BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF041M24

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009607662.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       190   1e-52   Nicotiana tomentosiformis
emb|CDP16183.1|  unnamed protein product                                187   2e-51   Coffea canephora [robusta coffee]
ref|XP_009787108.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            187   2e-51   Nicotiana sylvestris
emb|CDP16188.1|  unnamed protein product                                184   3e-51   Coffea canephora [robusta coffee]
ref|XP_011090957.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    180   4e-49   Sesamum indicum [beniseed]
ref|XP_011090875.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    180   6e-49   Sesamum indicum [beniseed]
emb|CDP21289.1|  unnamed protein product                                176   2e-47   Coffea canephora [robusta coffee]
ref|XP_006342519.1|  PREDICTED: probable peptide transporter At1g...    172   2e-46   Solanum tuberosum [potatoes]
ref|XP_010314832.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    171   4e-46   
emb|CDP16193.1|  unnamed protein product                                172   4e-46   Coffea canephora [robusta coffee]
emb|CDP16184.1|  unnamed protein product                                166   2e-45   Coffea canephora [robusta coffee]
ref|XP_004253108.2|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    170   3e-45   Solanum lycopersicum
emb|CDP16191.1|  unnamed protein product                                166   7e-44   Coffea canephora [robusta coffee]
ref|XP_009145285.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       157   4e-43   Brassica rapa
gb|AAL25616.1|  At1g52190/F9I5_4                                        157   9e-43   Arabidopsis thaliana [mouse-ear cress]
gb|EYU29274.1|  hypothetical protein MIMGU_mgv1a003369mg                162   1e-42   Erythranthe guttata [common monkey flower]
emb|CDP16194.1|  unnamed protein product                                162   2e-42   Coffea canephora [robusta coffee]
ref|XP_009114865.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       156   5e-42   Brassica rapa
ref|XP_006465636.1|  PREDICTED: probable peptide transporter At1g...    160   7e-42   
ref|XP_006465634.1|  PREDICTED: probable peptide transporter At1g...    160   9e-42   Citrus sinensis [apfelsine]
ref|XP_006426938.1|  hypothetical protein CICLE_v10025189mg             159   2e-41   Citrus clementina [clementine]
gb|KFK38969.1|  hypothetical protein AALP_AA3G183300                    159   2e-41   Arabis alpina [alpine rockcress]
dbj|BAB02684.1|  peptide/amino acid transporter-like protein            158   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188239.1|  nitrate transporter 1.12                              158   3e-41   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20441.1|  putative transport protein                              158   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114884.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...    157   4e-41   
emb|CDY28371.1|  BnaC01g35410D                                          157   4e-41   Brassica napus [oilseed rape]
ref|XP_004486756.1|  PREDICTED: probable peptide transporter At1g...    158   5e-41   
ref|XP_007135664.1|  hypothetical protein PHAVU_010G147900g             158   5e-41   Phaseolus vulgaris [French bean]
emb|CDY51257.1|  BnaC03g77810D                                          157   5e-41   Brassica napus [oilseed rape]
ref|XP_004486755.1|  PREDICTED: probable peptide transporter At1g...    158   6e-41   Cicer arietinum [garbanzo]
ref|XP_002885127.1|  proton-dependent oligopeptide transport fami...    157   6e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_002891678.1|  proton-dependent oligopeptide transport fami...    157   7e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_009114876.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...    157   8e-41   Brassica rapa
ref|NP_175630.1|  nitrate transporter 1.11                              157   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306954.1|  hypothetical protein CARUB_v10008522mg             157   1e-40   
ref|XP_011081806.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       156   2e-40   Sesamum indicum [beniseed]
ref|XP_002299719.2|  hypothetical protein POPTR_0001s18640g             156   2e-40   Populus trichocarpa [western balsam poplar]
gb|KFK35804.1|  hypothetical protein AALP_AA4G038900                    156   2e-40   Arabis alpina [alpine rockcress]
ref|XP_010465628.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1 isof...    155   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010503915.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       156   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006297268.1|  hypothetical protein CARUB_v10013282mg             155   3e-40   Capsella rubella
ref|XP_003531667.1|  PREDICTED: probable peptide transporter At1g...    155   3e-40   Glycine max [soybeans]
ref|XP_002516008.1|  nitrate transporter, putative                      155   4e-40   Ricinus communis
ref|XP_010654644.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            155   5e-40   Vitis vinifera
ref|XP_008462171.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       151   5e-40   Cucumis melo [Oriental melon]
ref|XP_009147706.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            155   5e-40   Brassica rapa
ref|XP_011008319.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            155   6e-40   Populus euphratica
ref|XP_010668942.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       155   6e-40   
ref|XP_011072387.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            155   6e-40   Sesamum indicum [beniseed]
ref|XP_010479719.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    155   6e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010487466.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       155   6e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010479721.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    155   7e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010479720.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    155   7e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010462057.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       155   7e-40   Camelina sativa [gold-of-pleasure]
ref|XP_003597728.1|  hypothetical protein MTR_2g101640                  154   1e-39   Medicago truncatula
ref|XP_006450666.1|  hypothetical protein CICLE_v10010188mg             153   2e-39   
ref|XP_008445025.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       153   2e-39   
emb|CDY30141.1|  BnaC05g37210D                                          153   2e-39   Brassica napus [oilseed rape]
ref|XP_009593688.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       153   2e-39   Nicotiana tomentosiformis
ref|XP_010545694.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       153   3e-39   Tarenaya hassleriana [spider flower]
ref|XP_004164040.1|  PREDICTED: probable peptide transporter At1g...    152   3e-39   
emb|CDX97728.1|  BnaA05g23510D                                          152   4e-39   
ref|XP_009146163.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1            152   5e-39   Brassica rapa
ref|XP_004170441.1|  PREDICTED: probable peptide transporter At1g...    152   5e-39   
ref|XP_003529761.1|  PREDICTED: probable peptide transporter At1g...    152   5e-39   Glycine max [soybeans]
ref|XP_010500813.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       152   5e-39   Camelina sativa [gold-of-pleasure]
emb|CDO98013.1|  unnamed protein product                                152   5e-39   Coffea canephora [robusta coffee]
ref|XP_004150292.1|  PREDICTED: probable peptide transporter At1g...    152   6e-39   
gb|KHN04221.1|  Putative peptide transporter                            152   7e-39   Glycine soja [wild soybean]
ref|XP_007137205.1|  hypothetical protein PHAVU_009G108400g             152   7e-39   Phaseolus vulgaris [French bean]
gb|KGN62823.1|  hypothetical protein Csa_2G374650                       152   8e-39   
ref|XP_009786716.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       152   8e-39   Nicotiana sylvestris
ref|XP_004141840.1|  PREDICTED: probable peptide transporter At1g...    152   9e-39   
ref|XP_004252349.2|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            152   9e-39   Solanum lycopersicum
gb|KHN04222.1|  Putative peptide transporter                            151   9e-39   Glycine soja [wild soybean]
ref|XP_003530142.1|  PREDICTED: probable peptide transporter At1g...    152   9e-39   Glycine max [soybeans]
gb|KGN45387.1|  hypothetical protein Csa_7G447020                       152   1e-38   Cucumis sativus [cucumbers]
ref|XP_006392949.1|  hypothetical protein EUTSA_v10011325mg             151   1e-38   Eutrema salsugineum [saltwater cress]
ref|XP_011026625.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       150   2e-38   Populus euphratica
ref|XP_002324232.2|  hypothetical protein POPTR_0018s00440g             150   2e-38   
gb|KDO79783.1|  hypothetical protein CISIN_1g039943mg                   150   2e-38   Citrus sinensis [apfelsine]
ref|XP_006450665.1|  hypothetical protein CICLE_v10010641mg             150   2e-38   Citrus clementina [clementine]
ref|XP_006476061.1|  PREDICTED: probable peptide transporter At1g...    150   2e-38   Citrus sinensis [apfelsine]
ref|XP_008445024.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       150   2e-38   Cucumis melo [Oriental melon]
ref|XP_011026626.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       150   3e-38   Populus euphratica
ref|XP_006406868.1|  hypothetical protein EUTSA_v10020365mg             150   3e-38   Eutrema salsugineum [saltwater cress]
ref|XP_002516546.1|  nitrate transporter, putative                      149   3e-38   
ref|XP_002324231.1|  hypothetical protein POPTR_0018s00430g             150   4e-38   
ref|XP_007150641.1|  hypothetical protein PHAVU_005G169400g             150   4e-38   Phaseolus vulgaris [French bean]
gb|KHM98741.1|  Putative peptide transporter                            150   4e-38   Glycine soja [wild soybean]
ref|XP_003546477.1|  PREDICTED: probable peptide transporter At1g...    149   5e-38   Glycine max [soybeans]
ref|XP_002516544.1|  nitrate transporter, putative                      148   1e-37   Ricinus communis
ref|XP_010668254.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       148   1e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003597725.1|  hypothetical protein MTR_2g101590                  148   2e-37   Medicago truncatula
ref|XP_003597726.1|  hypothetical protein MTR_2g101610                  147   3e-37   Medicago truncatula
gb|ADG37990.1|  AT1G52190-like protein                                  140   4e-37   Capsella grandiflora
gb|AEN81086.1|  AT1G52190-like protein                                  140   4e-37   Capsella rubella
gb|KDO79779.1|  hypothetical protein CISIN_1g008264mg                   145   5e-37   Citrus sinensis [apfelsine]
gb|KDO79781.1|  hypothetical protein CISIN_1g008264mg                   146   5e-37   Citrus sinensis [apfelsine]
gb|KDP37260.1|  hypothetical protein JCGZ_06316                         147   5e-37   Jatropha curcas
ref|XP_006359461.1|  PREDICTED: probable peptide transporter At1g...    146   7e-37   Solanum tuberosum [potatoes]
ref|XP_006476064.1|  PREDICTED: probable peptide transporter At1g...    145   8e-37   Citrus sinensis [apfelsine]
gb|KDO79777.1|  hypothetical protein CISIN_1g008264mg                   145   8e-37   Citrus sinensis [apfelsine]
ref|XP_010691376.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            146   1e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006450663.1|  hypothetical protein CICLE_v10007857mg             145   1e-36   Citrus clementina [clementine]
gb|KEH28715.1|  peptide/nitrate transporter plant                       145   1e-36   Medicago truncatula
gb|EPS73537.1|  proton-dependent oligopeptide transport family pr...    142   1e-36   Genlisea aurea
ref|XP_010648806.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            143   2e-36   
gb|ADG37995.1|  AT1G52190-like protein                                  139   2e-36   Neslia paniculata [ball mustard]
gb|ADG37992.1|  AT1G52190-like protein                                  138   2e-36   Capsella grandiflora
gb|KGN62822.1|  hypothetical protein Csa_2G374640                       144   2e-36   
ref|XP_004164039.1|  PREDICTED: probable peptide transporter At1g...    144   2e-36   
ref|XP_004150293.1|  PREDICTED: probable peptide transporter At1g...    144   2e-36   
ref|XP_003546946.1|  PREDICTED: probable peptide transporter At1g...    144   3e-36   Glycine max [soybeans]
gb|KHM98742.1|  Putative peptide transporter                            144   5e-36   Glycine soja [wild soybean]
ref|XP_008445026.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       143   6e-36   
gb|KCW79098.1|  hypothetical protein EUGRSUZ_C00542                     143   6e-36   Eucalyptus grandis [rose gum]
emb|CDO98012.1|  unnamed protein product                                144   7e-36   Coffea canephora [robusta coffee]
gb|KHG12398.1|  hypothetical protein F383_17450                         143   7e-36   Gossypium arboreum [tree cotton]
ref|XP_010050380.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       143   8e-36   
ref|XP_003597722.1|  hypothetical protein MTR_2g101560                  143   1e-35   
gb|KJB27308.1|  hypothetical protein B456_004G290200                    142   1e-35   Gossypium raimondii
gb|KHN10207.1|  Putative peptide transporter                            142   2e-35   Glycine soja [wild soybean]
ref|XP_003522705.1|  PREDICTED: probable peptide transporter At1g...    142   2e-35   Glycine max [soybeans]
gb|KJB27309.1|  hypothetical protein B456_004G290200                    142   2e-35   Gossypium raimondii
gb|KJB27307.1|  hypothetical protein B456_004G290100                    142   3e-35   Gossypium raimondii
gb|KCW69640.1|  hypothetical protein EUGRSUZ_F03048                     141   3e-35   Eucalyptus grandis [rose gum]
ref|XP_010668239.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       141   3e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN47833.1|  Putative peptide transporter                            141   3e-35   Glycine soja [wild soybean]
ref|XP_007012104.1|  Major facilitator superfamily protein              141   3e-35   
ref|XP_003531668.2|  PREDICTED: probable peptide transporter At1g...    141   4e-35   Glycine max [soybeans]
gb|KEH41919.1|  peptide/nitrate transporter plant                       140   4e-35   Medicago truncatula
gb|KEH41920.1|  peptide/nitrate transporter plant                       141   4e-35   Medicago truncatula
ref|XP_010062498.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       141   5e-35   
ref|XP_004235680.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       141   6e-35   Solanum lycopersicum
ref|XP_006486908.1|  PREDICTED: probable peptide transporter At1g...    140   6e-35   
ref|XP_006486906.1|  PREDICTED: probable peptide transporter At1g...    140   1e-34   Citrus sinensis [apfelsine]
ref|XP_006486905.1|  PREDICTED: probable peptide transporter At1g...    140   1e-34   
ref|XP_010047267.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    139   2e-34   
ref|XP_010318544.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    139   2e-34   
ref|XP_004235682.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    139   2e-34   
ref|XP_010318543.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    139   2e-34   Solanum lycopersicum
emb|CBI20867.3|  unnamed protein product                                142   3e-34   Vitis vinifera
gb|KHG04534.1|  hypothetical protein F383_29859                         139   3e-34   Gossypium arboreum [tree cotton]
ref|XP_006486909.1|  PREDICTED: probable peptide transporter At1g...    139   3e-34   Citrus sinensis [apfelsine]
gb|KJB56778.1|  hypothetical protein B456_009G135700                    138   4e-34   Gossypium raimondii
ref|XP_006422797.1|  hypothetical protein CICLE_v10029786mg             138   4e-34   
ref|XP_009783586.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       138   4e-34   Nicotiana sylvestris
ref|XP_006422799.1|  hypothetical protein CICLE_v10028344mg             137   5e-34   Citrus clementina [clementine]
ref|XP_009628045.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       138   5e-34   Nicotiana tomentosiformis
