  399
            +C +   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q C +FF+ 
Sbjct  310  VCMVLRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAEFFVK  369

Query  398  YQK--CPDHKSLLYVPC  354
             +K  CP      +  C
Sbjct  370  PKKYYCPHMWYHSFFSC  386



>gb|AEV41023.1| uncharacterized protein At4g06744 precursor [Oryza minuta]
Length=472

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 89/139 (64%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYEIGL++  TVFDA  N +TGPIP S GCL  +E LNL  NQLYG +P+ 
Sbjct  308  LNNHLSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSLGCLGLVEELNLAGNQLYGHIPDV  367

Query  572  LC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC   K   L+ LSLS NYF  +G  C  L+  KVLD+  NCIL+ PNQR A  C  F  
Sbjct  368  LCMLAKTGKLQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECARF--  425

Query  401  HYQKCPDHKSLL-YVPCDI  348
             Y   P H   + ++PCD+
Sbjct  426  -YADPPQHCPFVPHIPCDL  443



>gb|EAY86685.1| hypothetical protein OsI_08067 [Oryza sativa Indica Group]
Length=428

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 84/128 (66%), Gaps = 5/128 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG +P++
Sbjct  262  LNNQLSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLTSVEQLNLGGNRLYGEIPDA  321

Query  572  LCKLKD-----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  408
            LCKL       L  L+LS NYFT +GP C +L++  VL++ NNCI    NQR    C  F
Sbjct  322  LCKLATGPAGRLANLTLSSNYFTSVGPACLSLIKDGVLNVKNNCIPGFANQRRPAECASF  381

Query  407  FLHYQKCP  384
                + CP
Sbjct  382  HSQPKTCP  389



>gb|EAY86686.1| hypothetical protein OsI_08068 [Oryza sativa Indica Group]
Length=426

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 84/128 (66%), Gaps = 5/128 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG +P++
Sbjct  260  LNNQLSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLTSVEQLNLGGNRLYGEIPDA  319

Query  572  LCKLK-----DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  408
            LCKL       L  L+LS NYFT +GP C +L++  VL++ NNCI    NQR    C  F
Sbjct  320  LCKLAVGPAGRLANLTLSSNYFTSVGPACLSLIKDGVLNVKNNCIPGFTNQRRPAECASF  379

Query  407  FLHYQKCP  384
                + CP
Sbjct  380  HSQPKTCP  387



>gb|EMS59107.1| hypothetical protein TRIUR3_04108 [Triticum urartu]
Length=442

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 87/139 (63%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYEIGL++  TVFDA  NQ+ GPIP SFGCL  +E LNL  NQLYG VP+ 
Sbjct  269  LNNDLSGCLPYEIGLVEGLTVFDAGGNQIRGPIPLSFGCLADVEELNLARNQLYGHVPDV  328

Query  572  LC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC   K   L  LSLS NYF  +G  C  L+  +VLD+  NCIL  P QR    C  F+ 
Sbjct  329  LCLLAKTGKLTNLSLSDNYFHSVGYHCMELVRSRVLDVRRNCILGFPGQRPHIECVMFYA  388

Query  401  HYQK-CPDHKSLLYVPCDI  348
               K CP    + ++PCD+
Sbjct  389  DPTKHCP---FIPHIPCDL  404



>gb|KFK39606.1| hypothetical protein AALP_AA3G265800 [Arabis alpina]
Length=403

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 87/135 (64%), Gaps = 2/135 (1%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+PYEIG L+ ++V D   N+LTG +P S  CLEK+E LN   N L+G +PES
Sbjct  248  LNNDFTGCVPYEIGFLRGASVIDIGGNKLTGHLPLSLTCLEKVEQLNFAGNLLFGVIPES  307

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH  399
            +C L   +L   SLS NYFT +GP CR+L E  VLD+ NNC+  LP QRS + C +FF  
Sbjct  308  VCMLLRVNLVNFSLSDNYFTHMGPWCRSLFEIGVLDVRNNCLPFLPGQRSMKECAEFFFK  367

