BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF042E19

Length=715
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009776738.1|  PREDICTED: mucin-5AC-like                          219   8e-64   Nicotiana sylvestris
ref|XP_009603323.1|  PREDICTED: mucin-5B-like isoform X1                212   8e-61   Nicotiana tomentosiformis
gb|EYU20023.1|  hypothetical protein MIMGU_mgv1a003450mg                204   8e-58   Erythranthe guttata [common monkey flower]
ref|XP_011076682.1|  PREDICTED: cell wall protein RBR3 isoform X1       202   2e-57   Sesamum indicum [beniseed]
ref|XP_011076684.1|  PREDICTED: cell wall protein RBR3 isoform X2       201   8e-57   Sesamum indicum [beniseed]
ref|XP_009791269.1|  PREDICTED: mucin-5AC-like isoform X2               199   3e-56   Nicotiana sylvestris
ref|XP_009791262.1|  PREDICTED: mucin-5AC-like isoform X1               199   4e-56   Nicotiana sylvestris
ref|XP_002315162.1|  hypothetical protein POPTR_0010s19760g             194   3e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011035974.1|  PREDICTED: mucin-5AC-like                          194   4e-54   Populus euphratica
ref|XP_009605097.1|  PREDICTED: mucin-5AC-like isoform X2               192   1e-53   Nicotiana tomentosiformis
ref|XP_009605096.1|  PREDICTED: mucin-5AC-like isoform X1               192   1e-53   Nicotiana tomentosiformis
gb|KDO69021.1|  hypothetical protein CISIN_1g026936mg                   183   2e-53   Citrus sinensis [apfelsine]
ref|XP_006355666.1|  PREDICTED: mucin-5AC-like                          191   5e-53   Solanum tuberosum [potatoes]
ref|XP_004239930.1|  PREDICTED: uncharacterized protein DDB_G0274915    191   6e-53   Solanum lycopersicum
ref|XP_002526897.1|  ATP binding protein, putative                      190   7e-53   Ricinus communis
gb|KJB76175.1|  hypothetical protein B456_012G076400                    183   4e-52   Gossypium raimondii
ref|XP_004170203.1|  PREDICTED: uncharacterized protein LOC101230836    185   9e-52   
emb|CDP14035.1|  unnamed protein product                                187   1e-51   Coffea canephora [robusta coffee]
ref|XP_008373857.1|  PREDICTED: LOW QUALITY PROTEIN: flocculation...    187   1e-51   
ref|XP_008362728.1|  PREDICTED: flocculation protein FLO11-like i...    187   1e-51   
gb|KHF99477.1|  Low-density lipoprotein receptor-related                187   2e-51   Gossypium arboreum [tree cotton]
ref|XP_011016321.1|  PREDICTED: zonadhesin-like isoform X2              186   2e-51   Populus euphratica
ref|XP_011016320.1|  PREDICTED: serine/arginine repetitive matrix...    186   2e-51   Populus euphratica
ref|XP_011044062.1|  PREDICTED: LOW QUALITY PROTEIN: nascent poly...    186   2e-51   Populus euphratica
ref|XP_006435712.1|  hypothetical protein CICLE_v10030993mg             187   2e-51   Citrus clementina [clementine]
ref|XP_006435713.1|  hypothetical protein CICLE_v10030993mg             187   2e-51   Citrus clementina [clementine]
ref|XP_008441457.1|  PREDICTED: zonadhesin isoform X2                   185   3e-51   
ref|XP_008441454.1|  PREDICTED: probable serine/threonine-protein...    186   3e-51   Cucumis melo [Oriental melon]
ref|XP_009344718.1|  PREDICTED: serine/arginine repetitive matrix...    186   5e-51   Pyrus x bretschneideri [bai li]
gb|KJB76174.1|  hypothetical protein B456_012G076400                    184   5e-51   Gossypium raimondii
ref|XP_009344713.1|  PREDICTED: mucin-5AC-like isoform X1               186   5e-51   Pyrus x bretschneideri [bai li]
ref|XP_004138425.1|  PREDICTED: uncharacterized protein LOC101204600    185   6e-51   
gb|KGN45784.1|  hypothetical protein Csa_6G011590                       185   6e-51   Cucumis sativus [cucumbers]
gb|KJB76177.1|  hypothetical protein B456_012G076400                    183   7e-51   Gossypium raimondii
gb|KJB76179.1|  hypothetical protein B456_012G076400                    184   9e-51   Gossypium raimondii
gb|KJB76173.1|  hypothetical protein B456_012G076400                    184   1e-50   Gossypium raimondii
gb|KDP44785.1|  hypothetical protein JCGZ_01285                         183   3e-50   Jatropha curcas
gb|KHG16426.1|  hypothetical protein F383_23799                         183   4e-50   Gossypium arboreum [tree cotton]
ref|XP_010067518.1|  PREDICTED: serine/arginine repetitive matrix...    182   5e-50   Eucalyptus grandis [rose gum]
ref|XP_008369241.1|  PREDICTED: flocculation protein FLO11-like         181   2e-49   Malus domestica [apple tree]
ref|XP_007009023.1|  Uncharacterized protein TCM_042539                 181   2e-49   
gb|KJB74298.1|  hypothetical protein B456_011G285700                    181   2e-49   Gossypium raimondii
ref|XP_009369152.1|  PREDICTED: proteoglycan 4-like                     181   2e-49   Pyrus x bretschneideri [bai li]
ref|XP_010095095.1|  hypothetical protein L484_026404                   181   2e-49   Morus notabilis
ref|XP_004307632.1|  PREDICTED: flocculation protein FLO11 isofor...    180   4e-49   Fragaria vesca subsp. vesca
ref|XP_002312151.1|  hypothetical protein POPTR_0008s06680g             179   8e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011469903.1|  PREDICTED: flocculation protein FLO11 isofor...    178   2e-48   Fragaria vesca subsp. vesca
ref|XP_002274030.1|  PREDICTED: mucin-17                                177   5e-48   Vitis vinifera
ref|XP_010256565.1|  PREDICTED: mucin-5AC-like                          175   4e-47   Nelumbo nucifera [Indian lotus]
ref|XP_009133405.1|  PREDICTED: uncharacterized serine-rich prote...    174   6e-47   Brassica rapa
emb|CDY60338.1|  BnaC03g72310D                                          174   7e-47   Brassica napus [oilseed rape]
emb|CDY07628.1|  BnaA03g18830D                                          174   8e-47   Brassica napus [oilseed rape]
ref|XP_010534575.1|  PREDICTED: mucin-17-like                           173   1e-46   Tarenaya hassleriana [spider flower]
ref|XP_006367372.1|  PREDICTED: uncharacterized protein LOC102588142    164   2e-46   Solanum tuberosum [potatoes]
emb|CDY20509.1|  BnaC04g05350D                                          172   6e-46   Brassica napus [oilseed rape]
ref|XP_007218953.1|  hypothetical protein PRUPE_ppa003504mg             171   6e-46   Prunus persica
ref|XP_008233740.1|  PREDICTED: flocculation protein FLO11              171   7e-46   Prunus mume [ume]
ref|XP_006411252.1|  hypothetical protein EUTSA_v10016404mg             171   8e-46   Eutrema salsugineum [saltwater cress]
dbj|BAN18479.1|  proteophosphoglycan                                    162   9e-46   Schiedea laui
dbj|BAN18468.1|  proteophosphoglycan                                    162   9e-46   Schiedea kealiae
ref|XP_010535052.1|  PREDICTED: mucin-17                                171   1e-45   Tarenaya hassleriana [spider flower]
dbj|BAN18471.1|  proteophosphoglycan                                    161   2e-45   Schiedea adamantis
ref|XP_010689824.1|  PREDICTED: cell wall protein RBR3                  170   2e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010262832.1|  PREDICTED: nascent polypeptide-associated co...    169   3e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010262830.1|  PREDICTED: nascent polypeptide-associated co...    169   3e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010262831.1|  PREDICTED: nascent polypeptide-associated co...    169   3e-45   Nelumbo nucifera [Indian lotus]
emb|CDX74811.1|  BnaA05g05570D                                          169   4e-45   
dbj|BAN18489.1|  proteophosphoglycan                                    160   5e-45   Schiedea verticillata
dbj|BAN18487.1|  proteophosphoglycan                                    160   6e-45   Schiedea trinervis
ref|XP_009143258.1|  PREDICTED: endochitinase A-like                    169   7e-45   Brassica rapa
ref|XP_004235247.1|  PREDICTED: putative GPI-anchored protein PB1...    168   1e-44   Solanum lycopersicum
ref|NP_181536.3|  uncharacterized protein                               167   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004500676.1|  PREDICTED: flocculation protein FLO11-like         167   3e-44   Cicer arietinum [garbanzo]
ref|XP_006293855.1|  hypothetical protein CARUB_v10022840mg             167   3e-44   Capsella rubella
dbj|BAH57264.1|  AT2G40070                                              167   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508921.1|  PREDICTED: flocculation protein FLO11-like i...    167   4e-44   Camelina sativa [gold-of-pleasure]
ref|NP_001078028.1|  uncharacterized protein                            166   4e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517399.1|  PREDICTED: flocculation protein FLO11-like         166   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_003538456.1|  PREDICTED: flocculation protein FLO11-like         166   8e-44   Glycine max [soybeans]
gb|KHN34732.1|  hypothetical protein glysoja_039028                     166   8e-44   Glycine soja [wild soybean]
ref|XP_010910088.1|  PREDICTED: endochitinase A-like                    165   1e-43   Elaeis guineensis
ref|XP_010505709.1|  PREDICTED: flocculation protein FLO11-like         165   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_007141776.1|  hypothetical protein PHAVU_008G224800g             165   2e-43   Phaseolus vulgaris [French bean]
ref|XP_008795443.1|  PREDICTED: nascent polypeptide-associated co...    164   2e-43   Phoenix dactylifera
gb|KFK36895.1|  hypothetical protein AALP_AA4G186400                    165   2e-43   Arabis alpina [alpine rockcress]
ref|XP_007163529.1|  hypothetical protein PHAVU_001G241800g             164   5e-43   Phaseolus vulgaris [French bean]
ref|XP_003552436.1|  PREDICTED: flocculation protein FLO11-like         163   6e-43   Glycine max [soybeans]
gb|KEH34783.1|  ATP-binding protein, putative                           162   2e-42   Medicago truncatula
ref|XP_009412575.1|  PREDICTED: vegetative cell wall protein gp1-...    161   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412573.1|  PREDICTED: endochitinase A-like isoform X1         161   3e-42   
gb|EPS71355.1|  hypothetical protein M569_03402                         159   2e-41   Genlisea aurea
ref|XP_010654169.1|  PREDICTED: mucin-12-like isoform X2                158   2e-41   Vitis vinifera
ref|XP_010654168.1|  PREDICTED: zonadhesin-like isoform X1              158   3e-41   Vitis vinifera
emb|CAN77490.1|  hypothetical protein VITISV_010725                     158   3e-41   Vitis vinifera
ref|XP_008785362.1|  PREDICTED: nascent polypeptide-associated co...    157   4e-41   Phoenix dactylifera
ref|XP_009407549.1|  PREDICTED: mucin-1 isoform X2                      157   9e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011047445.1|  PREDICTED: mucin-2-like                            155   4e-40   Populus euphratica
ref|XP_009782013.1|  PREDICTED: cell wall protein RBR3-like             154   1e-39   Nicotiana sylvestris
ref|XP_009600813.1|  PREDICTED: putative GPI-anchored protein PB1...    153   2e-39   
ref|XP_009419731.1|  PREDICTED: nascent polypeptide-associated co...    152   3e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007026736.1|  Uncharacterized protein TCM_021711                 151   8e-39   
ref|XP_009407548.1|  PREDICTED: mucin-1 isoform X1                      150   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002323572.2|  hypothetical protein POPTR_0016s12230g             150   2e-38   
gb|KEH28284.1|  ATP-binding protein, putative                           150   2e-38   Medicago truncatula
gb|KEH28283.1|  ATP-binding protein, putative                           150   3e-38   Medicago truncatula
gb|KHN48560.1|  hypothetical protein glysoja_034183                     149   6e-38   Glycine soja [wild soybean]
ref|XP_006575535.1|  PREDICTED: flocculation protein FLO11-like i...    150   7e-38   Glycine max [soybeans]
ref|XP_006575536.1|  PREDICTED: flocculation protein FLO11-like i...    149   7e-38   Glycine max [soybeans]
ref|XP_004490980.1|  PREDICTED: flocculation protein FLO11-like         148   1e-37   Cicer arietinum [garbanzo]
ref|XP_006429352.1|  hypothetical protein CICLE_v10011390mg             147   4e-37   Citrus clementina [clementine]
gb|KDO47715.1|  hypothetical protein CISIN_1g008537mg                   145   8e-37   Citrus sinensis [apfelsine]
ref|XP_006471702.1|  PREDICTED: uncharacterized protein LOC102622828    140   2e-36   
gb|KJB76929.1|  hypothetical protein B456_012G113200                    144   2e-36   Gossypium raimondii
gb|EEC69917.1|  hypothetical protein OsI_00338                          144   3e-36   Oryza sativa Indica Group [Indian rice]
ref|NP_001041987.1|  Os01g0141900                                       144   3e-36   
gb|KJB76927.1|  hypothetical protein B456_012G113200                    144   3e-36   Gossypium raimondii
dbj|BAD61066.1|  putative proteophosphoglycan                           144   4e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008655627.1|  PREDICTED: uncharacterized protein LOC103634815    138   1e-35   
ref|XP_006595868.1|  PREDICTED: flocculation protein FLO11-like i...    142   1e-35   Glycine max [soybeans]
ref|XP_006595866.1|  PREDICTED: flocculation protein FLO11-like i...    143   2e-35   
ref|XP_006595867.1|  PREDICTED: flocculation protein FLO11-like i...    143   2e-35   Glycine max [soybeans]
ref|XP_002457389.1|  hypothetical protein SORBIDRAFT_03g006540          142   2e-35   Sorghum bicolor [broomcorn]
gb|KHN20852.1|  hypothetical protein glysoja_009160                     142   2e-35   Glycine soja [wild soybean]
gb|ACL54464.1|  unknown                                                 141   3e-35   Zea mays [maize]
ref|XP_008672699.1|  PREDICTED: hypothetical protein isoform X1         141   4e-35   Zea mays [maize]
ref|XP_008672700.1|  PREDICTED: hypothetical protein isoform X2         141   4e-35   Zea mays [maize]
ref|NP_001145904.1|  hypothetical protein                               141   6e-35   Zea mays [maize]
ref|XP_006643736.1|  PREDICTED: flocculation protein FLO11-like         139   1e-34   
ref|XP_009402293.1|  PREDICTED: nascent polypeptide-associated co...    139   2e-34   
ref|XP_004968162.1|  PREDICTED: mucin-5AC-like isoform X1               139   3e-34   Setaria italica
ref|XP_004968163.1|  PREDICTED: mucin-5AC-like isoform X2               138   3e-34   
ref|XP_003568404.1|  PREDICTED: nascent polypeptide-associated co...    138   5e-34   Brachypodium distachyon [annual false brome]
gb|KHG09845.1|  Maturase K                                              134   1e-32   Gossypium arboreum [tree cotton]
ref|XP_006848188.1|  hypothetical protein AMTR_s00029p00238480          134   2e-32   Amborella trichopoda
ref|XP_010923060.1|  PREDICTED: endochitinase A-like                    133   3e-32   Elaeis guineensis
ref|XP_002528111.1|  conserved hypothetical protein                     132   6e-32   Ricinus communis
ref|XP_010109621.1|  hypothetical protein L484_015576                   131   1e-31   Morus notabilis
ref|XP_008243876.1|  PREDICTED: flocculation protein FLO11-like         128   1e-30   Prunus mume [ume]
ref|XP_007208455.1|  hypothetical protein PRUPE_ppa003864mg             127   3e-30   Prunus persica
emb|CBI30400.3|  unnamed protein product                                120   4e-30   Vitis vinifera
gb|KDP24464.1|  hypothetical protein JCGZ_25028                         125   9e-30   Jatropha curcas
ref|XP_008388204.1|  PREDICTED: uncharacterized protein DDB_G0271...    123   7e-29   
ref|XP_009344715.1|  PREDICTED: flocculation protein FLO11-like         121   4e-28   Pyrus x bretschneideri [bai li]
ref|XP_010543220.1|  PREDICTED: mucin-1-like                            120   1e-27   Tarenaya hassleriana [spider flower]
emb|CDY53090.1|  BnaCnng24200D                                          118   4e-27   Brassica napus [oilseed rape]
emb|CDY44674.1|  BnaA05g29320D                                          117   6e-27   Brassica napus [oilseed rape]
ref|XP_009146960.1|  PREDICTED: flocculation protein FLO11-like         117   6e-27   Brassica rapa
ref|XP_007140357.1|  hypothetical protein PHAVU_008G105200g             117   6e-27   Phaseolus vulgaris [French bean]
ref|XP_009377788.1|  PREDICTED: mucin-2-like                            117   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_009603333.1|  PREDICTED: uncharacterized serine-rich prote...    114   8e-26   Nicotiana tomentosiformis
ref|XP_009123519.1|  PREDICTED: sialidase-like                          114   2e-25   Brassica rapa
ref|XP_009603328.1|  PREDICTED: uncharacterized serine-rich prote...    114   2e-25   Nicotiana tomentosiformis
ref|XP_004302638.1|  PREDICTED: endochitinase A-like                    113   2e-25   Fragaria vesca subsp. vesca
ref|XP_010486449.1|  PREDICTED: flocculation protein FLO11-like         113   3e-25   
gb|KFK38285.1|  hypothetical protein AALP_AA3G094600                    113   3e-25   Arabis alpina [alpine rockcress]
emb|CDY22176.1|  BnaC01g39250D                                          113   3e-25   Brassica napus [oilseed rape]
ref|NP_566340.1|  proline-rich uncharacterized protein                  113   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467544.1|  PREDICTED: mucin-5AC-like                          113   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006299014.1|  hypothetical protein CARUB_v10015141mg             112   8e-25   Capsella rubella
ref|XP_009588559.1|  PREDICTED: uncharacterized protein DDB_G0274...    112   9e-25   Nicotiana tomentosiformis
ref|XP_010464524.1|  PREDICTED: cell wall protein DAN4-like             112   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009588557.1|  PREDICTED: uncharacterized protein DDB_G0274...    112   1e-24   Nicotiana tomentosiformis
ref|XP_006407721.1|  hypothetical protein EUTSA_v10020521mg             111   1e-24   Eutrema salsugineum [saltwater cress]
ref|XP_004246841.1|  PREDICTED: endochitinase A-like                    111   2e-24   Solanum lycopersicum
ref|XP_008370081.1|  PREDICTED: flocculation protein FLO11-like         110   5e-24   
ref|XP_006602654.1|  PREDICTED: flocculation protein FLO11 isofor...    107   2e-23   
gb|KHN07485.1|  hypothetical protein glysoja_034966                     107   2e-23   Glycine soja [wild soybean]
emb|CDP12663.1|  unnamed protein product                                106   5e-23   Coffea canephora [robusta coffee]
ref|XP_006583646.1|  PREDICTED: flocculation protein FLO11-like         106   9e-23   Glycine max [soybeans]
ref|XP_006366352.1|  PREDICTED: flocculation protein FLO11-like         102   3e-21   Solanum tuberosum [potatoes]
ref|XP_009804552.1|  PREDICTED: endochitinase A-like isoform X2         102   3e-21   Nicotiana sylvestris
ref|XP_009804551.1|  PREDICTED: endochitinase A-like isoform X1         102   3e-21   Nicotiana sylvestris
gb|KJB76178.1|  hypothetical protein B456_012G076400                    100   1e-20   Gossypium raimondii
gb|EYU26656.1|  hypothetical protein MIMGU_mgv1a013847mg              96.7    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_004165110.1|  PREDICTED: uncharacterized protein LOC101231484  99.8    2e-20   
ref|XP_004147920.1|  PREDICTED: uncharacterized protein LOC101217147  99.8    2e-20   Cucumis sativus [cucumbers]
ref|XP_011094995.1|  PREDICTED: proteoglycan 4-like                   97.8    6e-20   Sesamum indicum [beniseed]
gb|AAB95292.1|  En/Spm-like transposon protein                        97.1    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008449274.1|  PREDICTED: uncharacterized protein DDB_G0271...  96.3    3e-19   Cucumis melo [Oriental melon]
ref|XP_008449265.1|  PREDICTED: uncharacterized protein DDB_G0271...  96.3    3e-19   Cucumis melo [Oriental melon]
gb|KEH23155.1|  hypothetical protein MTR_7g068220                     93.6    9e-19   Medicago truncatula
gb|KEH23156.1|  hypothetical protein MTR_7g068220                     93.6    1e-18   Medicago truncatula
ref|XP_003623288.1|  hypothetical protein MTR_7g068220                94.4    1e-18   Medicago truncatula
ref|XP_006356484.1|  PREDICTED: flocculation protein FLO11-like       93.2    3e-18   Solanum tuberosum [potatoes]
emb|CDY55901.1|  BnaAnng13940D                                        90.9    2e-17   Brassica napus [oilseed rape]
ref|XP_009125427.1|  PREDICTED: uncharacterized protein DDB_G0271670  90.9    2e-17   
emb|CDY48118.1|  BnaC02g03750D                                        88.2    2e-16   Brassica napus [oilseed rape]
ref|XP_006398633.1|  hypothetical protein EUTSA_v10013437mg           87.0    3e-16   
gb|KFK36712.1|  hypothetical protein AALP_AA4G159900                  83.6    1e-15   Arabis alpina [alpine rockcress]
ref|XP_011077570.1|  PREDICTED: endochitinase A1-like isoform X2      85.1    2e-15   Sesamum indicum [beniseed]
ref|XP_011077568.1|  PREDICTED: endochitinase A1-like isoform X1      84.7    2e-15   Sesamum indicum [beniseed]
emb|CDX93325.1|  BnaC04g45710D                                        80.5    2e-14   
ref|XP_004492428.1|  PREDICTED: mucin-5AC-like                        79.3    1e-13   Cicer arietinum [garbanzo]
ref|NP_181351.5|  uncharacterized protein                             77.0    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006495301.1|  PREDICTED: flocculation protein FLO11-like       77.8    4e-13   Citrus sinensis [apfelsine]
ref|XP_010517104.1|  PREDICTED: uncharacterized protein LOC104792614  76.3    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006295953.1|  hypothetical protein CARUB_v10025095mg           75.9    8e-13   Capsella rubella
ref|XP_009141724.1|  PREDICTED: uncharacterized protein LOC103865654  75.1    2e-12   Brassica rapa
ref|XP_010509216.1|  PREDICTED: uncharacterized protein LOC104785658  74.3    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006411019.1|  hypothetical protein EUTSA_v10017516mg           73.9    3e-12   
ref|XP_010528826.1|  PREDICTED: uncharacterized protein LOC104805834  73.6    4e-12   Tarenaya hassleriana [spider flower]
ref|XP_010505431.1|  PREDICTED: uncharacterized protein LOC104782251  73.2    6e-12   Camelina sativa [gold-of-pleasure]
gb|KJB76928.1|  hypothetical protein B456_012G113200                  73.6    1e-11   Gossypium raimondii
ref|XP_006286667.1|  hypothetical protein CARUB_v10002586mg           72.0    4e-11   Capsella rubella
ref|XP_010490586.1|  PREDICTED: putative GPI-anchored protein PB1...  71.6    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010452004.1|  PREDICTED: uncharacterized serine-rich prote...  69.3    3e-10   Camelina sativa [gold-of-pleasure]
gb|EPS68722.1|  hypothetical protein M569_06052                       62.4    1e-09   Genlisea aurea
gb|AAC27165.1|  hypothetical protein                                  66.2    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010553245.1|  PREDICTED: uncharacterized protein LOC104823383  65.9    3e-09   Tarenaya hassleriana [spider flower]
ref|NP_195748.1|  uncharacterized protein                             65.9    3e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CDY18403.1|  BnaA04g21840D                                        65.9    4e-09   Brassica napus [oilseed rape]
ref|XP_010423931.1|  PREDICTED: uncharacterized serine-rich prote...  63.9    2e-08   
ref|XP_003601170.1|  hypothetical protein MTR_3g076760                51.6    2e-05   
ref|XP_006842565.1|  hypothetical protein AMTR_s00077p00146340        53.9    5e-05   Amborella trichopoda
ref|XP_010683444.1|  PREDICTED: mucin-5AC                             53.5    6e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009406053.1|  PREDICTED: uncharacterized threonine-rich GP...  52.4    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP06374.1|  unnamed protein product                              51.2    4e-04   Coffea canephora [robusta coffee]
ref|XP_010098029.1|  hypothetical protein L484_004233                 51.2    4e-04   Morus notabilis
ref|XP_004142729.1|  PREDICTED: uncharacterized protein LOC101206216  50.8    4e-04   
ref|XP_004170022.1|  PREDICTED: uncharacterized protein LOC101225804  50.8    4e-04   
ref|XP_008463284.1|  PREDICTED: uncharacterized protein DDB_G0271670  50.8    4e-04   Cucumis melo [Oriental melon]
ref|XP_006602722.1|  PREDICTED: flocculation protein FLO11-like       50.8    5e-04   Glycine max [soybeans]
gb|KHN40608.1|  hypothetical protein glysoja_001106                   50.8    5e-04   Glycine soja [wild soybean]
ref|XP_002266425.1|  PREDICTED: putative GPI-anchored protein PB1...  50.4    6e-04   Vitis vinifera
ref|XP_006481235.1|  PREDICTED: putative GPI-anchored protein PB1...  50.4    7e-04   Citrus sinensis [apfelsine]
ref|XP_003534630.1|  PREDICTED: flocculation protein FLO11-like       50.4    7e-04   Glycine max [soybeans]
gb|KDO64167.1|  hypothetical protein CISIN_1g008000mg                 50.4    7e-04   Citrus sinensis [apfelsine]
ref|XP_010922788.1|  PREDICTED: DNA-directed RNA polymerase II su...  50.4    8e-04   Elaeis guineensis
gb|KHN29484.1|  hypothetical protein glysoja_005208                   50.1    8e-04   Glycine soja [wild soybean]
ref|XP_006429633.1|  hypothetical protein CICLE_v100114702mg          50.1    8e-04   
ref|XP_008803007.1|  PREDICTED: DNA-directed RNA polymerase II su...  50.1    8e-04   Phoenix dactylifera
ref|XP_004302521.1|  PREDICTED: sialidase                             50.1    0.001   Fragaria vesca subsp. vesca



>ref|XP_009776738.1| PREDICTED: mucin-5AC-like [Nicotiana sylvestris]
Length=570

 Score =   219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H+SGSSVP+PAMSRLHAKAN NVSPV++G+KMVERV+NMRKLAPP+ D+K SP SNLS K
Sbjct  401  HSSGSSVPIPAMSRLHAKANDNVSPVMVGSKMVERVVNMRKLAPPKQDDKQSPRSNLSTK  460

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
            SSSPDS+GFGRT SKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGP+RSRTV
Sbjct  461  SSSPDSSGFGRTFSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPNRSRTV  520

Query  351  SVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            SVSDSPLATSSNASSE S NNNA+C+DG   + +I+SDKGARSPPS+H
Sbjct  521  SVSDSPLATSSNASSEASFNNNALCVDGIEADDDINSDKGARSPPSLH  568



>ref|XP_009603323.1| PREDICTED: mucin-5B-like isoform X1 [Nicotiana tomentosiformis]
Length=574

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H+SGSSVP+PAMSRLHAKAN NVSPV++G+KMVERV+NMRKLAPP+ D+K SP SNLS K
Sbjct  405  HSSGSSVPIPAMSRLHAKANDNVSPVMVGSKMVERVVNMRKLAPPKQDDKQSPRSNLSTK  464

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
            SSSPDS+GFGRT SKKSLDMAIRHMDIRR+IPGNLRPL+TNIPASSMYSVRSGP++SRTV
Sbjct  465  SSSPDSSGFGRTFSKKSLDMAIRHMDIRRSIPGNLRPLLTNIPASSMYSVRSGPNKSRTV  524

Query  351  SVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            SVSDSPLATSSNASSEVSVNNNA+C+DG   + +I+SDKGARSP S+ 
Sbjct  525  SVSDSPLATSSNASSEVSVNNNALCVDGIEADDDINSDKGARSPASLQ  572



>gb|EYU20023.1| hypothetical protein MIMGU_mgv1a003450mg [Erythranthe guttata]
Length=584

 Score =   204 bits (518),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            HNSGSSVPVPA++R HAKAN NVSPV++G KMV+RV+NMRKLAPP+ D+K SP+SNLS K
Sbjct  416  HNSGSSVPVPAVNRFHAKANDNVSPVLLGTKMVDRVMNMRKLAPPKQDDKHSPHSNLSGK  475

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
            SSSPDS+GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGP R RTV
Sbjct  476  SSSPDSSGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPPR-RTV  534

Query  351  SVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            SVSDSPLATSSNASSEVSVNNNA+C+DGH  + ++SSDKG RSP S+ 
Sbjct  535  SVSDSPLATSSNASSEVSVNNNALCMDGHEIDDDVSSDKGIRSPASLR  582