ref|XP_006422795.1|  hypothetical protein CICLE_v10029930mg             138   6e-34   
ref|XP_007024218.1|  Major facilitator superfamily protein              138   7e-34   
ref|XP_006343082.1|  PREDICTED: probable peptide transporter At1g...    137   7e-34   
gb|KHG18966.1|  hypothetical protein F383_07419                         137   9e-34   Gossypium arboreum [tree cotton]
ref|XP_010320606.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    137   1e-33   Solanum lycopersicum
ref|XP_010254052.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            137   1e-33   Nelumbo nucifera [Indian lotus]
ref|XP_004239355.2|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    137   1e-33   
ref|XP_006343081.1|  PREDICTED: probable peptide transporter At1g...    137   1e-33   Solanum tuberosum [potatoes]
ref|XP_010042085.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       136   1e-33   Eucalyptus grandis [rose gum]
ref|XP_004506900.1|  PREDICTED: probable peptide transporter At1g...    136   2e-33   
ref|XP_007135665.1|  hypothetical protein PHAVU_010G148000g             136   2e-33   Phaseolus vulgaris [French bean]
ref|XP_004506898.1|  PREDICTED: probable peptide transporter At1g...    136   3e-33   
ref|XP_006371703.1|  hypothetical protein POPTR_0018s00450g             135   3e-33   
ref|XP_011026624.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       135   4e-33   Populus euphratica
ref|XP_009795448.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    135   4e-33   Nicotiana sylvestris
gb|KJB59595.1|  hypothetical protein B456_009G262700                    135   4e-33   Gossypium raimondii
ref|XP_006371705.1|  hypothetical protein POPTR_0018s00470g             135   4e-33   
ref|XP_009795447.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    135   4e-33   Nicotiana sylvestris
ref|XP_006371706.1|  hypothetical protein POPTR_0018s00470g             135   4e-33   
ref|XP_004235683.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       135   4e-33   Solanum lycopersicum
ref|XP_011026621.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       135   5e-33   Populus euphratica
ref|XP_011026623.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       135   5e-33   Populus euphratica
ref|XP_011013128.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       135   7e-33   Populus euphratica
gb|KJB18644.1|  hypothetical protein B456_003G064500                    135   8e-33   Gossypium raimondii
ref|XP_010049663.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       134   9e-33   Eucalyptus grandis [rose gum]
ref|XP_006343084.1|  PREDICTED: probable peptide transporter At1g...    134   1e-32   Solanum tuberosum [potatoes]
ref|XP_006371704.1|  hypothetical protein POPTR_0018s00460g             134   1e-32   
ref|XP_010519892.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.3            134   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_009628173.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       134   2e-32   Nicotiana tomentosiformis
ref|XP_002324233.2|  hypothetical protein POPTR_0018s00480g             133   2e-32   
ref|XP_002324234.2|  hypothetical protein POPTR_0018s00490g             133   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006343083.1|  PREDICTED: probable peptide transporter At1g...    133   4e-32   
ref|XP_007150640.1|  hypothetical protein PHAVU_005G169300g             132   5e-32   Phaseolus vulgaris [French bean]
ref|XP_003597729.1|  hypothetical protein MTR_2g101650                  132   6e-32   Medicago truncatula
ref|XP_008352327.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       129   8e-32   
ref|XP_006355955.1|  PREDICTED: probable peptide transporter At1g...    132   8e-32   Solanum tuberosum [potatoes]
ref|XP_006355953.1|  PREDICTED: probable peptide transporter At1g...    132   8e-32   Solanum tuberosum [potatoes]
ref|XP_002514272.1|  nitrate transporter, putative                      132   9e-32   Ricinus communis
ref|XP_007150639.1|  hypothetical protein PHAVU_005G169300g             132   9e-32   Phaseolus vulgaris [French bean]
ref|XP_004301550.2|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       132   1e-31   Fragaria vesca subsp. vesca
ref|XP_007019700.1|  Nitrate transporter, putative                      132   1e-31   
ref|XP_004238698.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       131   1e-31   Solanum lycopersicum
gb|KEH40281.1|  peptide/nitrate transporter plant                       131   2e-31   Medicago truncatula
gb|KJB33640.1|  hypothetical protein B456_006G023500                    130   3e-31   Gossypium raimondii
ref|XP_006355954.1|  PREDICTED: probable peptide transporter At1g...    130   3e-31   Solanum tuberosum [potatoes]
ref|XP_006355956.1|  PREDICTED: probable peptide transporter At1g...    130   4e-31   Solanum tuberosum [potatoes]
gb|KDP33700.1|  hypothetical protein JCGZ_07271                         129   6e-31   Jatropha curcas
emb|CDP21642.1|  unnamed protein product                                129   7e-31   Coffea canephora [robusta coffee]
ref|XP_010318545.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       129   8e-31   
ref|XP_004238701.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    129   1e-30   
gb|KEH16315.1|  peptide/nitrate transporter                             128   1e-30   Medicago truncatula
ref|XP_010098095.1|  putative peptide transporter                       129   1e-30   Morus notabilis
ref|XP_011026620.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    128   1e-30   Populus euphratica
ref|XP_010320607.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    128   1e-30   
ref|XP_004238699.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    128   2e-30   
ref|XP_007024207.1|  Major facilitator superfamily protein, putative    128   2e-30   
ref|XP_011026619.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...    128   2e-30   Populus euphratica
gb|KEH40283.1|  peptide/nitrate transporter plant                       127   3e-30   Medicago truncatula
gb|KEH21351.1|  peptide/nitrate transporter plant                       127   3e-30   Medicago truncatula
ref|XP_004252058.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       127   3e-30   
gb|KHN41645.1|  Putative peptide transporter                            127   5e-30   Glycine soja [wild soybean]
ref|XP_006353565.1|  PREDICTED: probable peptide/nitrate transpor...    127   7e-30   
ref|XP_006475660.1|  PREDICTED: probable peptide/nitrate transpor...    123   1e-29   
ref|XP_006585587.1|  PREDICTED: probable peptide transporter At1g...    125   2e-29   
ref|XP_010924574.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            125   2e-29   
ref|XP_003524398.1|  PREDICTED: probable peptide transporter At1g...    125   2e-29   Glycine max [soybeans]
ref|XP_009352687.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       125   2e-29   Pyrus x bretschneideri [bai li]
gb|KDO66443.1|  hypothetical protein CISIN_1g007637mg                   125   3e-29   Citrus sinensis [apfelsine]
ref|XP_009628044.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       120   3e-29   Nicotiana tomentosiformis
ref|XP_006451204.1|  hypothetical protein CICLE_v10007800mg             125   3e-29   Citrus clementina [clementine]
ref|XP_009416500.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       125   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010648805.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       124   4e-29   Vitis vinifera
ref|XP_009789264.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       123   5e-29   Nicotiana sylvestris
ref|XP_009780784.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       121   1e-28   Nicotiana sylvestris
ref|XP_006475659.1|  PREDICTED: probable peptide transporter At1g...    123   1e-28   Citrus sinensis [apfelsine]
gb|KDO66442.1|  hypothetical protein CISIN_1g007910mg                   123   1e-28   Citrus sinensis [apfelsine]
ref|XP_006355952.1|  PREDICTED: probable peptide transporter At1g...    123   2e-28   Solanum tuberosum [potatoes]
ref|XP_006451203.1|  hypothetical protein CICLE_v10007831mg             123   2e-28   Citrus clementina [clementine]
gb|EYU29810.1|  hypothetical protein MIMGU_mgv1a020560mg                122   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_007204860.1|  hypothetical protein PRUPE_ppa023390mg             122   3e-28   Prunus persica
ref|XP_009609880.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       117   5e-28   Nicotiana tomentosiformis
ref|XP_002318679.2|  hypothetical protein POPTR_0012s08940g             121   6e-28   
ref|XP_010668218.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       121   6e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN16613.1|  Putative peptide transporter                            120   7e-28   Glycine soja [wild soybean]
ref|XP_009788943.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       120   1e-27   Nicotiana sylvestris
ref|XP_010051584.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       120   1e-27   Eucalyptus grandis [rose gum]
ref|XP_008793166.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       120   1e-27   Phoenix dactylifera
ref|XP_008242634.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       120   2e-27   Prunus mume [ume]
ref|XP_004151437.1|  PREDICTED: probable peptide transporter At1g...    120   2e-27   Cucumis sativus [cucumbers]
ref|XP_006586332.1|  PREDICTED: probable peptide transporter At1g...    120   2e-27   
ref|XP_004171650.1|  PREDICTED: LOW QUALITY PROTEIN: probable pep...    119   2e-27   
emb|CDP21853.1|  unnamed protein product                                118   3e-27   Coffea canephora [robusta coffee]
ref|XP_011040515.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       119   3e-27   Populus euphratica
ref|XP_009774737.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       119   3e-27   Nicotiana sylvestris
ref|XP_010656492.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       119   4e-27   Vitis vinifera
ref|XP_004503821.1|  PREDICTED: probable peptide transporter At1g...    118   7e-27   
ref|XP_008793165.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       118   1e-26   
ref|XP_003567138.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       117   1e-26   Brachypodium distachyon [annual false brome]
ref|XP_003569868.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       117   1e-26   Brachypodium distachyon [annual false brome]
ref|XP_008462682.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       117   2e-26   Cucumis melo [Oriental melon]
ref|XP_006363540.1|  PREDICTED: probable peptide transporter At1g...    117   2e-26   Solanum tuberosum [potatoes]
ref|XP_009774738.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       116   4e-26   Nicotiana sylvestris
ref|XP_009795451.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       112   4e-26   Nicotiana sylvestris
ref|XP_004245185.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       115   5e-26   Solanum lycopersicum
ref|XP_008242632.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       116   5e-26   
ref|XP_006364284.1|  PREDICTED: probable peptide transporter At1g...    115   7e-26   Solanum tuberosum [potatoes]
gb|KHN41359.1|  Putative peptide transporter                            115   8e-26   Glycine soja [wild soybean]
ref|XP_004237077.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       115   8e-26   Solanum lycopersicum
ref|XP_004238696.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            115   8e-26   Solanum lycopersicum
gb|KEH40280.1|  peptide/nitrate transporter plant                       115   1e-25   Medicago truncatula
ref|XP_007203564.1|  hypothetical protein PRUPE_ppa026167mg             115   1e-25   
dbj|BAK04396.1|  predicted protein                                      114   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009787172.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    114   2e-25   Nicotiana sylvestris
ref|XP_008340555.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       111   2e-25   
gb|KDP45469.1|  hypothetical protein JCGZ_09718                         113   5e-25   Jatropha curcas
ref|XP_011019627.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       112   8e-25   Populus euphratica
ref|XP_004238700.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       112   1e-24   Solanum lycopersicum
ref|XP_010920695.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...    111   2e-24   Elaeis guineensis
ref|XP_010920688.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...    111   2e-24   Elaeis guineensis
gb|AEN81914.1|  AT3G16180-like protein                                  106   2e-24   Capsella grandiflora
gb|AEN81915.1|  AT3G16180-like protein                                  106   2e-24   Capsella rubella
gb|AEN81911.1|  AT3G16180-like protein                                  106   2e-24   Capsella grandiflora
gb|AEN81910.1|  AT3G16180-like protein                                  106   2e-24   Capsella grandiflora
gb|AEN81913.1|  AT3G16180-like protein                                  106   2e-24   Capsella grandiflora
ref|XP_010491892.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.3-like...    110   2e-24   
gb|AEN81912.1|  AT3G16180-like protein                                  106   2e-24   Capsella grandiflora
ref|XP_002300021.1|  hypothetical protein POPTR_0001s34640g             110   3e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010491891.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.3-like...    110   3e-24   
ref|XP_006286746.1|  hypothetical protein CARUB_v10003056mg             109   4e-24   
ref|XP_002308609.1|  hypothetical protein POPTR_0006s25670g             110   4e-24   
ref|XP_010551494.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           110   6e-24   
ref|XP_004239357.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       109   9e-24   
ref|XP_009621370.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    109   9e-24   
ref|XP_009621369.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    109   9e-24   
ref|XP_002269340.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           109   1e-23   
ref|XP_006355950.1|  PREDICTED: probable peptide transporter At1g...    109   1e-23   
ref|XP_006355986.1|  PREDICTED: probable peptide transporter At1g...    108   2e-23   
ref|XP_006355951.1|  PREDICTED: probable peptide transporter At1g...    108   2e-23   
gb|AAX94830.1|  Similar to peptide/amino acid transporter-like pr...    107   2e-23   
ref|XP_008389126.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       108   2e-23   
gb|EAY85681.1|  hypothetical protein OsI_07050                          107   2e-23   
emb|CDP03303.1|  unnamed protein product                                108   2e-23   
ref|XP_004985077.1|  PREDICTED: peptide transporter PTR2-like           108   2e-23   
ref|XP_006355949.1|  PREDICTED: probable peptide transporter At1g...    108   2e-23   
emb|CDY00315.1|  BnaA06g22160D                                          108   2e-23   
ref|XP_006645212.1|  PREDICTED: nitrate transporter 1.7-like            107   2e-23   
emb|CDM84274.1|  unnamed protein product                                108   3e-23   
ref|XP_011007525.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       108   3e-23   
ref|XP_011071716.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      108   3e-23   
gb|AAM47310.1|AF377946_12  putative peptide transporter protein         106   3e-23   
ref|XP_007160322.1|  hypothetical protein PHAVU_002G311900g             108   3e-23   
ref|XP_006394362.1|  hypothetical protein EUTSA_v10003849mg             108   3e-23   
ref|XP_004238703.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       107   4e-23   
ref|XP_009151387.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      107   6e-23   
ref|XP_008466783.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    107   6e-23   
ref|XP_011087208.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      107   6e-23   
ref|XP_010939959.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       107   7e-23   
ref|XP_008466778.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    107   7e-23   
ref|XP_010937011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       107   7e-23   
gb|AAX96583.1|  POT family, putative                                    107   7e-23   
ref|XP_010100643.1|  putative peptide/nitrate transporter               107   8e-23   