Query  398  YQKCPDHKSLLYVPC  354
             + CP      ++PC
Sbjct  368  PKYCPYRWFHSFIPC  382



>ref|XP_009141268.1| PREDICTED: uncharacterized protein At4g06744 isoform X1 [Brassica 
rapa]
Length=391

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 91/136 (67%), Gaps = 3/136 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+PYEIGLLK ++V D S N+LTGP+P S  CLEK+E LN   N L+G++P++
Sbjct  235  LNNDFTGCIPYEIGLLKGASVIDISGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAIPDA  294

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH  399
            +C    ++L   SLS NYFT +GP C+ L+E+ VLD+ NNCI   P QRS + C +FF+ 
Sbjct  295  VCMFLRENLVNFSLSDNYFTHVGPWCKILVERGVLDVRNNCIPFFPGQRSIEECAEFFVK  354

Query  398  YQ-KCPDHKSLLYVPC  354
                CP      ++PC
Sbjct  355  PNYYCPHAWFHSFLPC  370



>ref|XP_002874478.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50737.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 89/137 (65%), Gaps = 4/137 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G++PE+
Sbjct  252  LNNDFTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEA  311

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH  399
            +C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q C +FF+ 
Sbjct  312  VCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAEFFVK  371

Query  398  YQK--CPDHKSLLYVPC  354
             +K  CP      +  C
Sbjct  372  PKKYYCPHMWFHSFFSC  388



>ref|XP_004960235.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=512

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 90/139 (65%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIGL++   VFDA  N++ GPIP SFGCL  +E +NL  NQLYG VP+ 
Sbjct  355  LNNRLSGCLPYEIGLVEGLAVFDAGGNEIAGPIPLSFGCLRDVEEINLAGNQLYGQVPDV  414

Query  572  LC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C   K   L+ LSLS N+F  +G  C  L+  +VLD+  NCIL  P+QR A  C  F+ 
Sbjct  415  VCLLAKTGKLQNLSLSDNFFHSVGHHCMELVRSRVLDVRRNCILGFPDQRPALECAAFYA  474

Query  401  HYQK-CPDHKSLLYVPCDI  348
               K CP    + ++PCD+
Sbjct  475  DPTKHCP---FIPHIPCDL  490



>gb|AFW72330.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=245

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 85/132 (64%), Gaps = 5/132 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCL  E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++
Sbjct  79   LNNQLSGCLAPELGMLAKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGHVPDA  138

Query  572  LCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LC+L      L  L+LSGNYFT +GP C  L++  VL++ +NCI  L NQR  + C  F 
Sbjct  139  LCRLAGPTGRLANLTLSGNYFTSVGPACAALIKDGVLNVKSNCIPGLANQRRPEECAAFI  198

Query  404  LHYQK-CPDHKS  372
                K CP   +
Sbjct  199  QSRPKTCPAAAT  210



>ref|XP_004167460.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN57510.1| hypothetical protein Csa_3G200700 [Cucumis sativus]
Length=429

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 95/161 (59%), Gaps = 0/161 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GC+PYE+G LK + VFDA  N LTGP+P S  CLEK+E LN   N LYG VPE 
Sbjct  266  LNNQLTGCIPYEVGFLKKAIVFDAGENLLTGPLPCSLSCLEKIEQLNFAGNFLYGQVPEV  325

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C L +L  LSLS NYFT+IGP CR L+   VLD+  NCI  LP+QRS   C   +L   
Sbjct  326  VCDLGNLLNLSLSDNYFTKIGPSCRKLVRNGVLDLRKNCIRGLPDQRSPLDCFFSYLFQY  385

Query  392  KCPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGSST  270
             CP   +  +VPC   +S    G              G+ST
Sbjct  386  PCPFPATYGFVPCQKSKSIHSFGTGQQKRSYVPIANGGNST  426



>ref|NP_001150111.1| protein binding protein precursor [Zea mays]
 gb|ACG37876.1| protein binding protein [Zea mays]
Length=424

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 79/119 (66%), Gaps = 4/119 (3%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLP+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VPE+
Sbjct  259  LNNQLSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLTSVEQLNLAGNRLYGQVPEA  318