>ref|XP_011076682.1| PREDICTED: cell wall protein RBR3 isoform X1 [Sesamum indicum]
 ref|XP_011076683.1| PREDICTED: cell wall protein RBR3 isoform X1 [Sesamum indicum]
Length=573

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H+SGSSVPVPA++RLHAKAN NVSPV++G KMVERVINMRKL PP+ D+K SP+SNLS 
Sbjct  399  IHSSGSSVPVPAVNRLHAKANDNVSPVLVGTKMVERVINMRKLVPPKQDDKHSPHSNLSG  458

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS+GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG    RT
Sbjct  459  KSSSPDSSGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGGPTRRT  518

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHSSR  199
            VSVSDSPLATSSNASSEVSVNNNA+C+DG   + ++SSDKG RSP S+H S+
Sbjct  519  VSVSDSPLATSSNASSEVSVNNNALCMDGPEVDDDVSSDKGIRSPASLHGSK  570



>ref|XP_011076684.1| PREDICTED: cell wall protein RBR3 isoform X2 [Sesamum indicum]
Length=569

 Score =   201 bits (511),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H+SGSSVPVPA++RLHAKAN NVSPV++G KMVERVINMRKL PP+ D+K SP+SNLS 
Sbjct  399  IHSSGSSVPVPAVNRLHAKANDNVSPVLVGTKMVERVINMRKLVPPKQDDKHSPHSNLSG  458

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS+GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG    RT
Sbjct  459  KSSSPDSSGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGGPTRRT  518

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            VSVSDSPLATSSNASSEVSVNNNA+C+DG   + ++SSDKG RSP S+H
Sbjct  519  VSVSDSPLATSSNASSEVSVNNNALCMDGPEVDDDVSSDKGIRSPASLH  567



>ref|XP_009791269.1| PREDICTED: mucin-5AC-like isoform X2 [Nicotiana sylvestris]
Length=575

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 150/170 (88%), Gaps = 1/170 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPP-RLDnksspnsnls  538
            + +SGSSVP+PAMSRLHAKAN NVSP ++G KMVERV+NMRKLAPP + DNK SP SNLS
Sbjct  404  VRSSGSSVPIPAMSRLHAKANDNVSPGLIGTKMVERVVNMRKLAPPAKHDNKYSPRSNLS  463

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
            A S SPDS+GFGRTLSKKSLDMA+RHMDIRR+IPGNLRP MTNIPASSMYSVRSGP+RSR
Sbjct  464  ANSPSPDSSGFGRTLSKKSLDMAMRHMDIRRSIPGNLRPSMTNIPASSMYSVRSGPNRSR  523

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            TVSVSDSPL TSSNASSEVS+NNNAVC+DG   +  ISSDKG RSP S+ 
Sbjct  524  TVSVSDSPLHTSSNASSEVSINNNAVCVDGSEADDAISSDKGVRSPASMR  573



>ref|XP_009791262.1| PREDICTED: mucin-5AC-like isoform X1 [Nicotiana sylvestris]
Length=579

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 150/170 (88%), Gaps = 1/170 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPP-RLDnksspnsnls  538
            + +SGSSVP+PAMSRLHAKAN NVSP ++G KMVERV+NMRKLAPP + DNK SP SNLS
Sbjct  408  VRSSGSSVPIPAMSRLHAKANDNVSPGLIGTKMVERVVNMRKLAPPAKHDNKYSPRSNLS  467

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
            A S SPDS+GFGRTLSKKSLDMA+RHMDIRR+IPGNLRP MTNIPASSMYSVRSGP+RSR
Sbjct  468  ANSPSPDSSGFGRTLSKKSLDMAMRHMDIRRSIPGNLRPSMTNIPASSMYSVRSGPNRSR  527

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            TVSVSDSPL TSSNASSEVS+NNNAVC+DG   +  ISSDKG RSP S+ 
Sbjct  528  TVSVSDSPLHTSSNASSEVSINNNAVCVDGSEADDAISSDKGVRSPASMR  577



>ref|XP_002315162.1| hypothetical protein POPTR_0010s19760g [Populus trichocarpa]
 gb|EEF01333.1| hypothetical protein POPTR_0010s19760g [Populus trichocarpa]
Length=567

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 145/165 (88%), Gaps = 2/165 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A SR H+K N NVSPV++G KMVERVINMRKLAPP+ D K SP+ NL+ 
Sbjct  401  MHPSGSSVP--AFSRGHSKINDNVSPVIIGTKMVERVINMRKLAPPKQDGKHSPSGNLTG  458

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS+GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGP+RSRT
Sbjct  459  KSSSPDSSGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPARSRT  518

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            VSVSDSPLATSSNASSEVS+NNN +C+DG   E +I S++G RSP
Sbjct  519  VSVSDSPLATSSNASSEVSINNNGLCLDGIELEDDIGSERGGRSP  563



>ref|XP_011035974.1| PREDICTED: mucin-5AC-like [Populus euphratica]
Length=567

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 145/165 (88%), Gaps = 2/165 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A SR H+K N NVSPV++G KMVERVINMRKLAPP+ D K SP+ N++ 
Sbjct  401  MHPSGSSVP--AFSRGHSKINDNVSPVIIGTKMVERVINMRKLAPPKQDGKHSPSGNMTG  458

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS+GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGP+RSRT
Sbjct  459  KSSSPDSSGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPARSRT  518

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            VSVSDSPLATSSNASSEVS+NNN +C+DG   E +I S++G RSP
Sbjct  519  VSVSDSPLATSSNASSEVSINNNGLCLDGIELEDDIGSERGGRSP  563



>ref|XP_009605097.1| PREDICTED: mucin-5AC-like isoform X2 [Nicotiana tomentosiformis]
Length=575

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPP-RLDnksspnsnls  538
            + +SGSSVP+PAMSRLHAKAN NVSP ++G KMVERV+NMRKLAPP + DNK SP SNLS
Sbjct  404  VRSSGSSVPIPAMSRLHAKANDNVSPGLIGTKMVERVVNMRKLAPPAKQDNKYSPRSNLS  463

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
            A SSSPDS+GFGRTLSKKSLDMA+RHMDIRR+IPG LRP MTNIPASSMYSVRSGP+RSR
Sbjct  464  ANSSSPDSSGFGRTLSKKSLDMAMRHMDIRRSIPGILRPSMTNIPASSMYSVRSGPNRSR  523

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            TVSVSDSPL TSSNASSEVS+NNNAVC+DG   +  ISSDKG RSP
Sbjct  524  TVSVSDSPLHTSSNASSEVSINNNAVCVDGSEVDDAISSDKGVRSP  569



>ref|XP_009605096.1| PREDICTED: mucin-5AC-like isoform X1 [Nicotiana tomentosiformis]
Length=579

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPP-RLDnksspnsnls  538
            + +SGSSVP+PAMSRLHAKAN NVSP ++G KMVERV+NMRKLAPP + DNK SP SNLS
Sbjct  408  VRSSGSSVPIPAMSRLHAKANDNVSPGLIGTKMVERVVNMRKLAPPAKQDNKYSPRSNLS  467

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
            A SSSPDS+GFGRTLSKKSLDMA+RHMDIRR+IPG LRP MTNIPASSMYSVRSGP+RSR
Sbjct  468  ANSSSPDSSGFGRTLSKKSLDMAMRHMDIRRSIPGILRPSMTNIPASSMYSVRSGPNRSR  527

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            TVSVSDSPL TSSNASSEVS+NNNAVC+DG   +  ISSDKG RSP
Sbjct  528  TVSVSDSPLHTSSNASSEVSINNNAVCVDGSEVDDAISSDKGVRSP  573



>gb|KDO69021.1| hypothetical protein CISIN_1g026936mg [Citrus sinensis]
Length=230

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 3/168 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A SR ++K N NVSPVV+G KMVERVINMRKLAPP+ D+K SP+SNL+ 
Sbjct  63   VHLSGSSVP--AFSRGYSKVNDNVSPVVIGTKMVERVINMRKLAPPKQDDKHSPHSNLTG  120

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            K+SSPDS GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGP RSRT
Sbjct  121  KTSSPDSLGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGP-RSRT  179

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSV  211
            VSVSDSPLATSSNASSE+SVNNN +C+DG   E +I S++G RSP SV
Sbjct  180  VSVSDSPLATSSNASSELSVNNNGLCMDGCDIEDDIGSERGGRSPASV  227



>ref|XP_006355666.1| PREDICTED: mucin-5AC-like [Solanum tuberosum]
Length=578

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPP-RLDnksspnsnls  538
            + +SGSSVP+PAMSRLHAKAN NVSP ++G KMVERVINMRKLAPP + DNK SP +NL 
Sbjct  407  VRSSGSSVPIPAMSRLHAKANDNVSPGMVGTKMVERVINMRKLAPPAKQDNKHSPRNNLY  466

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
            A S+SPDSTGFGRTLSKKSLDMA+RHMDIRR+I GNLRP MTNIPASSMYSVRSGP+R+R
Sbjct  467  AHSASPDSTGFGRTLSKKSLDMAMRHMDIRRSISGNLRPSMTNIPASSMYSVRSGPNRTR  526

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            TVSVSDSPLATSSNASSEVSVNNN VC+DG   +  IS  KG RSP  +H
Sbjct  527  TVSVSDSPLATSSNASSEVSVNNNTVCLDGSEVDDAISGVKGVRSPAYMH  576



>ref|XP_004239930.1| PREDICTED: uncharacterized protein DDB_G0274915 [Solanum lycopersicum]
Length=578

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPP-RLDnksspnsnls  538
            + +SGSSVP+PAMSRLHAKAN NVSP ++G KMVERV+NMRKLAPP + DNK SP +NL 
Sbjct  407  VRSSGSSVPIPAMSRLHAKANDNVSPGMIGTKMVERVVNMRKLAPPAKQDNKHSPRNNLY  466

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
            A SSSPDSTGFGRTLSKKSLDMA+RHMDIR++I GNLRP MTNIPASSMYSVRSGP+R+R
Sbjct  467  AHSSSPDSTGFGRTLSKKSLDMAMRHMDIRQSISGNLRPSMTNIPASSMYSVRSGPNRTR  526

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            TVSVSDSPLATSSNASSEVSVNNN +C+DG   +  IS  KGARSP  +H
Sbjct  527  TVSVSDSPLATSSNASSEVSVNNNTMCLDGSEVDDAISGVKGARSPAYMH  576



>ref|XP_002526897.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF35528.1| ATP binding protein, putative [Ricinus communis]
Length=568

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A+SRLHAKAN NVSPV++G KMVERVINMRKLAPP+ D+K SP+ NLS 
Sbjct  405  MHPSGSSVP--AISRLHAKANDNVSPVLIGTKMVERVINMRKLAPPKQDDKLSPHGNLSG  462

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS+GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSG +RSRT
Sbjct  463  KSSSPDSSGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGSARSRT  522

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            +SVSDSPLATSSN SSEVSVNNN +C+D    E +I S++G RSP
Sbjct  523  ISVSDSPLATSSNGSSEVSVNNNGLCLDAIELEDDIGSERGGRSP  567



>gb|KJB76175.1| hypothetical protein B456_012G076400 [Gossypium raimondii]
Length=336

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 143/170 (84%), Gaps = 2/170 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            LH SG SVP  A+SR ++KA+ NVSPVV+G KMVERVINMRKLAPP+ D+K+SP  N S 
Sbjct  168  LHLSGGSVP--AVSRGYSKASDNVSPVVIGTKMVERVINMRKLAPPKQDDKNSPQRNSSG  225

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KS+SPDSTGFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSG +RSRT
Sbjct  226  KSASPDSTGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGHTRSRT  285

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHS  205
            +SV DSPLATSSN SSE+SVNNN  C DG   E +I S++  RSP  VH+
Sbjct  286  ISVLDSPLATSSNGSSELSVNNNGHCFDGSEVEDDIGSERVGRSPSRVHA  335



>ref|XP_004170203.1| PREDICTED: uncharacterized protein LOC101230836, partial [Cucumis 
sativus]
Length=435

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 145/166 (87%), Gaps = 3/166 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspn-snls  538
            +H SG SVP  A++R+H+KAN N+SPV++G KMVERVINMRKL PP+ D+K S    NLS
Sbjct  266  IHLSGGSVP--AINRMHSKANDNISPVLIGTKMVERVINMRKLVPPKQDDKHSSPHGNLS  323

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
             KSSSPDS+GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGPSRSR
Sbjct  324  GKSSSPDSSGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPSRSR  383

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            T+SVSDSPLATSSNASSE+SVNNN +C+D H  + EI S++G RSP
Sbjct  384  TISVSDSPLATSSNASSEMSVNNNGLCLDTHEIDDEIGSERGGRSP  429



>emb|CDP14035.1| unnamed protein product [Coffea canephora]
Length=576

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H+SGSSVP  A +RLHAKAN NVSPV++G KMVERVINMRKL PP+ D+K SP SNLS 
Sbjct  408  IHSSGSSVP--AGNRLHAKANDNVSPVLIGTKMVERVINMRKLVPPKQDDKHSPLSNLSG  465

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS+GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG ++SRT
Sbjct  466  KSSSPDSSGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGSTKSRT  525

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHS  205
            +SVSDSPLATSSNASSEVSVNNNA+C D    E +++SDK  RSP S+ +
Sbjct  526  LSVSDSPLATSSNASSEVSVNNNALCADAGEIEDDVNSDKVVRSPASMRA  575



>ref|XP_008373857.1| PREDICTED: LOW QUALITY PROTEIN: flocculation protein FLO11-like 
[Malus domestica]
 ref|XP_008362729.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Malus 
domestica]
Length=594

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 146/170 (86%), Gaps = 9/170 (5%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H SGSSVP  A SR H+K N NVSPV+MG KMVERVINMRKLAPP+ ++K SP+ N S K
Sbjct  428  HTSGSSVP--AFSRGHSKVNDNVSPVLMGTKMVERVINMRKLAPPKQEDKHSPHGNHSGK  485

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
            S+SPDS+GFGR+LSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGP+RSRT+
Sbjct  486  SASPDSSGFGRSLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPARSRTI  545

Query  351  SVSDSPLatssnassevsvnnnaVCIDGHGGECEIS---SDKGARSPPSV  211
            SVSDSPLATSSNASSEVSVNNN +C+DG    CEI    S++G RSP SV
Sbjct  546  SVSDSPLATSSNASSEVSVNNNGLCLDG----CEIEDNGSERGGRSPTSV  591



>ref|XP_008362728.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Malus 
domestica]
Length=595

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 146/170 (86%), Gaps = 9/170 (5%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H SGSSVP  A SR H+K N NVSPV+MG KMVERVINMRKLAPP+ ++K SP+ N S K
Sbjct  429  HTSGSSVP--AFSRGHSKVNDNVSPVLMGTKMVERVINMRKLAPPKQEDKHSPHGNHSGK  486

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
            S+SPDS+GFGR+LSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGP+RSRT+
Sbjct  487  SASPDSSGFGRSLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPARSRTI  546

Query  351  SVSDSPLatssnassevsvnnnaVCIDGHGGECEIS---SDKGARSPPSV  211
            SVSDSPLATSSNASSEVSVNNN +C+DG    CEI    S++G RSP SV
Sbjct  547  SVSDSPLATSSNASSEVSVNNNGLCLDG----CEIEDNGSERGGRSPTSV  592



>gb|KHF99477.1| Low-density lipoprotein receptor-related [Gossypium arboreum]
 gb|KHG03855.1| Low-density lipoprotein receptor-related [Gossypium arboreum]
Length=584

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 148/170 (87%), Gaps = 2/170 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            LH SGSSVP  A+SR ++K + NVSPVV+GNKMVERVINMRKL PP+ D+K SP+ NLS 
Sbjct  416  LHVSGSSVP--AISRGYSKVSDNVSPVVIGNKMVERVINMRKLVPPKQDDKHSPHGNLSV  473

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS+GFGRTLSKKSLDMAIRHMDIRR IPGNLRPLMTNIPASSMYSVRSGP+RSR 
Sbjct  474  KSSSPDSSGFGRTLSKKSLDMAIRHMDIRRRIPGNLRPLMTNIPASSMYSVRSGPTRSRN  533

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHS  205
            +SVSDSPLATSSNASSE+SVNNN +C+DG   E +I S+ G RSP S+H+
Sbjct  534  ISVSDSPLATSSNASSELSVNNNGICLDGSEIEDDIGSEIGGRSPASMHA  583



>ref|XP_011016321.1| PREDICTED: zonadhesin-like isoform X2 [Populus euphratica]
Length=563

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 136/165 (82%), Gaps = 3/165 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A SR H+K N NVSPVV+G KMV+RVINMRKLAPP+ D+K SP      
Sbjct  398  MHPSGSSVP--AFSRGHSKINDNVSPVVIGTKMVDRVINMRKLAPPKQDDKHSPRILTGK  455

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             SS    +GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGP+RSRT
Sbjct  456  SSSPDS-SGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPTRSRT  514

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            VSVSDSPLATSSNASSEVSVNNN +C+DG   E +I S +G RSP
Sbjct  515  VSVSDSPLATSSNASSEVSVNNNGLCLDGIELEDDIGSGRGGRSP  559



>ref|XP_011016320.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Populus euphratica]
Length=564

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 136/165 (82%), Gaps = 3/165 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A SR H+K N NVSPVV+G KMV+RVINMRKLAPP+ D+K SP      
Sbjct  399  MHPSGSSVP--AFSRGHSKINDNVSPVVIGTKMVDRVINMRKLAPPKQDDKHSPRILTGK  456

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             SS    +GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGP+RSRT
Sbjct  457  SSSPDS-SGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPTRSRT  515

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            VSVSDSPLATSSNASSEVSVNNN +C+DG   E +I S +G RSP
Sbjct  516  VSVSDSPLATSSNASSEVSVNNNGLCLDGIELEDDIGSGRGGRSP  560



>ref|XP_011044062.1| PREDICTED: LOW QUALITY PROTEIN: nascent polypeptide-associated 
complex subunit alpha, muscle-specific form [Populus euphratica]
Length=560

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 136/165 (82%), Gaps = 3/165 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A SR H+K N NVSPVV+G KMV+RVINMRKLAPP+ D+K SP      
Sbjct  395  MHPSGSSVP--AFSRGHSKINDNVSPVVIGTKMVDRVINMRKLAPPKQDDKHSPRILTGK  452

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             SS    +GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGP+RSRT
Sbjct  453  SSSPDS-SGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPARSRT  511

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            VSVSDSPLATSSNASSEVSVNNN +C+DG   E +I S +G RSP
Sbjct  512  VSVSDSPLATSSNASSEVSVNNNGLCLDGIELEDDIGSGRGGRSP  556



>ref|XP_006435712.1| hypothetical protein CICLE_v10030993mg [Citrus clementina]
 ref|XP_006486333.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Citrus 
sinensis]
 gb|ESR48952.1| hypothetical protein CICLE_v10030993mg [Citrus clementina]
Length=600

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 147/169 (87%), Gaps = 3/169 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A SR ++K N NVSPVV+G KMVERVINMRKLAPP+ D+K SP+SNL+ 
Sbjct  433  MHLSGSSVP--AFSRGYSKVNDNVSPVVIGTKMVERVINMRKLAPPKQDDKHSPHSNLTG  490

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            K+SSPDS GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGP RSRT
Sbjct  491  KTSSPDSLGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGP-RSRT  549

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            VSVSDSPLATSSNASSE+SVNNN +C+DG   E +I S++G RSP SV 
Sbjct  550  VSVSDSPLATSSNASSELSVNNNGLCMDGCDIEDDIGSERGGRSPASVR  598



>ref|XP_006435713.1| hypothetical protein CICLE_v10030993mg [Citrus clementina]
 ref|XP_006486332.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Citrus 
sinensis]
 gb|ESR48953.1| hypothetical protein CICLE_v10030993mg [Citrus clementina]
Length=609

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 147/169 (87%), Gaps = 3/169 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A SR ++K N NVSPVV+G KMVERVINMRKLAPP+ D+K SP+SNL+ 
Sbjct  442  MHLSGSSVP--AFSRGYSKVNDNVSPVVIGTKMVERVINMRKLAPPKQDDKHSPHSNLTG  499

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            K+SSPDS GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGP RSRT
Sbjct  500  KTSSPDSLGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGP-RSRT  558

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            VSVSDSPLATSSNASSE+SVNNN +C+DG   E +I S++G RSP SV 
Sbjct  559  VSVSDSPLATSSNASSELSVNNNGLCMDGCDIEDDIGSERGGRSPASVR  607



>ref|XP_008441457.1| PREDICTED: zonadhesin isoform X2 [Cucumis melo]
Length=514

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 145/166 (87%), Gaps = 3/166 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspns-nls  538
            +H SG SVP  A++R+H+KAN N+SPV++G KMVERVINMRKL PP+ D+K S    NLS
Sbjct  345  MHLSGGSVP--AINRMHSKANDNISPVLIGTKMVERVINMRKLVPPKQDDKHSSPHGNLS  402

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
             KSSSPDS+GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGPSRSR
Sbjct  403  GKSSSPDSSGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPSRSR  462

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            TVSVSDSPLATSSNASSE+SVNNN +C+D H  + EI S++G RSP
Sbjct  463  TVSVSDSPLATSSNASSEMSVNNNGLCLDTHEIDDEIGSERGGRSP  508



>ref|XP_008441454.1| PREDICTED: probable serine/threonine-protein kinase nek3 isoform 
X1 [Cucumis melo]
 ref|XP_008441455.1| PREDICTED: probable serine/threonine-protein kinase nek3 isoform 
X1 [Cucumis melo]
 ref|XP_008441456.1| PREDICTED: probable serine/threonine-protein kinase nek3 isoform 
X1 [Cucumis melo]
Length=577

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 145/166 (87%), Gaps = 3/166 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspn-snls  538
            +H SG SVP  A++R+H+KAN N+SPV++G KMVERVINMRKL PP+ D+K S    NLS
Sbjct  408  MHLSGGSVP--AINRMHSKANDNISPVLIGTKMVERVINMRKLVPPKQDDKHSSPHGNLS  465

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
             KSSSPDS+GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGPSRSR
Sbjct  466  GKSSSPDSSGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPSRSR  525

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            TVSVSDSPLATSSNASSE+SVNNN +C+D H  + EI S++G RSP
Sbjct  526  TVSVSDSPLATSSNASSEMSVNNNGLCLDTHEIDDEIGSERGGRSP  571



>ref|XP_009344718.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=588

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 141/172 (82%), Gaps = 10/172 (6%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRL-Dnksspnsnlsa  535
            H SGSSVP  A SR H+K N NVSPV+MG KMVERVINMRKLAPP+  D  S   ++   
Sbjct  421  HTSGSSVP--AFSRGHSKVNENVSPVLMGTKMVERVINMRKLAPPKQEDKHSPLGNHSGK  478

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             +SSPDS+GFGR+LSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGP+RSRT
Sbjct  479  SASSPDSSGFGRSLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPARSRT  538

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEIS---SDKGARSPPSVH  208
            +SVSDSPLATSSNASSEVSVNNN +C+DG    CEI    S++G RSP SV 
Sbjct  539  ISVSDSPLATSSNASSEVSVNNNGLCLDG----CEIEDNGSERGGRSPASVR  586



>gb|KJB76174.1| hypothetical protein B456_012G076400 [Gossypium raimondii]
 gb|KJB76176.1| hypothetical protein B456_012G076400 [Gossypium raimondii]
 gb|KJB76180.1| hypothetical protein B456_012G076400 [Gossypium raimondii]
Length=472

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 143/170 (84%), Gaps = 2/170 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            LH SG SVP  A+SR ++KA+ NVSPVV+G KMVERVINMRKLAPP+ D+K+SP  N S 
Sbjct  304  LHLSGGSVP--AVSRGYSKASDNVSPVVIGTKMVERVINMRKLAPPKQDDKNSPQRNSSG  361

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KS+SPDSTGFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSG +RSRT
Sbjct  362  KSASPDSTGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGHTRSRT  421

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHS  205
            +SV DSPLATSSN SSE+SVNNN  C DG   E +I S++  RSP  VH+
Sbjct  422  ISVLDSPLATSSNGSSELSVNNNGHCFDGSEVEDDIGSERVGRSPSRVHA  471



>ref|XP_009344713.1| PREDICTED: mucin-5AC-like isoform X1 [Pyrus x bretschneideri]
Length=589

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 141/172 (82%), Gaps = 10/172 (6%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRL-Dnksspnsnlsa  535
            H SGSSVP  A SR H+K N NVSPV+MG KMVERVINMRKLAPP+  D  S   ++   
Sbjct  422  HTSGSSVP--AFSRGHSKVNENVSPVLMGTKMVERVINMRKLAPPKQEDKHSPLGNHSGK  479

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             +SSPDS+GFGR+LSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGP+RSRT
Sbjct  480  SASSPDSSGFGRSLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPARSRT  539

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEIS---SDKGARSPPSVH  208
            +SVSDSPLATSSNASSEVSVNNN +C+DG    CEI    S++G RSP SV 
Sbjct  540  ISVSDSPLATSSNASSEVSVNNNGLCLDG----CEIEDNGSERGGRSPASVR  587



>ref|XP_004138425.1| PREDICTED: uncharacterized protein LOC101204600 [Cucumis sativus]
Length=575

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 145/166 (87%), Gaps = 3/166 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspn-snls  538
            +H SG SVP  A++R+H+KAN N+SPV++G KMVERVINMRKL PP+ D+K S    NLS
Sbjct  406  IHLSGGSVP--AINRMHSKANDNISPVLIGTKMVERVINMRKLVPPKQDDKHSSPHGNLS  463

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
             KSSSPDS+GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGPSRSR
Sbjct  464  GKSSSPDSSGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPSRSR  523

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            T+SVSDSPLATSSNASSE+SVNNN +C+D H  + EI S++G RSP
Sbjct  524  TISVSDSPLATSSNASSEMSVNNNGLCLDTHEIDDEIGSERGGRSP  569



>gb|KGN45784.1| hypothetical protein Csa_6G011590 [Cucumis sativus]
Length=576

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 145/166 (87%), Gaps = 3/166 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspn-snls  538
            +H SG SVP  A++R+H+KAN N+SPV++G KMVERVINMRKL PP+ D+K S    NLS
Sbjct  407  IHLSGGSVP--AINRMHSKANDNISPVLIGTKMVERVINMRKLVPPKQDDKHSSPHGNLS  464

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
             KSSSPDS+GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGPSRSR
Sbjct  465  GKSSSPDSSGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPSRSR  524

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            T+SVSDSPLATSSNASSE+SVNNN +C+D H  + EI S++G RSP
Sbjct  525  TISVSDSPLATSSNASSEMSVNNNGLCLDTHEIDDEIGSERGGRSP  570



>gb|KJB76177.1| hypothetical protein B456_012G076400 [Gossypium raimondii]
Length=478

 Score =   183 bits (465),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 143/170 (84%), Gaps = 2/170 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            LH SG SVP  A+SR ++KA+ NVSPVV+G KMVERVINMRKLAPP+ D+K+SP  N S 
Sbjct  310  LHLSGGSVP--AVSRGYSKASDNVSPVVIGTKMVERVINMRKLAPPKQDDKNSPQRNSSG  367

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KS+SPDSTGFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSG +RSRT
Sbjct  368  KSASPDSTGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGHTRSRT  427

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHS  205
            +SV DSPLATSSN SSE+SVNNN  C DG   E +I S++  RSP  VH+
Sbjct  428  ISVLDSPLATSSNGSSELSVNNNGHCFDGSEVEDDIGSERVGRSPSRVHA  477



>gb|KJB76179.1| hypothetical protein B456_012G076400 [Gossypium raimondii]
Length=560

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 143/170 (84%), Gaps = 2/170 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            LH SG SVP  A+SR ++KA+ NVSPVV+G KMVERVINMRKLAPP+ D+K+SP  N S 
Sbjct  392  LHLSGGSVP--AVSRGYSKASDNVSPVVIGTKMVERVINMRKLAPPKQDDKNSPQRNSSG  449

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KS+SPDSTGFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSG +RSRT
Sbjct  450  KSASPDSTGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGHTRSRT  509

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHS  205
            +SV DSPLATSSN SSE+SVNNN  C DG   E +I S++  RSP  VH+
Sbjct  510  ISVLDSPLATSSNGSSELSVNNNGHCFDGSEVEDDIGSERVGRSPSRVHA  559



>gb|KJB76173.1| hypothetical protein B456_012G076400 [Gossypium raimondii]
Length=573

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 143/170 (84%), Gaps = 2/170 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            LH SG SVP  A+SR ++KA+ NVSPVV+G KMVERVINMRKLAPP+ D+K+SP  N S 
Sbjct  405  LHLSGGSVP--AVSRGYSKASDNVSPVVIGTKMVERVINMRKLAPPKQDDKNSPQRNSSG  462

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KS+SPDSTGFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSG +RSRT
Sbjct  463  KSASPDSTGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGHTRSRT  522

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHS  205
            +SV DSPLATSSN SSE+SVNNN  C DG   E +I S++  RSP  VH+
Sbjct  523  ISVLDSPLATSSNGSSELSVNNNGHCFDGSEVEDDIGSERVGRSPSRVHA  572