ref|XP_009105593.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      103   8e-23   
ref|NP_001051098.1|  Os03g0719900                                       106   1e-22   
ref|XP_010320609.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       106   1e-22   
ref|XP_008787880.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       106   1e-22   
gb|EEE59822.1|  hypothetical protein OsJ_12376                          106   1e-22   
ref|XP_002873521.1|  proton-dependent oligopeptide transport fami...    105   1e-22   
gb|EEC72017.1|  hypothetical protein OsI_04891                          105   1e-22   
ref|XP_010933709.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       106   1e-22   
ref|XP_004236179.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      106   1e-22   
ref|XP_009351619.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       106   2e-22   
ref|XP_010683278.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12           106   2e-22   
ref|XP_004149470.1|  PREDICTED: peptide transporter PTR2-like           105   2e-22   
gb|EPS63172.1|  hypothetical protein M569_11615                         104   2e-22   
ref|XP_007222294.1|  hypothetical protein PRUPE_ppa003339mg             104   2e-22   
ref|XP_008798043.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       105   2e-22   
ref|XP_007045396.1|  Peptide transporter 2 isoform 2                    104   3e-22   
gb|KHN18517.1|  Putative peptide/nitrate transporter                    105   3e-22   
ref|XP_003549658.1|  PREDICTED: probable peptide/nitrate transpor...    105   3e-22   
ref|XP_006448045.1|  hypothetical protein CICLE_v10014643mg             103   3e-22   
ref|XP_007032430.1|  Major facilitator superfamily protein              105   3e-22   
emb|CDY45756.1|  BnaC02g42260D                                          105   3e-22   
ref|XP_003608979.1|  Nitrate transporter NRT1-2                         105   4e-22   
gb|EPS61327.1|  hypothetical protein M569_13470                         105   4e-22   
gb|KHN48654.1|  Putative peptide/nitrate transporter                    105   4e-22   
tpg|DAA57516.1|  TPA: hypothetical protein ZEAMMB73_864993              103   4e-22   
gb|AES91176.2|  peptide/nitrate transporter                             105   4e-22   
ref|XP_003525007.2|  PREDICTED: probable peptide/nitrate transpor...    105   4e-22   
gb|KHN06246.1|  Peptide transporter PTR1                                104   4e-22   
emb|CDP10977.1|  unnamed protein product                                104   5e-22   
ref|XP_006373301.1|  hypothetical protein POPTR_0017s11320g             104   5e-22   
ref|XP_006367062.1|  PREDICTED: probable peptide/nitrate transpor...    104   5e-22   
gb|KDP45400.1|  hypothetical protein JCGZ_09649                         104   6e-22   
ref|XP_009130227.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           104   6e-22   
ref|XP_006849517.1|  hypothetical protein AMTR_s00024p00147790          104   6e-22   
ref|XP_010939960.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       104   6e-22   
gb|EMT16488.1|  Peptide transporter PTR1                                102   6e-22   
ref|NP_196718.1|  major facilitator protein                             103   6e-22   
ref|XP_007161541.1|  hypothetical protein PHAVU_001G078000g             104   7e-22   
ref|XP_006650508.1|  PREDICTED: peptide transporter PTR2-like           104   7e-22   
ref|XP_007222295.1|  hypothetical protein PRUPE_ppa003339mg             104   7e-22   
ref|XP_004500227.1|  PREDICTED: peptide transporter PTR5-like iso...    103   8e-22   
ref|XP_010033021.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       103   8e-22   
ref|XP_008807862.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      104   8e-22   
ref|XP_009408470.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      104   9e-22   
gb|EMS66306.1|  Peptide transporter PTR2                                103   1e-21   
ref|XP_010230764.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       104   1e-21   
ref|XP_003551296.1|  PREDICTED: peptide transporter PTR1                103   1e-21   
ref|XP_002517390.1|  nitrate transporter, putative                      103   1e-21   
ref|XP_007045395.1|  Peptide transporter 2 isoform 1                    103   1e-21   
gb|KHN48656.1|  Putative peptide/nitrate transporter                    103   1e-21   
ref|XP_010678901.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      103   1e-21   
ref|XP_006833367.1|  hypothetical protein AMTR_s00109p00101980          103   1e-21   
gb|KDP46550.1|  hypothetical protein JCGZ_08522                         101   1e-21   
ref|XP_006492274.1|  PREDICTED: peptide transporter PTR2-like           103   1e-21   
ref|XP_004985076.1|  PREDICTED: peptide transporter PTR2-like iso...    103   1e-21   
ref|XP_003524995.1|  PREDICTED: probable peptide/nitrate transpor...    103   1e-21   
gb|ABR32183.1|  peptide transporter                                     103   1e-21   
ref|XP_010314236.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    102   1e-21   
ref|XP_006448044.1|  hypothetical protein CICLE_v10014643mg             103   1e-21   
gb|KEH16161.1|  proton-dependent oligopeptide transport family pr...    103   1e-21   
ref|XP_009121934.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.3            103   1e-21   
ref|XP_004985075.1|  PREDICTED: peptide transporter PTR2-like iso...    103   1e-21   
gb|EPS64583.1|  hypothetical protein M569_10198                         100   1e-21   
gb|EMS49861.1|  Nitrate transporter 1.7                                 103   1e-21   
ref|XP_003524837.1|  PREDICTED: peptide transporter PTR2-like           103   1e-21   
gb|KHN10296.1|  Putative peptide transporter                            103   1e-21   
emb|CDY48389.1|  BnaA07g24080D                                          103   1e-21   
emb|CDY67993.1|  BnaCnng57240D                                          103   1e-21   
dbj|BAK04665.1|  predicted protein                                      103   2e-21   
ref|XP_010256190.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       103   2e-21   
gb|KHN28716.1|  Nitrate transporter 1.7                                 103   2e-21   
ref|XP_006282309.1|  hypothetical protein CARUB_v10028599mg             103   2e-21   
gb|KEH29311.1|  proton-dependent oligopeptide transport family pr...    101   2e-21   
ref|XP_006487530.1|  PREDICTED: probable peptide/nitrate transpor...    100   2e-21   
ref|XP_006596167.1|  PREDICTED: probable peptide transporter At1g...    102   2e-21   
ref|XP_002866507.1|  proton-dependent oligopeptide transport fami...    103   2e-21   
gb|KDP21241.1|  hypothetical protein JCGZ_21712                         103   2e-21   
ref|XP_008798073.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            102   2e-21   
ref|XP_002315835.1|  Peptide transporter PTR2-B family protein          102   2e-21   
ref|XP_003558413.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       102   2e-21   
gb|EMT07615.1|  Peptide transporter PTR2                                102   2e-21   
gb|KEH29310.1|  proton-dependent oligopeptide transport family pr...    101   2e-21   
ref|XP_009405084.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       102   3e-21   
ref|XP_011013862.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like      101   3e-21   
ref|NP_001045170.1|  Os01g0913300                                       102   3e-21   
ref|XP_003519778.1|  PREDICTED: nitrate transporter 1.7-like            102   3e-21   
ref|XP_006484348.1|  PREDICTED: probable peptide/nitrate transpor...    100   3e-21   
ref|XP_008220969.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    102   3e-21   
gb|EYU35891.1|  hypothetical protein MIMGU_mgv1a021530mg                102   3e-21   
ref|XP_002317995.2|  proton-dependent oligopeptide transport fami...    102   3e-21   
gb|KEH31904.1|  peptide/nitrate transporter plant                       102   3e-21   
ref|NP_001152466.1|  peptide transporter PTR2                           102   3e-21   
ref|XP_011029471.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       102   3e-21   
ref|XP_004252286.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    102   3e-21   
ref|XP_008347950.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    102   3e-21   
gb|KHN01163.1|  Nitrate transporter 1.7                                 102   3e-21   
ref|XP_006601040.1|  PREDICTED: probable peptide transporter At1g...    102   4e-21   
emb|CBI15285.3|  unnamed protein product                                103   4e-21   
gb|KJB15302.1|  hypothetical protein B456_002G169800                    102   4e-21   
ref|XP_011070505.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       102   4e-21   
ref|XP_002285274.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       102   5e-21   
ref|XP_011021701.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       102   5e-21   
ref|XP_002458530.1|  hypothetical protein SORBIDRAFT_03g035270          102   5e-21   
ref|NP_201074.1|  glucosinolate transporter-2                           102   5e-21   
ref|XP_002270812.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           101   5e-21   
ref|XP_002270558.3|  PREDICTED: uncharacterized protein LOC100263850    102   6e-21   
ref|XP_004239356.2|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       101   6e-21   
ref|XP_010923125.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       101   6e-21   
gb|KFK28007.1|  hypothetical protein AALP_AA8G459400                    101   6e-21   
emb|CBH32526.1|  peptide transporter, putative, expressed               101   6e-21   
ref|XP_009335771.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       101   7e-21   
ref|XP_004138297.1|  PREDICTED: probable peptide/nitrate transpor...    101   7e-21   
ref|XP_004241514.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      101   7e-21   
gb|KEH29309.1|  proton-dependent oligopeptide transport family pr...    101   7e-21   
emb|CDX69747.1|  BnaA10g20960D                                          102   7e-21   
ref|XP_004970047.1|  PREDICTED: probable peptide transporter At1g...    101   8e-21   
gb|KDP46548.1|  hypothetical protein JCGZ_08520                         101   8e-21   
ref|XP_010043898.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            101   8e-21   
gb|KDP46546.1|  hypothetical protein JCGZ_08518                         101   8e-21   
ref|XP_004970046.1|  PREDICTED: probable peptide transporter At1g...    101   8e-21   
ref|XP_008364618.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      101   8e-21   
gb|EYU29570.1|  hypothetical protein MIMGU_mgv1a021473mg              97.1    9e-21   
ref|XP_004970045.1|  PREDICTED: probable peptide transporter At1g...    101   9e-21   
ref|XP_004985083.1|  PREDICTED: peptide transporter PTR2-like iso...    100   1e-20   
ref|XP_004965186.1|  PREDICTED: probable nitrite transporter At1g...    100   1e-20   
gb|KHG27963.1|  Peptide transporter PTR2 -like protein                  100   1e-20   
ref|XP_004985084.1|  PREDICTED: peptide transporter PTR2-like iso...    100   1e-20   
ref|XP_011042616.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      100   1e-20   
gb|KDP38200.1|  hypothetical protein JCGZ_04843                         100   1e-20   
gb|AFK37404.1|  unknown                                               97.1    1e-20   
ref|XP_004970044.1|  PREDICTED: probable peptide transporter At1g...    101   1e-20   
ref|XP_008220970.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       100   1e-20   
ref|XP_003531124.1|  PREDICTED: peptide transporter PTR2-like           100   1e-20   
ref|XP_010680056.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       100   1e-20   
ref|XP_002463973.1|  hypothetical protein SORBIDRAFT_01g009900          100   1e-20   
ref|XP_010676231.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       100   1e-20   
ref|XP_010483980.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           100   1e-20   
ref|XP_002521890.1|  peptide transporter, putative                      100   2e-20   
ref|XP_004982146.1|  PREDICTED: probable peptide/nitrate transpor...  99.4    2e-20   
ref|XP_008348207.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    100   2e-20   
ref|XP_008775060.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       100   2e-20   
ref|XP_006476662.1|  PREDICTED: probable peptide/nitrate transpor...    100   2e-20   
gb|KEH29314.1|  peptide/nitrate transporter plant-like protein        99.4    2e-20   
ref|XP_006439660.1|  hypothetical protein CICLE_v10023266mg             100   2e-20   
emb|CDP09151.1|  unnamed protein product                                100   2e-20   
ref|NP_001237970.1|  nitrate transporter NRT1-2                         100   2e-20   
ref|XP_008357888.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  99.8    2e-20   
gb|EMT01362.1|  Peptide transporter PTR5                              97.1    2e-20   
ref|XP_004508783.1|  PREDICTED: probable peptide/nitrate transpor...    100   2e-20   
gb|KHN18518.1|  Putative peptide/nitrate transporter                  99.8    2e-20   
ref|XP_007157410.1|  hypothetical protein PHAVU_002G067700g             100   2e-20   
gb|EYU35890.1|  hypothetical protein MIMGU_mgv1a018347mg              97.4    2e-20   
ref|XP_004508781.1|  PREDICTED: probable peptide/nitrate transpor...    100   2e-20   
gb|KDP38199.1|  hypothetical protein JCGZ_04842                         100   2e-20   
ref|XP_009369363.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like...  99.8    2e-20   
ref|XP_003550765.1|  PREDICTED: probable peptide/nitrate transpor...    100   2e-20   
ref|XP_009369361.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like...  99.8    2e-20   
ref|XP_010242330.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like     99.8    3e-20   
gb|KGN63647.1|  hypothetical protein Csa_1G008530                     99.8    3e-20   
gb|KHN18519.1|  Putative peptide/nitrate transporter                  99.8    3e-20   
gb|KDP24486.1|  hypothetical protein JCGZ_25050                       99.8    3e-20   
ref|XP_010276263.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     99.8    3e-20   
ref|XP_004138148.1|  PREDICTED: probable peptide/nitrate transpor...  99.8    3e-20   
ref|XP_003630771.1|  hypothetical protein MTR_8g103250                99.4    3e-20   
ref|XP_007225683.1|  hypothetical protein PRUPE_ppa003292mg           99.8    3e-20   
ref|XP_010546036.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    99.8    3e-20   
tpg|DAA50699.1|  TPA: hypothetical protein ZEAMMB73_457708            98.6    3e-20   
ref|NP_001136757.1|  hypothetical protein                             97.8    3e-20   
emb|CDY30731.1|  BnaA02g33530D                                        99.8    3e-20   
ref|XP_009626986.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    99.8    3e-20   
ref|XP_009150212.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like    99.8    3e-20   
gb|EMT06499.1|  Peptide transporter PTR2                              99.0    3e-20   
ref|XP_010105516.1|  Peptide transporter                              99.4    3e-20   
ref|XP_010444119.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    99.8    3e-20   
ref|XP_004246936.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     99.4    3e-20   
ref|XP_007026785.1|  Peptide transporter 1 isoform 1                  99.4    4e-20   
ref|XP_003604615.1|  Peptide transporter PTR1                         99.4    4e-20   
ref|XP_006425015.1|  hypothetical protein CICLE_v10028095mg           99.4    4e-20   
ref|XP_008466771.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  99.4    4e-20   
gb|KHG06441.1|  Peptide transporter PTR2 -like protein                99.4    4e-20   
ref|NP_001130581.1|  uncharacterized protein LOC100191680             98.6    4e-20   
gb|KJB77816.1|  hypothetical protein B456_012G159000                  99.4    4e-20   
gb|KDO76033.1|  hypothetical protein CISIN_1g007827mg                 98.2    4e-20   
ref|XP_011463116.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like    99.4    4e-20   
ref|XP_003568460.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     99.0    5e-20   
ref|XP_010923294.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    99.0    5e-20   
ref|XP_008453175.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like    99.0    5e-20   
emb|CDY69433.1|  BnaCnng63460D                                        99.4    5e-20   