Query  572  LCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  408
            LC L      L  L+LS NYFT + P C  L++  VLD+ NNCI  L NQR    C  F
Sbjct  319  LCMLAGPAGRLTNLTLSSNYFTSVAPACAALIKDGVLDVKNNCIPGLANQRRPAECAAF  377



>ref|XP_002447298.1| hypothetical protein SORBIDRAFT_06g032310 [Sorghum bicolor]
 gb|EES11626.1| hypothetical protein SORBIDRAFT_06g032310 [Sorghum bicolor]
Length=449

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 90/139 (65%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYE+GL++   VFDA  N++TGPIP SFGCL  +E LNL +NQLYG VP+ 
Sbjct  284  LNNRLSGCLPYEVGLVEGLAVFDAGGNEITGPIPLSFGCLRDVEELNLASNQLYGQVPDV  343

Query  572  LCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC L     L  LSLS N+F  +G  C  L+  +VLD+  NCIL  P+QR    C  F+ 
Sbjct  344  LCLLARNGKLGNLSLSENFFHSVGHHCMELVRSRVLDVRRNCILGFPDQRPPLECAAFYA  403

Query  401  HYQK-CPDHKSLLYVPCDI  348
               K CP    + ++PCD+
Sbjct  404  DPTKHCP---FIPHIPCDL  419



>gb|EMT08852.1| hypothetical protein F775_11606 [Aegilops tauschii]
Length=518

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 87/139 (63%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYEIGL++  TVFDA  N++ GPIP SFGCL  +E LNL  NQLYG VP+ 
Sbjct  348  LNNDLSGCLPYEIGLVEGLTVFDAGGNEIRGPIPLSFGCLADVEELNLAGNQLYGHVPDV  407

Query  572  LC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC   K   L  LSLS NYF  +G  C  L+  +VLD+  NCIL  P QR    C  F+ 
Sbjct  408  LCLLAKTGKLTNLSLSDNYFHSVGYHCMELVRSRVLDVRRNCILGFPGQRPHIECAMFYA  467

Query  401  HYQK-CPDHKSLLYVPCDI  348
               K CP    + ++PCD+
Sbjct  468  DPTKHCP---FIPHIPCDL  483



>gb|ACG42798.1| leucine-rich repeat, plant specific [Zea mays]
Length=431

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 91/139 (65%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIGL++   VFDA  N++TGP+P SFGCL  +E LNL  NQLYG VP+ 
Sbjct  279  LNNRLSGCLPYEIGLVEGLAVFDAGGNEITGPVPLSFGCLRDVEELNLAGNQLYGQVPDV  338

Query  572  LCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C L     L+ LSLS N+F  +G  C  L+  +VLD+  NCIL  P+QR    C  F++
Sbjct  339  VCLLARTGKLQNLSLSDNFFHSVGHHCMELVRSRVLDVRRNCILGFPDQRPPLECAAFYV  398

Query  401  HYQK-CPDHKSLLYVPCDI  348
               K CP    + ++PC++
Sbjct  399  DPSKHCP---FIPHIPCEL  414



>ref|NP_001141186.1| leucine-rich repeat (LRR) family protein precursor [Zea mays]
 gb|ACF85658.1| unknown [Zea mays]
 gb|AFW59826.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=431

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 91/139 (65%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYEIGL++   VFDA  N++TGP+P SFGCL  +E LNL  NQLYG VP+ 
Sbjct  279  LNNRLSGCLPYEIGLVEGLAVFDAGGNEITGPVPLSFGCLRDVEELNLAGNQLYGQVPDV  338

Query  572  LCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            +C L     L+ LSLS N+F  +G  C  L+  +VLD+  NCIL  P+QR    C  F++
Sbjct  339  VCLLARTGKLQNLSLSDNFFHSVGHHCMELVRSRVLDVRRNCILGFPDQRPPLECAAFYV  398

Query  401  HYQK-CPDHKSLLYVPCDI  348
               K CP    + ++PC++
Sbjct  399  DPSKHCP---FIPHIPCEL  414



>gb|EMT04546.1| hypothetical protein F775_44003 [Aegilops tauschii]
Length=384

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 90/141 (64%), Gaps = 12/141 (9%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKLSGCLPYE+GLL  +TV DA  NQLTG IP S+ CL K+E LNL +N LYG VP++
Sbjct  219  LNNKLSGCLPYELGLLAKATVIDAGTNQLTGTIPASYACLRKVEQLNLADNLLYGEVPDA  278