>gb|KDP44785.1| hypothetical protein JCGZ_01285 [Jatropha curcas]
Length=547

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 144/165 (87%), Gaps = 3/165 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A++R  AK N NVSPV++G KMVERVINMRKLAPP+ D+K SP  NLS 
Sbjct  382  MHTSGSSVP--AINRARAKVNDNVSPVLIGTKMVERVINMRKLAPPKQDDKLSPLGNLSG  439

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS+GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSG +RSRT
Sbjct  440  KSSSPDSSGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGSARSRT  499

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            VSVSDSPLATSSNASSEVSVNNN +C+DG   E E+ S++G RSP
Sbjct  500  VSVSDSPLATSSNASSEVSVNNNGLCLDGIELE-EVGSERGGRSP  543



>gb|KHG16426.1| hypothetical protein F383_23799 [Gossypium arboreum]
Length=574

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 143/170 (84%), Gaps = 2/170 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            LH SG SVP  A+SR ++KA+ NVSPVV+G KMVERVINMRKLAPP+ D+K+SP  N S 
Sbjct  406  LHLSGGSVP--AVSRGYSKASDNVSPVVIGTKMVERVINMRKLAPPKQDDKNSPQGNSSG  463

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KS+SPDS+GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSG +RSRT
Sbjct  464  KSASPDSSGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGHTRSRT  523

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHS  205
            +SV DSPLATSSN SSE+SVNNN  C DG   E +I S++  RSP  VH+
Sbjct  524  ISVLDSPLATSSNGSSELSVNNNGHCFDGSEVEDDIGSERVGRSPSRVHA  573



>ref|XP_010067518.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Eucalyptus 
grandis]
 gb|KCW65668.1| hypothetical protein EUGRSUZ_G03055 [Eucalyptus grandis]
Length=557

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 142/166 (86%), Gaps = 3/166 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnk-sspnsnls  538
            LH SG SVP  A+SR H K N NVSPV++G KMVERV+NMR+LAPP+ D++ S  ++   
Sbjct  388  LHTSGGSVP--AVSRGHPKINDNVSPVLIGTKMVERVMNMRRLAPPKQDDRHSPRSNMSG  445

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
              +SSPDS+GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGP+RSR
Sbjct  446  RSASSPDSSGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPTRSR  505

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            TVSVSDSPLATSSNASSEVSVNNN +C++G+G + +I+SD+   SP
Sbjct  506  TVSVSDSPLATSSNASSEVSVNNNGLCVEGNGLDDDITSDRDGHSP  551



>ref|XP_008369241.1| PREDICTED: flocculation protein FLO11-like [Malus domestica]
Length=575

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 140/169 (83%), Gaps = 4/169 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRL-Dnksspnsnlsa  535
            H SGSSVP  A SR H+K N NVSPV+MG KMVERVINMRKLAPP+  D  S   ++   
Sbjct  408  HASGSSVP--AFSRGHSKVNDNVSPVLMGTKMVERVINMRKLAPPKQEDKHSPHGNHSGK  465

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             +SSPDS+GFGR+LSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGP+RSRT
Sbjct  466  SASSPDSSGFGRSLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPARSRT  525

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            +SVSDSPLATSSNASSEVSVNNN +C+DG   E +  S++G RSP SV 
Sbjct  526  ISVSDSPLATSSNASSEVSVNNNGLCLDGSEVE-DNGSERGGRSPASVR  573



>ref|XP_007009023.1| Uncharacterized protein TCM_042539 [Theobroma cacao]
 gb|EOY17833.1| Uncharacterized protein TCM_042539 [Theobroma cacao]
Length=591

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 147/170 (86%), Gaps = 2/170 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            LH SGSSVP  A+SR ++K + N+SPVV+G KMVERVINMRKLAPP+ D+K SP+ NLS 
Sbjct  423  LHVSGSSVP--AVSRGYSKVSDNLSPVVIGTKMVERVINMRKLAPPKQDDKHSPHGNLSG  480

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS+GFGRTLSKKSLDMAIRHMDIRR+IP NLRPLM NIPASSMYSVRSGP+R RT
Sbjct  481  KSSSPDSSGFGRTLSKKSLDMAIRHMDIRRSIPNNLRPLMMNIPASSMYSVRSGPTRGRT  540

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHS  205
            +SVSDSPLATSSNASSE+SVNNN +C+DG   E +I S++G  SP SVH+
Sbjct  541  ISVSDSPLATSSNASSELSVNNNGICLDGIEVEDDIGSERGGPSPASVHA  590



>gb|KJB74298.1| hypothetical protein B456_011G285700 [Gossypium raimondii]
Length=583

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 146/170 (86%), Gaps = 2/170 (1%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            LH SG SVP  A+SR ++K + NVSPVV+GNKMVERVINMRKL PP+ D+K SP+ NLS 
Sbjct  415  LHVSGCSVP--AISRGYSKVSDNVSPVVIGNKMVERVINMRKLVPPKQDDKHSPHGNLSV  472

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS+GFGRTLSKKSLDMAIRHMDIRR IP NLRPLMTNIPASSMYSVRSGP+RSR 
Sbjct  473  KSSSPDSSGFGRTLSKKSLDMAIRHMDIRRRIPCNLRPLMTNIPASSMYSVRSGPTRSRN  532

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHS  205
            +SVSDSPLATSSNASSE+SVNNN +C+DG   E +I S+ G RSP S+H+
Sbjct  533  ISVSDSPLATSSNASSELSVNNNGICLDGSEIEDDIGSEIGGRSPASMHA  582



>ref|XP_009369152.1| PREDICTED: proteoglycan 4-like [Pyrus x bretschneideri]
Length=569

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 140/168 (83%), Gaps = 4/168 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRL-Dnksspnsnlsa  535
            H SGSSVP  A SR H+K N NVSPV+MG KMVER+INMRKLAPP+  D  S   ++   
Sbjct  402  HTSGSSVP--AFSRGHSKVNDNVSPVLMGTKMVERLINMRKLAPPKQEDKHSPHGNHSGK  459

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             +SSPDS+GFGR+LSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGP+RSRT
Sbjct  460  SASSPDSSGFGRSLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPARSRT  519

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSV  211
            +SVSDSPLATSSNASSEVSVNNN +C+DG   E +  S++G RSP SV
Sbjct  520  ISVSDSPLATSSNASSEVSVNNNGLCLDGSEVE-DNGSERGGRSPASV  566



>ref|XP_010095095.1| hypothetical protein L484_026404 [Morus notabilis]
 gb|EXB58201.1| hypothetical protein L484_026404 [Morus notabilis]
Length=578

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 140/168 (83%), Gaps = 3/168 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A SR   K N NVSP ++G KMVERVINMRKLAPP+ D+K SP  +LSA
Sbjct  411  VHPSGSSVP--AGSRNQYKINDNVSPALIGTKMVERVINMRKLAPPKQDDKHSPYGHLSA  468

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSS    +GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVR+G +RSR 
Sbjct  469  KSSPES-SGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRAGSARSRA  527

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSV  211
            +SVSDSPLATSSNASSEVSVNNN +C+DG   E +I S++G RSPPSV
Sbjct  528  ISVSDSPLATSSNASSEVSVNNNGLCLDGSELEDDIGSERGGRSPPSV  575



>ref|XP_004307632.1| PREDICTED: flocculation protein FLO11 isoform X3 [Fragaria vesca 
subsp. vesca]
Length=566

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 142/168 (85%), Gaps = 2/168 (1%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H SGSSVP  A SR  +K N NVSPV+MG KMVERVINMRKLAPP+ D+K SP+ N    
Sbjct  399  HISGSSVP--AFSRGRSKVNDNVSPVLMGTKMVERVINMRKLAPPKHDDKQSPHGNSGKS  456

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
            SSSPDS+GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGP+RSRTV
Sbjct  457  SSSPDSSGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPARSRTV  516

Query  351  SVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            SVSDSPLATSSNASSEVSVNNN +C+D  G E +I S++G RSP  V 
Sbjct  517  SVSDSPLATSSNASSEVSVNNNGLCLDVSGVEDDIGSERGGRSPAGVQ  564



>ref|XP_002312151.1| hypothetical protein POPTR_0008s06680g [Populus trichocarpa]
 gb|EEE89518.1| hypothetical protein POPTR_0008s06680g [Populus trichocarpa]
Length=565

 Score =   179 bits (455),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 134/165 (81%), Gaps = 3/165 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A SR  +K N NVSPVV+G KMV+RVINMRKLAPP+ D+K SP      
Sbjct  400  MHPSGSSVP--AFSRGRSKINDNVSPVVIGTKMVDRVINMRKLAPPKQDDKHSPRFLTGK  457

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             SS    +GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +RSRT
Sbjct  458  SSSPDS-SGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRSRT  516

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSP  220
            VSVSDSPLATSSNASSEVSVNNN +C+DG   E +I S +G RSP
Sbjct  517  VSVSDSPLATSSNASSEVSVNNNGLCLDGIELEDDIGSGRGGRSP  561



>ref|XP_011469903.1| PREDICTED: flocculation protein FLO11 isoform X1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011469904.1| PREDICTED: flocculation protein FLO11 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=566

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 143/168 (85%), Gaps = 2/168 (1%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H SGSSVP  A SR  +K N NVSPV+MG KMVERVINMR+LAPP+ D+K SP+ N    
Sbjct  399  HISGSSVP--AFSRGRSKVNDNVSPVLMGTKMVERVINMRRLAPPKHDDKPSPHGNSGKS  456

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
            SSSPDS+GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGP+RSRTV
Sbjct  457  SSSPDSSGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPARSRTV  516

Query  351  SVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            SVSDSPLATSSNASSEVSVNNN +C+D  G E +I S++G +SP SV 
Sbjct  517  SVSDSPLATSSNASSEVSVNNNGLCLDVSGVEDDIGSERGGQSPASVQ  564



>ref|XP_002274030.1| PREDICTED: mucin-17 [Vitis vinifera]
 emb|CBI25498.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 139/168 (83%), Gaps = 3/168 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRL-Dnksspnsnls  538
            +H SGSSVP  A+SR  +K + NVSPV++G KMVERVINMRKL PP+  D  S   +   
Sbjct  375  IHTSGSSVP--AVSRGLSKVSDNVSPVLIGTKMVERVINMRKLVPPKQEDKHSPRGNLSG  432

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
              +SSPDS+GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGP+RSR
Sbjct  433  KLASSPDSSGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPTRSR  492

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPS  214
            TVSVSDSPLATSSNASSEVSVNNNA+C+DG   E +I S++G R  P+
Sbjct  493  TVSVSDSPLATSSNASSEVSVNNNALCVDGGEIEDDIGSERGGRPSPA  540



>ref|XP_010256565.1| PREDICTED: mucin-5AC-like [Nelumbo nucifera]
Length=569

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 139/174 (80%), Gaps = 10/174 (6%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H+SGSSVP  A+SR H+  + NVSPV++G KMVERVINMRKLAP RLD++SS ++  S 
Sbjct  399  IHSSGSSVP--AVSRSHSNGSDNVSPVLIGTKMVERVINMRKLAPSRLDDRSSNSAGKST  456

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             S     +GFGRTLSKKSLDMA+RHMDIRR+IPG+LRPLMTNIPASSMYSVRSGP+RSRT
Sbjct  457  SSPDS--SGFGRTLSKKSLDMALRHMDIRRSIPGSLRPLMTNIPASSMYSVRSGPARSRT  514

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHG-GECEISSDKGAR----SPPSVH  208
            VSVSDSPL  +S+ +S  SVNNNA+C+DG   G+ ++ S++G R    SP S H
Sbjct  515  VSVSDSPL-ATSSNASSESVNNNALCLDGSDIGDDDLGSERGERGGRSSPASQH  567



>ref|XP_009133405.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Brassica 
rapa]
Length=609

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 142/170 (84%), Gaps = 3/170 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A++R +++AN NVSPV+MG KMVERV+NMRKLAPPR D+KSSP  NLSA
Sbjct  440  MHASGSSVP--AVNRGYSRANDNVSPVLMGTKMVERVVNMRKLAPPRSDDKSSPQGNLSA  497

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R 
Sbjct  498  KSSSPDSAGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGRP  557

Query  354  VSVSDSPLatssnasse-vsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ++VSDSPLATSSNASSE    NNN VC++    E +  S++G RSP S+ 
Sbjct  558  MNVSDSPLATSSNASSEISVYNNNGVCLEASEKEDDAGSERGCRSPSSLQ  607



>emb|CDY60338.1| BnaC03g72310D [Brassica napus]
Length=610

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 142/170 (84%), Gaps = 3/170 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A++R +++AN NVSPV+MG KMVERV+NMRKLAPPR D+KSSP  NLSA
Sbjct  441  MHASGSSVP--AVNRGYSRANDNVSPVLMGTKMVERVVNMRKLAPPRSDDKSSPQGNLSA  498

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R 
Sbjct  499  KSSSPDSAGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGRP  558

Query  354  VSVSDSPLatssnasse-vsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ++VSDSPLATSSNASSE    NNN VC++    E +  S++G RSP S+ 
Sbjct  559  MNVSDSPLATSSNASSEISVYNNNGVCLEASEKEDDAGSERGCRSPSSLQ  608



>emb|CDY07628.1| BnaA03g18830D [Brassica napus]
Length=609

 Score =   174 bits (442),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 142/170 (84%), Gaps = 3/170 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A++R +++AN NVSPV+MG KMVERV+NMRKLAPPR D+KSSP  NLSA
Sbjct  440  MHASGSSVP--AVNRGYSRANDNVSPVLMGTKMVERVVNMRKLAPPRSDDKSSPQGNLSA  497

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R 
Sbjct  498  KSSSPDSAGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGRP  557

Query  354  VSVSDSPLatssnasse-vsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ++VSDSPLATSSNASSE    NNN VC++    E +  S++G RSP S+ 
Sbjct  558  MNVSDSPLATSSNASSEISVYNNNGVCLEASEKEDDAGSERGCRSPSSLQ  607



>ref|XP_010534575.1| PREDICTED: mucin-17-like [Tarenaya hassleriana]
Length=586

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 118/128 (92%), Gaps = 2/128 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A+SR ++KAN NVSPVV+G KMV+RVINMRKL PPRLDN SSP+SN+S 
Sbjct  421  MHPSGSSVP--AVSRGYSKANDNVSPVVIGTKMVDRVINMRKLGPPRLDNGSSPHSNMSG  478

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS+GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG SR+RT
Sbjct  479  KSSSPDSSGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGDSRTRT  538

Query  354  VSVSDSPL  331
            VSVSDSPL
Sbjct  539  VSVSDSPL  546



>ref|XP_006367372.1| PREDICTED: uncharacterized protein LOC102588142 [Solanum tuberosum]
Length=175

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 139/161 (86%), Gaps = 4/161 (2%)
 Frame = -2

Query  678  MSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGR  499
            MSRLHAKA  NVSP ++G KMVERVINMRKL PP+ D+K SP+SNLSAKSSSPDS+GFGR
Sbjct  13   MSRLHAKAKDNVSPGMVGTKMVERVINMRKLVPPKQDDKHSPHSNLSAKSSSPDSSGFGR  72

Query  498  TLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGP----SRSRTVSVSDSPL  331
            +LSKKSLDMAIRHMDIR+ +PGNLRPLMTNIPASSMYSVRSGP      SR++++ DSPL
Sbjct  73   SLSKKSLDMAIRHMDIRQRVPGNLRPLMTNIPASSMYSVRSGPPTRGRTSRSINMPDSPL  132

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ATSSNASSEVSV+NN V +DG   + +ISSDKGARSP SVH
Sbjct  133  ATSSNASSEVSVSNNVVWVDGSEIDEDISSDKGARSPASVH  173



>emb|CDY20509.1| BnaC04g05350D [Brassica napus]
Length=601

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 141/169 (83%), Gaps = 4/169 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A++R ++KAN NVSPV+MG KMVERVINMRKLAPPR D K SP+ NLSA
Sbjct  430  MHASGSSVP--AVNRGYSKANDNVSPVLMGAKMVERVINMRKLAPPRSDEKGSPHGNLSA  487

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R 
Sbjct  488  KSSSPDSAGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGRP  547

Query  354  VSVSDSPLatssnasse-vsvnnnaVCIDGHG-GECEISSDKGARSPPS  214
            ++VSDSPLATSSNASSE    NNN VC++     E +  S++G RSPP+
Sbjct  548  MNVSDSPLATSSNASSEISVYNNNGVCLEAASEKEDDAGSERGCRSPPA  596



>ref|XP_007218953.1| hypothetical protein PRUPE_ppa003504mg [Prunus persica]
 gb|EMJ20152.1| hypothetical protein PRUPE_ppa003504mg [Prunus persica]
Length=569

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 140/169 (83%), Gaps = 4/169 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRL-Dnksspnsnlsa  535
            H SGSSVP  A SR H+K N NVSPV++G KMVERVINMRKLAPP+  D  S   ++   
Sbjct  402  HTSGSSVP--AFSRGHSKVNDNVSPVLIGTKMVERVINMRKLAPPKQEDKHSPHGNHSGK  459

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             SSSPDS+GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGP+RSRT
Sbjct  460  SSSSPDSSGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPARSRT  519

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            VSVSDSPLATSSNASSEVSVNNN +C+DG   E +  S++G RSP SV 
Sbjct  520  VSVSDSPLATSSNASSEVSVNNNGICLDGSEVE-DNGSERGGRSPASVR  567



>ref|XP_008233740.1| PREDICTED: flocculation protein FLO11 [Prunus mume]
Length=569

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 140/169 (83%), Gaps = 4/169 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRL-Dnksspnsnlsa  535
            H SGSSVP  A SR H+K N NVSPV++G KMVERVINMRKLAPP+  D  S   ++   
Sbjct  402  HTSGSSVP--AFSRGHSKVNDNVSPVLIGTKMVERVINMRKLAPPKQEDKHSPHGNHSGK  459

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             SSSPDS+GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRSGP+RSRT
Sbjct  460  SSSSPDSSGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGPARSRT  519

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            VSVSDSPLATSSNASSEVSVNNN +C+DG   E +  S++G RSP SV 
Sbjct  520  VSVSDSPLATSSNASSEVSVNNNGICLDGSEVE-DNGSERGGRSPASVR  567



>ref|XP_006411252.1| hypothetical protein EUTSA_v10016404mg [Eutrema salsugineum]
 gb|ESQ52705.1| hypothetical protein EUTSA_v10016404mg [Eutrema salsugineum]
Length=603

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 141/170 (83%), Gaps = 3/170 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            ++ SGSSVP  A++R ++KAN NVSPV+MG KMVERVINMRKLAPPR D+K SP+ NLSA
Sbjct  434  MYTSGSSVP--AVNRGYSKANDNVSPVLMGTKMVERVINMRKLAPPRPDDKGSPHGNLSA  491

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS GFGR+LSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R 
Sbjct  492  KSSSPDSAGFGRSLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGRP  551

Query  354  VSVSDSPLatssnasse-vsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ++V+DSPLATSSNASSE    NNN  C++    E +  S++G RSP S+ 
Sbjct  552  MNVADSPLATSSNASSEISVYNNNGNCLEASEKEDDAGSERGCRSPASLQ  601



>dbj|BAN18479.1| proteophosphoglycan, partial [Schiedea laui]
 dbj|BAN18480.1| proteophosphoglycan, partial [Schiedea pentandra]
 dbj|BAN18481.1| proteophosphoglycan, partial [Schiedea kauaiensis]
 dbj|BAN18482.1| proteophosphoglycan, partial [Schiedea perlmanii]
 dbj|BAN18483.1| proteophosphoglycan, partial [Schiedea stellarioides]
 dbj|BAN18484.1| proteophosphoglycan, partial [Schiedea nuttallii]
 dbj|BAN18485.1| proteophosphoglycan, partial [Schiedea helleri]
 dbj|BAN18486.1| proteophosphoglycan, partial [Schiedea membranacea]
Length=190

 Score =   162 bits (410),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 124/148 (84%), Gaps = 5/148 (3%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H+SGSSVP  AMSR H+K N +VSPVVMGNKMVERV++MRKLAPPR D+K SP+ +  + 
Sbjct  47   HSSGSSVP--AMSRAHSKVNDDVSPVVMGNKMVERVVHMRKLAPPRQDDKHSPSLSGKSA  104

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
            SS     GFGRTLSKKSLDMAIRHM IR++IPGNLRPLMT IPASSMYSVRSGP+ SRT 
Sbjct  105  SSP---EGFGRTLSKKSLDMAIRHMGIRQSIPGNLRPLMTKIPASSMYSVRSGPTVSRTA  161

Query  351  SVSDSPLatssnassevsvnnnaVCIDG  268
            SVSDSP+ATSSNASSE+S NN+   +DG
Sbjct  162  SVSDSPIATSSNASSELSFNNHHGTLDG  189



>dbj|BAN18468.1| proteophosphoglycan, partial [Schiedea kealiae]
 dbj|BAN18469.1| proteophosphoglycan, partial [Schiedea spergulina]
 dbj|BAN18470.1| proteophosphoglycan, partial [Schiedea mannii]
 dbj|BAN18472.1| proteophosphoglycan, partial [Schiedea menziesii]
 dbj|BAN18473.1| proteophosphoglycan, partial [Schiedea hookeri]
 dbj|BAN18474.1| proteophosphoglycan, partial [Schiedea sarmentosa]
 dbj|BAN18475.1| proteophosphoglycan, partial [Schiedea lydgatei]
 dbj|BAN18476.1| proteophosphoglycan, partial [Schiedea ligustrina]
 dbj|BAN18477.1| proteophosphoglycan, partial [Schiedea salicaria]
 dbj|BAN18478.1| proteophosphoglycan, partial [Schiedea globosa]
Length=190

 Score =   162 bits (410),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 124/148 (84%), Gaps = 5/148 (3%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H+SGSSVP  AMSR H+K N +VSPVVMGNKMVERV++MRKLAPPR D+K SP+ +  + 
Sbjct  47   HSSGSSVP--AMSRAHSKVNDDVSPVVMGNKMVERVVHMRKLAPPRQDDKHSPSLSGKSA  104

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
            SS     GFGRTLSKKSLDMAIRHM IR++IPGNLRPLMT IPASSMYSVRSGP+ SRT 
Sbjct  105  SSP---EGFGRTLSKKSLDMAIRHMGIRQSIPGNLRPLMTKIPASSMYSVRSGPTVSRTA  161

Query  351  SVSDSPLatssnassevsvnnnaVCIDG  268
            SVSDSP+ATSSNASSE+S NN+   +DG
Sbjct  162  SVSDSPIATSSNASSELSFNNHHGTLDG  189



>ref|XP_010535052.1| PREDICTED: mucin-17 [Tarenaya hassleriana]
Length=581

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 148/171 (87%), Gaps = 4/171 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H SGSSVP  A++R ++K N NVSPV++G KMV+RVINMRKLAPPR DN SSP+SNLSA
Sbjct  411  MHPSGSSVP--AVNRGYSKVNDNVSPVLIGAKMVDRVINMRKLAPPRSDNNSSPHSNLSA  468

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRS--GPSRS  361
            KSSSPDS+GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMTNIPASSMYSVRS  G  R+
Sbjct  469  KSSSPDSSGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTNIPASSMYSVRSGHGHGRN  528

Query  360  RTVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            RT SVSDSPLATSSNASSE+SVNNN +C++    E +++S++G RSP S+ 
Sbjct  529  RTASVSDSPLATSSNASSEISVNNNGLCLEVSEREDDVASERGCRSPASLQ  579



>dbj|BAN18471.1| proteophosphoglycan, partial [Schiedea adamantis]
Length=190

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 124/148 (84%), Gaps = 5/148 (3%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H+SG+SVP  AMSR H+K N +VSPVVMGNKMVERV++MRKLAPPR D+K SP+ +  + 
Sbjct  47   HSSGTSVP--AMSRAHSKVNDDVSPVVMGNKMVERVVHMRKLAPPRQDDKHSPSLSGKSA  104

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
            SS     GFGRTLSKKSLDMAIRHM IR++IPGNLRPLMT IPASSMYSVRSGP+ SRT 
Sbjct  105  SSP---EGFGRTLSKKSLDMAIRHMGIRQSIPGNLRPLMTKIPASSMYSVRSGPTVSRTA  161

Query  351  SVSDSPLatssnassevsvnnnaVCIDG  268
            SVSDSP+ATSSNASSE+S NN+   +DG
Sbjct  162  SVSDSPIATSSNASSELSFNNHHGTLDG  189



>ref|XP_010689824.1| PREDICTED: cell wall protein RBR3 [Beta vulgaris subsp. vulgaris]
Length=612

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 133/172 (77%), Gaps = 11/172 (6%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H+SGSSVP  A+SR H+K N +VSPVV+G KMVERVINMRKL PPR D+K SP+ +  +
Sbjct  448  IHSSGSSVP--AVSRGHSKVNDDVSPVVIGTKMVERVINMRKLGPPRQDDKHSPSLSGKS  505

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             SS    +GFGRTLSKKSLDMAIRHMDIRR+IPGNLRPLMT IPASSMYSVRSGP+ SRT
Sbjct  506  ASSPDS-SGFGRTLSKKSLDMAIRHMDIRRSIPGNLRPLMTKIPASSMYSVRSGPTGSRT  564

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECE--ISSDKGAR-SPPSVH  208
             SVSDSPLATSS +S     N+      GHG E E  ++S++G + SP +VH
Sbjct  565  ASVSDSPLATSSASSEHSVNNHA-----GHGSELEDDLASERGCQASPTAVH  611



>ref|XP_010262832.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like isoform X3 [Nelumbo nucifera]
Length=518

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 138/168 (82%), Gaps = 6/168 (4%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H+SGSSVP  AMSR H+    N+SPV++G KMVERVINMRKLAPPR D++S+ N    +
Sbjct  352  IHSSGSSVP--AMSRSHSNGGDNISPVLIGTKMVERVINMRKLAPPRQDDRSTHNLGGKS  409

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             SS    +GFGRTLSKKSLDMA+RHMDIRR+IPG+LRPLMTNIPASSMYSVRSGP+R+  
Sbjct  410  TSSPDS-SGFGRTLSKKSLDMALRHMDIRRSIPGSLRPLMTNIPASSMYSVRSGPARA--  466

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHG-GECEISSDKGARSPPS  214
            VSVSDSPLATSSNASSE SVNNNA+C+DG   G+ ++ S++G  SP S
Sbjct  467  VSVSDSPLATSSNASSEQSVNNNALCLDGSDIGDDDLGSERGRSSPAS  514



>ref|XP_010262830.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like isoform X1 [Nelumbo nucifera]
Length=546

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 138/168 (82%), Gaps = 6/168 (4%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H+SGSSVP  AMSR H+    N+SPV++G KMVERVINMRKLAPPR D++S+ N    +
Sbjct  380  IHSSGSSVP--AMSRSHSNGGDNISPVLIGTKMVERVINMRKLAPPRQDDRSTHNLGGKS  437

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             SS    +GFGRTLSKKSLDMA+RHMDIRR+IPG+LRPLMTNIPASSMYSVRSGP+R+  
Sbjct  438  TSSPDS-SGFGRTLSKKSLDMALRHMDIRRSIPGSLRPLMTNIPASSMYSVRSGPARA--  494

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHG-GECEISSDKGARSPPS  214
            VSVSDSPLATSSNASSE SVNNNA+C+DG   G+ ++ S++G  SP S
Sbjct  495  VSVSDSPLATSSNASSEQSVNNNALCLDGSDIGDDDLGSERGRSSPAS  542



>ref|XP_010262831.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like isoform X2 [Nelumbo nucifera]
Length=535

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 138/168 (82%), Gaps = 6/168 (4%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H+SGSSVP  AMSR H+    N+SPV++G KMVERVINMRKLAPPR D++S+ N    +
Sbjct  369  IHSSGSSVP--AMSRSHSNGGDNISPVLIGTKMVERVINMRKLAPPRQDDRSTHNLGGKS  426

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             SS    +GFGRTLSKKSLDMA+RHMDIRR+IPG+LRPLMTNIPASSMYSVRSGP+R+  
Sbjct  427  TSSPDS-SGFGRTLSKKSLDMALRHMDIRRSIPGSLRPLMTNIPASSMYSVRSGPARA--  483

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHG-GECEISSDKGARSPPS  214
            VSVSDSPLATSSNASSE SVNNNA+C+DG   G+ ++ S++G  SP S
Sbjct  484  VSVSDSPLATSSNASSEQSVNNNALCLDGSDIGDDDLGSERGRSSPAS  531



>emb|CDX74811.1| BnaA05g05570D [Brassica napus]
Length=588

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 141/169 (83%), Gaps = 4/169 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            ++ SGSSVP  A++R ++KAN NVSPV+MG KMVERVINMRKLAPPR D K SP+ NLSA
Sbjct  417  MYASGSSVP--AVNRGYSKANDNVSPVMMGAKMVERVINMRKLAPPRSDEKGSPHGNLSA  474

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R 
Sbjct  475  KSSSPDSAGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGRP  534

Query  354  VSVSDSPLatssnasse-vsvnnnaVCIDGHG-GECEISSDKGARSPPS  214
            ++VSDSPLATSSNASSE    NNN VC++     E +  S++G RSPP+
Sbjct  535  MNVSDSPLATSSNASSEISVYNNNGVCLEAASEKEDDAGSERGCRSPPA  583