>ref|XP_009607662.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
Length=576

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 135/191 (71%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WIVLYDRL+LP+AS++ G   H  TK RMGFG+F+SF   +++  VE +RRS+AIK+ +S
Sbjct  386  WIVLYDRLVLPIASKLTGKPAHFSTKERMGFGMFLSFLSVLVMAVVEGVRRSIAIKEGYS  445

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS +W++PQ  L G A   NA+ QN+F+ISEFPRSMS++AS L      +  
Sbjct  446  DDPQSVIPMSAMWLLPQNCLGGFAEALNAIGQNEFYISEFPRSMSSVASALLGVGMGVAS  505

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS +MS+INEL+   G  SW++S+IN+GH+DY+Y VLAGLS+VN L ++ CSR+YGP 
Sbjct  506  LLASFIMSTINELTRGGGQESWVSSNINKGHFDYYYLVLAGLSVVNLLCYIACSRAYGPC  565

Query  193  KDEKPVAMEED  161
            K E    +EED
Sbjct  566  KGENREVIEED  576



>emb|CDP16183.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 135/191 (71%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYD++LLP+ASRI+G  V+   + RMG GIF+S    ++   VE IRRSLAIKQ  S
Sbjct  382  WVALYDQVLLPLASRIKGKPVYVNARQRMGTGIFLSSLCMIVTAAVEYIRRSLAIKQGVS  441

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIas----tlyalgy  374
             D      MS LW++PQY LMG+A G NA+AQN+F+ISEFPRSMS++AS       ++  
Sbjct  442  DDPEAMVHMSALWLLPQYCLMGLAEGLNAIAQNEFYISEFPRSMSSMASNLSGAGMSVAS  501

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS LM+SI++L+   G  SWI+++IN+GHYDY++ VLAGLSMVN L FLIC  +YGP 
Sbjct  502  LLASFLMNSIDDLTKKGGQESWISTNINKGHYDYYFCVLAGLSMVNMLYFLICCWAYGPC  561

Query  193  KDEKPVAMEED  161
            + E+  A +E 
Sbjct  562  RAEEGKASDEQ  572



>ref|XP_009787108.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Nicotiana sylvestris]
Length=576

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 134/191 (70%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WIVLYD L+LP+AS++ G   H  TK RMGFG+F+SF   +++  VE +RRS+AIK+ +S
Sbjct  386  WIVLYDCLVLPIASKMTGKPAHFSTKERMGFGMFLSFLSVLVMAVVEGVRRSIAIKEGYS  445