Query  572  LCKLK------DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  411
            LC+L        L  L+LS NYFT +G  C  L+++  L++  NCI   PNQRS + C  
Sbjct  279  LCRLAYPSSGGHLANLTLSDNYFTSLGSCCWALIKQGKLNVARNCIPYAPNQRSHEECAG  338

Query  410  FFLHYQK--CPDHKSLLYVPC  354
            FF H  K  CP      YVPC
Sbjct  339  FF-HRTKTYCPVST---YVPC  355



>ref|XP_006397360.1| hypothetical protein EUTSA_v10028721mg [Eutrema salsugineum]
 gb|ESQ38813.1| hypothetical protein EUTSA_v10028721mg [Eutrema salsugineum]
Length=391

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 92/145 (63%), Gaps = 6/145 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+PYEIG LK ++V D S N+LTG +P S  CLEK+E LN   N L+G++PE+
Sbjct  235  LNNDFTGCIPYEIGFLKGASVIDISGNKLTGLLPLSLMCLEKVEQLNFAGNLLFGAIPEA  294

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH  399
            +C L   ++  LSLS NYFT +GP C+ L E+ VLD+ NNCI   P QRS   C +FF+ 
Sbjct  295  VCMLLWDNIVNLSLSDNYFTHVGPWCKGLFERGVLDVTNNCIPFFPGQRSIDECAEFFVK  354

Query  398  YQ-KCPDHKSLLYVPC---DIDESP  336
             +  CP      ++PC    I  SP
Sbjct  355  PKYYCPHPWFHRFLPCRYSHISSSP  379



>gb|EMS61305.1| hypothetical protein TRIUR3_11917 [Triticum urartu]
Length=414

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 90/141 (64%), Gaps = 12/141 (9%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKLSGCLPYE+GLL  +TV DA  NQLTG IP S+ CL K+E LNL +N LYG VP++
Sbjct  249  LNNKLSGCLPYELGLLAKATVIDAGTNQLTGTIPASYACLRKVEQLNLADNLLYGEVPDA  308

Query  572  LCKLK------DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  411
            LC+L        L  L+LS NYFT +G  C  L+++  L++  NCI   PNQRS + C  
Sbjct  309  LCRLAYKSSGGHLANLTLSDNYFTSLGACCWALIKQGKLNVARNCIPYAPNQRSHEECAG  368

Query  410  FFLHYQK--CPDHKSLLYVPC  354
            FF H  K  CP      YVPC
Sbjct  369  FF-HGTKTYCPVST---YVPC  385



>dbj|BAJ91151.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 86/139 (62%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYEIGL++  TVFDA  NQ+ GPIP S GCL  ++ LNL  NQLYG VP+ 
Sbjct  365  LNNDLSGCLPYEIGLVEGLTVFDAGGNQIRGPIPLSLGCLADVQELNLARNQLYGHVPDV  424

Query  572  LC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  402
            LC   K   L  LSLS NYF  +G  C  L+  +VLD+  NCIL  P QR    C  F+ 
Sbjct  425  LCLLAKTGKLTNLSLSDNYFHSVGYHCMELVRSRVLDVRRNCILGFPGQRPHIECAMFYA  484

Query  401  HYQK-CPDHKSLLYVPCDI  348
               K CP    + ++PCD+
Sbjct  485  DPTKHCP---FIPHIPCDL  500



>gb|KCW54905.1| hypothetical protein EUGRSUZ_I00883 [Eucalyptus grandis]
Length=469

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 92/142 (65%), Gaps = 6/142 (4%)
 Frame = -2

Query  749  NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFG-----CLEKLEILNLTNNQLYGS  585
            NN+ +G +P  +G    S +  A+ N+ TGPIP+S G      LE++  LNL+ N LYG 
Sbjct  300  NNEFNGAIPENLGKTPVSYLTLAN-NKFTGPIPRSIGQTSKSLLEQMNQLNLSCNHLYGP  358