>dbj|BAN18489.1| proteophosphoglycan, partial [Schiedea verticillata]
Length=190

 Score =   160 bits (405),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 123/148 (83%), Gaps = 5/148 (3%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H+SGSSVP  AMSR H+K N +VSPVVMGNKMVERV++MRKLAPPR D+K SP+ +  + 
Sbjct  47   HSSGSSVP--AMSRAHSKVNDDVSPVVMGNKMVERVVHMRKLAPPRQDDKHSPSLSGKSA  104

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
            SS     GFGRTLSKKSLDMAIRHM IR++IPGNLRPLMT IPASSMYSVRSGP+ SRT 
Sbjct  105  SSP---EGFGRTLSKKSLDMAIRHMGIRQSIPGNLRPLMTKIPASSMYSVRSGPTVSRTA  161

Query  351  SVSDSPLatssnassevsvnnnaVCIDG  268
            SV DSP+ATSSNASSE+S NN+   +DG
Sbjct  162  SVCDSPIATSSNASSELSFNNHHGTLDG  189



>dbj|BAN18487.1| proteophosphoglycan, partial [Schiedea trinervis]
 dbj|BAN18488.1| proteophosphoglycan, partial [Schiedea obovata]
Length=190

 Score =   160 bits (405),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 106/127 (83%), Gaps = 5/127 (4%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H+SGSSVP  AMSR H+K N +VSPVVMGNKMVERV++MRKLAPPR D+K SP+ +  + 
Sbjct  47   HSSGSSVP--AMSRAHSKVNDDVSPVVMGNKMVERVVHMRKLAPPRQDDKHSPSLSGKSA  104

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
            SS     GFGRTLSKKSLDMAIRHM IR++IPGNLRPLMT IPASSMYSVRSGP+ SRT 
Sbjct  105  SSP---EGFGRTLSKKSLDMAIRHMGIRQSIPGNLRPLMTKIPASSMYSVRSGPTVSRTA  161

Query  351  SVSDSPL  331
            SV DSP+
Sbjct  162  SVCDSPI  168



>ref|XP_009143258.1| PREDICTED: endochitinase A-like [Brassica rapa]
Length=604

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 141/169 (83%), Gaps = 4/169 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            ++ SGSSVP  A++R ++KAN NVSPV+MG KMVERVINMRKLAPPR D K SP+ NLSA
Sbjct  433  MYASGSSVP--AVNRGYSKANDNVSPVMMGAKMVERVINMRKLAPPRSDEKGSPHGNLSA  490

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R 
Sbjct  491  KSSSPDSAGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGRP  550

Query  354  VSVSDSPLatssnasse-vsvnnnaVCIDGHG-GECEISSDKGARSPPS  214
            ++VSDSPLATSSNASSE    NNN VC++     E +  S++G RSPP+
Sbjct  551  MNVSDSPLATSSNASSEISVYNNNGVCLEAASEKEDDAGSERGCRSPPA  599



>ref|XP_004235247.1| PREDICTED: putative GPI-anchored protein PB15E9.01c [Solanum 
lycopersicum]
Length=584

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 137/161 (85%), Gaps = 4/161 (2%)
 Frame = -2

Query  678  MSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGR  499
            MSRLHAKA  NVSP  +G KMVERVINMRKL PP+ D+K SP+SNLSAKSSSPDS+GFGR
Sbjct  422  MSRLHAKAKDNVSPGTVGTKMVERVINMRKLVPPKQDDKHSPHSNLSAKSSSPDSSGFGR  481

Query  498  TLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGP----SRSRTVSVSDSPL  331
            +LSKKSLDMAIRHMDIR+ + GNLRPLMTNIPASSMYSVRSGP      SR++SV DSPL
Sbjct  482  SLSKKSLDMAIRHMDIRQRVSGNLRPLMTNIPASSMYSVRSGPPTRGRTSRSISVPDSPL  541

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ATSSNASSEVSV+NN VCIDG   + +ISSDKGARSP SV 
Sbjct  542  ATSSNASSEVSVSNNVVCIDGSEIDEDISSDKGARSPASVR  582



>ref|NP_181536.3| uncharacterized protein [Arabidopsis thaliana]
 gb|AAZ23924.1| At2g40070 [Arabidopsis thaliana]
 dbj|BAE98974.1| En/Spm-like transposon protein [Arabidopsis thaliana]
 gb|AEC09771.1| uncharacterized protein AT2G40070 [Arabidopsis thaliana]
Length=607

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 146/171 (85%), Gaps = 4/171 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +++SGSSVP  A++R ++KA+ NVSPV+MG KMVERVINMRKLAPPR D+K SP+ NLSA
Sbjct  437  MYSSGSSVP--AVNRGYSKASDNVSPVMMGTKMVERVINMRKLAPPRSDDKGSPHGNLSA  494

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R 
Sbjct  495  KSSSPDSAGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGRP  554

Query  354  VSVSD-SPLatssnassevsv-nnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ++VSD SPLATSSNASSE+SV NNN +C++    E +  S++G RSP S+ 
Sbjct  555  MNVSDSSPLATSSNASSEISVCNNNGICLEASEKEDDAGSERGCRSPASLQ  605



>ref|XP_004500676.1| PREDICTED: flocculation protein FLO11-like [Cicer arietinum]
Length=613

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 137/170 (81%), Gaps = 3/170 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkss-pnsnls  538
            +H SG+S+P  A++R  +K N NVSPV+MG KMVERVINMRKLAPP +DNK+S  ++   
Sbjct  444  VHLSGNSMP--AVNRGRSKVNDNVSPVLMGTKMVERVINMRKLAPPMMDNKNSPRSNLSG  501

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
              SSSPDSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  R R
Sbjct  502  KSSSSPDSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGSQRGR  561

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            T+SVS SP ATSSNASSE+SVN N +C+D    + EI S++  +SP SV 
Sbjct  562  TISVSGSPHATSSNASSEMSVNQNGICLDSSEIDDEIGSERYGQSPASVR  611



>ref|XP_006293855.1| hypothetical protein CARUB_v10022840mg [Capsella rubella]
 gb|EOA26753.1| hypothetical protein CARUB_v10022840mg [Capsella rubella]
Length=607

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 146/171 (85%), Gaps = 4/171 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +++SGSSVP  A++R ++KA+ NVSPV+MG KMVERVINMRKLAPPR D+K SP+ NLSA
Sbjct  437  MYSSGSSVP--AVNRGYSKASDNVSPVMMGTKMVERVINMRKLAPPRSDDKGSPHGNLSA  494

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R 
Sbjct  495  KSSSPDSAGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGRP  554

Query  354  VSVSD-SPLatssnassevsv-nnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ++VSD SPLATSSNASSE+SV NNN +C++    E +  S++G RSP S+ 
Sbjct  555  MNVSDSSPLATSSNASSEISVCNNNGICLEASEKEDDAGSERGCRSPASLQ  605



>dbj|BAH57264.1| AT2G40070 [Arabidopsis thaliana]
Length=575

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 146/171 (85%), Gaps = 4/171 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +++SGSSVP  A++R ++KA+ NVSPV+MG KMVERVINMRKLAPPR D+K SP+ NLSA
Sbjct  405  MYSSGSSVP--AVNRGYSKASDNVSPVMMGTKMVERVINMRKLAPPRSDDKGSPHGNLSA  462

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R 
Sbjct  463  KSSSPDSAGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGRP  522

Query  354  VSVSD-SPLatssnassevsv-nnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ++VSD SPLATSSNASSE+SV NNN +C++    E +  S++G RSP S+ 
Sbjct  523  MNVSDSSPLATSSNASSEISVCNNNGICLEASEKEDDAGSERGCRSPASLQ  573



>ref|XP_010508921.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Camelina 
sativa]
 ref|XP_010508922.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Camelina 
sativa]
Length=607

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 146/171 (85%), Gaps = 4/171 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +++SGSSVP  A++R +++A+ NVSPV+MG KMVERVINMRKLAPPR D+K SP+ NLSA
Sbjct  437  MYSSGSSVP--AVNRGYSRASDNVSPVMMGTKMVERVINMRKLAPPRSDDKGSPHGNLSA  494

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R 
Sbjct  495  KSSSPDSAGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGRP  554

Query  354  VSVSD-SPLatssnassevsv-nnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ++VSD SPLATSSNASSE+SV NNN +C+D    E +  S++G RSP S+ 
Sbjct  555  MNVSDSSPLATSSNASSEISVCNNNGICLDASEKEDDAGSERGCRSPASLQ  605



>ref|NP_001078028.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC09772.1| uncharacterized protein AT2G40070 [Arabidopsis thaliana]
Length=567

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 146/171 (85%), Gaps = 4/171 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +++SGSSVP  A++R ++KA+ NVSPV+MG KMVERVINMRKLAPPR D+K SP+ NLSA
Sbjct  397  MYSSGSSVP--AVNRGYSKASDNVSPVMMGTKMVERVINMRKLAPPRSDDKGSPHGNLSA  454

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R 
Sbjct  455  KSSSPDSAGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGRP  514

Query  354  VSVSD-SPLatssnassevsv-nnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ++VSD SPLATSSNASSE+SV NNN +C++    E +  S++G RSP S+ 
Sbjct  515  MNVSDSSPLATSSNASSEISVCNNNGICLEASEKEDDAGSERGCRSPASLQ  565



>ref|XP_010517399.1| PREDICTED: flocculation protein FLO11-like [Camelina sativa]
Length=607

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 146/171 (85%), Gaps = 4/171 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +++SGSSVP  A++R ++KA+ NVSPV+MG KMVERVINMRKLAPPR D++ SP+ NLSA
Sbjct  437  MYSSGSSVP--AVNRGYSKASDNVSPVMMGTKMVERVINMRKLAPPRSDDRGSPHGNLSA  494

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R 
Sbjct  495  KSSSPDSAGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGRP  554

Query  354  VSVSD-SPLatssnassevsv-nnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ++VSD SPLATSSNASSE+SV NNN +C++    E +  S++G RSP S+ 
Sbjct  555  MNVSDSSPLATSSNASSEISVCNNNGICLEASEKEDDAGSERGCRSPASLQ  605



>ref|XP_003538456.1| PREDICTED: flocculation protein FLO11-like [Glycine max]
Length=614

 Score =   166 bits (420),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 135/169 (80%), Gaps = 3/169 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRL-Dnksspnsnls  538
            +H SG+S+P  A++R H+K N NVSPVVMGNKMVERVINMRKLAPP + D  S  ++   
Sbjct  445  VHISGNSMP--AVNRGHSKVNDNVSPVVMGNKMVERVINMRKLAPPMIEDKNSPHSNLSG  502

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
              +SSPDS+GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASS+YSVRSG    R
Sbjct  503  RSASSPDSSGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSLYSVRSGSHHGR  562

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSV  211
            T+SVS SP ATSSNASSE+SVN N +C+D    + +I S++  +SP SV
Sbjct  563  TISVSGSPHATSSNASSELSVNQNGICLDSSEVDDDIGSERCGQSPASV  611



>gb|KHN34732.1| hypothetical protein glysoja_039028 [Glycine soja]
Length=619

 Score =   166 bits (420),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 135/169 (80%), Gaps = 3/169 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRL-Dnksspnsnls  538
            +H SG+S+P  A++R H+K N NVSPVVMGNKMVERVINMRKLAPP + D  S  ++   
Sbjct  450  VHISGNSMP--AVNRGHSKVNDNVSPVVMGNKMVERVINMRKLAPPMIEDKNSPHSNLSG  507

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
              +SSPDS+GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASS+YSVRSG    R
Sbjct  508  RSASSPDSSGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSLYSVRSGSHHGR  567

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSV  211
            T+SVS SP ATSSNASSE+SVN N +C+D    + +I S++  +SP SV
Sbjct  568  TISVSGSPHATSSNASSELSVNQNGICLDSSEVDDDIGSERCGQSPASV  616



>ref|XP_010910088.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
 ref|XP_010910089.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
Length=529

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 132/161 (82%), Gaps = 3/161 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H  GS   VPA+SR H     +++PV++GNKMVERV+NMR+LAPP+ D++ S N+    
Sbjct  369  VHKGGS---VPAVSRSHLNGGDSLNPVLIGNKMVERVVNMRRLAPPKQDDQRSLNNPPGK  425

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             + SPDSTGFGRTLSKKSLDMA+RHMDIRR+IP +LRPLMT +PASSMYS+RSGP+RSR 
Sbjct  426  PTLSPDSTGFGRTLSKKSLDMALRHMDIRRSIPNSLRPLMTKVPASSMYSMRSGPARSRP  485

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKG  232
            VSVSDSPLATSSNASSE SVNNN +C+DG   E ++SS+KG
Sbjct  486  VSVSDSPLATSSNASSEQSVNNNMICLDGSELEDDLSSEKG  526



>ref|XP_010505709.1| PREDICTED: flocculation protein FLO11-like [Camelina sativa]
Length=607

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 146/171 (85%), Gaps = 4/171 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +++SGSSVP  A++R +++A+ NVSPV+MG KMVERVINMRKLAPPR D+K SP+ NLSA
Sbjct  437  MYSSGSSVP--AVNRGYSRASDNVSPVMMGTKMVERVINMRKLAPPRSDDKGSPHGNLSA  494

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            KSSSPDS GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R 
Sbjct  495  KSSSPDSAGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGRP  554

Query  354  VSVSD-SPLatssnassevsv-nnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ++VSD SPLATSSNASSE+SV NNN +C++    E +  S++G RSP S+ 
Sbjct  555  MNVSDSSPLATSSNASSEISVCNNNGICLEASEKEDDAGSERGCRSPASLQ  605



>ref|XP_007141776.1| hypothetical protein PHAVU_008G224800g [Phaseolus vulgaris]
 gb|ESW13770.1| hypothetical protein PHAVU_008G224800g [Phaseolus vulgaris]
Length=627

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 138/169 (82%), Gaps = 3/169 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H +GSS+P  A++R +++AN NVSPVVMG KMVERVINMRKLAPPRLD+K+S ++     
Sbjct  459  HPTGSSMP--AVNRGYSRANDNVSPVVMGTKMVERVINMRKLAPPRLDDKNSSHNLSGKS  516

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLR-PLMTNIPASSMYSVRSGPSRSRT  355
            SSSPD++GFGR+LSKKSLDMAIRHMDIRR +PGNLR  LMTNIPASSMYSVRSGP RSRT
Sbjct  517  SSSPDTSGFGRSLSKKSLDMAIRHMDIRRRVPGNLRSSLMTNIPASSMYSVRSGPPRSRT  576

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            VS+S SP ATSSNASSEVSVN N VC+     + +I S++  +SP SV 
Sbjct  577  VSISGSPHATSSNASSEVSVNPNGVCLYNSEIDDDIGSERSGQSPASVR  625



>ref|XP_008795443.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Phoenix dactylifera]
Length=529

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 130/160 (81%), Gaps = 3/160 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +H  GS   VPA+SR H     ++SPV++GNKMVERV+NMR+LAPP+ D++ S ++    
Sbjct  369  VHKGGS---VPAISRSHLNGGDSLSPVLIGNKMVERVVNMRRLAPPKQDDQRSLHNLPGK  425

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             S  PDSTGFGRTLSKKSLDMA+RHMDIRR+IP +LRPLMT +PASSMYS+RSGP+RSR 
Sbjct  426  PSLLPDSTGFGRTLSKKSLDMALRHMDIRRSIPNSLRPLMTKVPASSMYSMRSGPTRSRP  485

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDK  235
            VSVSDSPLATSSNASSE SVNNN +C+DG   E ++SS+K
Sbjct  486  VSVSDSPLATSSNASSEQSVNNNTICVDGSELEDDLSSEK  525



>gb|KFK36895.1| hypothetical protein AALP_AA4G186400 [Arabis alpina]
Length=607

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 142/171 (83%), Gaps = 4/171 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspn-snls  538
            +++SGSSVP  A++R ++KAN NVSPV+MG KMVERVINMRKLAPPR D+       NLS
Sbjct  437  MYSSGSSVP--AVNRGYSKANDNVSPVLMGAKMVERVINMRKLAPPRSDDNKGSPHGNLS  494

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
            AKSSSPDS GFGR+LSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG +R R
Sbjct  495  AKSSSPDSAGFGRSLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGHTRGR  554

Query  357  TVSVSDSPLatssnassevsv-nnnaVCIDGHGGECEISSDKGARSPPSVH  208
             ++V+DSPLATSSNASSE+SV NNN +C++    E +  S++G +SP S+ 
Sbjct  555  PLNVTDSPLATSSNASSEISVCNNNGICLEASEKEDDAGSERGCKSPASLQ  605



>ref|XP_007163529.1| hypothetical protein PHAVU_001G241800g [Phaseolus vulgaris]
 gb|ESW35523.1| hypothetical protein PHAVU_001G241800g [Phaseolus vulgaris]
Length=595

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 139/169 (82%), Gaps = 3/169 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnls-a  535
            H SG+S+P  A+SR  +K N NVSPVVMGNKMVERVINMRKLAPP +D+K+SP SNLS  
Sbjct  427  HISGNSMP--AVSRGRSKVNDNVSPVVMGNKMVERVINMRKLAPPMIDDKNSPRSNLSGK  484

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             +SSPDS+GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASS+YSVRSG    RT
Sbjct  485  STSSPDSSGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSLYSVRSGSHHGRT  544

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            +SVS SP ATSSNASSE+SVN N +C+D    + +I S++  +SP SV 
Sbjct  545  ISVSGSPHATSSNASSELSVNQNGICLDSSEVDDDIGSERCGQSPASVR  593



>ref|XP_003552436.1| PREDICTED: flocculation protein FLO11-like [Glycine max]
 gb|KHN36386.1| hypothetical protein glysoja_041416 [Glycine soja]
Length=601

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 133/169 (79%), Gaps = 3/169 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRL-Dnksspnsnls  538
            +H SG+S+P  A+SR H+K N NVSPVVMG KMVERVINMRKL PP + D  S  ++   
Sbjct  432  VHISGNSMP--AVSRGHSKVNDNVSPVVMGTKMVERVINMRKLVPPMIEDKNSPRSNLSG  489

Query  537  akssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSR  358
              +SSPDS+GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASS+YSVRSG    R
Sbjct  490  KSASSPDSSGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSLYSVRSGSHHGR  549

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSV  211
            T+SVS SP ATSSNASSE+SVN N +C+D    + +I S++  +SP SV
Sbjct  550  TISVSGSPHATSSNASSELSVNQNGICLDSSEVDDDIGSERCGQSPASV  598



>gb|KEH34783.1| ATP-binding protein, putative [Medicago truncatula]
Length=628

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 135/169 (80%), Gaps = 3/169 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkss-pnsnlsa  535
            H SG+S+P  A+SR  +K N NVSP +MG KMVERVINMRKLAPP +DNK+S  ++    
Sbjct  460  HISGNSMP--AVSRGRSKVNDNVSPGMMGTKMVERVINMRKLAPPMMDNKNSPRSNLSGK  517

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             SSSPDSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSG  R RT
Sbjct  518  SSSSPDSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGSHRGRT  577

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            +SVS SP ATSSNASSE+SVN N +C+D    + E+ S++  +SP SV 
Sbjct  578  ISVSGSPHATSSNASSEMSVNQNGLCLDSSEIDDEVGSERCVQSPASVR  626



>ref|XP_009412575.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkssp-nsnlsakssspdST  511
            VP  SR  A  + NV+PV++GNKMVER++NMR+LAPP+ D++ S  N+     S SPD  
Sbjct  359  VPPSSRPQASGSDNVNPVIIGNKMVERIVNMRRLAPPKQDDQRSSHNNLSGKSSLSPDGA  418

Query  510  GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            GFGRTLSKKSLDMA+RHMDIRR++P +LRPLM NIPASS+YSVRSG +RSRTVSVSDSPL
Sbjct  419  GFGRTLSKKSLDMALRHMDIRRSVPNSLRPLMANIPASSVYSVRSGATRSRTVSVSDSPL  478

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHSSR  199
            ATSS  SSE SVNNN + +DG   E EI+SDK  R PP+V ++R
Sbjct  479  ATSSTVSSEQSVNNNMLGLDGSEIEDEITSDKRGRCPPAVPNTR  522



>ref|XP_009412573.1| PREDICTED: endochitinase A-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=569

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkssp-nsnlsakssspdST  511
            VP  SR  A  + NV+PV++GNKMVER++NMR+LAPP+ D++ S  N+     S SPD  
Sbjct  406  VPPSSRPQASGSDNVNPVIIGNKMVERIVNMRRLAPPKQDDQRSSHNNLSGKSSLSPDGA  465

Query  510  GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            GFGRTLSKKSLDMA+RHMDIRR++P +LRPLM NIPASS+YSVRSG +RSRTVSVSDSPL
Sbjct  466  GFGRTLSKKSLDMALRHMDIRRSVPNSLRPLMANIPASSVYSVRSGATRSRTVSVSDSPL  525

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHSSR  199
            ATSS  SSE SVNNN + +DG   E EI+SDK  R PP+V ++R
Sbjct  526  ATSSTVSSEQSVNNNMLGLDGSEIEDEITSDKRGRCPPAVPNTR  569



>gb|EPS71355.1| hypothetical protein M569_03402 [Genlisea aurea]
Length=566

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 114/129 (88%), Gaps = 3/129 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H+SGSSVPVP ++RL AKAN NVSP ++G KMVERVINMRKLAPP+ D++ SP+S+LS K
Sbjct  401  HSSGSSVPVPMVNRLQAKANDNVSPALIGTKMVERVINMRKLAPPKNDDRHSPHSSLSGK  460

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVR--SGPSRSR  358
            SSSPDS+GFGR LSKKSLDMAIRHMDIRRTIPGNLRPLM+N+PASSMYSVR  SG  R R
Sbjct  461  SSSPDSSGFGRMLSKKSLDMAIRHMDIRRTIPGNLRPLMSNVPASSMYSVRSPSGQPR-R  519

Query  357  TVSVSDSPL  331
            TV VSDSP+
Sbjct  520  TVGVSDSPV  528



>ref|XP_010654169.1| PREDICTED: mucin-12-like isoform X2 [Vitis vinifera]
Length=544

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 120/159 (75%), Gaps = 2/159 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTG  508
            +PAM R H+  + NVSPV++G KMVERV+NMRKLAPP+ D+  S +    + S+    +G
Sbjct  383  IPAMRRAHSNGSDNVSPVLIGTKMVERVVNMRKLAPPKQDDHRSAHPAGKSSSAPDS-SG  441

Query  507  FGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLa  328
            FGRTLSKKSLDMA+RHMDIRR+I GNLRPLMTNIPASSMYSVRSGP++S T SVS SPLA
Sbjct  442  FGRTLSKKSLDMALRHMDIRRSIQGNLRPLMTNIPASSMYSVRSGPTKSSTASVSGSPLA  501

Query  327  tssnassevsvnnnaVCIDGHGGE-CEISSDKGARSPPS  214
            TSS  SSE SVN N+ C  G   E  E+ SD+G  SP S
Sbjct  502  TSSITSSEPSVNENSHCFYGSEIEDDELGSDRGHSSPAS  540



>ref|XP_010654168.1| PREDICTED: zonadhesin-like isoform X1 [Vitis vinifera]
Length=548

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 119/157 (76%), Gaps = 2/157 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTG  508
            +PAM R H+  + NVSPV++G KMVERV+NMRKLAPP+ D+  S +    + S+    +G
Sbjct  387  IPAMRRAHSNGSDNVSPVLIGTKMVERVVNMRKLAPPKQDDHRSAHPAGKSSSAPDS-SG  445

Query  507  FGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLa  328
            FGRTLSKKSLDMA+RHMDIRR+I GNLRPLMTNIPASSMYSVRSGP++S T SVS SPLA
Sbjct  446  FGRTLSKKSLDMALRHMDIRRSIQGNLRPLMTNIPASSMYSVRSGPTKSSTASVSGSPLA  505

Query  327  tssnassevsvnnnaVCIDGHGGE-CEISSDKGARSP  220
            TSS  SSE SVN N+ C  G   E  E+ SD+G  SP
Sbjct  506  TSSITSSEPSVNENSHCFYGSEIEDDELGSDRGHSSP  542



>emb|CAN77490.1| hypothetical protein VITISV_010725 [Vitis vinifera]
Length=569

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 122/164 (74%), Gaps = 2/164 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTG  508
            +PAM R H+  + NVSPV++G KMVERV+NMRKLAPP+ D+  S +    + S+    +G
Sbjct  364  IPAMRRAHSNGSDNVSPVLIGTKMVERVVNMRKLAPPKQDDHRSAHPAGKSSSAPDS-SG  422

Query  507  FGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLa  328
            FGRTLSKKSLDMA+RHMDIRR+I GNLRPLMTNIPASSMYSVRSGP++S T SVS SPLA
Sbjct  423  FGRTLSKKSLDMALRHMDIRRSIQGNLRPLMTNIPASSMYSVRSGPTKSSTASVSGSPLA  482

Query  327  tssnassevsvnnnaVCIDGHGGE-CEISSDKGARSPPSVHSSR  199
            TSS  SSE SVN N+ C  G   E  E+ SD+G  SP S  + +
Sbjct  483  TSSITSSEPSVNENSHCFYGSEIEDDELGSDRGHSSPASRQAGK  526



>ref|XP_008785362.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Phoenix dactylifera]
 ref|XP_008785363.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Phoenix dactylifera]
Length=542

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkssp-nsnlsakssspdST  511
            VPA+SR H     +++PV++GNKMVERV+NMR+L PP+ D++ S  N+     S  PDST
Sbjct  376  VPAVSRSHLNGGDSLNPVLIGNKMVERVVNMRRLVPPKQDDQRSTHNNLPGKPSLQPDST  435

Query  510  GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            GFGRTLSKKSLDMA+RHMDIRR+IP +LRPLMT +PASSMYSVRSGPSRS++VS+SDSPL
Sbjct  436  GFGRTLSKKSLDMALRHMDIRRSIPNSLRPLMTKVPASSMYSVRSGPSRSKSVSISDSPL  495

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDKGARS  223
            ATSSNASSE SV+N+ +C++G   E ++ S+KG RS
Sbjct  496  ATSSNASSEQSVDNHMICLNGGELEDDLRSEKGGRS  531



>ref|XP_009407549.1| PREDICTED: mucin-1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=522

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkssp-nsnlsakssspdST  511
            VP  SR HA AN N++PV++GNKMVER++NMR+L PP+ D++ S  N+     S +PDST
Sbjct  360  VPPSSRPHANANDNMNPVLIGNKMVERIVNMRRLVPPKQDDQRSSHNNLSGKSSLTPDST  419

Query  510  GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            GFGRTLSKKSLDMA+RHMDIRR++P + RP MTN+PA S+Y VRSGP+RSRTV VSDSPL
Sbjct  420  GFGRTLSKKSLDMALRHMDIRRSVPNSSRPSMTNVPALSVY-VRSGPTRSRTVGVSDSPL  478

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHSSR  199
            ATSS ASSE SVNNN +C+DG+  E +++S+KG R  P+V  +R
Sbjct  479  ATSSTASSEHSVNNNTICLDGNEIEDDLTSEKGGRCSPAVFIAR  522



>ref|XP_011047445.1| PREDICTED: mucin-2-like [Populus euphratica]
Length=563

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 123/162 (76%), Gaps = 2/162 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTG  508
            +P+ SR       +V+PV MG KMVERV+NMRKL PP+ D   S  SN + KSSS DSTG
Sbjct  400  IPSKSRTQTNGGDDVNPVQMGTKMVERVVNMRKLVPPKQDGSHSSLSNSAGKSSSLDSTG  459

Query  507  FGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRS-GPSRSRTVSVSDSPL  331
            FGRTLSKKSLDMA+RHMDIRR+I GNLRPLMTNIPASSMYSVRS G S+ RTVSVSDSPL
Sbjct  460  FGRTLSKKSLDMALRHMDIRRSISGNLRPLMTNIPASSMYSVRSGGSSKGRTVSVSDSPL  519

Query  330  atssnassevsvnnnaVCIDG-HGGECEISSDKGARSPPSVH  208
            ATSSNASSE SVNNN+   DG    + E  SD+G  SP S H
Sbjct  520  ATSSNASSEPSVNNNSYFADGIEIEDNEFGSDRGNSSPSSQH  561



>ref|XP_009782013.1| PREDICTED: cell wall protein RBR3-like [Nicotiana sylvestris]
Length=570

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 136/160 (85%), Gaps = 3/160 (2%)
 Frame = -2

Query  678  MSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGR  499
            MSRLHAKAN NVSPV++G KMVERVINMRKL  P+ D+K SP+SNLSAKSSSPDS+GFGR
Sbjct  409  MSRLHAKANDNVSPVMVGTKMVERVINMRKLVRPKQDDKHSPHSNLSAKSSSPDSSGFGR  468

Query  498  TLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSV---RSGPSRSRTVSVSDSPLa  328
            +LSKKSLDMAIRHMDIR+ IPGNLRPLMTNIPASSMYSV    S    SR++SV DSPLA
Sbjct  469  SLSKKSLDMAIRHMDIRQRIPGNLRPLMTNIPASSMYSVRSGPSRSRTSRSISVPDSPLA  528

Query  327  tssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            TSSNASSEVSV+NNAV  DG   + +ISSDKG RSP SVH
Sbjct  529  TSSNASSEVSVSNNAVYFDGSEIDDDISSDKGVRSPASVH  568