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS +W++PQ  L G A   NA+ QN+F+ISEFPRSMS++AS L      +  
Sbjct  446  DDPQSVIPMSAMWLLPQNCLAGFAEALNAIGQNEFYISEFPRSMSSVASALLGVGMGVAS  505

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS +MS+INEL+   G  SW++S+IN+GH+DY+Y VLAGLS+VN L ++ CSR+YGP 
Sbjct  506  LLASFIMSTINELTGGGGQESWVSSNINKGHFDYYYLVLAGLSVVNLLCYIACSRAYGPC  565

Query  193  KDEKPVAMEED  161
            K E    +EED
Sbjct  566  KGENREMIEED  576



>emb|CDP16188.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 137/192 (71%), Gaps = 5/192 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LY ++ LPVASRI G  VH  T+ RMG G+ +SF   ++   VE+ RRSLAI++ +S
Sbjct  270  WIALYQQIFLPVASRIMGRPVHLSTRKRMGIGMALSFLCMIVTATVEAKRRSLAIREGYS  329

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS+LW++PQY L+G A  ++A+AQN+F+ SEFPRSMS+I+STL     +   
Sbjct  330  DDLDAVVDMSVLWLLPQYFLIGAAETASAIAQNEFYYSEFPRSMSSISSTLFSLGVSAAN  389

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +AS LM++I++LS   G  SWI ++IN+GHYDY+YWVLAGLS++N + FLICS++YGPS
Sbjct  390  LVASFLMNAIDKLSKLGGKESWIETNINKGHYDYYYWVLAGLSVLNMIYFLICSKAYGPS  449

Query  193  K-DEKPVAMEED  161
            K DEK     E+
Sbjct  450  KEDEKETTFHEE  461



>ref|XP_011090957.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X2 [Sesamum indicum]
Length=543

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+ LP+ASR+    VH  TK RMG GI  SF   +    +E+IRRSLAI + + 
Sbjct  351  WVAVYDRVFLPLASRVMRRPVHVSTKRRMGIGIVFSFLAMLASAGIEAIRRSLAIDEGYL  410

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
               L  ++MS +W+VPQ  L G A  SNA+AQN+F+ SEFPRSMS+IASTL     +L  
Sbjct  411  DHPLAMTQMSAMWLVPQNCLTGFAEASNAIAQNEFYFSEFPRSMSSIASTLNGIGMSLAN  470

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
              ASL+M++++ LS   G  SWI+S+IN+GHYDY+Y VLA LSM N + FL+CS  YGP 
Sbjct  471  LAASLIMNAVDSLSKAGGQESWISSNINKGHYDYYYLVLAALSMANMMYFLVCSSMYGPL  530

Query  193  KDEKPVAMEED  161
            K+E  +A EED
Sbjct  531  KEEGKIAEEED  541



>ref|XP_011090875.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X1 [Sesamum indicum]
Length=572

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+ LP+ASR+    VH  TK RMG GI  SF   +    +E+IRRSLAI + + 
Sbjct  380  WVAVYDRVFLPLASRVMRRPVHVSTKRRMGIGIVFSFLAMLASAGIEAIRRSLAIDEGYL  439

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
               L  ++MS +W+VPQ  L G A  SNA+AQN+F+ SEFPRSMS+IASTL     +L  
Sbjct  440  DHPLAMTQMSAMWLVPQNCLTGFAEASNAIAQNEFYFSEFPRSMSSIASTLNGIGMSLAN  499

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
              ASL+M++++ LS   G  SWI+S+IN+GHYDY+Y VLA LSM N + FL+CS  YGP 
Sbjct  500  LAASLIMNAVDSLSKAGGQESWISSNINKGHYDYYYLVLAALSMANMMYFLVCSSMYGPL  559

Query  193  KDEKPVAMEED  161
            K+E  +A EED
Sbjct  560  KEEGKIAEEED  570



>emb|CDP21289.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 129/191 (68%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YD++LLP+A+RI+G  V+   + RMG G F+SF   V+   VE IR SLA K+  S
Sbjct  429  WVAFYDQVLLPIAARIKGKPVYLTARQRMGIGTFISFLSVVVTATVECIRLSLAFKEGIS  488

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIastlyalgy  374
             D      MS LW++PQY L+G+ +G +A+AQN+FFISE PRSM    ST+     +LG 
Sbjct  489  DDPEAIVHMSALWLLPQYCLIGLTLGLSAIAQNEFFISELPRSMSSMASTLCGVGISLGC  548

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +AS +MS+I++ +   G  SWI+++IN+GHYDY++WVL+GLS+ NF  FLIC  +YGP 
Sbjct  549  LVASFIMSAIDDFTKRGGGESWISTNINKGHYDYYFWVLSGLSLANFFFFLICCWTYGPC  608

Query  193  KDEKPVAMEED  161
            + E+    +E+
Sbjct  609  RGEEGNVNDEE  619



>ref|XP_006342519.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=576

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 138/191 (72%), Gaps = 7/191 (4%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WIVLYD L+LP+AS++ G   H  TK RMGFG+F+SF   ++V  VE +RRS+AIK+ + 
Sbjct  387  WIVLYDYLILPIASKMTGKPAHFSTKERMGFGLFLSFLSVLVVAVVEGVRRSIAIKEGYL  446

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D  G   MS +W++PQ +L G A   +A+ QN+F+ISEFPRSMS++A++L      +G 
Sbjct  447  DDPEGVIPMSAMWLLPQNSLTGFAEALHAIGQNEFYISEFPRSMSSVAASLLGVGMGVGS  506

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS +MS+I++L+   G  SW++S+IN+GHYDY+Y VLAG S+VN L +++CS++YGP 
Sbjct  507  LLASSIMSTIDDLTKRGGEESWVSSNINKGHYDYYYLVLAGFSLVNILCYIVCSKAYGPC  566

Query  193  KDEKPVAMEED  161
            K+E    MEE+
Sbjct  567  KEE---VMEEE  574



>ref|XP_010314832.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Solanum 
lycopersicum]
Length=484

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 138/191 (72%), Gaps = 7/191 (4%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WIVLYD L+LP AS++ G   H  TK RMGFG+F+SF   ++V  VE +RRS+AIK+ +S
Sbjct  295  WIVLYDYLILPTASKMTGKPAHFSTKERMGFGLFLSFLSVLVVAVVEGVRRSIAIKEGYS  354

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D  G   MS ++++PQ +L G A   +A+ QN+F+ISEFPRSMS++A++L      +G 
Sbjct  355  DDPEGMIPMSAMFLLPQNSLTGFAEALHAIGQNEFYISEFPRSMSSVAASLLGVGMGVGS  414

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS +MS+I++L+   G  SW++S+IN+GHYDY+Y VLAG S+VN L +++CS++YGP 
Sbjct  415  LLASSIMSTIDDLTKRGGEESWVSSNINKGHYDYYYLVLAGFSLVNILCYIVCSKAYGPC  474

Query  193  KDEKPVAMEED  161
            K+E    MEE+
Sbjct  475  KEE---VMEEE  482



>emb|CDP16193.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 131/184 (71%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  Y +++LPVASRI G  VH  T+ RMG G+ +SF   ++   VE  RRSLAI++ +S
Sbjct  379  WIPFYLQIILPVASRILGRPVHPSTRERMGIGVALSFVGMIVAATVELKRRSLAIREGYS  438

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastly----algy  374
             D+     +S+LW++PQ  L+G    +N VAQN+F+ SEFPRSMS+I+ TL     +   
Sbjct  439  DDSAAVVDISLLWLLPQSFLIGAGAIANMVAQNEFYYSEFPRSMSSISCTLSLLGISAAN  498

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             ++S LM++I++LS   G  SWI++++N+GHYDY+YWVLAGLSM+N + FLIC+++YGP 
Sbjct  499  LVSSFLMNAIDKLSKLGGKESWISTNVNKGHYDYYYWVLAGLSMLNMIYFLICNKAYGPG  558

Query  193  KDEK  182
            K++K
Sbjct  559  KEDK  562



>emb|CDP16184.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 122/182 (67%), Gaps = 5/182 (3%)
 Frame = -1

Query  712  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN  533
            LYDR+ LP+ S+I G  VH   + RM  G+ +SF   V+   VE+ RR+LAI++ +S D+
Sbjct  165  LYDRVFLPIVSKIMGKHVHLSARKRMAIGMLLSFVCMVVTATVEAKRRNLAIREGYSDDS  224

Query  532  LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIastlyalgysla  365
                 MS LW++PQ  L+G A   +AVAQN+F+ SEFP SM    ST+     ++   +A
Sbjct  225  ETVLDMSALWLLPQLCLIGFAEALSAVAQNEFYYSEFPLSMKSIASTLFLLEMSVANLVA  284

Query  364  sllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK-D  188
            S LM+ I++LS   G  SWI+++IN GHYDY+YWVLAGLSM+N + FL C+++YGP K D
Sbjct  285  SFLMNIIDKLSKRGGKESWISTNINNGHYDYYYWVLAGLSMLNMIYFLTCTKAYGPGKED  344

Query  187  EK  182
            EK
Sbjct  345  EK  346



>ref|XP_004253108.2| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X1 [Solanum 
lycopersicum]
Length=657

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 138/191 (72%), Gaps = 7/191 (4%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WIVLYD L+LP AS++ G   H  TK RMGFG+F+SF   ++V  VE +RRS+AIK+ +S
Sbjct  468  WIVLYDYLILPTASKMTGKPAHFSTKERMGFGLFLSFLSVLVVAVVEGVRRSIAIKEGYS  527

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D  G   MS ++++PQ +L G A   +A+ QN+F+ISEFPRSMS++A++L      +G 
Sbjct  528  DDPEGMIPMSAMFLLPQNSLTGFAEALHAIGQNEFYISEFPRSMSSVAASLLGVGMGVGS  587

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS +MS+I++L+   G  SW++S+IN+GHYDY+Y VLAG S+VN L +++CS++YGP 
Sbjct  588  LLASSIMSTIDDLTKRGGEESWVSSNINKGHYDYYYLVLAGFSLVNILCYIVCSKAYGPC  647

Query  193  KDEKPVAMEED  161
            K+E    MEE+
Sbjct  648  KEE---VMEEE  655



>emb|CDP16191.1| unnamed protein product [Coffea canephora]
Length=571

 Score =   166 bits (419),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 130/184 (71%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  Y +++LPVASRI G  VH  T+ RMG GI +SF   ++   VE  RRSLAI++ +S
Sbjct  378  WIPFYLQIILPVASRILGRPVHLSTRKRMGIGIALSFVGMIVAATVEVKRRSLAIREGYS  437

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D+     MS+LW++PQ  L G    +N VAQN+F+ SEFPRSMS+I+STL     +   
Sbjct  438  DDSDAVVDMSLLWLLPQSFLTGAGATANIVAQNEFYYSEFPRSMSSISSTLSLLGMSAAN  497

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +AS LM++I+ELS   G  SWI+++IN+GHYDY+YWVLAGLS+ N + FLICS++YGP 
Sbjct  498  LVASFLMNAIDELSKLGGKESWISTNINKGHYDYYYWVLAGLSVPNMIYFLICSKAYGPG  557

Query  193  KDEK  182
            K++K
Sbjct  558  KEDK  561



>ref|XP_009145285.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Brassica rapa]
Length=248

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 120/182 (66%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct  46   WVVLYDRAILPLASKIRGKPVRINVKIRMGLGLFISFLAMAVSATVEHYRRRTAISQGLA  105

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA+ L+ LG ++A+
Sbjct  106  NNATATVNISAMWLVPQYGLHGLAEALTGIGQTEFFYTEFPKSMSSIAAALFGLGMAVAN  165