Query  584  VPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            VPE++C L  L  L+L+ NYFTQ+GPECR L+ KK LD+  NCIL LP+QRS   C  FF
Sbjct  359  VPETVCVLPKLSALTLNNNYFTQVGPECRKLILKKKLDVRMNCILGLPSQRSPAECDAFF  418

Query  404  LHYQKCPDHKSLLYVPCDIDES  339
                KCP+ KS+ YVPC I +S
Sbjct  419  SKKVKCPNEKSMRYVPCKISQS  440



>ref|XP_006648837.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=437

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 83/132 (63%), Gaps = 5/132 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCLPYE+G+L  + V DA +NQLTGPIP SF CL  +E LNL +N+LYG +P +
Sbjct  271  LNNQLSGCLPYEVGMLTKANVIDAGMNQLTGPIPSSFSCLTSVEQLNLGSNRLYGEIPAA  330

Query  572  LCK-----LKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  408
            LC         L  L+LS NY T +GP C  L++  V+++ NNCI    NQR +  C  F
Sbjct  331  LCNPAAGPASRLANLTLSSNYLTSVGPSCLPLIKDGVVNVKNNCIPGFANQRRSAECASF  390

Query  407  FLHYQKCPDHKS  372
                + CP+  +
Sbjct  391  LSQPKTCPEASA  402



>ref|XP_008456145.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=424

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 88/133 (66%), Gaps = 0/133 (0%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+L+GC+PYE+G LK + VFDA  N LTGP+P S GCLEK+E LN   N LYG VPE 
Sbjct  261  LNNQLTGCIPYEVGFLKTAIVFDAGENLLTGPLPCSLGCLEKIEQLNFAGNFLYGQVPEV  320

Query  572  LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
            +C+L +L  LSLS NY T+IGP CR L+   VLD+  NCI  LP+QRS   C    L   
Sbjct  321  VCELGNLLNLSLSDNYLTKIGPSCRKLVRNGVLDLRKNCIRGLPDQRSPLDCFFSSLFRY  380

Query  392  KCPDHKSLLYVPC  354
             CP   +  +VPC
Sbjct  381  PCPFPATYGFVPC  393



>dbj|BAJ86489.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 88/141 (62%), Gaps = 12/141 (9%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNNKL GCLPYE+GLL  +TV DA  NQLTG IP S+ CL K+E LNL  N LYG VP++
Sbjct  290  LNNKLCGCLPYELGLLAKATVIDAGTNQLTGTIPASYACLRKVEQLNLAGNLLYGEVPDA  349

Query  572  LCKLK------DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKD  411
            LC+L        L  L+LS NYFT +G  C  L+++  L++  NCI   PNQRS + C  
Sbjct  350  LCRLAYPSSGGHLANLTLSDNYFTSLGSCCWALIKQGKLNVARNCIPYAPNQRSHEECAG  409

Query  410  FFLHYQK--CPDHKSLLYVPC  354
            FF H  K  CP      YVPC
Sbjct  410  FF-HRTKTTCPVST---YVPC  426



>gb|ABS78922.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78923.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G+VPE+
Sbjct  63   LNNDFTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAVPEA  122

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  423
            +C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  123  VCMLLRDNLVNLSLSBNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>ref|NP_001141180.1| uncharacterized protein LOC100273267 precursor [Zea mays]
 gb|ACF85643.1| unknown [Zea mays]
Length=437

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 84/128 (66%), Gaps = 5/128 (4%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGCL  E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++
Sbjct  271  LNNQLSGCLAPELGMLAKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGHVPDA  330

Query  572  LCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LC+L      L  L+LSGNYFT +GP C  L++  VL++ +NCI  L NQR  + C  F 
Sbjct  331  LCRLAGPTGRLANLTLSGNYFTSVGPACAALIKDGVLNVKSNCIPGLANQRRPEECAAFI  390

Query  404  LHYQK-CP  384
                K CP
Sbjct  391  QSRPKTCP  398



>gb|ABS78920.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78921.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78924.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G+VPE+
Sbjct  63   LNNDFTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAVPEA  122

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  423
            +C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  123  VCMLLRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78905.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78908.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78909.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G+VPE+
Sbjct  63   LNNDFTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAVPEA  122