>ref|XP_009600813.1| PREDICTED: putative GPI-anchored protein PB15E9.01c [Nicotiana 
tomentosiformis]
 ref|XP_009600821.1| PREDICTED: putative GPI-anchored protein PB15E9.01c [Nicotiana 
tomentosiformis]
Length=571

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 136/160 (85%), Gaps = 3/160 (2%)
 Frame = -2

Query  678  MSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGR  499
            MSRLHAKAN NVSPV++G KMVERVINMRKL  P+ D+K SP+SNLSAKSSSPDS+GFGR
Sbjct  410  MSRLHAKANDNVSPVLVGTKMVERVINMRKLVRPKQDDKHSPHSNLSAKSSSPDSSGFGR  469

Query  498  TLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSV---RSGPSRSRTVSVSDSPLa  328
            +LSKKSLDMAIRHMDIR+ IPGNLRPLMTNIPASSMYSV    S    SR++SV DSPLA
Sbjct  470  SLSKKSLDMAIRHMDIRQRIPGNLRPLMTNIPASSMYSVRSGPSRSRTSRSISVPDSPLA  529

Query  327  tssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            TSSNASSEVSV+NNAV  DG   + ++SSDKG RSP SVH
Sbjct  530  TSSNASSEVSVSNNAVYFDGSEIDDDVSSDKGVRSPASVH  569



>ref|XP_009419731.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form [Musa acuminata subsp. malaccensis]
Length=519

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 131/169 (78%), Gaps = 6/169 (4%)
 Frame = -2

Query  702  GSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkssp-nsnlsakss  526
            GSSVP P  SR H+     ++PVV+GNKMVER++NMR+LAPP+ D+  S  N+     S 
Sbjct  356  GSSVPPP--SRQHSNGGDKLNPVVIGNKMVERIVNMRRLAPPKQDDHRSTHNNLSGKSSL  413

Query  525  spdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSV  346
            SPDSTGFGRTLSKKSLDMA+RHMDIRR++P +LRPLM NIPASS + VRSGP+RSR +SV
Sbjct  414  SPDSTGFGRTLSKKSLDMALRHMDIRRSVPNSLRPLMANIPASSAFGVRSGPTRSRAISV  473

Query  345  SDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHSSR  199
            SDSPLATSS ASSE SVNNN +C++    E +++S+KG R P +V + R
Sbjct  474  SDSPLATSSTASSEQSVNNNIICLE---IEDDLTSEKGGRCPAAVSNVR  519



>ref|XP_007026736.1| Uncharacterized protein TCM_021711 [Theobroma cacao]
 gb|EOY07238.1| Uncharacterized protein TCM_021711 [Theobroma cacao]
Length=556

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 115/144 (80%), Gaps = 2/144 (1%)
 Frame = -2

Query  648  NVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKKSLDMA  469
            N SPVV+G KMVERV+NMRKL PP+ D+    N      +S    +GFGRTLSKKSLDMA
Sbjct  408  NDSPVVIGTKMVERVVNMRKLVPPKQDDNPRNNPTAKLSASLDS-SGFGRTLSKKSLDMA  466

Query  468  IRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatssnassevsvnn  289
            +RHMDIRR+IPGN RPLMTN+PASS+YSVRSG ++SRTVSVSDSPLATSSNASSE SVNN
Sbjct  467  LRHMDIRRSIPGNQRPLMTNVPASSIYSVRSGSTKSRTVSVSDSPLATSSNASSEPSVNN  526

Query  288  naVCIDGHGGEC-EISSDKGARSP  220
            N+ CIDG   E  ++SS++G  SP
Sbjct  527  NSFCIDGIEMEYNDLSSERGNSSP  550



>ref|XP_009407548.1| PREDICTED: mucin-1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=528

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 131/170 (77%), Gaps = 8/170 (5%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkssp-nsnlsakssspdST  511
            VP  SR HA AN N++PV++GNKMVER++NMR+L PP+ D++ S  N+     S +PDST
Sbjct  360  VPPSSRPHANANDNMNPVLIGNKMVERIVNMRRLVPPKQDDQRSSHNNLSGKSSLTPDST  419

Query  510  GFGRTLSKKSLDMAIRHM------DIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVS  349
            GFGRTLSKKSLDMA+RHM      DIRR++P + RP MTN+PA S+Y VRSGP+RSRTV 
Sbjct  420  GFGRTLSKKSLDMALRHMIYLQTQDIRRSVPNSSRPSMTNVPALSVY-VRSGPTRSRTVG  478

Query  348  VSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHSSR  199
            VSDSPLATSS ASSE SVNNN +C+DG+  E +++S+KG R  P+V  +R
Sbjct  479  VSDSPLATSSTASSEHSVNNNTICLDGNEIEDDLTSEKGGRCSPAVFIAR  528



>ref|XP_002323572.2| hypothetical protein POPTR_0016s12230g [Populus trichocarpa]
 gb|EEF05333.2| hypothetical protein POPTR_0016s12230g [Populus trichocarpa]
Length=519

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 121/162 (75%), Gaps = 2/162 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTG  508
            +P  SR       +V+PV MG KMVERV+NMRKL PP+ D   S  SN + KSSS DSTG
Sbjct  356  IPTKSRTQTNGGDDVNPVQMGTKMVERVVNMRKLVPPKQDGSHSSLSNSAGKSSSLDSTG  415

Query  507  FGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRS-GPSRSRTVSVSDSPL  331
            FGRTLSKKSLDMA+RHMDIRR+I GNLRPLMTNIPASSMYSVRS G S+ RTVSV DSPL
Sbjct  416  FGRTLSKKSLDMALRHMDIRRSISGNLRPLMTNIPASSMYSVRSGGSSKGRTVSVLDSPL  475

Query  330  atssnassevsvnnnaVCIDG-HGGECEISSDKGARSPPSVH  208
            ATSSNASSE SVNNN+   DG    + E  S++G  SP S H
Sbjct  476  ATSSNASSEPSVNNNSYFADGIEIEDNEFGSERGNSSPSSHH  517



>gb|KEH28284.1| ATP-binding protein, putative [Medicago truncatula]
Length=601

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 133/169 (79%), Gaps = 4/169 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkssp-nsnlsa  535
            H SGSS+P  A++R ++K N  VSPV MGNKMVER+INMRKLAPPR D KSSP ++    
Sbjct  429  HTSGSSMP--AVNRGYSKVNDKVSPVAMGNKMVERLINMRKLAPPRPDVKSSPHSNLSGK  486

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             SSSPD++GFGRTLSKKSLDMA+RHMDIR+++PGNLRPLMTNIPASSMYSVRSG  RS  
Sbjct  487  SSSSPDNSGFGRTLSKKSLDMALRHMDIRKSVPGNLRPLMTNIPASSMYSVRSGHQRSLM  546

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGE-CEISSDKGARSPPSV  211
            VSVS SP ATSSNA SEVSVN N +  D    +  ++ SD+G +SP SV
Sbjct  547  VSVSGSPHATSSNAGSEVSVNQNGLYSDNSEIDYYDMVSDRGGQSPASV  595



>gb|KEH28283.1| ATP-binding protein, putative [Medicago truncatula]
Length=616

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 133/169 (79%), Gaps = 4/169 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkssp-nsnlsa  535
            H SGSS+P  A++R ++K N  VSPV MGNKMVER+INMRKLAPPR D KSSP ++    
Sbjct  440  HTSGSSMP--AVNRGYSKVNDKVSPVAMGNKMVERLINMRKLAPPRPDVKSSPHSNLSGK  497

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             SSSPD++GFGRTLSKKSLDMA+RHMDIR+++PGNLRPLMTNIPASSMYSVRSG  RS  
Sbjct  498  SSSSPDNSGFGRTLSKKSLDMALRHMDIRKSVPGNLRPLMTNIPASSMYSVRSGHQRSLM  557

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGE-CEISSDKGARSPPSV  211
            VSVS SP ATSSNA SEVSVN N +  D    +  ++ SD+G +SP SV
Sbjct  558  VSVSGSPHATSSNAGSEVSVNQNGLYSDNSEIDYYDMVSDRGGQSPASV  606



>gb|KHN48560.1| hypothetical protein glysoja_034183 [Glycine soja]
Length=635

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTG  508
            +PA++R ++KAN NVSPVVMG KMVERVINMRKLAPPR+D+K+S ++     SSSPDS+G
Sbjct  473  MPAVNRAYSKANDNVSPVVMGTKMVERVINMRKLAPPRMDDKNSFHNLSGKSSSSPDSSG  532

Query  507  FGRTLSKKSLDMAIRHMDIRRTIPGNLRP-LMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            FGR+LSKKSLDMAIRHMDIRR  PGNLRP LMT IPASSMYSVRSGP RSRT S+S SP 
Sbjct  533  FGRSLSKKSLDMAIRHMDIRRRAPGNLRPSLMTKIPASSMYSVRSGPQRSRTASISGSPH  592

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            A+ SNASSEVSVN N +CID    + +I S +  +S  +V 
Sbjct  593  ASGSNASSEVSVNENGLCIDNSEIDDDIVSVRSGQSSATVQ  633



>ref|XP_006575535.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Glycine 
max]
Length=692

 Score =   150 bits (378),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTG  508
            +PA++R ++KAN NVSPVVMG KMVERVINMRKLAPPR+D+K+S ++     SSSPDS+G
Sbjct  530  MPAVNRAYSKANDNVSPVVMGTKMVERVINMRKLAPPRMDDKNSFHNLSGKSSSSPDSSG  589

Query  507  FGRTLSKKSLDMAIRHMDIRRTIPGNLRP-LMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            FGR+LSKKSLDMAIRHMDIRR  PGNLRP LMT IPASSMYSVRSGP RSRT S+S SP 
Sbjct  590  FGRSLSKKSLDMAIRHMDIRRRAPGNLRPSLMTKIPASSMYSVRSGPQRSRTASISGSPH  649

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            A+ SNASSEVSVN N +CID    + +I S +  +S  +V 
Sbjct  650  ASGSNASSEVSVNENGLCIDNSEIDDDIVSVRSGQSSATVQ  690



>ref|XP_006575536.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Glycine 
max]
Length=681

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTG  508
            +PA++R ++KAN NVSPVVMG KMVERVINMRKLAPPR+D+K+S ++     SSSPDS+G
Sbjct  519  MPAVNRAYSKANDNVSPVVMGTKMVERVINMRKLAPPRMDDKNSFHNLSGKSSSSPDSSG  578

Query  507  FGRTLSKKSLDMAIRHMDIRRTIPGNLRP-LMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            FGR+LSKKSLDMAIRHMDIRR  PGNLRP LMT IPASSMYSVRSGP RSRT S+S SP 
Sbjct  579  FGRSLSKKSLDMAIRHMDIRRRAPGNLRPSLMTKIPASSMYSVRSGPQRSRTASISGSPH  638

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            A+ SNASSEVSVN N +CID    + +I S +  +S  +V 
Sbjct  639  ASGSNASSEVSVNENGLCIDNSEIDDDIVSVRSGQSSATVQ  679



>ref|XP_004490980.1| PREDICTED: flocculation protein FLO11-like [Cicer arietinum]
Length=586

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 103/127 (81%), Gaps = 3/127 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkssp-nsnlsa  535
            H SGSS+P  A++R ++K N  VSPV+MG KMVERVINMRKLAPP  D K+SP  +    
Sbjct  412  HTSGSSMP--AVNRGYSKVNEKVSPVLMGTKMVERVINMRKLAPPSPDVKNSPHRNLSGK  469

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
             SSSPDSTGFGRTLSKKSLDMAIRHMDIR+  PGNLRPLMTNIPASSMYSVRSG  RS T
Sbjct  470  SSSSPDSTGFGRTLSKKSLDMAIRHMDIRKRAPGNLRPLMTNIPASSMYSVRSGYQRSLT  529

Query  354  VSVSDSP  334
            VSVS SP
Sbjct  530  VSVSGSP  536



>ref|XP_006429352.1| hypothetical protein CICLE_v10011390mg [Citrus clementina]
 ref|XP_006429353.1| hypothetical protein CICLE_v10011390mg [Citrus clementina]
 gb|ESR42592.1| hypothetical protein CICLE_v10011390mg [Citrus clementina]
 gb|ESR42593.1| hypothetical protein CICLE_v10011390mg [Citrus clementina]
Length=562

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 129/161 (80%), Gaps = 3/161 (2%)
 Frame = -2

Query  672  RLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTL  493
            R++A    +V+PVV+G KMVERV+NMRKLAPP+ +N S+  ++    SSS DS+GFGRTL
Sbjct  402  RVNASDGDDVNPVVIGTKMVERVVNMRKLAPPKQENHSTHYTSAGKSSSSLDSSGFGRTL  461

Query  492  SKKSLDMAIRHMDIRRTI-PGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatssn  316
            SKKSLDMA+RHMDIRR+I  G+LRPLMTNIPASSMYSVRSG  +SRTVSV+DSPLATSSN
Sbjct  462  SKKSLDMALRHMDIRRSINSGSLRPLMTNIPASSMYSVRSGSIKSRTVSVTDSPLATSSN  521

Query  315  assevsvnnnaVCIDGHGGEC--EISSDKGARSPPSVHSSR  199
            ASSE SVNNN+  +DG+  +   +  S++G  SP S HSSR
Sbjct  522  ASSEPSVNNNSFILDGNELDDIHDFGSERGNSSPVSQHSSR  562



>gb|KDO47715.1| hypothetical protein CISIN_1g008537mg [Citrus sinensis]
 gb|KDO47716.1| hypothetical protein CISIN_1g008537mg [Citrus sinensis]
Length=562

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 128/161 (80%), Gaps = 3/161 (2%)
 Frame = -2

Query  672  RLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTL  493
            R++A    +V+PVV+G KMVERV+NMRKLAPP+ +N S+  ++    SSS DS+GFGRTL
Sbjct  402  RVNASDGDDVNPVVIGTKMVERVVNMRKLAPPKQENHSTHYTSAGKSSSSLDSSGFGRTL  461

Query  492  SKKSLDMAIRHMDIRRTI-PGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatssn  316
            SKKSLDMA+RHMDIRR+I  G+LRPLMTNIPASSMYSVRSG ++SRTVSV+DSPLATSSN
Sbjct  462  SKKSLDMALRHMDIRRSINSGSLRPLMTNIPASSMYSVRSGSTKSRTVSVTDSPLATSSN  521

Query  315  assevsvnnnaVCIDGHGGEC--EISSDKGARSPPSVHSSR  199
            ASSE SVNNN+  +DG   +   +  S++G  SP S HS R
Sbjct  522  ASSEPSVNNNSFILDGSELDDIHDFGSERGNSSPVSQHSCR  562



>ref|XP_006471702.1| PREDICTED: uncharacterized protein LOC102622828 [Citrus sinensis]
Length=262

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = -2

Query  702  GSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsaksss  523
            G+   + +  R++A    +V+PVV+G KMVERV+NMRKLAPP+ +N S+  ++    SSS
Sbjct  89   GNGGCITSARRVNASDGDDVNPVVIGTKMVERVVNMRKLAPPKQENHSTHYTSAGKSSSS  148

Query  522  pdSTGFGRTLSKKSLDMAIRHMDIRRTI-PGNLRPLMTNIPASSMYSVRSGPSRSRTVSV  346
             DS+GFGRTLSKKSLDMA+RHMDIRR+I  G+L+PLMTNIPASSMYSVRSG ++SRTVSV
Sbjct  149  VDSSGFGRTLSKKSLDMALRHMDIRRSINSGSLQPLMTNIPASSMYSVRSGSTKSRTVSV  208

Query  345  SDSPL  331
            +DSPL
Sbjct  209  TDSPL  213



>gb|KJB76929.1| hypothetical protein B456_012G113200 [Gossypium raimondii]
Length=465

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = -2

Query  672  RLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTL  493
            R  A  + N SPVV+G KMVERV+NMRKL PP+ D+    N      SS    +GFGRTL
Sbjct  309  RADANGSDNESPVVIGTKMVERVVNMRKLVPPKQDDNHRNNPTAKLSSSLDS-SGFGRTL  367

Query  492  SKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatssna  313
            SKKSLDMA+RHMDIRR+I G  RPLMTN+PASS+YSVRSG ++SRT+SV DSPLATSS A
Sbjct  368  SKKSLDMAMRHMDIRRSISGQQRPLMTNVPASSIYSVRSGSTKSRTLSVCDSPLATSSTA  427

Query  312  ssevsvnnnaVCIDGHGGE-CEISSDKGARSPPSVH  208
            SSE SVNNN+  +DG   E  +ISS++G  SP S H
Sbjct  428  SSEPSVNNNSFFMDGSEMEDNDISSERGISSPTSQH  463



>gb|EEC69917.1| hypothetical protein OsI_00338 [Oryza sativa Indica Group]
Length=600

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 127/161 (79%), Gaps = 3/161 (2%)
 Frame = -2

Query  705  SGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsn-lsaks  529
            SGSSVP  A+ R H  +  +V+PV MGNKMVERV+NMR+L PP+ D++ S  +      S
Sbjct  439  SGSSVP--AVRRSHLNSGDSVNPVQMGNKMVERVVNMRRLVPPKHDDQRSSLNGLSGKSS  496

Query  528  sspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVS  349
            +SPDS+GFGRTLSKKSLDMA+RHMDIRR+IP NLRPLMT+IPASS++S RSG +RSR +S
Sbjct  497  NSPDSSGFGRTLSKKSLDMALRHMDIRRSIPNNLRPLMTSIPASSVHSARSGSTRSRPIS  556

Query  348  VSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGAR  226
            VSDSPLATSSNASSE SVNNN +C+D    + E+ SD+  +
Sbjct  557  VSDSPLATSSNASSEPSVNNNLMCLDSIEIDDELCSDRAGQ  597



>ref|NP_001041987.1| Os01g0141900 [Oryza sativa Japonica Group]
 dbj|BAF03901.1| Os01g0141900 [Oryza sativa Japonica Group]
 dbj|BAG92172.1| unnamed protein product [Oryza sativa Japonica Group]
Length=606

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 127/161 (79%), Gaps = 3/161 (2%)
 Frame = -2

Query  705  SGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsn-lsaks  529
            SGSSVP  A+ R H  +  +V+PV MGNKMVERV+NMR+L PP+ D++ S  +      S
Sbjct  445  SGSSVP--AVRRSHLNSGDSVNPVQMGNKMVERVVNMRRLVPPKHDDQRSSLNGLSGKSS  502

Query  528  sspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVS  349
            +SPDS+GFGRTLSKKSLDMA+RHMDIRR+IP NLRPLMT+IPASS++S RSG +RSR +S
Sbjct  503  NSPDSSGFGRTLSKKSLDMALRHMDIRRSIPNNLRPLMTSIPASSVHSARSGSTRSRPIS  562

Query  348  VSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGAR  226
            VSDSPLATSSNASSE SVNNN +C+D    + E+ SD+  +
Sbjct  563  VSDSPLATSSNASSEPSVNNNLMCLDSIEIDDELCSDRAGQ  603



>gb|KJB76927.1| hypothetical protein B456_012G113200 [Gossypium raimondii]
Length=570

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = -2

Query  672  RLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTL  493
            R  A  + N SPVV+G KMVERV+NMRKL PP+ D+    N      SS    +GFGRTL
Sbjct  414  RADANGSDNESPVVIGTKMVERVVNMRKLVPPKQDDNHRNNPTAKLSSSLDS-SGFGRTL  472

Query  492  SKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatssna  313
            SKKSLDMA+RHMDIRR+I G  RPLMTN+PASS+YSVRSG ++SRT+SV DSPLATSS A
Sbjct  473  SKKSLDMAMRHMDIRRSISGQQRPLMTNVPASSIYSVRSGSTKSRTLSVCDSPLATSSTA  532

Query  312  ssevsvnnnaVCIDGHGGE-CEISSDKGARSPPSVH  208
            SSE SVNNN+  +DG   E  +ISS++G  SP S H
Sbjct  533  SSEPSVNNNSFFMDGSEMEDNDISSERGISSPTSQH  568



>dbj|BAD61066.1| putative proteophosphoglycan [Oryza sativa Japonica Group]
 gb|EEE53843.1| hypothetical protein OsJ_00320 [Oryza sativa Japonica Group]
Length=601

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 127/161 (79%), Gaps = 3/161 (2%)
 Frame = -2

Query  705  SGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsn-lsaks  529
            SGSSVP  A+ R H  +  +V+PV MGNKMVERV+NMR+L PP+ D++ S  +      S
Sbjct  440  SGSSVP--AVRRSHLNSGDSVNPVQMGNKMVERVVNMRRLVPPKHDDQRSSLNGLSGKSS  497

Query  528  sspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVS  349
            +SPDS+GFGRTLSKKSLDMA+RHMDIRR+IP NLRPLMT+IPASS++S RSG +RSR +S
Sbjct  498  NSPDSSGFGRTLSKKSLDMALRHMDIRRSIPNNLRPLMTSIPASSVHSARSGSTRSRPIS  557

Query  348  VSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGAR  226
            VSDSPLATSSNASSE SVNNN +C+D    + E+ SD+  +
Sbjct  558  VSDSPLATSSNASSEPSVNNNLMCLDSIEIDDELCSDRAGQ  598



>ref|XP_008655627.1| PREDICTED: uncharacterized protein LOC103634815 [Zea mays]
Length=258

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsn-lsakssspdST  511
            +PA+ R H     +V+PV MGNKMVERV+NMR+L PP+ D++ S  ++  +  S+SPDS+
Sbjct  101  MPAVRRSHLNVGDSVNPVQMGNKMVERVVNMRRLVPPKHDDQRSSLNSLAAKSSNSPDSS  160

Query  510  GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            GFGRTLSKKSLDMA+RHMDIRR+IP NLRPLMT+IPASS++S RS  +RSR +SVSDSPL
Sbjct  161  GFGRTLSKKSLDMALRHMDIRRSIPNNLRPLMTSIPASSVHSARSASTRSRPMSVSDSPL  220

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDK  235
            ATS NASSE SVNNN +C+D    + E+ SD+
Sbjct  221  ATSRNASSEPSVNNNLMCLDSIDIDDELCSDR  252



>ref|XP_006595868.1| PREDICTED: flocculation protein FLO11-like isoform X3 [Glycine 
max]
Length=544

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTG  508
            +PA++R ++KAN NVSPVVMG KMVERVINMRKLAPPRLD+K+S ++     SSSPDS+G
Sbjct  382  MPAVNRAYSKANDNVSPVVMGTKMVERVINMRKLAPPRLDDKNSFHNLSGKSSSSPDSSG  441

Query  507  FGRTLSKKSLDMAIRHMDIRRTIPGNLRP-LMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            FGR+LSKKSLDMAIRHMDIRR  PG+LRP LMT IPASSMYSVRSG  RSRT S+S SP 
Sbjct  442  FGRSLSKKSLDMAIRHMDIRRRAPGDLRPSLMTKIPASSMYSVRSGLQRSRTGSISGSPH  501

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ATSSNASSEVSVN N +C+D    + +I S +  +S  SV 
Sbjct  502  ATSSNASSEVSVNQNGLCLDNSEIDDDIVSVRSGQSSASVR  542



>ref|XP_006595866.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Glycine 
max]
Length=678

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTG  508
            +PA++R ++KAN NVSPVVMG KMVERVINMRKLAPPRLD+K+S ++     SSSPDS+G
Sbjct  516  MPAVNRAYSKANDNVSPVVMGTKMVERVINMRKLAPPRLDDKNSFHNLSGKSSSSPDSSG  575

Query  507  FGRTLSKKSLDMAIRHMDIRRTIPGNLRP-LMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            FGR+LSKKSLDMAIRHMDIRR  PG+LRP LMT IPASSMYSVRSG  RSRT S+S SP 
Sbjct  576  FGRSLSKKSLDMAIRHMDIRRRAPGDLRPSLMTKIPASSMYSVRSGLQRSRTGSISGSPH  635

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ATSSNASSEVSVN N +C+D    + +I S +  +S  SV 
Sbjct  636  ATSSNASSEVSVNQNGLCLDNSEIDDDIVSVRSGQSSASVR  676



>ref|XP_006595867.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Glycine 
max]
Length=668

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTG  508
            +PA++R ++KAN NVSPVVMG KMVERVINMRKLAPPRLD+K+S ++     SSSPDS+G
Sbjct  506  MPAVNRAYSKANDNVSPVVMGTKMVERVINMRKLAPPRLDDKNSFHNLSGKSSSSPDSSG  565

Query  507  FGRTLSKKSLDMAIRHMDIRRTIPGNLRP-LMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            FGR+LSKKSLDMAIRHMDIRR  PG+LRP LMT IPASSMYSVRSG  RSRT S+S SP 
Sbjct  566  FGRSLSKKSLDMAIRHMDIRRRAPGDLRPSLMTKIPASSMYSVRSGLQRSRTGSISGSPH  625

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ATSSNASSEVSVN N +C+D    + +I S +  +S  SV 
Sbjct  626  ATSSNASSEVSVNQNGLCLDNSEIDDDIVSVRSGQSSASVR  666



>ref|XP_002457389.1| hypothetical protein SORBIDRAFT_03g006540 [Sorghum bicolor]
 gb|EES02509.1| hypothetical protein SORBIDRAFT_03g006540 [Sorghum bicolor]
Length=600

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 126/158 (80%), Gaps = 3/158 (2%)
 Frame = -2

Query  705  SGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsn-lsaks  529
            SGSS+P  A+ R H     +V+PV MGNKMVERV+NMR+L PP+ D++ S  ++     S
Sbjct  439  SGSSMP--AVRRSHLNGGDSVNPVQMGNKMVERVVNMRRLVPPKHDDQRSSLNSLSGKSS  496

Query  528  sspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVS  349
            +SPDS+GFGRTLSKKSLDMA+RHMDIRR+IP NLRPLMT+IPASS++S RSG +RSR +S
Sbjct  497  NSPDSSGFGRTLSKKSLDMALRHMDIRRSIPNNLRPLMTSIPASSVHSARSGSTRSRPIS  556

Query  348  VSDSPLatssnassevsvnnnaVCIDGHGGECEISSDK  235
            VSDSPLATSSNASSE SVNNN +C+D    + E+ SD+
Sbjct  557  VSDSPLATSSNASSEPSVNNNLMCLDSIDIDDELCSDR  594



>gb|KHN20852.1| hypothetical protein glysoja_009160 [Glycine soja]
Length=668

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTG  508
            +PA++R ++KAN NVSPVVMG KMVERVINMRKLAPPRLD+K+S ++     SSSPDS+G
Sbjct  506  MPAVNRAYSKANDNVSPVVMGTKMVERVINMRKLAPPRLDDKNSFHNLSGKSSSSPDSSG  565

Query  507  FGRTLSKKSLDMAIRHMDIRRTIPGNLRP-LMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            FGR+LSKKSLDMAIRHMDIRR  PG+LRP LMT IPASSMYSVRSG  RSRT S+S SP 
Sbjct  566  FGRSLSKKSLDMAIRHMDIRRRAPGDLRPSLMTKIPASSMYSVRSGLQRSRTGSISGSPH  625

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            ATSSNASSEVSVN N +C+D    + +I S +  +S  SV 
Sbjct  626  ATSSNASSEVSVNQNGLCLDNSEIDDDIVSVRSGQSSASVR  666



>gb|ACL54464.1| unknown [Zea mays]
Length=566

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 126/158 (80%), Gaps = 3/158 (2%)
 Frame = -2

Query  705  SGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkssp-nsnlsaks  529
            SGSS+P  A+ R H     +V+PV MGNKMVERV+NMR+L PP+ D++ S  NS     S
Sbjct  405  SGSSMP--AVRRSHLNGGDSVNPVQMGNKMVERVVNMRRLVPPKHDDQRSSLNSVSGKTS  462

Query  528  sspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVS  349
            +SPDS+GFGRTLSKKSLDMA+RHMDIRR+IP NLRPLMT+IP SS++S RSG +RSR +S
Sbjct  463  NSPDSSGFGRTLSKKSLDMALRHMDIRRSIPNNLRPLMTSIPPSSVHSARSGSTRSRPMS  522

Query  348  VSDSPLatssnassevsvnnnaVCIDGHGGECEISSDK  235
            VSDSPLATSSNASSE SVNNN +C+DG   + E+ SD+
Sbjct  523  VSDSPLATSSNASSEPSVNNNLMCLDGIYMDDELCSDR  560



>ref|XP_008672699.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN27636.1| unknown [Zea mays]
 gb|ACN34315.1| unknown [Zea mays]
 gb|ACR36057.1| unknown [Zea mays]
Length=600

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 126/158 (80%), Gaps = 3/158 (2%)
 Frame = -2

Query  705  SGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkssp-nsnlsaks  529
            SGSS+P  A+ R H     +V+PV MGNKMVERV+NMR+L PP+ D++ S  NS     S
Sbjct  439  SGSSMP--AVRRSHLNGGDSVNPVQMGNKMVERVVNMRRLVPPKHDDQRSSLNSVSGKTS  496

Query  528  sspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVS  349
            +SPDS+GFGRTLSKKSLDMA+RHMDIRR+IP NLRPLMT+IP SS++S RSG +RSR +S
Sbjct  497  NSPDSSGFGRTLSKKSLDMALRHMDIRRSIPNNLRPLMTSIPPSSVHSARSGSTRSRPMS  556