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I  +  NS   G  SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct  166  ILASVILNVVKNSSKKGGESWIEDNINKGHYDYYYWVLAILSFVNVIYYIVCSWSYGPTM  225

Query  190  DE  185
            D+
Sbjct  226  DQ  227



>gb|AAL25616.1| At1g52190/F9I5_4 [Arabidopsis thaliana]
 gb|AAM19991.1| At1g52190/F9I5_4 [Arabidopsis thaliana]
Length=265

 Score =   157 bits (396),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 126/183 (69%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++LYDR ++P+AS+IRG       K RMG G+F+SF    +   VES RR  AI Q ++
Sbjct  48   WVILYDRAVIPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAISAMVESFRRKKAISQGYA  107

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +++     +S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L     A+  
Sbjct  108  NNSNAVVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAS  167

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS++++++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP 
Sbjct  168  LLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPL  227

Query  193  KDE  185
             D+
Sbjct  228  VDQ  230



>gb|EYU29274.1| hypothetical protein MIMGU_mgv1a003369mg [Erythranthe guttata]
Length=589

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 122/190 (64%), Gaps = 11/190 (6%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+ LP+ASR+    +    K+RMG GIF S    +    VE +RRSL  +    
Sbjct  381  WIFLYDRIFLPLASRVMRRPIRISPKTRMGIGIFFSILAMIATSAVEGVRRSLHARS---  437

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
                G S+MS +W+VPQY L G A  SN +AQN+F+ SEFPRSMS++A T+     +L  
Sbjct  438  ----GGSQMSAVWLVPQYCLTGFAEASNVIAQNEFYFSEFPRSMSSVALTMNGIGMSLAN  493

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +AS LM+ ++ +S   G  SWI+SDIN+G YDY+Y VLAGLS+ N + FL+CS +YGP 
Sbjct  494  LIASFLMNFVDWVSKKGGKESWISSDINKGRYDYYYLVLAGLSVANMIYFLVCSSAYGPL  553

Query  193  KDEKPVAMEE  164
            K EK +  E+
Sbjct  554  KGEKKLEEEQ  563



>emb|CDP16194.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 135/184 (73%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LY +++LPVASRI G  VH  T+ RMG G+ +SF   V+   VE+ RRSLAI++ +S
Sbjct  379  WIPLYLQIILPVASRILGRPVHLSTRKRMGIGMALSFLGMVVAATVEAKRRSLAIREGYS  438

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D+     MS+LW++PQ+ L+G A  ++A AQN+F+ SEFPRSMS+I+STL     +   
Sbjct  439  DDSDAVVDMSVLWLLPQFFLIGAAAAASATAQNEFYYSEFPRSMSSISSTLSLLGMSAAN  498

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +AS LM++I+ELS      SWI++++N+GHYDY+YWVLAGLSM+N + FLIC+++YGP 
Sbjct  499  LVASFLMNAIDELSKLGEKESWISTNVNKGHYDYYYWVLAGLSMLNMIYFLICNKAYGPG  558

Query  193  KDEK  182
            K++K
Sbjct  559  KEDK  562



>ref|XP_009114865.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Brassica rapa]
Length=330

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 120/182 (66%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct  128  WVVLYDRAILPLASKIRGKPVRINVKIRMGLGLFISFLAMAVSATVEHYRRRTAISQGLA  187

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA+ L+ LG ++A+
Sbjct  188  NNATATVNISAMWLVPQYGLHGLAEALTGIGQTEFFYTEFPKSMSSIAAALFGLGMAVAN  247

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I  +  NS   G  SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct  248  ILASVILNVVKNSSKKGGESWIEDNINKGHYDYYYWVLAILSFVNVIYYIVCSWSYGPTM  307

Query  190  DE  185
            D+
Sbjct  308  DQ  309



>ref|XP_006465636.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X3 [Citrus sinensis]
Length=558

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 130/183 (71%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR+L+PVAS+++G  V  G K RMG G+F+S    V+ G VE+IRR  AI++ + 
Sbjct  336  WVVLYDRVLIPVASKMKGKPVRLGVKLRMGIGLFLSCMGMVVSGLVENIRRRRAIREGYL  395

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++     +MS +W+VPQ+ L G+A   NA+AQ +FF SEFP+SMS+IA++L     A+  
Sbjct  396  NNGQAVLEMSAMWLVPQHCLNGLAEAFNAIAQTEFFYSEFPKSMSSIAASLFGLGMAVAN  455

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS ++S++++++   G  SW++S+IN+G YD +YW+LA +S+VN + FL+CS +YGP 
Sbjct  456  LLASAIVSAVDDITSKGGKESWVSSNINKGRYDNYYWLLAIMSLVNLVYFLVCSWAYGPC  515

Query  193  KDE  185
             D 
Sbjct  516  VDR  518



>ref|XP_006465634.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Citrus sinensis]
 ref|XP_006465635.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Citrus sinensis]
 gb|KDO56946.1| hypothetical protein CISIN_1g007262mg [Citrus sinensis]
 gb|KDO56947.1| hypothetical protein CISIN_1g007262mg [Citrus sinensis]
Length=611

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 130/183 (71%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR+L+PVAS+++G  V  G K RMG G+F+S    V+ G VE+IRR  AI++ + 
Sbjct  389  WVVLYDRVLIPVASKMKGKPVRLGVKLRMGIGLFLSCMGMVVSGLVENIRRRRAIREGYL  448

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++     +MS +W+VPQ+ L G+A   NA+AQ +FF SEFP+SMS+IA++L     A+  
Sbjct  449  NNGQAVLEMSAMWLVPQHCLNGLAEAFNAIAQTEFFYSEFPKSMSSIAASLFGLGMAVAN  508

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS ++S++++++   G  SW++S+IN+G YD +YW+LA +S+VN + FL+CS +YGP 
Sbjct  509  LLASAIVSAVDDITSKGGKESWVSSNINKGRYDNYYWLLAIMSLVNLVYFLVCSWAYGPC  568

Query  193  KDE  185
             D 
Sbjct  569  VDR  571



>ref|XP_006426938.1| hypothetical protein CICLE_v10025189mg [Citrus clementina]
 gb|ESR40178.1| hypothetical protein CICLE_v10025189mg [Citrus clementina]
Length=611

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 129/183 (70%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR+L+PVAS+++G  V  G K RMG G+F+S    V+ G VE+IRR  AI++ + 
Sbjct  389  WVVLYDRVLIPVASKMKGKPVRLGVKLRMGIGLFLSCMGMVVSGLVENIRRRRAIREGYL  448

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++     +MS +W+VPQ+ L G+A   NA+AQ +FF SEFP+SMS+IA++L     A+  
Sbjct  449  NNGQAVLEMSAMWLVPQHCLNGLAEAFNAIAQTEFFYSEFPKSMSSIAASLFGLGMAVAN  508

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS ++S+++ ++   G  SW++S+IN+G YD +YW+LA +S+VN + FL+CS +YGP 
Sbjct  509  LLASAIVSAVDHITSKGGKESWVSSNINKGRYDNYYWLLAIMSLVNLVYFLVCSWAYGPC  568

Query  193  KDE  185
             D 
Sbjct  569  VDR  571



>gb|KFK38969.1| hypothetical protein AALP_AA3G183300 [Arabis alpina]
Length=589

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 122/182 (67%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct  389  WVVLYDRAILPLASKIRGRPVRVSVKIRMGLGLFISFLAMAVSATVEHYRRKTAINQGLA  448

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++      +S +W++PQY L G+A    A+ Q +FF +EFP+SMS+IA++L+ LG ++A+
Sbjct  449  NNANATVNISAMWLIPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAN  508

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I  +  NS   GN SWI  +IN GHYDY+YW+LA LS VN + +++CS SYGP+ 
Sbjct  509  ILASVILNVVKNSSKKGNDSWIEDNINRGHYDYYYWILAILSFVNVIYYVVCSWSYGPTM  568

Query  190  DE  185
            D+
Sbjct  569  DQ  570



>dbj|BAB02684.1| peptide/amino acid transporter-like protein [Arabidopsis thaliana]
Length=541

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 121/182 (66%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct  340  WVVLYDRAILPLASKIRGRPVRVNVKIRMGLGLFISFLAMAVSATVEHYRRKTAISQGLA  399

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            +D      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA++L+ LG ++A+
Sbjct  400  NDANSTVSISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAASLFGLGMAVAN  459

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I     NS   GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct  460  ILASVILNAVKNSSKQGNVSWIEDNINKGHYDYYYWVLAILSFVNVIYYVVCSWSYGPTV  519

Query  190  DE  185
            D+
Sbjct  520  DQ  521



>ref|NP_188239.1| nitrate transporter 1.12 [Arabidopsis thaliana]
 sp|Q8LPL2.2|PTR32_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 1.1; Short=AtNPF1.1; AltName: 
Full=Nitrate transporter 1.12 [Arabidopsis thaliana]
 gb|AEE75781.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=591

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 121/182 (66%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct  390  WVVLYDRAILPLASKIRGRPVRVNVKIRMGLGLFISFLAMAVSATVEHYRRKTAISQGLA  449

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            +D      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA++L+ LG ++A+
Sbjct  450  NDANSTVSISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAASLFGLGMAVAN  509

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I     NS   GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct  510  ILASVILNAVKNSSKQGNVSWIEDNINKGHYDYYYWVLAILSFVNVIYYVVCSWSYGPTV  569

Query  190  DE  185
            D+
Sbjct  570  DQ  571



>gb|AAM20441.1| putative transport protein [Arabidopsis thaliana]
Length=579

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 121/182 (66%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct  390  WVVLYDRAILPLASKIRGRPVRVNVKIRMGLGLFISFLAMAVSATVEHYRRKTAISQGLA  449

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            +D      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA++L+ LG ++A+
Sbjct  450  NDANSTVSISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAASLFGLGMAVAN  509

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I     NS   GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct  510  ILASVILNAVKNSSKQGNVSWIEDNINKGHYDYYYWVLAILSFVNVIYYVVCSWSYGPTV  569

Query  190  DE  185
            D+
Sbjct  570  DQ  571



>ref|XP_009114884.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like isoform X2 [Brassica 
rapa]
Length=486

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 120/182 (66%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct  284  WVVLYDRAILPLASKIRGKPVRINVKIRMGLGLFISFLAMAVSATVEHYRRRTAISQGLA  343

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA+ L+ LG ++A+
Sbjct  344  NNATATVNISAMWLVPQYGLHGLAEALTGIGQTEFFYTEFPKSMSSIAAALFGLGMAVAN  403

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I  +  NS   G  SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct  404  ILASVILNVVKNSSKKGGESWIEDNINKGHYDYYYWVLAILSFVNVIYYIVCSWSYGPTM  463

Query  190  DE  185
            D+
Sbjct  464  DQ  465



>emb|CDY28371.1| BnaC01g35410D [Brassica napus]
Length=486

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 120/182 (66%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct  284  WVVLYDRAILPLASKIRGKPVRINVKIRMGLGLFISFLAMAVSATVEHYRRRTAISQGLA  343

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA+ L+ LG ++A+
Sbjct  344  NNATATVNISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAAALFGLGMAVAN  403

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I  +  NS   G  SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct  404  ILASVILNVVKNSSKKGGESWIEDNINKGHYDYYYWVLAILSFVNVIYYIVCSWSYGPTM  463

Query  190  DE  185
            D+
Sbjct  464  DQ  465



>ref|XP_004486756.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Cicer arietinum]
Length=593