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  423
            +C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  123  VCMLLRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>ref|XP_004140807.1| PREDICTED: uncharacterized protein LOC101203557 [Cucumis sativus]
Length=1406

 Score =   133 bits (335),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 91/143 (64%), Gaps = 0/143 (0%)
 Frame = -2

Query  752   LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
             LNN+L+GC+PYE+G LK + VFDA  N LTGP+P S  CLEK+E LN   N LYG VPE 
Sbjct  909   LNNQLTGCIPYEVGFLKKAIVFDAGENLLTGPLPCSLSCLEKIEQLNFAGNFLYGQVPEV  968

Query  572   LCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ  393
             +C L +L  LSLS NYFT+IGP CR L+   VLD+  NCI  LP+QRS   C   +L   
Sbjct  969   VCDLGNLLNLSLSDNYFTKIGPSCRKLVRNGVLDLRKNCIRGLPDQRSPLDCFFSYLFQY  1028

Query  392   KCPDHKSLLYVPCDIDESPRKAG  324
              CP   +  +VPC   +S    G
Sbjct  1029  PCPFPATYGFVPCQKSKSIHSFG  1051



>gb|ABS78915.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78917.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78919.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=174

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G++PE+
Sbjct  63   LNNDFTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEA  122

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  423
            +C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  123  VCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78911.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78912.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78914.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=174

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G++PE+
Sbjct  63   LNNDFTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEA  122

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  423
            +C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  123  VCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78901.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78913.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78916.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78925.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78926.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78927.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78928.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78929.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78930.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78931.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G++PE+
Sbjct  63   LNNDFTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEA  122

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  423
            +C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  123  VCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78900.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78903.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78904.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G++PE+
Sbjct  63   LNNDFTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPET  122

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  423
            +C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  123  VCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78910.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78918.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=174

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G++PE+
Sbjct  63   LNNDFTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEA  122

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  423
            +C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  123  VCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|EEC78222.1| hypothetical protein OsI_17861 [Oryza sativa Indica Group]
Length=408

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 88/140 (63%), Gaps = 8/140 (6%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYEIGL++  TVFDA  N +TGPIP S GCL  +E LNL  NQLYG +P+ 
Sbjct  245  LNNHLSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSLGCLGLVEELNLAGNQLYGHIPDV  304

Query  572  LCKLK---DLEELSLSGNYFTQIG-PECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LC L     L+ LSLS NYF  +G   C  L+  KVLD+  NCI + P+QR A  C  F 
Sbjct  305  LCALAKTGKLQNLSLSDNYFHSVGRRHCLELVRSKVLDVRLNCIPNFPHQRPALECARF-  363

Query  404  LHYQKCPDHKSLL-YVPCDI  348
              Y   P H   + ++PCD+
Sbjct  364  --YADPPQHCPFVPHIPCDL  381



>gb|ABS78902.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   123 bits (309),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 2/112 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G++PE 
Sbjct  63   LNNDFTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEX  122

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  423
            +C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  123  VCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>ref|NP_001054210.2| Os04g0670100 [Oryza sativa Japonica Group]
 emb|CAE02822.1| OSJNBa0043A12.27 [Oryza sativa Japonica Group]
 dbj|BAF16124.2| Os04g0670100 [Oryza sativa Japonica Group]
Length=446

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 88/140 (63%), Gaps = 8/140 (6%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYEIGL++  TVFDA  N +TGPIP S GCL  +E LNL  NQLYG +P+ 
Sbjct  283  LNNHLSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSLGCLGLVEELNLAGNQLYGHIPDV  342

Query  572  LCKLK---DLEELSLSGNYFTQIG-PECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LC L     L+ LSLS NYF  +G   C  L+  KVLD+  NCI + P+QR A  C  F 
Sbjct  343  LCALAKTGKLQNLSLSDNYFHSVGRRHCLELVRSKVLDVRLNCIPNFPHQRPALECARF-  401

Query  404  LHYQKCPDHKSLL-YVPCDI  348
              Y   P H   + ++PCD+
Sbjct  402  --YADPPQHCPFVPHIPCDL  419



>ref|XP_010227187.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Brachypodium distachyon]
Length=1492