Query  348  VSDSPLatssnassevsvnnnaVCIDGHGGECEISSDK  235
            VSDSPLATSSNASSE SVNNN +C+DG   + E+ SD+
Sbjct  557  VSDSPLATSSNASSEPSVNNNLMCLDGIYMDDELCSDR  594



>ref|XP_008672700.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACN36549.1| unknown [Zea mays]
Length=570

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 126/158 (80%), Gaps = 3/158 (2%)
 Frame = -2

Query  705  SGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkssp-nsnlsaks  529
            SGSS+P  A+ R H     +V+PV MGNKMVERV+NMR+L PP+ D++ S  NS     S
Sbjct  409  SGSSMP--AVRRSHLNGGDSVNPVQMGNKMVERVVNMRRLVPPKHDDQRSSLNSVSGKTS  466

Query  528  sspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVS  349
            +SPDS+GFGRTLSKKSLDMA+RHMDIRR+IP NLRPLMT+IP SS++S RSG +RSR +S
Sbjct  467  NSPDSSGFGRTLSKKSLDMALRHMDIRRSIPNNLRPLMTSIPPSSVHSARSGSTRSRPMS  526

Query  348  VSDSPLatssnassevsvnnnaVCIDGHGGECEISSDK  235
            VSDSPLATSSNASSE SVNNN +C+DG   + E+ SD+
Sbjct  527  VSDSPLATSSNASSEPSVNNNLMCLDGIYMDDELCSDR  564



>ref|NP_001145904.1| hypothetical protein [Zea mays]
 gb|ACL52822.1| unknown [Zea mays]
Length=640

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 126/158 (80%), Gaps = 3/158 (2%)
 Frame = -2

Query  705  SGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkssp-nsnlsaks  529
            SGSS+P  A+ R H     +V+PV MGNKMVERV+NMR+L PP+ D++ S  NS     S
Sbjct  479  SGSSMP--AVRRSHLNGGDSVNPVQMGNKMVERVVNMRRLVPPKHDDQRSSLNSVSGKTS  536

Query  528  sspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVS  349
            +SPDS+GFGRTLSKKSLDMA+RHMDIRR+IP NLRPLMT+IP SS++S RSG +RSR +S
Sbjct  537  NSPDSSGFGRTLSKKSLDMALRHMDIRRSIPNNLRPLMTSIPPSSVHSARSGSTRSRPMS  596

Query  348  VSDSPLatssnassevsvnnnaVCIDGHGGECEISSDK  235
            VSDSPLATSSNASSE SVNNN +C+DG   + E+ SD+
Sbjct  597  VSDSPLATSSNASSEPSVNNNLMCLDGIYMDDELCSDR  634



>ref|XP_006643736.1| PREDICTED: flocculation protein FLO11-like [Oryza brachyantha]
Length=513

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = -2

Query  705  SGSSVPVPAMSRLH-AKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsn-lsak  532
            SGSS+P  A+ R H +    +V+PV MGNKMVERV+NMR+L PP+ D++ S  ++     
Sbjct  351  SGSSMP--AVRRSHLSNGGDSVNPVQMGNKMVERVVNMRRLVPPKHDDQRSSLNSLSGKS  408

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
            S+SPDS+GFGRTLSKKSLDMA+RHMDIRR+IP NLRPLMT+IPASS++S RSG +RSR +
Sbjct  409  SNSPDSSGFGRTLSKKSLDMALRHMDIRRSIPNNLRPLMTSIPASSVHSARSGSTRSRPI  468

Query  351  SVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGAR  226
            SVSDSPLATSSNASSE SVNNN +C+D    + E+ SD+  +
Sbjct  469  SVSDSPLATSSNASSEPSVNNNLMCLDSIDIDDELCSDRAGQ  510



>ref|XP_009402293.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Musa acuminata subsp. malaccensis]
 ref|XP_009402294.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Musa acuminata subsp. malaccensis]
Length=527

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 122/163 (75%), Gaps = 4/163 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H  GS   V A S+  A+   N +PVV+GN+MVER  N+R+LAPP+ DN+   N NLS K
Sbjct  359  HKGGS---VQAPSKRQARDGDNSNPVVLGNRMVERTANVRRLAPPKQDNQRLTNDNLSGK  415

Query  531  s-sspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRT  355
            +  SPDSTGFGR+LSK+SLDMA RHMDIRR+IP +LRPLM NIPASS+YSVRSG +RSRT
Sbjct  416  TCVSPDSTGFGRSLSKQSLDMAFRHMDIRRSIPNSLRPLMANIPASSVYSVRSGSTRSRT  475

Query  354  VSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGAR  226
            VS S SPL TSS  SSE SVNNN  C+  +  E +++SDKG R
Sbjct  476  VSASGSPLTTSSTTSSEQSVNNNMTCLGRNEIEDDLTSDKGVR  518



>ref|XP_004968162.1| PREDICTED: mucin-5AC-like isoform X1 [Setaria italica]
Length=591

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 125/158 (79%), Gaps = 3/158 (2%)
 Frame = -2

Query  705  SGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsn-lsaks  529
            SGSS+P  A+ R H     +V+PV MGNKMVERV++MR+L PP+ D++ S  ++     S
Sbjct  430  SGSSMP--AVRRSHLNGGDSVNPVQMGNKMVERVVHMRRLVPPKHDDQRSSLNSISGKSS  487

Query  528  sspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVS  349
            +SPDS+GFGRTLSKKSLDMA+RHMDIRR+IP NLRPLMT IPASS++S RSG +RSR +S
Sbjct  488  NSPDSSGFGRTLSKKSLDMALRHMDIRRSIPNNLRPLMTTIPASSVHSARSGSTRSRPMS  547

Query  348  VSDSPLatssnassevsvnnnaVCIDGHGGECEISSDK  235
            VSDSPLATSSNASSE SVNNN +C+D    + E+ SD+
Sbjct  548  VSDSPLATSSNASSEPSVNNNLMCLDSIDIDDELCSDR  585



>ref|XP_004968163.1| PREDICTED: mucin-5AC-like isoform X2 [Setaria italica]
Length=568

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 125/158 (79%), Gaps = 3/158 (2%)
 Frame = -2

Query  705  SGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsn-lsaks  529
            SGSS+P  A+ R H     +V+PV MGNKMVERV++MR+L PP+ D++ S  ++     S
Sbjct  407  SGSSMP--AVRRSHLNGGDSVNPVQMGNKMVERVVHMRRLVPPKHDDQRSSLNSISGKSS  464

Query  528  sspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVS  349
            +SPDS+GFGRTLSKKSLDMA+RHMDIRR+IP NLRPLMT IPASS++S RSG +RSR +S
Sbjct  465  NSPDSSGFGRTLSKKSLDMALRHMDIRRSIPNNLRPLMTTIPASSVHSARSGSTRSRPMS  524

Query  348  VSDSPLatssnassevsvnnnaVCIDGHGGECEISSDK  235
            VSDSPLATSSNASSE SVNNN +C+D    + E+ SD+
Sbjct  525  VSDSPLATSSNASSEPSVNNNLMCLDSIDIDDELCSDR  562



>ref|XP_003568404.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form [Brachypodium distachyon]
Length=605

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 128/161 (80%), Gaps = 3/161 (2%)
 Frame = -2

Query  705  SGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsaks-  529
            SGSS+P  A+ R H     +V+PV MGNKMVERV+NMR+L PP+ D++ S  ++LS KS 
Sbjct  444  SGSSMP--AVRRSHLNGGDSVNPVQMGNKMVERVVNMRRLVPPKHDDQRSSLNSLSGKSL  501

Query  528  sspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVS  349
            +SPDS+GFGR+LSKKSLDMA+RHMDIRR+IP NLRPLMT+IPASS++S RSG +R R +S
Sbjct  502  NSPDSSGFGRSLSKKSLDMALRHMDIRRSIPNNLRPLMTSIPASSVHSARSGSTRGRPMS  561

Query  348  VSDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGAR  226
            VSDSPLATSSNASSE SVNNN +C D    + E+ SD+  +
Sbjct  562  VSDSPLATSSNASSEPSVNNNLMCFDSIDIDDELCSDRAGQ  602



>gb|KHG09845.1| Maturase K [Gossypium arboreum]
Length=568

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 114/156 (73%), Gaps = 4/156 (3%)
 Frame = -2

Query  672  RLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTL  493
            R  A  + N SPVV+G KMVERV+NMRKL PP+ D+    N      +S    +GFGRTL
Sbjct  414  RADANGSDNESPVVIGTKMVERVVNMRKLVPPKQDDNHRNNPTAKLSTSLDS-SGFGRTL  472

Query  492  SKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatssna  313
            SKKSLDMA+RHMDIRR+I G+   LMTN+PASS+YSVRSG ++SRT+SV DSPLATSS A
Sbjct  473  SKKSLDMAMRHMDIRRSISGHK--LMTNVPASSIYSVRSGSTKSRTLSVCDSPLATSSTA  530

Query  312  ssevsvnnnaVCIDGHGGE-CEISSDKGARSPPSVH  208
            SSE SVNNN+  +DG   E  +ISS++G  SP S H
Sbjct  531  SSEPSVNNNSFFMDGSEMEDNDISSERGISSPTSQH  566



>ref|XP_006848188.1| hypothetical protein AMTR_s00029p00238480 [Amborella trichopoda]
 gb|ERN09769.1| hypothetical protein AMTR_s00029p00238480 [Amborella trichopoda]
Length=631

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 120/163 (74%), Gaps = 6/163 (4%)
 Frame = -2

Query  678  MSRLHAKANAN-VSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdST---  511
            +++ ++  N++ V+P ++G KMVERVIN R+LAPP  D ++S     S        +   
Sbjct  441  LNKGYSNGNSDSVNPGLIGTKMVERVINSRRLAPPSRDEEASLKHGQSKVQVKASGSPDS  500

Query  510  -GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSP  334
             GFGR LSKKSLDMA+RHMDIRR+IP  LRPL+TNIPASSMYSVRSG +RSR VSVSDSP
Sbjct  501  GGFGRNLSKKSLDMALRHMDIRRSIPSGLRPLITNIPASSMYSVRSGSTRSRPVSVSDSP  560

Query  333  Latssnassevsvnnna-VCIDGHGGECEISSDKGARSPPSVH  208
            LATSSNASSE SVNNN  +CIDG+  E +  S++G+ S P+ +
Sbjct  561  LATSSNASSEQSVNNNNILCIDGNEMEEDSRSERGSLSSPATY  603



>ref|XP_010923060.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
 ref|XP_010923061.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
 ref|XP_010923062.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
Length=542

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 129/158 (82%), Gaps = 1/158 (1%)
 Frame = -2

Query  687  VPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnkssp-nsnlsakssspdST  511
            VPA+SR H      ++PV++GNKMVERV+NMR+LAPP+ D++ S  N+     S SPDST
Sbjct  376  VPAVSRSHLNGGDCLNPVLIGNKMVERVVNMRRLAPPKQDDQRSAHNNLPGKPSLSPDST  435

Query  510  GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            GFGRTLSKKSLDMA+RHMDIRR+IP +LRPLM+ +PASSMYSVRSG SRSR VSVSDSPL
Sbjct  436  GFGRTLSKKSLDMALRHMDIRRSIPNSLRPLMSKVPASSMYSVRSGSSRSRPVSVSDSPL  495

Query  330  atssnassevsvnnnaVCIDGHGGECEISSDKGARSPP  217
            ATSSNASSE SVNNN +C++G   E ++SS+KG RS P
Sbjct  496  ATSSNASSEQSVNNNMICLNGSELEDDLSSEKGGRSSP  533



>ref|XP_002528111.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34290.1| conserved hypothetical protein [Ricinus communis]
Length=513

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 122/169 (72%), Gaps = 2/169 (1%)
 Frame = -2

Query  702  GSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsaksss  523
            GS + +P   R     + +V+P++MG KMVERV+NMRKLAPP+ D+  S  +N   KSSS
Sbjct  346  GSRISIPTKGRAQNNGSDDVNPILMGTKMVERVVNMRKLAPPKQDDHHSLLNNSGGKSSS  405

Query  522  pdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPS-RSRTVSV  346
             DSTGFGRTLSKKSLDMA+RHMDIRR+I GNLRPL T+IPASS+YSVRSG S + +T SV
Sbjct  406  LDSTGFGRTLSKKSLDMALRHMDIRRSISGNLRPL-TSIPASSVYSVRSGGSTKGKTSSV  464

Query  345  SDSPLatssnassevsvnnnaVCIDGHGGECEISSDKGARSPPSVHSSR  199
             DSPLATSSNASSE SVNNN++  DG   E      +     P+ HS +
Sbjct  465  LDSPLATSSNASSEPSVNNNSLFADGIEMEVNDFGSENGNCSPTSHSGK  513



>ref|XP_010109621.1| hypothetical protein L484_015576 [Morus notabilis]
 gb|EXC23666.1| hypothetical protein L484_015576 [Morus notabilis]
Length=518

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 106/142 (75%), Gaps = 1/142 (1%)
 Frame = -2

Query  681  AMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFG  502
            AMS+        VSPVV+G +MVERV+NMRKLAPP+ ++  S N++      S    GFG
Sbjct  368  AMSKSRCNDIDEVSPVVIGTQMVERVVNMRKLAPPKREDDHSNNNSAGKSLFSDSL-GFG  426

Query  501  RTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLats  322
            RTLSKKSLDMA+RHMDIRR++ GNLRP++T+IP SSMYS+RSG +++R  S SDSPLATS
Sbjct  427  RTLSKKSLDMALRHMDIRRSMQGNLRPVVTSIPVSSMYSIRSGGTKNRATSNSDSPLATS  486

Query  321  snassevsvnnnaVCIDGHGGE  256
            SNASSE SVNN   C+DG   E
Sbjct  487  SNASSEPSVNNAFTCLDGSDAE  508



>ref|XP_008243876.1| PREDICTED: flocculation protein FLO11-like [Prunus mume]
Length=543

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 119/164 (73%), Gaps = 8/164 (5%)
 Frame = -2

Query  678  MSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGR  499
            +SR  +  + +V+PV++G +MVERV+N RKLAPP+  +  +  +N + KS S +S+GFGR
Sbjct  384  ISRPSSNDSDDVNPVLIGTQMVERVVNSRKLAPPKQYDHHTTQNNSAGKSLSSESSGFGR  443

Query  498  TLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatss  319
             LSKKS DMA+RHMDIRR++ GNLRP++TN+PASS+YSVR+ P++S+T S +DSPLAT S
Sbjct  444  NLSKKSFDMAMRHMDIRRSVTGNLRPVLTNVPASSVYSVRTRPAKSKTASATDSPLATCS  503

Query  318  nassevsvnnnaVCIDGHGGECEISS----DKGARSPPSVHSSR  199
            NASSE SVNN  V ++G    CEI       +G  S P+ H  R
Sbjct  504  NASSEPSVNNIPVTLEG----CEIEDVDLGSEGGNSSPASHQGR  543



>ref|XP_007208455.1| hypothetical protein PRUPE_ppa003864mg [Prunus persica]
 gb|EMJ09654.1| hypothetical protein PRUPE_ppa003864mg [Prunus persica]
Length=543

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 119/164 (73%), Gaps = 8/164 (5%)
 Frame = -2

Query  678  MSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGR  499
            +SR  +  + +V+PV++G +MVERV+N RKLAPP+  +  +  +N + KS S +S+GFGR
Sbjct  384  ISRPSSNDSDDVNPVLIGTQMVERVVNSRKLAPPKQYDHHTTQNNSAGKSLSSESSGFGR  443

Query  498  TLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatss  319
             LSKKS DMA+RHMDIRR++ GNLRP++TN+PASS+YSVR+ P++S+T S +DSPLAT S
Sbjct  444  NLSKKSFDMAMRHMDIRRSMTGNLRPVLTNVPASSVYSVRTRPAKSKTTSATDSPLATCS  503

Query  318  nassevsvnnnaVCIDGHGGECEISS----DKGARSPPSVHSSR  199
            NASSE SV+N  V ++G    CEI       +G  S P+ H  R
Sbjct  504  NASSEPSVSNIPVSLEG----CEIEDVDLGSEGGNSSPASHQGR  543



>emb|CBI30400.3| unnamed protein product [Vitis vinifera]
Length=132

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 96/129 (74%), Gaps = 2/129 (2%)
 Frame = -2

Query  597  MRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPL  418
            MRKLAPP+ D+  S +    + S+    +GFGRTLSKKSLDMA+RHMDIRR+I GNLRPL
Sbjct  1    MRKLAPPKQDDHRSAHPAGKSSSAPDS-SGFGRTLSKKSLDMALRHMDIRRSIQGNLRPL  59

Query  417  MTNIPASSMYSVRSGPSRSRTVSVSDSPLatssnassevsvnnnaVCIDGHGGE-CEISS  241
            MTNIPASSMYSVRSGP++S T SVS SPLATSS  SSE SVN N+ C  G   E  E+ S
Sbjct  60   MTNIPASSMYSVRSGPTKSSTASVSGSPLATSSITSSEPSVNENSHCFYGSEIEDDELGS  119

Query  240  DKGARSPPS  214
            D+G  SP S
Sbjct  120  DRGHSSPAS  128



>gb|KDP24464.1| hypothetical protein JCGZ_25028 [Jatropha curcas]
Length=512

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 93/124 (75%), Gaps = 3/124 (2%)
 Frame = -2

Query  702  GSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsaksss  523
            G  + +P  SR    +  +VSPV+MG KMVERV+NMRKL PP+ D+ S+ N++    SS 
Sbjct  357  GRRISIPTKSRTQTSSGDDVSPVLMGTKMVERVVNMRKLVPPKQDDHSTHNNSTGKSSSL  416

Query  522  pdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPS-RSRTVSV  346
               TGFGRTLSKKSLDMA+RHMDIRR+I GNLRPL T+IPASS+YSVRSG S +S+T S 
Sbjct  417  DG-TGFGRTLSKKSLDMALRHMDIRRSISGNLRPL-TSIPASSVYSVRSGGSAKSKTYSG  474

Query  345  SDSP  334
             DSP
Sbjct  475  LDSP  478



>ref|XP_008388204.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Malus domestica]
 ref|XP_008359786.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Malus domestica]
Length=546

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 112/160 (70%), Gaps = 9/160 (6%)
 Frame = -2

Query  678  MSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGR  499
            +SR  A  N +V+PV+MG +MVERV+N R+LAPP+  +  +     + K SS +S+GFGR
Sbjct  387  ISRASAHDNDDVNPVLMGTQMVERVVNSRRLAPPKQYDHYTTLKGSAGKPSSSESSGFGR  446

Query  498  TLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatss  319
             LSKKS DMA+RHMDI+R++ GNLRP++TN+PASS YSVR+ P +S T+   DSPLAT S
Sbjct  447  NLSKKSFDMAMRHMDIKRSMAGNLRPVLTNVPASSGYSVRTKPXKSNTIGAMDSPLATCS  506

Query  318  nassevsvnnnaVCIDGHGGECEIS-----SDKGARSPPS  214
            NASSE SVN   V ++G    CE+      S++G  SP S
Sbjct  507  NASSEPSVNTIPVSLEG----CEVEDIDLGSERGNSSPAS  542



>ref|XP_009344715.1| PREDICTED: flocculation protein FLO11-like [Pyrus x bretschneideri]
Length=550

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 113/160 (71%), Gaps = 9/160 (6%)
 Frame = -2

Query  678  MSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGR  499
            +SR  A  N +V+PV+MG +MVERV+N R+LAPP+  +  +     + K SS +S+GFGR
Sbjct  391  ISRASAHDNDDVNPVLMGTQMVERVVNSRRLAPPKQYDHYNTLKGSAGKPSSSESSGFGR  450

Query  498  TLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatss  319
             LSKKS DMA+RHMDI+R++ GNLRP++TN+PAS  YSVR+ P++S T+   DSPLAT S
Sbjct  451  NLSKKSFDMAMRHMDIKRSMAGNLRPVLTNVPASCGYSVRTKPTKSNTIGAMDSPLATCS  510

Query  318  nassevsvnnnaVCIDGHGGECEIS-----SDKGARSPPS  214
            NASSE SVNN  V ++G    CE+      S++G  SP S
Sbjct  511  NASSEPSVNNIPVSLEG----CEVEDIDLGSERGNSSPAS  546



>ref|XP_010543220.1| PREDICTED: mucin-1-like [Tarenaya hassleriana]
Length=523

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 101/144 (70%), Gaps = 9/144 (6%)
 Frame = -2

Query  639  PVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKKSLDMAIRH  460
            PV MG+KMVERV+NMRKLAPPR       + +     SS DS G+GR LSK SLDMA+RH
Sbjct  376  PVAMGSKMVERVVNMRKLAPPR-----QSDRSNGKPISSLDSLGYGRNLSKSSLDMALRH  430

Query  459  MDIRRTIPGNLRPLMTNIPASSMYSVRSGPS-RSRTVSVSDSPLatssnassevsvnnna  283
            MDIRR+  GNLRPL+T +PASSMYSVR+  S RSRT SVSDSPLAT+S+ +S     NN 
Sbjct  431  MDIRRSFNGNLRPLVTKVPASSMYSVRTSTSGRSRTTSVSDSPLATTSSPTSSEPSVNNI  490

Query  282  V--CIDGHGGEC-EISSDKGARSP  220
               C+DG   E  ++ S++G  SP
Sbjct  491  NILCLDGSEAENDDLLSERGNSSP  514



>emb|CDY53090.1| BnaCnng24200D [Brassica napus]
Length=510

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 98/144 (68%), Gaps = 9/144 (6%)
 Frame = -2

Query  675  SRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRT  496
            +R   KAN   SPV MGNKMVERV+NMRKL PPRL    S     S  SS+ +S G+GR 
Sbjct  354  ARGRGKANNGDSPVAMGNKMVERVVNMRKLGPPRL--TESGGRGTSKSSSAFNSLGYGRN  411

Query  495  LSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatssn  316
            LSK S+DMA+RHMDIRR + GNLRPL+T +PASSMYSV     RSR+ SV++SP+ATSS 
Sbjct  412  LSKSSIDMALRHMDIRRGMTGNLRPLVTKVPASSMYSV-----RSRSNSVTNSPMATSST  466

Query  315  assevsvnnnaV--CIDGHGGECE  250
             SS     +N    C+DG+  E +
Sbjct  467  VSSSEPNFDNINILCLDGNDAEND  490



>emb|CDY44674.1| BnaA05g29320D [Brassica napus]
Length=529

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 98/144 (68%), Gaps = 9/144 (6%)
 Frame = -2

Query  675  SRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRT  496
            +R   KAN   SPV MGNKMVERV+NMRKL PPRL    S     +  SS+ +S G+GR 
Sbjct  373  ARGRGKANNGDSPVAMGNKMVERVVNMRKLGPPRL--TESGGRGTAKSSSAFNSLGYGRN  430

Query  495  LSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatssn  316
            LSK S+DMA+RHMDIRR + GNLRPL+T +PASSMYSVRS P+     SV++SP+ATSS 
Sbjct  431  LSKSSIDMALRHMDIRRGMTGNLRPLVTKVPASSMYSVRSRPN-----SVTNSPMATSST  485

Query  315  assevsvnnnaV--CIDGHGGECE  250
             SS     +N    C+DG+  E +
Sbjct  486  VSSSEPNLDNINILCLDGNDAEND  509



>ref|XP_009146960.1| PREDICTED: flocculation protein FLO11-like [Brassica rapa]
Length=529

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 98/144 (68%), Gaps = 9/144 (6%)
 Frame = -2

Query  675  SRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRT  496
            +R   KAN   SPV MGNKMVERV+NMRKL PPRL    S     +  SS+ +S G+GR 
Sbjct  373  ARGRGKANNGDSPVAMGNKMVERVVNMRKLGPPRL--TESGGRGTAKSSSAFNSLGYGRN  430

Query  495  LSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatssn  316
            LSK S+DMA+RHMDIRR + GNLRPL+T +PASSMYSVRS P+     SV++SP+ATSS 
Sbjct  431  LSKSSIDMALRHMDIRRGMTGNLRPLVTKVPASSMYSVRSRPN-----SVTNSPMATSST  485

Query  315  assevsvnnnaV--CIDGHGGECE  250
             SS     +N    C+DG+  E +
Sbjct  486  VSSSEPNLDNINILCLDGNDAEND  509



>ref|XP_007140357.1| hypothetical protein PHAVU_008G105200g [Phaseolus vulgaris]
 gb|ESW12351.1| hypothetical protein PHAVU_008G105200g [Phaseolus vulgaris]
Length=509

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 95/129 (74%), Gaps = 4/129 (3%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +HN+ +S+ V  +SR       + SPVV+G KMVERV+NMRKLAPP+ D+  S   N   
Sbjct  353  VHNNHTSMQV--LSRARFTDANDESPVVIGTKMVERVVNMRKLAPPKHDDHHSSRDNAYG  410

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMY-SVRSGPSRSR  358
            KSSS   +GFG TLSKKSLDMA+RHMDIRR+I GNLRPL+T+IPASSMY       S+SR
Sbjct  411  KSSSGT-SGFGTTLSKKSLDMAMRHMDIRRSIQGNLRPLVTSIPASSMYSVRSGSSSKSR  469

Query  357  TVSVSDSPL  331
            T+SVSDSPL
Sbjct  470  TMSVSDSPL  478



>ref|XP_009377788.1| PREDICTED: mucin-2-like [Pyrus x bretschneideri]
Length=549

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 109/144 (76%), Gaps = 4/144 (3%)
 Frame = -2

Query  678  MSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGR  499
            +SR  +  N +V+PV++G +MVERV+N RKLAPP+  +  + ++    KSSS +++GFGR
Sbjct  392  ISRASSHDNDDVNPVLIGTQMVERVVNSRKLAPPKHYDHHNTDNGSGGKSSSSENSGFGR  451

Query  498  TLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatss  319
             LSKKS+DMA+RHMDIRR++PGNLRP++TN+PASS YSVR  P++S T    DSPLAT S
Sbjct  452  NLSKKSIDMAMRHMDIRRSMPGNLRPVLTNVPASSGYSVRIKPTKSNTTGAMDSPLATCS  511

Query  318  nassevsvnnnaVCIDGHGGECEI  247
            NASSE SVNN  + ++G    CEI
Sbjct  512  NASSEPSVNNIPLSLEG----CEI  531



>ref|XP_009603333.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X3 [Nicotiana tomentosiformis]
Length=500

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H+SGSSVP+PAMSRLHAKAN NVSPV++G+KMVERV+NMRKLAPP+ D+K SP SNLS K
Sbjct  405  HSSGSSVPIPAMSRLHAKANDNVSPVMVGSKMVERVVNMRKLAPPKQDDKQSPRSNLSTK  464

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDI  451
            SSSPDS+GFGRT SKKSLDMAIRHM  
Sbjct  465  SSSPDSSGFGRTFSKKSLDMAIRHMTF  491



>ref|XP_009123519.1| PREDICTED: sialidase-like [Brassica rapa]
Length=515

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 7/116 (6%)
 Frame = -2

Query  675  SRLHAKANAN-VSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGR  499
            +R+  KAN +  SPV MGNKMVERV+NMRKL PPRL  ++         +S+ ++ G+GR
Sbjct  371  ARVRGKANNDSFSPVAMGNKMVERVVNMRKLGPPRL-TENCGGRGTLKSNSAFNTLGYGR  429

Query  498  TLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
             LSK S+DMA+RHMDIRR + GNLRPL+T +PAS+MYSV     RSR+ SV++SP+
Sbjct  430  NLSKSSIDMALRHMDIRRGMTGNLRPLVTKVPASAMYSV-----RSRSTSVTNSPV  480



>ref|XP_009603328.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X2 [Nicotiana tomentosiformis]
Length=524

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            H+SGSSVP+PAMSRLHAKAN NVSPV++G+KMVERV+NMRKLAPP+ D+K SP SNLS K
Sbjct  405  HSSGSSVPIPAMSRLHAKANDNVSPVMVGSKMVERVVNMRKLAPPKQDDKQSPRSNLSTK  464

Query  531  ssspdSTGFGRTLSKKSLDMAIRHM  457
            SSSPDS+GFGRT SKKSLDMAIRHM
Sbjct  465  SSSPDSSGFGRTFSKKSLDMAIRHM  489



>ref|XP_004302638.1| PREDICTED: endochitinase A-like [Fragaria vesca subsp. vesca]
Length=530

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 104/147 (71%), Gaps = 10/147 (7%)
 Frame = -2

Query  645  VSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKKSLDMAI  466
            V+PV+MG + VERV+N RKLAPP+     S   N   KS S DS GFGRTLSKKS DMA+
Sbjct  383  VNPVLMGTQSVERVVNQRKLAPPK-QYDRSTQKNPDGKSMSSDSLGFGRTLSKKSFDMAM  441

Query  465  RHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatssnassevsvnnn  286
            RHMDIRR++  NL+P++T +PASS+YSVR+ P++S+T + +DSPLAT SNASSE SVNN 
Sbjct  442  RHMDIRRSVQDNLQPVLTKVPASSVYSVRTRPTKSKTTNATDSPLATCSNASSEPSVNN-  500