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 126/191 (66%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WIVLYDR+++P+AS+I+G       K+RMG G+F+SF + V     ESIRR  AIK+ + 
Sbjct  343  WIVLYDRVIIPLASKIKGKPFRICAKTRMGIGLFLSFLHLVTAATFESIRRKKAIKEGYI  402

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastly----algy  374
            +D  G  KMS +W+ PQ  + GIA   N + QN+F+ +EFPR+MS++A++L     A G 
Sbjct  403  NDTHGVLKMSAMWLAPQLCIGGIAEAFNGIGQNEFYYTEFPRTMSSVAASLSGLGMAAGN  462

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             ++S + S+I  ++   G   WI+ +IN+G +D +YWV+AG+S +N L +L+CS +YGP+
Sbjct  463  LVSSFVFSTIENVTSREGKEGWISDNINKGRFDKYYWVIAGVSALNILYYLVCSWAYGPT  522

Query  193  KDEKPVAMEED  161
             D+     EE+
Sbjct  523  VDQISKVSEEN  533



>ref|XP_007135664.1| hypothetical protein PHAVU_010G147900g [Phaseolus vulgaris]
 gb|ESW07658.1| hypothetical protein PHAVU_010G147900g [Phaseolus vulgaris]
Length=616

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 125/191 (65%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR ++P+AS++RG  +   +K+RMG G+F SF + V    VE+ RR  AI + H 
Sbjct  386  WIALYDRAIIPLASKLRGKPIRISSKTRMGLGLFFSFLHLVTAAIVETTRRRRAISEGHV  445

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +D      MS +W+ PQ  L GIA   NAV QN+F+ +EFP++MS+IAS+      A+GY
Sbjct  446  NDTHAVLNMSAMWLFPQLCLGGIAEAFNAVGQNEFYYTEFPKTMSSIASSFFGVGMAVGY  505

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             L+SLL S++ + S   G   WI+ +IN+GH+D +YWVL  LS VN L +L+CS +YGP+
Sbjct  506  VLSSLLFSAVEKFSSRGGKHGWISDNINKGHFDKYYWVLVTLSAVNLLYYLLCSWAYGPT  565

Query  193  KDEKPVAMEED  161
             D++    +E+
Sbjct  566  ADQESKVTQEN  576



>emb|CDY51257.1| BnaC03g77810D [Brassica napus]
Length=486

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 120/182 (66%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct  284  WVVLYDRAILPLASKIRGKPVRINVKIRMGLGLFISFLAMAVSATVEHYRRRTAISQGLA  343

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++  G   +S +W+VPQY L G+A     + Q +FF +EFP+SMS+I + L+ LG ++A+
Sbjct  344  NNANGIVNISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIVAALFGLGMAVAN  403

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I  +  NS   G  SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct  404  ILASVILNVVKNSSKKGGESWIEDNINKGHYDYYYWVLAILSFVNVIYYIVCSWSYGPAM  463

Query  190  DE  185
            D+
Sbjct  464  DQ  465



>ref|XP_004486755.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Cicer arietinum]
Length=638

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 126/191 (66%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WIVLYDR+++P+AS+I+G       K+RMG G+F+SF + V     ESIRR  AIK+ + 
Sbjct  388  WIVLYDRVIIPLASKIKGKPFRICAKTRMGIGLFLSFLHLVTAATFESIRRKKAIKEGYI  447

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastly----algy  374
            +D  G  KMS +W+ PQ  + GIA   N + QN+F+ +EFPR+MS++A++L     A G 
Sbjct  448  NDTHGVLKMSAMWLAPQLCIGGIAEAFNGIGQNEFYYTEFPRTMSSVAASLSGLGMAAGN  507

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             ++S + S+I  ++   G   WI+ +IN+G +D +YWV+AG+S +N L +L+CS +YGP+
Sbjct  508  LVSSFVFSTIENVTSREGKEGWISDNINKGRFDKYYWVIAGVSALNILYYLVCSWAYGPT  567

Query  193  KDEKPVAMEED  161
             D+     EE+
Sbjct  568  VDQISKVSEEN  578



>ref|XP_002885127.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH61386.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=593

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 121/182 (66%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct  391  WVVLYDRAILPLASKIRGRPVRVNVKIRMGLGLFISFLAMAVSATVEHYRRKTAISQGLA  450

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            +D      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA++L+ LG ++A+
Sbjct  451  NDANTTVNISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAASLFGLGMAVAN  510

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I     NS   GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct  511  ILASVILNAVKNSSKKGNVSWIEDNINKGHYDYYYWVLAILSFVNVIYYVLCSWSYGPTV  570

Query  190  DE  185
            D+
Sbjct  571  DQ  572



>ref|XP_002891678.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67937.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=607

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 125/183 (68%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR ++P+AS+IRG       K RMG G+F+SF    +   VES RR  A+ Q ++
Sbjct  390  WVVLYDRAVIPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAISAMVESFRRKKALSQGYA  449

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +D      +S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L     A+  
Sbjct  450  NDANAVVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAS  509

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS++++++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP 
Sbjct  510  LLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPL  569

Query  193  KDE  185
             D+
Sbjct  570  VDQ  572



>ref|XP_009114876.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like isoform X1 [Brassica 
rapa]
Length=593

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 120/182 (66%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct  391  WVVLYDRAILPLASKIRGKPVRINVKIRMGLGLFISFLAMAVSATVEHYRRRTAISQGLA  450

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA+ L+ LG ++A+
Sbjct  451  NNATATVNISAMWLVPQYGLHGLAEALTGIGQTEFFYTEFPKSMSSIAAALFGLGMAVAN  510

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I  +  NS   G  SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct  511  ILASVILNVVKNSSKKGGESWIEDNINKGHYDYYYWVLAILSFVNVIYYIVCSWSYGPTM  570

Query  190  DE  185
            D+
Sbjct  571  DQ  572



>ref|NP_175630.1| nitrate transporter 1.11 [Arabidopsis thaliana]
 sp|Q9M817.1|PTR6_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 1.2; Short=AtNPF1.2; AltName: 
Full=Nitrate transporter 1.11 [Arabidopsis thaliana]
 gb|AAF29404.1|AC022354_3 peptide transporter, putative [Arabidopsis thaliana]
 gb|AEE32766.1| putative peptide transporter [Arabidopsis thaliana]
Length=607

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 126/183 (69%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++LYDR ++P+AS+IRG       K RMG G+F+SF    +   VES RR  AI Q ++
Sbjct  390  WVILYDRAVIPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAISAMVESFRRKKAISQGYA  449

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +++     +S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L     A+  
Sbjct  450  NNSNAVVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAS  509

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS++++++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP 
Sbjct  510  LLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPL  569

Query  193  KDE  185
             D+
Sbjct  570  VDQ  572



>ref|XP_006306954.1| hypothetical protein CARUB_v10008522mg, partial [Capsella rubella]
 gb|EOA39852.1| hypothetical protein CARUB_v10008522mg, partial [Capsella rubella]
Length=664

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 125/183 (68%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG       K RMG G+F+SF    +   VES RR+ AI Q + 
Sbjct  447  WVVLYDRAVLPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAVSAMVESFRRNKAISQGYG  506

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      +S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L     A+  
Sbjct  507  NNPNAVVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAS  566

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS++++++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S VN + ++ICS SYGP 
Sbjct  567  LLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFVNVIYYVICSWSYGPL  626

Query  193  KDE  185
             D+
Sbjct  627  VDQ  629



>ref|XP_011081806.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Sesamum indicum]
Length=535

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 126/191 (66%), Gaps = 7/191 (4%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ L D + LP+ASR+ G  V+  T  RMG GIF+S    ++   VES+RR  AIK  +S
Sbjct  346  WVGLKDSVFLPLASRVTGRPVNISTTRRMGIGIFLSCIAMMVTAAVESMRRGRAIKDGNS  405

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastly----algy  374
            S++     +S+LW+VPQY L G++ G N + QN+F+ SE PRSMS+IAS L     A+G 
Sbjct  406  SEH---HLISVLWLVPQYCLSGLSDGFNEITQNEFYYSELPRSMSSIASNLSGLGFAVGS  462

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS +M+ ++ +S   G  SWITSDIN+G YD +Y VLAGLSM N + +L+C R+YGP 
Sbjct  463  LLASFVMNMVDSISKARGRQSWITSDINKGRYDCYYLVLAGLSMANTVYYLVCRRAYGPL  522

Query  193  KDEKPVAMEED  161
            K E+ +   ED
Sbjct  523  KAERRLKEHED  533



>ref|XP_002299719.2| hypothetical protein POPTR_0001s18640g [Populus trichocarpa]
 gb|EEE84524.2| hypothetical protein POPTR_0001s18640g [Populus trichocarpa]
Length=597

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 124/179 (69%), Gaps = 4/179 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++LYDR +LP+AS+I+G  V  G K RMG G+F+S    V+   VESIRR  AI++ + 
Sbjct  388  WVILYDRAILPLASKIKGKPVQLGAKLRMGIGLFLSCMAMVVSAIVESIRRRKAIREGYL  447

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      MS +W+VPQY L G+A   NA+ Q +F+ SEFP+SMS+IA+ L     A+  
Sbjct  448  NNAHAVLDMSAMWLVPQYCLNGLAEAFNAIGQTEFYYSEFPKSMSSIAAALFGLGMAVAN  507

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  197
             LAS ++S++++L+   G  SW++++IN+GHYD +YW+LA +S VN L FL+CS +YGP
Sbjct  508  LLASAILSAVDKLTSRGGKESWVSNNINKGHYDNYYWLLAIMSSVNLLYFLVCSWAYGP  566



>gb|KFK35804.1| hypothetical protein AALP_AA4G038900 [Arabis alpina]
Length=608

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 125/183 (68%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR ++P+AS+IRG       K RMG G+F+SF    +   VESIRR  AI Q ++
Sbjct  390  WVVLYDRAVIPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAISAMVESIRRKKAISQGYA  449

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      +S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L     A+  
Sbjct  450  NNGNAIVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAS  509

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS++++++NEL+  +G  SW+  +IN+GHY+Y+YW+LA +S +N + ++ICS SYGP 
Sbjct  510  LLASVVLNAVNELTSRNGKVSWVADNINKGHYNYYYWLLAIMSFINVIYYVICSWSYGPL  569

Query  193  KDE  185
             D+
Sbjct  570  VDQ  572



>ref|XP_010465628.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1 isoform X1 [Camelina 
sativa]
 ref|XP_010465629.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1 isoform X2 [Camelina 
sativa]
Length=483

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 123/182 (68%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+I+G  V    K RMG G+F+SF    L   VE  RR  AI Q  +
Sbjct  282  WVVLYDRAILPLASKIQGRPVRINVKIRMGLGLFISFLAMALSATVEHYRRKTAISQGLA  341

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA++L+ LG ++A+
Sbjct  342  NNADATVNISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAASLFGLGMAVAN  401

Query  361  llmsSI-NELSINS--GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I N +  +S  GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct  402  ILASVILNAIKSSSKKGNVSWIEDNINKGHYDYYYWVLAILSFVNVIYYVVCSWSYGPTV  461

Query  190  DE  185
            D+
Sbjct  462  DQ  463



>ref|XP_010503915.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Camelina sativa]
Length=595

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 123/182 (68%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+I+G  V    K RMG G+F+SF    L   VE  RR  AI Q  +
Sbjct  394  WVVLYDRAILPLASKIQGRPVRVNVKIRMGLGLFISFLAMALSATVEHYRRKTAISQGLA  453