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 92/141 (65%), Gaps = 9/141 (6%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN+LSGC+PYE+GLL  +TV DA  N LTG IP S+ CL  +E LNL +N LYG VP++
Sbjct  283  LNNRLSGCIPYELGLLGKATVIDAGTNMLTGTIPASYACLRSVEQLNLADNLLYGVVPDA  342

Query  572  LCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LC+L      L  L+LSGNYFT +G  C +L+ +  L++D NCI   PNQRS + C  FF
Sbjct  343  LCQLASSGGRLVNLTLSGNYFTWLGACCWDLINEGKLNVDRNCIPWAPNQRSHEECARFF  402

Query  404  LHYQKCPDHKS---LLYVPCD  351
              ++K   H +    ++ PC+
Sbjct  403  --FRKIESHATCPISVHAPCE  421


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 51/96 (53%), Gaps = 0/96 (0%)
 Frame = -2

Query  746   NKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC  567
             N+ +G +P  IG +   TV   + NQ  GPIP S   L++L  L+L+ N L  ++PE + 
Sbjct  907   NRFTGTIPTSIGNITKLTVLFLANNQFHGPIPSSLENLQQLGFLDLSYNNLQDNIPEEVF  966

Query  566   KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNN  459
             ++  + + +LS N      P   NL +   LD+ +N
Sbjct  967   RVATIIQCALSHNSLEGQIPCISNLQQLNYLDLSSN  1002


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = -2

Query  746  NKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC  567
            N L G +P EI LL N T      N+LTG IP   G +  LE + L  NQL GS+P+   
Sbjct  634  NLLVGEIPQEIALLSNLTRLWLPYNKLTGVIPPGLGNITSLEHIILMYNQLEGSIPDEFG  693

Query  566  KLKDLEELSLSGNYFTQIGPEC  501
            KL  +  L L  N  +   P+ 
Sbjct  694  KLSKMSNLLLGENMLSSRVPDA  715



>gb|AIE88270.1| hypothetical protein OG_BBa0063K01.1 [Oryza glaberrima]
Length=484

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 88/140 (63%), Gaps = 8/140 (6%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYEIGL++  TVFDA  N +TGPIP S GCL  +E LNL  NQLYG +P+ 
Sbjct  321  LNNHLSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSLGCLGLVEELNLAGNQLYGHIPDV  380

Query  572  LCKLK---DLEELSLSGNYFTQIG-PECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LC L     L+ LSLS NYF  +G   C  L+  KVLD+  NCI + P+QR A  C  F 
Sbjct  381  LCALAKTGKLQNLSLSDNYFHSVGRRHCLELVRSKVLDVRLNCIPNFPHQRPALECARF-  439

Query  404  LHYQKCPDHKSLL-YVPCDI  348
              Y   P H   + ++PCD+
Sbjct  440  --YADPPQHCPFVPHIPCDL  457



>gb|ABS78906.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78907.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 2/112 (2%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN  +GC+P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G+ PE+
Sbjct  63   LNNDFTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAXPEA  122

Query  572  LCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  423
            +C L   +L  LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  123  VCMLLRDNLVNLSLSBNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|EAZ32358.1| hypothetical protein OsJ_16568 [Oryza sativa Japonica Group]
Length=480

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 88/140 (63%), Gaps = 8/140 (6%)
 Frame = -2

Query  752  LNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPES  573
            LNN LSGCLPYEIGL++  TVFDA  N +TGPIP S GCL  +E LNL  NQLYG +P+ 
Sbjct  317  LNNHLSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSLGCLGLVEELNLAGNQLYGHIPDV  376

Query  572  LCKLK---DLEELSLSGNYFTQIG-PECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF  405
            LC L     L+ LSLS NYF  +G   C  L+  KVLD+  NCI + P+QR A  C  F 
Sbjct  377  LCALAKTGKLQNLSLSDNYFHSVGRRHCLELVRSKVLDVRLNCIPNFPHQRPALECARF-  435

Query  404  LHYQKCPDHKSLL-YVPCDI  348
              Y   P H   + ++PCD+
Sbjct  436  --YADPPQHCPFVPHIPCDL  453



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050