Query  285  aVCIDGHGGECEIS-----SDKGARSP  220
               +  +   CEI      S+KG  SP
Sbjct  501  ---VSAYFEACEIEDVDHGSEKGNSSP  524



>ref|XP_010486449.1| PREDICTED: flocculation protein FLO11-like [Camelina sativa]
 ref|XP_010486450.1| PREDICTED: flocculation protein FLO11-like [Camelina sativa]
 ref|XP_010486451.1| PREDICTED: flocculation protein FLO11-like [Camelina sativa]
Length=532

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 82/118 (69%), Gaps = 11/118 (9%)
 Frame = -2

Query  672  RLHAKAN----ANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGF  505
            R  AKAN     ++SPV MGNKMVERV+NMRKL PPRL    S        +S+ +S G+
Sbjct  373  RGRAKANNGGSDSLSPVAMGNKMVERVVNMRKLGPPRL--TESGGRGTGKSNSAFNSLGY  430

Query  504  GRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            GR LSK S+DMA+RHMDIRR + GNLRPL+T +PASSMYSVRS P      SVS SP+
Sbjct  431  GRNLSKSSIDMALRHMDIRRGMTGNLRPLVTKVPASSMYSVRSRP-----TSVSSSPM  483



>gb|KFK38285.1| hypothetical protein AALP_AA3G094600 [Arabis alpina]
Length=524

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 90/130 (69%), Gaps = 8/130 (6%)
 Frame = -2

Query  645  VSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKKSLDMAI  466
            +SPV MGNKMVERV+NMRKL PPRL+      +  S  + +    G+GR LSK S+DMA+
Sbjct  381  LSPVAMGNKMVERVVNMRKLGPPRLNESGGRGTGKSNSAFNSL--GYGRNLSKSSIDMAL  438

Query  465  RHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatssnassevsvnnn  286
            RHMDIRR + GNLRPL+T +PASSMYSV     RSR  SV++SP+  +S++S     N N
Sbjct  439  RHMDIRRGMTGNLRPLVTKVPASSMYSV-----RSRPASVTNSPV-ATSSSSEPSVDNIN  492

Query  285  aVCIDGHGGE  256
             +C+DG+  E
Sbjct  493  ILCLDGNEAE  502



>emb|CDY22176.1| BnaC01g39250D [Brassica napus]
Length=516

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 7/116 (6%)
 Frame = -2

Query  675  SRLHAKA-NANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGR  499
            +R+  KA N + SPV MGNKMVERV+NMRKL PPRL  ++         +S+ ++ G+GR
Sbjct  372  ARVRGKAYNDSFSPVAMGNKMVERVVNMRKLGPPRL-TENGGGRGTVKSNSAFNTLGYGR  430

Query  498  TLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
             LSK S+DMA+RHMDIRR + GNLRPL+T +PAS+MYSV     RSR+ SV++SP+
Sbjct  431  NLSKSSIDMALRHMDIRRGMTGNLRPLVTKVPASAMYSV-----RSRSTSVTNSPV  481



>ref|NP_566340.1| proline-rich uncharacterized protein [Arabidopsis thaliana]
 gb|AAD56316.1|AC009326_3 hypothetical protein [Arabidopsis thaliana]
 gb|AAF07827.1|AC010871_3 hypothetical protein [Arabidopsis thaliana]
 gb|AAL16108.1|AF428276_1 AT3g09000/T16O11_4 [Arabidopsis thaliana]
 gb|AAN31886.1| unknown protein [Arabidopsis thaliana]
 gb|AAV85714.1| At3g09000 [Arabidopsis thaliana]
 gb|AEE74707.1| proline-rich uncharacterized protein [Arabidopsis thaliana]
Length=541

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 91/133 (68%), Gaps = 9/133 (7%)
 Frame = -2

Query  648  NVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKKSLDMA  469
            N+SPV MGNKMVERV+NMRKL PPRL    +        SS+ +S G+GR LSK S+DMA
Sbjct  393  NLSPVAMGNKMVERVVNMRKLGPPRL--TENGGRGSGKSSSAFNSLGYGRNLSKSSIDMA  450

Query  468  IRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatssnassevsvnn  289
            IRHMDIRR + GNLRPL+T +PASSMYSVRS P      SVS SP+ATSS  SS     +
Sbjct  451  IRHMDIRRGMTGNLRPLVTKVPASSMYSVRSRPG-----SVSSSPVATSSTVSSSDPSVD  505

Query  288  naV--CIDGHGGE  256
            N    C+DG+  E
Sbjct  506  NINILCLDGNEAE  518



>ref|XP_010467544.1| PREDICTED: mucin-5AC-like [Camelina sativa]
 ref|XP_010467611.1| PREDICTED: mucin-5AC-like [Camelina sativa]
Length=542

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  672  RLHAKAN----ANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGF  505
            R  AKAN     ++SPV MGNKMVERV+NMRKL PPRL    +        +S+ +S G+
Sbjct  383  RGRAKANNSGSDSLSPVAMGNKMVERVVNMRKLGPPRL--TENGGRGTGKSNSAFNSLGY  440

Query  504  GRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLat  325
            GR LSK S+DMA+RHMDIRR + GNLRPL+T +PASSMYSVRS P      SVS SP+AT
Sbjct  441  GRNLSKSSIDMALRHMDIRRGMTGNLRPLVTKVPASSMYSVRSRP-----ASVSSSPMAT  495

Query  324  ssnassevsvnnnaV--CIDGHGGE  256
            SS  SS     +N    C+DG+  E
Sbjct  496  SSTVSSSEPSVDNINILCLDGNEAE  520



>ref|XP_006299014.1| hypothetical protein CARUB_v10015141mg [Capsella rubella]
 gb|EOA31912.1| hypothetical protein CARUB_v10015141mg [Capsella rubella]
Length=523

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 82/120 (68%), Gaps = 13/120 (11%)
 Frame = -2

Query  672  RLHAKAN------ANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdST  511
            R  AKAN       ++SPV MGNKMVERV+NMRKL PPRL    S        SS+ +S 
Sbjct  362  RGRAKANNVGSSCDSLSPVAMGNKMVERVVNMRKLGPPRL--TDSGGRGTGKSSSAFNSL  419

Query  510  GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            G+GR LSK S+DMA+RHMDIRR + GNLRPL+T +PASSMYSVRS P      SVS SP+
Sbjct  420  GYGRNLSKSSIDMALRHMDIRRGMTGNLRPLVTKVPASSMYSVRSRP-----ASVSSSPV  474



>ref|XP_009588559.1| PREDICTED: uncharacterized protein DDB_G0274915-like isoform 
X2 [Nicotiana tomentosiformis]
Length=535

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = -2

Query  681  AMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFG  502
            + SR H     +V+PV++G +MVERV+NMRKLAPP+ D+     +      S  + +GFG
Sbjct  374  SKSRGHGYEKDDVNPVLIGTQMVERVVNMRKLAPPKQDDNPYQENPSKKSLSREN-SGFG  432

Query  501  RTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            R+ SKKSLDMA+RHMDIRR++ G LRP++T + +SS   +RS  ++++T SVSDSPL
Sbjct  433  RSFSKKSLDMALRHMDIRRSVNGTLRPVLTRVSSSSANGIRSSSTKNKTGSVSDSPL  489



>ref|XP_010464524.1| PREDICTED: cell wall protein DAN4-like [Camelina sativa]
 ref|XP_010464525.1| PREDICTED: cell wall protein DAN4-like [Camelina sativa]
Length=541

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 81/119 (68%), Gaps = 12/119 (10%)
 Frame = -2

Query  672  RLHAKANAN-----VSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTG  508
            R  AKA  N     +SPV MGNKMVERV+NMRKL PPRL    S        +S+ +S G
Sbjct  381  RGRAKAANNSGSDSLSPVAMGNKMVERVVNMRKLGPPRL--TESGGRGTGKSNSAFNSLG  438

Query  507  FGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            +GR LSK S+DMA+RHMDIRR + GNLRPL+T +PASSMYSVRS P      SVS SP+
Sbjct  439  YGRNLSKSSIDMALRHMDIRRGMTGNLRPLVTKVPASSMYSVRSRP-----ASVSSSPM  492



>ref|XP_009588557.1| PREDICTED: uncharacterized protein DDB_G0274915-like isoform 
X1 [Nicotiana tomentosiformis]
Length=550

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = -2

Query  681  AMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFG  502
            + SR H     +V+PV++G +MVERV+NMRKLAPP+ D+     +      S  + +GFG
Sbjct  389  SKSRGHGYEKDDVNPVLIGTQMVERVVNMRKLAPPKQDDNPYQENPSKKSLSREN-SGFG  447

Query  501  RTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            R+ SKKSLDMA+RHMDIRR++ G LRP++T + +SS   +RS  ++++T SVSDSPL
Sbjct  448  RSFSKKSLDMALRHMDIRRSVNGTLRPVLTRVSSSSANGIRSSSTKNKTGSVSDSPL  504



>ref|XP_006407721.1| hypothetical protein EUTSA_v10020521mg [Eutrema salsugineum]
 gb|ESQ49174.1| hypothetical protein EUTSA_v10020521mg [Eutrema salsugineum]
Length=518

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 7/106 (7%)
 Frame = -2

Query  648  NVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKKSLDMA  469
            ++SPV MGNKMVERV+NMRKL PPRL    S        SS+ +S G+GR LSK S+DMA
Sbjct  371  SLSPVAMGNKMVERVVNMRKLGPPRL--TESGGRGTGKSSSAFNSLGYGRNLSKSSIDMA  428

Query  468  IRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            +RHMDIRR + GNLRPL+T +PASSMYSVRS P      SV++SP+
Sbjct  429  LRHMDIRRGMTGNLRPLVTKVPASSMYSVRSRP-----ASVTNSPM  469



>ref|XP_004246841.1| PREDICTED: endochitinase A-like [Solanum lycopersicum]
Length=535

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = -2

Query  681  AMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFG  502
            + SR +     +V+PV++G +MVERV+NMRKLAPP+ D+  S  ++     S  + +GFG
Sbjct  381  SKSRGYGIEKDDVNPVLIGTQMVERVVNMRKLAPPKQDDNVSHENSSKKSLSREN-SGFG  439

Query  501  RTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            R+ SKKSLDMA+RHMDIRR++ G LRP++T + ASS   VRS  ++++T SVSDSPL
Sbjct  440  RSFSKKSLDMALRHMDIRRSVNGTLRPVLTRVSASSANGVRSSSTKNKTGSVSDSPL  496



>ref|XP_008370081.1| PREDICTED: flocculation protein FLO11-like [Malus domestica]
Length=552

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 113/151 (75%), Gaps = 5/151 (3%)
 Frame = -2

Query  678  MSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGR  499
            +SR  +  N +V+PV++G +MVERV+N RKLAPP+  +  + ++    KSSS +S+GFGR
Sbjct  395  ISRSSSHDNDDVNPVLIGTQMVERVVNSRKLAPPKHYDHHNTDNGSGGKSSSSESSGFGR  454

Query  498  TLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatss  319
             LSKKS+DMA+RHMDIRR++PGNLRP++TN+PASS YSVR  P++S T    DSPLAT S
Sbjct  455  NLSKKSIDMAMRHMDIRRSMPGNLRPVLTNVPASSGYSVRIKPTKSNTTGAMDSPLATCS  514

Query  318  nassevsvnnnaVCIDGHGGECEISS-DKGA  229
            NASSE SVNN  + ++G    CEI + D G+
Sbjct  515  NASSEPSVNNIPLSLEG----CEIEAIDPGS  541



>ref|XP_006602654.1| PREDICTED: flocculation protein FLO11 isoform X1 [Glycine max]
 ref|XP_006602655.1| PREDICTED: flocculation protein FLO11 isoform X2 [Glycine max]
 ref|XP_006602656.1| PREDICTED: flocculation protein FLO11 isoform X3 [Glycine max]
Length=515

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +HN+ +S+ V  +SR       + SPVV+G KMVERV+NMRKLAPP+ ++  S   N   
Sbjct  354  VHNNHTSMQV--LSRARFTDGDDESPVVIGTKMVERVVNMRKLAPPKHEDHHSSRDNSYG  411

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMY-SVRSGPSRSR  358
            KSSS  S     TLSKKSLDMA+RHMDIRR+I GNLRPL+T+IPASSMY       S+SR
Sbjct  412  KSSSGSSGFGT-TLSKKSLDMAMRHMDIRRSIQGNLRPLVTSIPASSMYSVRSGSSSKSR  470

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGE-----CE  250
            TVS SDSPLATSS  SSE SVN N++  DG G E     CE
Sbjct  471  TVSASDSPLATSSTTSSEPSVNTNSMSYDGSGVEENDFACE  511



>gb|KHN07485.1| hypothetical protein glysoja_034966 [Glycine soja]
Length=515

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +HN+ +S+ V  +SR       + SPVV+G KMVERV+NMRKLAPP+ ++  S   N   
Sbjct  354  VHNNHTSMQV--LSRARFTDGDDESPVVIGTKMVERVVNMRKLAPPKHEDHHSSRDNSYG  411

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMY-SVRSGPSRSR  358
            KSSS  S     TLSKKSLDMA+RHMDIRR+I GNLRPL+T+IPASSMY       S+SR
Sbjct  412  KSSSGSSGFGT-TLSKKSLDMAMRHMDIRRSIQGNLRPLVTSIPASSMYSVRSGSSSKSR  470

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDGHGGE-----CE  250
            TVS SDSPLATSS  SSE SVN N++  DG G E     CE
Sbjct  471  TVSASDSPLATSSTTSSEPSVNTNSMSYDGSGVEENDFACE  511



>emb|CDP12663.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 102/136 (75%), Gaps = 6/136 (4%)
 Frame = -2

Query  675  SRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRT  496
            SR ++  N +V+PV++G KMVERV+NMRKLAP + +N  S +++    S S  ++GFGR+
Sbjct  348  SRGYSNCNDSVNPVLIGTKMVERVVNMRKLAPSKHNNYESQDNSSGKPSLSIGNSGFGRS  407

Query  495  LSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPLatssn  316
            LSKKSLDMAIRHMDI R I GNL+ ++T++PAS     +SG ++SRT S+SDSPLAT S 
Sbjct  408  LSKKSLDMAIRHMDI-RGISGNLKTIVTSLPAS-----KSGSTKSRTTSLSDSPLATCST  461

Query  315  assevsvnnnaVCIDG  268
            ASSE SVNN A  +DG
Sbjct  462  ASSEPSVNNVANVLDG  477



>ref|XP_006583646.1| PREDICTED: flocculation protein FLO11-like [Glycine max]
 gb|KHN22748.1| hypothetical protein glysoja_031333 [Glycine soja]
Length=515

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 113/163 (69%), Gaps = 5/163 (3%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +HN+ +S+ V  +SR       + SPV++G KMVERV+NMRKLAPP+ ++  S   N   
Sbjct  354  VHNNHTSMQV--LSRARFTDGDDESPVMIGTKMVERVVNMRKLAPPKHEDHHSSRENSYG  411

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMY-SVRSGPSRSR  358
            KSSS  S     TLSKKSLDMA+RHMDIRR+  GN+RPL+T+IPASSMY       S+SR
Sbjct  412  KSSSGSSGFGT-TLSKKSLDMAMRHMDIRRSFQGNMRPLVTSIPASSMYSVRSGSSSKSR  470

Query  357  TVSVSDSPLatssnassevsvnnnaVCIDG-HGGECEISSDKG  232
            TVS SDSPLATSS  SSE SVNN+++  DG    E + +S+KG
Sbjct  471  TVSASDSPLATSSTTSSEPSVNNSSISYDGSEAEENDFASEKG  513



>ref|XP_006366352.1| PREDICTED: flocculation protein FLO11-like [Solanum tuberosum]
Length=535

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = -2

Query  681  AMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFG  502
            + SR +   N +V+PV++G +MVERV+NMRKLAPP+ D+  S  ++     S  + +GFG
Sbjct  381  SKSRGYGIENDDVNPVLIGTQMVERVVNMRKLAPPKQDDNLSHENSSKKSLSREN-SGFG  439

Query  501  RTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            R+ SKKSLDMA+RHMDIRR++ G LRP++T + ASS  S+RS  ++++T SVSDSPL
Sbjct  440  RSFSKKSLDMALRHMDIRRSVNGTLRPVLTRVSASSANSIRSSSTKNKTGSVSDSPL  496



>ref|XP_009804552.1| PREDICTED: endochitinase A-like isoform X2 [Nicotiana sylvestris]
Length=537

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = -2

Query  681  AMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFG  502
            + SR H     +V+PV++G +MVERV+NMRKLAPP+ D+     +      S  + +GFG
Sbjct  374  SKSRGHGYEKDDVNPVLIGTQMVERVVNMRKLAPPKQDDNPYHENPSKKSLSREN-SGFG  432

Query  501  RTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            R+ SKKSLDMA+RHMDIRR++ G LRP++T + +SS  S+RS  ++++T SVSDSPL
Sbjct  433  RSFSKKSLDMALRHMDIRRSVNGTLRPVLTRVSSSSANSIRSSSTKNKTGSVSDSPL  489



>ref|XP_009804551.1| PREDICTED: endochitinase A-like isoform X1 [Nicotiana sylvestris]
Length=552

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = -2

Query  681  AMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFG  502
            + SR H     +V+PV++G +MVERV+NMRKLAPP+ D+     +      S  + +GFG
Sbjct  389  SKSRGHGYEKDDVNPVLIGTQMVERVVNMRKLAPPKQDDNPYHENPSKKSLSREN-SGFG  447

Query  501  RTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTVSVSDSPL  331
            R+ SKKSLDMA+RHMDIRR++ G LRP++T + +SS  S+RS  ++++T SVSDSPL
Sbjct  448  RSFSKKSLDMALRHMDIRRSVNGTLRPVLTRVSSSSANSIRSSSTKNKTGSVSDSPL  504



>gb|KJB76178.1| hypothetical protein B456_012G076400 [Gossypium raimondii]
Length=492

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            LH SG SVP  A+SR ++KA+ NVSPVV+G KMVERVINMRKLAPP+ D+K+SP  N S 
Sbjct  405  LHLSGGSVP--AVSRGYSKASDNVSPVVIGTKMVERVINMRKLAPPKQDDKNSPQRNSSG  462

Query  534  kssspdSTGFGRTLSKKSLDMAIRHM  457
            KS+SPDSTGFGRTLSKKSLDMAIRHM
Sbjct  463  KSASPDSTGFGRTLSKKSLDMAIRHM  488



>gb|EYU26656.1| hypothetical protein MIMGU_mgv1a013847mg [Erythranthe guttata]
Length=209

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 83/131 (63%), Gaps = 20/131 (15%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            + +GS +    +SR     + +V+PV+MG KMV+RV+NMRKLAPP+ D  +  + N    
Sbjct  84   YKTGSKI----LSRSSNGVDDDVNPVLMGTKMVDRVVNMRKLAPPKQDEYAVSSDNTRKS  139

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
            S     +GFGR+LSKKSLDMAIRHMDIRR+IP  LRP+ T          RSG ++S T 
Sbjct  140  SHEN--SGFGRSLSKKSLDMAIRHMDIRRSIPEKLRPIAT----------RSGCAKSSTT  187

Query  351  S----VSDSPL  331
            +    +S+SPL
Sbjct  188  TTVGDLSESPL  198



>ref|XP_004165110.1| PREDICTED: uncharacterized protein LOC101231484 [Cucumis sativus]
Length=517

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 80/127 (63%), Gaps = 3/127 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            +NSG   P     R+    +  VSPVVMG KMVERV+NMRKL PP+      P+    + 
Sbjct  358  YNSGKVFPF--KPRIRCPDDNEVSPVVMGTKMVERVVNMRKLVPPK-QGDYRPSIGDPSS  414

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
             SS D  GFGRTLS KSLDMA+RHMDI R+I G +RP++T    SSM +  S  +++ T 
Sbjct  415  KSSADIPGFGRTLSNKSLDMALRHMDITRSISGKVRPVITKTQTSSMNNGSSRSTKAGTT  474

Query  351  SVSDSPL  331
             VSDSPL
Sbjct  475  GVSDSPL  481



>ref|XP_004147920.1| PREDICTED: uncharacterized protein LOC101217147 [Cucumis sativus]
 gb|KGN54368.1| hypothetical protein Csa_4G308580 [Cucumis sativus]
Length=517

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 80/127 (63%), Gaps = 3/127 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            +NSG   P     R+    +  VSPVVMG KMVERV+NMRKL PP+      P+    + 
Sbjct  358  YNSGKVFPF--KPRIRCPDDNEVSPVVMGTKMVERVVNMRKLVPPK-QGDYRPSIGDPSS  414

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
             SS D  GFGRTLS KSLDMA+RHMDI R+I G +RP++T    SSM +  S  +++ T 
Sbjct  415  KSSADIPGFGRTLSNKSLDMALRHMDITRSISGKVRPVITKTQTSSMNNGSSRSTKAGTT  474

Query  351  SVSDSPL  331
             VSDSPL
Sbjct  475  GVSDSPL  481



>ref|XP_011094995.1| PREDICTED: proteoglycan 4-like [Sesamum indicum]
Length=452

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 67/90 (74%), Gaps = 3/90 (3%)
 Frame = -2

Query  648  NVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKKSLDMA  469
            +V+PV+MG +MVERV+NMRKLAPP+ D   S +        +   +GFGR+LSKKSLDMA
Sbjct  335  DVNPVLMGTQMVERVVNMRKLAPPKQDECISNDHPKKPSLGN---SGFGRSLSKKSLDMA  391

Query  468  IRHMDIRRTIPGNLRPLMTNIPASSMYSVR  379
            IRHMDIRR+IP NLRP+ T I +SS+  ++
Sbjct  392  IRHMDIRRSIPDNLRPVATAILSSSVCDIQ  421



>gb|AAB95292.1| En/Spm-like transposon protein [Arabidopsis thaliana]
Length=510

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 77/86 (90%), Gaps = 2/86 (2%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
            +++SGSSVP  A++R ++KA+ NVSPV+MG KMVERVINMRKLAPPR D+K SP+ NLSA
Sbjct  410  MYSSGSSVP--AVNRGYSKASDNVSPVMMGTKMVERVINMRKLAPPRSDDKGSPHGNLSA  467

Query  534  kssspdSTGFGRTLSKKSLDMAIRHM  457
            KSSSPDS GFGRTLSKKSLDMAIRHM
Sbjct  468  KSSSPDSAGFGRTLSKKSLDMAIRHM  493



>ref|XP_008449274.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X2 [Cucumis melo]
Length=515

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 80/127 (63%), Gaps = 3/127 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            +NSG   P     R+ +  +  VSPVVMG KMVERV+NMRKLAPP+      P+    + 
Sbjct  356  YNSGKVFPF--KPRIRSADDNEVSPVVMGTKMVERVVNMRKLAPPK-QGDYRPSIGDPSS  412

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
             SS D  GFGRTLS KSLDMA+RHMDI R+I G +R ++T    SSM +  S  +++ T 
Sbjct  413  KSSVDIPGFGRTLSNKSLDMALRHMDITRSISGKVRSVITKTHTSSMNNGSSRSTKAGTT  472

Query  351  SVSDSPL  331
              SDSPL
Sbjct  473  GFSDSPL  479



>ref|XP_008449265.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X1 [Cucumis melo]
Length=517

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 80/127 (63%), Gaps = 3/127 (2%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            +NSG   P     R+ +  +  VSPVVMG KMVERV+NMRKLAPP+      P+    + 
Sbjct  358  YNSGKVFPF--KPRIRSADDNEVSPVVMGTKMVERVVNMRKLAPPK-QGDYRPSIGDPSS  414

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPSRSRTV  352
             SS D  GFGRTLS KSLDMA+RHMDI R+I G +R ++T    SSM +  S  +++ T 
Sbjct  415  KSSVDIPGFGRTLSNKSLDMALRHMDITRSISGKVRSVITKTHTSSMNNGSSRSTKAGTT  474

Query  351  SVSDSPL  331
              SDSPL
Sbjct  475  GFSDSPL  481



>gb|KEH23155.1| hypothetical protein MTR_7g068220 [Medicago truncatula]
Length=405

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 88/128 (69%), Gaps = 5/128 (4%)
 Frame = -2

Query  714  LHNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsa  535
             HN+ SS+   A+SR         SPVV+G KMVERV+NMRKLAPP+ D+  + N++   
Sbjct  254  THNNHSSLH--ALSRARFTDGDEDSPVVIGTKMVERVVNMRKLAPPKHDDPCANNNSYGK  311

Query  534  kssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMY-SVRSGPSRSR  358
             SS     G   TLSKKSLDMA+RHMDIRR++ GN+RP +T+IPASSMY       S+SR
Sbjct  312  SSSGSSGFGS--TLSKKSLDMAMRHMDIRRSVQGNMRPHVTSIPASSMYSVRSGSSSKSR  369

Query  357  TVSVSDSP  334
            T+SVSDSP
Sbjct  370  TMSVSDSP  377



>gb|KEH23156.1| hypothetical protein MTR_7g068220 [Medicago truncatula]
Length=424

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            HN+ SS+   A+SR         SPVV+G KMVERV+NMRKLAPP+ D+  + N++    
Sbjct  274  HNNHSSLH--ALSRARFTDGDEDSPVVIGTKMVERVVNMRKLAPPKHDDPCANNNSYGKS  331

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMY-SVRSGPSRSRT  355
            SS     G   TLSKKSLDMA+RHMDIRR++ GN+RP +T+IPASSMY       S+SRT
Sbjct  332  SSGSSGFGS--TLSKKSLDMAMRHMDIRRSVQGNMRPHVTSIPASSMYSVRSGSSSKSRT  389

Query  354  VSVSDSP  334
            +SVSDSP
Sbjct  390  MSVSDSP  396



>ref|XP_003623288.1| hypothetical protein MTR_7g068220 [Medicago truncatula]
 gb|AES79506.1| hypothetical protein MTR_7g068220 [Medicago truncatula]
Length=503

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = -2

Query  711  HNSGSSVPVPAMSRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsak  532
            HN+ SS+   A+SR         SPVV+G KMVERV+NMRKLAPP+ D+  + N++    
Sbjct  353  HNNHSSLH--ALSRARFTDGDEDSPVVIGTKMVERVVNMRKLAPPKHDDPCANNNSYGKS  410

Query  531  ssspdSTGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMY-SVRSGPSRSRT  355
            SS     G   TLSKKSLDMA+RHMDIRR++ GN+RP +T+IPASSMY       S+SRT
Sbjct  411  SSGSSGFGS--TLSKKSLDMAMRHMDIRRSVQGNMRPHVTSIPASSMYSVRSGSSSKSRT  468

Query  354  VSVSDSP  334
            +SVSDSP
Sbjct  469  MSVSDSP  475



>ref|XP_006356484.1| PREDICTED: flocculation protein FLO11-like [Solanum tuberosum]
Length=498

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 78/95 (82%), Gaps = 4/95 (4%)
 Frame = -2

Query  480  LDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGP----SRSRTVSVSDSPLatssna  313
            +DMAIRHMDIR+ + GNLRPLMTNIPASSMYSVRSGP      SR++++ DSPLATSSNA
Sbjct  402  VDMAIRHMDIRQRVSGNLRPLMTNIPASSMYSVRSGPPTRGRTSRSINMPDSPLATSSNA  461

Query  312  ssevsvnnnaVCIDGHGGECEISSDKGARSPPSVH  208
            SSEVSV+NN V +DG   + +ISSDKGARSP SV 
Sbjct  462  SSEVSVSNNVVWVDGSEIDEDISSDKGARSPASVR  496



>emb|CDY55901.1| BnaAnng13940D [Brassica napus]
Length=506

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = -2

Query  645  VSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKKSLDMAI  466
            +SPV  G +MVERV+++RKLAPPRL       SN    SS  D  GFGR LSK S DMA+
Sbjct  381  ISPVAKGAQMVERVVSVRKLAPPRL--TEKGGSNAGKSSSGADGVGFGRNLSKSSFDMAL  438

Query  465  RHMDIRR-TIPGNLRPLMTNIPASSMYSVRSGPSR  364
            RHMDI++ ++ GN R L TN+PA+S+YSVRS  +R
Sbjct  439  RHMDIKQGSMKGNFRQLATNVPAASLYSVRSSGTR  473



>ref|XP_009125427.1| PREDICTED: uncharacterized protein DDB_G0271670 [Brassica rapa]
Length=536

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = -2

Query  645  VSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKKSLDMAI  466
            +SPV  G +MVERV+++RKLAPPRL       SN    SS  D  GFGR LSK S DMA+
Sbjct  411  ISPVAKGAQMVERVVSVRKLAPPRL--TEKGGSNAGKSSSGADGVGFGRNLSKSSFDMAL  468

Query  465  RHMDIRR-TIPGNLRPLMTNIPASSMYSVRSGPSR  364
            RHMDI++ ++ GN R L TN+PA+S+YSVRS  +R
Sbjct  469  RHMDIKQGSMKGNFRQLATNVPAASLYSVRSSGTR  503



>emb|CDY48118.1| BnaC02g03750D [Brassica napus]
Length=506

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 66/95 (69%), Gaps = 3/95 (3%)
 Frame = -2

Query  645  VSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKKSLDMAI  466
            +SPV  G +M+ERV+++RKLAPPRL       SN    SS  D  GFGR LSK S DMA+
Sbjct  381  ISPVAKGAQMIERVVSVRKLAPPRL--TEKGGSNAGKSSSGADGVGFGRNLSKSSFDMAL  438

Query  465  RHMDIRR-TIPGNLRPLMTNIPASSMYSVRSGPSR  364
            RHMDI++ ++ GN R L T +PA+S+YSVRS  +R
Sbjct  439  RHMDIKQGSMKGNFRQLATKVPAASLYSVRSSGTR  473



>ref|XP_006398633.1| hypothetical protein EUTSA_v10013437mg [Eutrema salsugineum]
 gb|ESQ40086.1| hypothetical protein EUTSA_v10013437mg [Eutrema salsugineum]
Length=473

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 74/113 (65%), Gaps = 7/113 (6%)
 Frame = -2

Query  687  VPAMSRLHAKANAN----VSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsaksssp  520
            VP +    AK + N    +SPV  G++MVERV+N+RKLAPPRL    +        SS  
Sbjct  331  VPLLRGRRAKTSNNDGGLISPVAKGDQMVERVVNVRKLAPPRL--TENGGRGGKKLSSES  388

Query  519  dSTGFGRTLSKKSLDMAIRHMDIRR-TIPGNLRPLMTNIPASSMYSVRSGPSR  364
            D  GFGR LSK S DMA+RH DI+R ++ GN++ L+T +PA+S+YSV+S  +R
Sbjct  389  DGLGFGRNLSKSSFDMALRHKDIKRGSMMGNIQTLVTKVPAASLYSVKSSGTR  441



>gb|KFK36712.1| hypothetical protein AALP_AA4G159900 [Arabis alpina]
Length=324

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 65/97 (67%), Gaps = 15/97 (15%)
 Frame = -2

Query  657  ANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKKSL  478
            +N +V+PV+MG +MVERV+NMRKL PP+ D+K+S              + FGR+LS+ SL
Sbjct  242  SNDDVNPVLMGTQMVERVVNMRKLPPPKQDDKTS--------------SNFGRSLSRSSL  287

Query  477  DMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPS  367
            DMA+RHM+IRR+I GNLR +  N   +SM    S PS
Sbjct  288  DMALRHMNIRRSISGNLR-VTINSSTNSMDKNESSPS  323



>ref|XP_011077570.1| PREDICTED: endochitinase A1-like isoform X2 [Sesamum indicum]
Length=465

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 5/88 (6%)
 Frame = -2

Query  675  SRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRT  496
            SR ++    +V+PV++G KMV+RV+NMRKLAPP+ D      ++ + K SS +++GFGR+
Sbjct  349  SRGYSNEGDDVNPVLIGTKMVDRVVNMRKLAPPKQD---EYVAHENPKKSSQENSGFGRS  405

Query  495  LSKKSLDMAIRHMDIRRTIPGNLRPLMT  412
            LSKKSLDMAIRHMDIR  IP NLR + T
Sbjct  406  LSKKSLDMAIRHMDIR--IPENLRHIAT  431



>ref|XP_011077568.1| PREDICTED: endochitinase A1-like isoform X1 [Sesamum indicum]
 ref|XP_011077569.1| PREDICTED: endochitinase A1-like isoform X1 [Sesamum indicum]
Length=472

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 5/88 (6%)
 Frame = -2

Query  675  SRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRT  496
            SR ++    +V+PV++G KMV+RV+NMRKLAPP+ D      ++ + K SS +++GFGR+
Sbjct  356  SRGYSNEGDDVNPVLIGTKMVDRVVNMRKLAPPKQD---EYVAHENPKKSSQENSGFGRS  412

Query  495  LSKKSLDMAIRHMDIRRTIPGNLRPLMT  412
            LSKKSLDMAIRHMDIR  IP NLR + T
Sbjct  413  LSKKSLDMAIRHMDIR--IPENLRHIAT  438



>emb|CDX93325.1| BnaC04g45710D [Brassica napus]
Length=332

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 67/99 (68%), Gaps = 15/99 (15%)
 Frame = -2

Query  663  AKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKK  484
            +K + +V+PV+MG +MVERV+NMRKL PP+ D+ +               +GFGRTLS+ 
Sbjct  240  SKISDDVNPVLMGTQMVERVVNMRKLPPPKHDDNNMN-------------SGFGRTLSRS  286

Query  483  SLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPS  367
            SLDMA+RHM+I+ ++PGNLR  +++   +SM   +S PS
Sbjct  287  SLDMAMRHMNIKPSVPGNLR--VSSNATNSMDKNKSSPS  323



>ref|XP_004492428.1| PREDICTED: mucin-5AC-like [Cicer arietinum]
Length=511

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = -2

Query  642  SPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKKSLDMAIR  463
            SP+V+G KMVERV+NMRKLAPP+ ++ S+ N++    SSS  +     TLSKKSLDMAIR
Sbjct  375  SPIVIGTKMVERVVNMRKLAPPKHEDPSANNNSYGKYSSSGSTGFGS-TLSKKSLDMAIR  433

Query  462  HMDIRRTIPGNLRPLMTNIPA  400
            HMDIRR++ GN+R  +T+IPA
Sbjct  434  HMDIRRSVQGNMRAQVTSIPA  454



>ref|NP_181351.5| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001189700.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC09497.1| uncharacterized protein AT2G38160 [Arabidopsis thaliana]
 gb|AEC09498.1| uncharacterized protein AT2G38160 [Arabidopsis thaliana]
Length=314

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 55/81 (68%), Gaps = 14/81 (17%)
 Frame = -2

Query  666  HAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSK  487
             +K + +V+PV+MG +MVERV+NMRKL PP+ D+ ++               GFGRTLS+
Sbjct  232  RSKISNDVNPVLMGTQMVERVVNMRKLPPPKHDDNTTL--------------GFGRTLSR  277

Query  486  KSLDMAIRHMDIRRTIPGNLR  424
             SLDMA+RHM+IR ++  NLR
Sbjct  278  SSLDMALRHMNIRHSVSKNLR  298



>ref|XP_006495301.1| PREDICTED: flocculation protein FLO11-like [Citrus sinensis]
Length=482

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -2

Query  672  RLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTL  493
            R++A    +V+PVV+G KMVERV+NMRKLAPP+ +N S+  ++    SSS DS+GFGRTL
Sbjct  402  RVNASDGDDVNPVVIGTKMVERVVNMRKLAPPKQENHSTHYTSAGKSSSSVDSSGFGRTL  461

Query  492  SKKSLDMAIRHM  457
            SKKSLDMA+RHM
Sbjct  462  SKKSLDMALRHM  473



>ref|XP_010517104.1| PREDICTED: uncharacterized protein LOC104792614 [Camelina sativa]
Length=316

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 16/93 (17%)
 Frame = -2

Query  666  HAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSK  487
             +K + +V+PV+MG +MVERV+NMRKL PP+ D+K+S               GFGR LSK
Sbjct  233  RSKTSNDVNPVLMGTQMVERVVNMRKLPPPKYDDKTSL--------------GFGRNLSK  278

Query  486  KSLDMAIRHMDIRR-TIPGNLRPLMTNIPASSM  391
             SLDMA+RHM+IRR ++  NLR +  N P + M
Sbjct  279  SSLDMALRHMNIRRSSVSKNLR-VTINAPTNLM  310



>ref|XP_006295953.1| hypothetical protein CARUB_v10025095mg [Capsella rubella]
 gb|EOA28851.1| hypothetical protein CARUB_v10025095mg [Capsella rubella]
Length=317

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 62/92 (67%), Gaps = 15/92 (16%)
 Frame = -2

Query  666  HAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSK  487
             +K + +V+PV+MG +MVERV+NMRKL PP+ ++ +S              +GFGR LS+
Sbjct  237  RSKISNDVNPVLMGTQMVERVVNMRKLPPPKYNDNTS--------------SGFGRNLSR  282

Query  486  KSLDMAIRHMDIRRTIPGNLRPLMTNIPASSM  391
             SLDMA+RHM+IRR++  NL+ + TN   +S+
Sbjct  283  SSLDMALRHMNIRRSVSKNLK-VTTNASTNSV  313



>ref|XP_009141724.1| PREDICTED: uncharacterized protein LOC103865654 [Brassica rapa]
Length=326

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 63/99 (64%), Gaps = 18/99 (18%)
 Frame = -2

Query  663  AKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKK  484
            +K + +V+PV+MG +MVERV+NMRKL PP+ D              +  ++GFGRTLS+ 
Sbjct  237  SKISDDVNPVLMGTQMVERVVNMRKLPPPKHD-------------DNNMNSGFGRTLSRS  283

Query  483  SLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRSGPS  367
            SLDMA+RHM+I+R++ G     +T+   +SM    S PS
Sbjct  284  SLDMAMRHMNIKRSVSG-----VTSNATNSMDKKESSPS  317



>ref|XP_010509216.1| PREDICTED: uncharacterized protein LOC104785658 [Camelina sativa]
 ref|XP_010509217.1| PREDICTED: uncharacterized protein LOC104785658 [Camelina sativa]
Length=319

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 60/93 (65%), Gaps = 16/93 (17%)
 Frame = -2

Query  666  HAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSK  487
              K + +V+PV+MG +MVERV+NMRKL PP+ D+K+S               GFGR LS+
Sbjct  236  RCKISNDVNPVLMGTQMVERVVNMRKLPPPKYDDKTSL--------------GFGRNLSR  281

Query  486  KSLDMAIRHMDIRR-TIPGNLRPLMTNIPASSM  391
             SLDMA+RHM+IRR ++  NLR +  N P + M
Sbjct  282  SSLDMALRHMNIRRSSVSKNLR-VTINTPTNLM  313



>ref|XP_006411019.1| hypothetical protein EUTSA_v10017516mg, partial [Eutrema salsugineum]
 gb|ESQ52472.1| hypothetical protein EUTSA_v10017516mg, partial [Eutrema salsugineum]
Length=309

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 13/81 (16%)
 Frame = -2

Query  666  HAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSK  487
             +K + +V+PV++G +MVERV+NMRKL PP+ D   S               GFGR LS+
Sbjct  239  RSKISNDVNPVLLGTQMVERVVNMRKLPPPKHDGNMSSG-------------GFGRNLSR  285

Query  486  KSLDMAIRHMDIRRTIPGNLR  424
             SLDMA+RHM+IRR I  NLR
Sbjct  286  SSLDMALRHMNIRRRISRNLR  306



>ref|XP_010528826.1| PREDICTED: uncharacterized protein LOC104805834 [Tarenaya hassleriana]
Length=300

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 57/89 (64%), Gaps = 9/89 (10%)
 Frame = -2

Query  702  GSSVPVPAMSRLHAKA-NANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakss  526
            G + P  A+ R  +++ N  V+PV++G KMVERV+NMRKL PPR              + 
Sbjct  219  GRAYPSAAVKRGQSRSSNEVVNPVLIGTKMVERVVNMRKLPPPR--------QGGGNSTG  270

Query  525  spdSTGFGRTLSKKSLDMAIRHMDIRRTI  439
              + +GFGR LS+ SLDMA+RHMDIRR++
Sbjct  271  KSEGSGFGRNLSRSSLDMALRHMDIRRSM  299



>ref|XP_010505431.1| PREDICTED: uncharacterized protein LOC104782251 [Camelina sativa]
 ref|XP_010505432.1| PREDICTED: uncharacterized protein LOC104782251 [Camelina sativa]
Length=318

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 14/75 (19%)
 Frame = -2

Query  666  HAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSK  487
             +K++ +V+PV+MG +MVERV+NMRKL PP+ D+K+S               GFGR LS+
Sbjct  239  RSKSSNDVNPVLMGTQMVERVVNMRKLPPPKYDDKTSL--------------GFGRNLSR  284

Query  486  KSLDMAIRHMDIRRT  442
             SLDMA+RHM+IRR+
Sbjct  285  SSLDMALRHMNIRRS  299



>gb|KJB76928.1| hypothetical protein B456_012G113200 [Gossypium raimondii]
Length=504

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = -2

Query  672  RLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTL  493
            R  A  + N SPVV+G KMVERV+NMRKL PP+ D  +  N+  +  SSS DS+GFGRTL
Sbjct  414  RADANGSDNESPVVIGTKMVERVVNMRKLVPPKQD-DNHRNNPTAKLSSSLDSSGFGRTL  472

Query  492  SKKSLDMAIRHM  457
            SKKSLDMA+RHM
Sbjct  473  SKKSLDMAMRHM  484



>ref|XP_006286667.1| hypothetical protein CARUB_v10002586mg [Capsella rubella]
 gb|EOA19565.1| hypothetical protein CARUB_v10002586mg [Capsella rubella]
Length=457

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 9/99 (9%)
 Frame = -2

Query  645  VSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFG-------RTLSK  487
            +S V  GN+ VERV+N+RKLAPPR    S    +     SS   +  G       R LSK
Sbjct  325  ISHVATGNQKVERVVNVRKLAPPRQTESSGRGLSGGGGGSSAGKSSSGSDGFGFGRNLSK  384

Query  486  KSLDMAIRHMDIRR--TIPGNLRPLMTNIPASSMYSVRS  376
             S+DMA+RHMD+RR  ++ GN RP +T +PA+S+YS+ S
Sbjct  385  SSIDMALRHMDVRRRGSMAGNFRPSVTKVPATSLYSMTS  423



>ref|XP_010490586.1| PREDICTED: putative GPI-anchored protein PB15E9.01c [Camelina 
sativa]
Length=463

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 58/94 (62%), Gaps = 7/94 (7%)
 Frame = -2

Query  636  VVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFG------RTLSKKSLD  475
            V  GN+ +ERV+N+RKLAPPR+             SS+  S+         R LSK S+D
Sbjct  336  VAKGNQKMERVVNVRKLAPPRVTESRGRGLGSDGGSSAGKSSSGSDGFGFGRNLSKSSID  395

Query  474  MAIRHMDIRR-TIPGNLRPLMTNIPASSMYSVRS  376
            MA+RHMD+RR ++ GN RP +T  PA+S YSVRS
Sbjct  396  MALRHMDVRRGSMAGNFRPSVTKAPATSSYSVRS  429



>ref|XP_010452004.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Camelina 
sativa]
Length=488

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 59/97 (61%), Gaps = 7/97 (7%)
 Frame = -2

Query  645  VSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFG------RTLSKK  484
             S V  GN+ +ERV+N+RKLAPPR+             SS+  S+         R LSK 
Sbjct  358  TSHVAKGNQKMERVVNVRKLAPPRVTETRGRGLGGDGGSSAGKSSSGSDGFGFGRNLSKS  417

Query  483  SLDMAIRHMDIRR-TIPGNLRPLMTNIPASSMYSVRS  376
            S+D+A+RHMD+R+ ++ GN RP +T  PA+S YSVRS
Sbjct  418  SIDLALRHMDVRQGSMAGNFRPSVTKTPATSSYSVRS  454



>gb|EPS68722.1| hypothetical protein M569_06052, partial [Genlisea aurea]
Length=65

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 10/65 (15%)
 Frame = -2

Query  651  ANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKKSLDM  472
            A ++PV++G KMVERV+NMRKLAPP          + S+   +P   GFGR+LSKKSL+M
Sbjct  11   AALNPVLVGTKMVERVVNMRKLAPP----------DSSSLLLNPKKAGFGRSLSKKSLEM  60

Query  471  AIRHM  457
            AIRHM
Sbjct  61   AIRHM  65



>gb|AAC27165.1| hypothetical protein [Arabidopsis thaliana]
Length=305

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 14/70 (20%)
 Frame = -2

Query  666  HAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSK  487
             +K + +V+PV+MG +MVERV+NMRKL PP+ D+ ++               GFGRTLS+
Sbjct  238  RSKISNDVNPVLMGTQMVERVVNMRKLPPPKHDDNTTL--------------GFGRTLSR  283

Query  486  KSLDMAIRHM  457
             SLDMA+RHM
Sbjct  284  SSLDMALRHM  293



>ref|XP_010553245.1| PREDICTED: uncharacterized protein LOC104823383 [Tarenaya hassleriana]
Length=327

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 54/79 (68%), Gaps = 8/79 (10%)
 Frame = -2

Query  675  SRLHAKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRT  496
            SR  +K + +V+PV++G+KMVERV+N+RKL PP+ ++ +    +   +        FG  
Sbjct  256  SRRQSKCSNDVNPVLIGSKMVERVVNVRKLPPPKQNDHNPARKSDGPR--------FGMN  307

Query  495  LSKKSLDMAIRHMDIRRTI  439
            LS+ SLDMA+RHMDIRR++
Sbjct  308  LSRSSLDMALRHMDIRRSM  326



>ref|NP_195748.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB69856.1| putative protein [Arabidopsis thaliana]
 gb|AED90322.1| uncharacterized protein AT5G01280 [Arabidopsis thaliana]
Length=460

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 65/116 (56%), Gaps = 12/116 (10%)
 Frame = -2

Query  687  VPAMSRLHAKANAN----VSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsaksssp  520
            VP++    AK N +    +S    GN+ VE+V+NMRKLA PRL    S         SS 
Sbjct  311  VPSLRGQRAKTNNDDGRLISHAAKGNQKVEKVVNMRKLATPRLTESGSRRLGGGGGDSSA  370

Query  519  dSTGFGR-------TLSKKSLDMAIRHMDIRR-TIPGNLRPLMTNIPASSMYSVRS  376
              +  G         LSK S+DMA+RHMD+R+ ++ GN R  +T  PA+S+YSVRS
Sbjct  371  GKSSSGSGGFGFGRNLSKSSIDMALRHMDVRKGSMAGNFRHSVTKAPATSVYSVRS  426



>emb|CDY18403.1| BnaA04g21840D [Brassica napus]
Length=382

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 13/69 (19%)
 Frame = -2

Query  663  AKANANVSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdSTGFGRTLSKK  484
            +K + +V+PV+MG +MVERV+NMRKL PP+ D              +  ++GFGRTLS+ 
Sbjct  219  SKISDDVNPVLMGTQMVERVVNMRKLPPPKHD-------------DNNMNSGFGRTLSRS  265

Query  483  SLDMAIRHM  457
            SLDMA+RHM
Sbjct  266  SLDMAMRHM  274



>ref|XP_010423931.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X1 [Camelina sativa]
Length=483

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 55/96 (57%), Gaps = 10/96 (10%)
 Frame = -2

Query  645  VSPVVMGNKMVERVINMRKLAPPRLDnksspnsnlsakssspdST------GFGRTLSKK  484
             S V  GN+ +ERV+N+RKLAPPR+        +    S +  S+      GFGR LSK 
Sbjct  358  TSHVAKGNQKIERVVNVRKLAPPRVTETRGRGLDGDGGSYAGKSSSGSDGFGFGRNLSKS  417

Query  483  SLDMAIRHMDIRRTIPGNLRPLMTNIPASSMYSVRS  376
            S+DM +R    R ++ GN RP +T   A+S YSVRS
Sbjct  418  SMDMDVR----RGSMAGNFRPSVTKARATSSYSVRS  449



>ref|XP_003601170.1| hypothetical protein MTR_3g076760 [Medicago truncatula]
 gb|AES71421.1| ATP-binding protein, putative [Medicago truncatula]
Length=93

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  417  MTNIPASSMYSVRSGPSRSRTVSVSDSPLatssnassevsvnnnaVCIDGHGGECEISSD  238
            MTNIPASSMYS+RSG  R RT+SVS SP ATSSNASSE+SVN N +C+D    + E+ S+
Sbjct  1    MTNIPASSMYSMRSGSHRGRTISVSGSPHATSSNASSEMSVNQNGLCLDSSEIDDEVGSE  60

Query  237  KGARSPPSV  211
            +  +SP S 
Sbjct  61   RCVQSPASF  69



>ref|XP_006842565.1| hypothetical protein AMTR_s00077p00146340 [Amborella trichopoda]
 gb|ERN04240.1| hypothetical protein AMTR_s00077p00146340 [Amborella trichopoda]
Length=557

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 7/54 (13%)
 Frame = -2

Query  513  TGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMY--SVRSGPSRSR  358
            TGFGR +SKKSLDMA+RHMDIR+   G LRPL     A+S++  SVRS  S++R
Sbjct  411  TGFGRNISKKSLDMALRHMDIRQAT-GGLRPLS----ATSLFPQSVRSVSSKAR  459



>ref|XP_010683444.1| PREDICTED: mucin-5AC [Beta vulgaris subsp. vulgaris]
Length=581

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 7/61 (11%)
 Frame = -2

Query  510  GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMY--SVRSGPSRSRTVSVSDS  337
            G GRT+SKKSLDMAIRHMDIR     ++RPL    P++S++  S+RS PS+ +T   S S
Sbjct  430  GMGRTISKKSLDMAIRHMDIRNGS-ASMRPL----PSTSLFPQSIRSAPSKIQTTHGSGS  484

Query  336  P  334
            P
Sbjct  485  P  485



>ref|XP_009406053.1| PREDICTED: uncharacterized threonine-rich GPI-anchored glycoprotein 
PJ4664.02-like [Musa acuminata subsp. malaccensis]
Length=621

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 10/61 (16%)
 Frame = -2

Query  513  TGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMY--SVRSGPSRSRTVSVSD  340
            TGFGRT+SKKSLDMAI+HMDIR+++ G        I  +S++  S+RS   + RT  VS+
Sbjct  470  TGFGRTISKKSLDMAIKHMDIRQSLGG--------IRGASIFPHSIRSAVPKGRTARVSE  521

Query  339  S  337
            +
Sbjct  522  T  522



>emb|CDP06374.1| unnamed protein product [Coffea canephora]
Length=577

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  513  TGFGRTLSKKSLDMAIRHMDIRRTIPGN  430
            TGFGRT+SKKSLDMAIRHMDIR    GN
Sbjct  426  TGFGRTISKKSLDMAIRHMDIRNGTSGN  453



>ref|XP_010098029.1| hypothetical protein L484_004233 [Morus notabilis]
 gb|EXB74412.1| hypothetical protein L484_004233 [Morus notabilis]
Length=574

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = -2

Query  510  GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPL  418
            GFGRT+SKKSLDMAIRHMDI R+  GN+RPL
Sbjct  424  GFGRTISKKSLDMAIRHMDI-RSGGGNVRPL  453



>ref|XP_004142729.1| PREDICTED: uncharacterized protein LOC101206216 [Cucumis sativus]
 gb|KGN54463.1| hypothetical protein Csa_4G335230 [Cucumis sativus]
Length=578

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 7/60 (12%)
 Frame = -2

Query  510  GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTN--IPASSMYSVRSGPSRSRTVSVSDS  337
            GFGR++SKKSLDMAIRHMDIR   PG++R    N   P    +S+RS  S+++++++S+S
Sbjct  427  GFGRSISKKSLDMAIRHMDIRNG-PGSVRSGSGNTLFP----HSIRSATSKTQSIALSNS  481



>ref|XP_004170022.1| PREDICTED: uncharacterized protein LOC101225804, partial [Cucumis 
sativus]
Length=484

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 7/60 (12%)
 Frame = -2

Query  510  GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTN--IPASSMYSVRSGPSRSRTVSVSDS  337
            GFGR++SKKSLDMAIRHMDIR   PG++R    N   P    +S+RS  S+++++++S+S
Sbjct  333  GFGRSISKKSLDMAIRHMDIRNG-PGSVRSGSGNTLFP----HSIRSATSKTQSIALSNS  387



>ref|XP_008463284.1| PREDICTED: uncharacterized protein DDB_G0271670 [Cucumis melo]
Length=577

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 7/60 (12%)
 Frame = -2

Query  510  GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTN--IPASSMYSVRSGPSRSRTVSVSDS  337
            GFGR++SKKSLDMAIRHMDIR   PG++R    N   P    +S+RS  S+++++++S+S
Sbjct  427  GFGRSISKKSLDMAIRHMDIRNG-PGSVRSGSGNTLFP----HSIRSATSKTQSIALSNS  481



>ref|XP_006602722.1| PREDICTED: flocculation protein FLO11-like [Glycine max]
Length=585

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 7/57 (12%)
 Frame = -2

Query  513  TGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMY--SVRSGPSRSRTVS  349
            TGFGRT+SKKSLDMAI+HMDIR +  GN+R L     +++++  S+R+  S+S  VS
Sbjct  434  TGFGRTISKKSLDMAIKHMDIRNSS-GNIRSLS----STTLFPQSIRTSTSKSHRVS  485



>gb|KHN40608.1| hypothetical protein glysoja_001106 [Glycine soja]
Length=627

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 7/57 (12%)
 Frame = -2

Query  513  TGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMY--SVRSGPSRSRTVS  349
            TGFGRT+SKKSLDMAI+HMDIR +  GN+R L     +++++  S+R+  S+S  VS
Sbjct  476  TGFGRTISKKSLDMAIKHMDIRNSS-GNIRSLS----STTLFPQSIRTSTSKSHRVS  527



>ref|XP_002266425.1| PREDICTED: putative GPI-anchored protein PB15E9.01c [Vitis vinifera]
 emb|CAN71240.1| hypothetical protein VITISV_034160 [Vitis vinifera]
 emb|CBI31170.3| unnamed protein product [Vitis vinifera]
Length=570

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 1/31 (3%)
 Frame = -2

Query  510  GFGRTLSKKSLDMAIRHMDIRRTIPGNLRPL  418
            GFGRT+SKKSLDMAIRHMDIR    G++RPL
Sbjct  417  GFGRTISKKSLDMAIRHMDIRNGT-GSIRPL  446



>ref|XP_006481235.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X1 [Citrus sinensis]
 ref|XP_006481236.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X2 [Citrus sinensis]
Length=582

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 7/56 (13%)
 Frame = -2

Query  513  TGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPL--MTNIPASSMYSVRSGPSRSRTV  352
            TGFGRT+SKKSLDMAIRHMDIR    G++R L   T  P     S+RS  S++R+ 
Sbjct  436  TGFGRTISKKSLDMAIRHMDIRNGA-GSIRQLSGTTLFP----QSIRSATSKTRSA  486



>ref|XP_003534630.1| PREDICTED: flocculation protein FLO11-like [Glycine max]
Length=586

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 1/34 (3%)
 Frame = -2

Query  513  TGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMT  412
            TGFGRT+SKKSLDMAI+HMDIR +  GN+R L +
Sbjct  435  TGFGRTISKKSLDMAIKHMDIRNSS-GNIRSLTS  467



>gb|KDO64167.1| hypothetical protein CISIN_1g008000mg [Citrus sinensis]
Length=582

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 7/56 (13%)
 Frame = -2

Query  513  TGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPL--MTNIPASSMYSVRSGPSRSRTV  352
            TGFGRT+SKKSLDMAIRHMDIR    G++R L   T  P     S+RS  S++R+ 
Sbjct  436  TGFGRTISKKSLDMAIRHMDIRNGA-GSIRQLSGTTLFP----QSIRSATSKTRSA  486



>ref|XP_010922788.1| PREDICTED: DNA-directed RNA polymerase II subunit RPB1-like [Elaeis 
guineensis]
Length=581

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  513  TGFGRTLSKKSLDMAIRHMDIRRTIPG  433
            TGFGRT+SKKSLDMA+RHMDIR+++ G
Sbjct  428  TGFGRTISKKSLDMALRHMDIRQSLGG  454



>gb|KHN29484.1| hypothetical protein glysoja_005208 [Glycine soja]
Length=586

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 1/34 (3%)
 Frame = -2

Query  513  TGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMT  412
            TGFGRT+SKKSLDMAI+HMDIR +  GN+R L +
Sbjct  435  TGFGRTISKKSLDMAIKHMDIRNSS-GNIRSLTS  467



>ref|XP_006429633.1| hypothetical protein CICLE_v100114702mg, partial [Citrus clementina]
 gb|ESR42873.1| hypothetical protein CICLE_v100114702mg, partial [Citrus clementina]
Length=368

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 7/56 (13%)
 Frame = -2

Query  513  TGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPL--MTNIPASSMYSVRSGPSRSRTV  352
            TGFGRT+SKKSLDMAIRHMDIR    G++R L   T  P     S+RS  S++R+ 
Sbjct  222  TGFGRTISKKSLDMAIRHMDIRNGA-GSIRQLSGTTLFP----QSIRSATSKTRSA  272



>ref|XP_008803007.1| PREDICTED: DNA-directed RNA polymerase II subunit RPB1-like [Phoenix 
dactylifera]
Length=616

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  513  TGFGRTLSKKSLDMAIRHMDIRRTIPG  433
            TGFGRT+SKKSLDMA+RHMDIR+++ G
Sbjct  462  TGFGRTISKKSLDMALRHMDIRQSLGG  488



>ref|XP_004302521.1| PREDICTED: sialidase [Fragaria vesca subsp. vesca]
Length=583

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 7/56 (13%)
 Frame = -2

Query  513  TGFGRTLSKKSLDMAIRHMDIRRTIPGNLRPLMTNIPASSMY--SVRSGPSRSRTV  352
            TGFGR +SKKSLDMAIRHMDI+    GN R L      S+++  S+RSG  +++TV
Sbjct  430  TGFGRNISKKSLDMAIRHMDIKNGT-GNSRQLS----GSTLFPQSIRSGTPKTQTV  480



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395