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA++L+ LG ++A+
Sbjct  454  NNADATVNISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAASLFGLGMAVAN  513

Query  361  llmsSI-NELSINS--GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I N +  +S  GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct  514  ILASVILNAVKSSSKKGNVSWIEDNINKGHYDYYYWVLATLSFVNVIYYVVCSWSYGPTV  573

Query  190  DE  185
            D+
Sbjct  574  DQ  575



>ref|XP_006297268.1| hypothetical protein CARUB_v10013282mg [Capsella rubella]
 gb|EOA30166.1| hypothetical protein CARUB_v10013282mg [Capsella rubella]
Length=597

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 120/182 (66%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+I+G  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct  395  WVVLYDRAILPLASKIQGRQVRINVKIRMGLGLFISFLAMAVSATVEHYRRKTAISQGLA  454

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            +D      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA+ L+ LG ++A+
Sbjct  455  NDANTTVNISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAAALFGLGMAVAN  514

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I     NS   GN SWI  +IN+GHYDY+YW+LA LS VN + +++CS SYGP+ 
Sbjct  515  ILASVILNAVKNSSKKGNVSWIEDNINKGHYDYYYWILAILSFVNVIYYVVCSWSYGPTV  574

Query  190  DE  185
            D+
Sbjct  575  DQ  576



>ref|XP_003531667.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
 gb|KHN47834.1| Putative peptide transporter [Glycine soja]
Length=587

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 124/191 (65%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDRL++P+AS+IRG  V    K RMG G+  SF + V    VE+IRR  AI + H 
Sbjct  387  WIALYDRLIIPLASKIRGKPVRISAKRRMGLGLLFSFLHLVTAAMVETIRRRRAISEGHV  446

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +D      MS +W+ PQ  L GIA   NA+ QN+F+ +EFP++MS+IAS+L     A+GY
Sbjct  447  NDTHAVLNMSAMWLFPQLCLGGIAEAFNAIGQNEFYYTEFPKTMSSIASSLFGLGMAVGY  506

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             L+SL+ S + +++   G   W++ +IN+G +D +YW+LA LS VN L +L+CS  YGP+
Sbjct  507  VLSSLVFSVVEKVTSRGGKDGWVSDNINKGRFDKYYWLLATLSAVNVLYYLVCSWIYGPT  566

Query  193  KDEKPVAMEED  161
             D++    EE+
Sbjct  567  ADQESKVTEEN  577



>ref|XP_002516008.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF46428.1| nitrate transporter, putative [Ricinus communis]
Length=612

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 120/183 (66%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WIVLYDR +LP+A++I+G  V  G K RMG G+F+S    V+ G VE++RR  AI + + 
Sbjct  391  WIVLYDRAILPLATKIKGKPVRLGVKLRMGIGLFLSCMGMVVAGIVENVRRRKAIHEGYL  450

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++     +MS  W+ PQY L G A   NA+ Q +F+ +EFP+SMS+IA  L     A+  
Sbjct  451  NNPNAVVQMSAFWLAPQYCLNGFAEALNAIGQTEFYYTEFPKSMSSIAGALFGLGMAVAN  510

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LA++++S +N ++   G   W+ S+IN+GHYD +YW+LA +S VN L FLICS  YGP 
Sbjct  511  LLATVILSLVNNITSKGGKVGWVPSNINQGHYDNYYWLLAIMSAVNLLYFLICSWGYGPC  570

Query  193  KDE  185
            K++
Sbjct  571  KEQ  573



>ref|XP_010654644.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Vitis vinifera]
 ref|XP_010654645.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Vitis vinifera]
 ref|XP_010654646.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Vitis vinifera]
 emb|CBI36110.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 124/183 (68%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR++LP+AS++RG  V  G K RMG G+F+S    V+   VE++RR  AI+Q   
Sbjct  379  WVALYDRVILPLASKVRGKRVRLGVKQRMGIGLFLSCLGMVVAAIVENVRRRKAIRQGLL  438

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      MS +W+VPQY L G+A   NA+ Q +F+ SEFP+SMS+IA+ L     A+  
Sbjct  439  NNPQTLVGMSAMWLVPQYCLYGLAEAFNAIGQTEFYYSEFPKSMSSIAAALFGLGMAVAN  498

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S++N L+   G  SW++++IN+GHYD +YW+LA +S +N L +L+CS  YGP 
Sbjct  499  LLASVILSAVNHLTSRGGKESWVSNNINKGHYDNYYWLLAIMSAINLLYYLVCSYFYGPC  558

Query  193  KDE  185
             ++
Sbjct  559  VEQ  561



>ref|XP_008462171.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Cucumis melo]
Length=329

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 125/187 (67%), Gaps = 4/187 (2%)
 Frame = -1

Query  712  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN  533
            LYDR +LP+AS+IRG  VH G KSRMG G+  S     L   VE++RR  AI Q    D 
Sbjct  111  LYDRAILPLASKIRGKPVHFGVKSRMGAGLICSAMSMALSAIVENVRRRKAIAQGIVDDL  170

Query  532  LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgysla  365
                 MS LW++PQ+ L G+A   NA+ Q +F+ SEFP++MS++AS+L     A+   LA
Sbjct  171  DAVVDMSALWLIPQHCLNGLAEALNAIGQTEFYYSEFPKTMSSVASSLFGLGMAVANLLA  230

Query  364  sllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  185
            S +MS+++ ++   G  SW++ +IN+GH++ +YW+LA LS++N L +++CS +YGPS D+
Sbjct  231  SAIMSTVDNVTSKGGKESWVSKNINKGHFEKYYWLLAILSVINVLYYVVCSWAYGPSVDQ  290

Query  184  KPVAMEE  164
            +  AM++
Sbjct  291  RRTAMDD  297



>ref|XP_009147706.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Brassica rapa]
Length=606

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 126/183 (69%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR ++P+AS+IRG       K RMG G+F+SF    +   VE++RR  A+ Q ++
Sbjct  389  WVVLYDRAVIPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAISAMVETLRRKKALSQGYA  448

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      +S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L     A+  
Sbjct  449  NNANAIVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAS  508

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS++++++NEL+  +G  SW++ +IN+GHY+Y+YW+LA +S +N + ++ICS SYGP 
Sbjct  509  LLASVILNAVNELTSRNGEDSWVSDNINKGHYNYYYWLLAIMSFINVIYYMICSWSYGPL  568

Query  193  KDE  185
             D+
Sbjct  569  VDQ  571



>ref|XP_011008319.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Populus euphratica]
Length=597

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 124/179 (69%), Gaps = 4/179 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++LYDR +LP+AS+I+G  V  G K RMG G+F+S    V+   VESIRR  AI++ + 
Sbjct  388  WVILYDRAILPLASKIKGKPVQLGAKLRMGIGLFLSCMAMVVSAIVESIRRRKAIREGYL  447

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      MS +W+VPQ+ L G+A   NA+ Q +F+ SEFP+SMS+IA+ L     A+  
Sbjct  448  NNAHAVLDMSAMWLVPQHCLNGLAEAFNAIGQTEFYYSEFPKSMSSIAAALFGLGMAVAN  507

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  197
             LAS ++S++++L+   G  SW++++IN+GHYD +YW+LA +S VN L FL+CS +YGP
Sbjct  508  LLASAILSAVDKLTSRGGKESWVSNNINKGHYDNYYWLLAIMSSVNLLYFLVCSWAYGP  566



>ref|XP_010668942.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Beta vulgaris subsp. 
vulgaris]
Length=559

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 126/181 (70%), Gaps = 6/181 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR+++P+AS++ G  V    K+RMG G+ +SF   V+ G VES+RR +A + +H+
Sbjct  369  WLVLYDRIIIPLASKVMGKPVRLNVKTRMGIGLLLSFICLVVAGIVESVRREMATRGDHN  428

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
              +    +MS LW+VPQ  L G+A    A+AQ +FF SEFPRSMS++AS LY LG  +AS
Sbjct  429  GAS-STVRMSALWLVPQVCLFGLAEAFAAIAQIEFFYSEFPRSMSSMASNLYGLGAGVAS  487

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    + ++   G  SW++SDIN+GHYDY+YW+LAGLS++N++ F+ CS+ Y   
Sbjct  488  LVASVIMSGVDHVTTKFGE-SWVSSDINKGHYDYYYWILAGLSLLNYVYFVFCSKGYDQG  546

Query  193  K  191
            K
Sbjct  547  K  547



>ref|XP_011072387.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Sesamum indicum]
Length=592

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 124/183 (68%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR+++P+ S+I G  +H G + RMG GIF+S     + G VE IRR   I+Q  +
Sbjct  387  WVVLYDRVIIPLTSKIAGKKIHLGVRLRMGVGIFLSGLAMTVSGIVEHIRRKKVIEQRLA  446

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             +      MS LW+VPQ  L G+A   NA+AQ +F+ SEFP+SMS+IAS+L     A+G 
Sbjct  447  DNPHAVVNMSALWLVPQNCLTGLAEAFNAIAQTEFYYSEFPKSMSSIASSLFGVGMAIGN  506

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S+++  + N GN SW++S+IN+GHYD++YW+LA ++ +N + FL CS  YGP 
Sbjct  507  LLASVVLSTVDSATKNGGNESWVSSNINKGHYDFYYWLLAAMTFINLIYFLCCSWIYGPC  566

Query  193  KDE  185
             + 
Sbjct  567  VER  569



>ref|XP_010479719.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X1 [Camelina 
sativa]
Length=608

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 123/183 (67%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR ++P+AS+IRG       K RMG G+F+SF    +   VES RR+ AI Q ++
Sbjct  391  WVVLYDRAVIPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAVSATVESFRRNKAISQGYA  450

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +        S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L      +  
Sbjct  451  NSPNAVVDFSAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMGVAS  510

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS++++++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP 
Sbjct  511  LLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPL  570

Query  193  KDE  185
             D+
Sbjct  571  VDQ  573



>ref|XP_010487466.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Camelina sativa]
Length=595

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 123/182 (68%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+I+G  V    K RMG G+F+SF    L   VE  RR  AI Q  +
Sbjct  393  WVVLYDRAILPLASKIQGRPVRVNVKIRMGLGLFISFLAMALSATVEHYRRKTAISQGLA  452

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA++L+ LG ++A+
Sbjct  453  NNADATVNISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAASLFGLGMAVAN  512

Query  361  llmsSI-NELSINS--GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I N +  +S  GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct  513  ILASVILNAVKSSSKKGNVSWIEDNINKGHYDYYYWVLAILSFVNVIYYVVCSWSYGPTV  572

Query  190  DE  185
            D+
Sbjct  573  DQ  574



>ref|XP_010479721.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X3 [Camelina 
sativa]
Length=607

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 123/183 (67%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR ++P+AS+IRG       K RMG G+F+SF    +   VES RR+ AI Q ++
Sbjct  390  WVVLYDRAVIPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAVSATVESFRRNKAISQGYA  449

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +        S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L      +  
Sbjct  450  NSPNAVVDFSAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMGVAS  509

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS++++++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP 
Sbjct  510  LLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPL  569

Query  193  KDE  185
             D+
Sbjct  570  VDQ  572



>ref|XP_010479720.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X2 [Camelina 
sativa]
Length=607

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 123/183 (67%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR ++P+AS+IRG       K RMG G+F+SF    +   VES RR+ AI Q ++
Sbjct  390  WVVLYDRAVIPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAVSATVESFRRNKAISQGYA  449

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +        S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L      +  
Sbjct  450  NSPNAVVDFSAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMGVAS  509

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS++++++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP 
Sbjct  510  LLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPL  569

Query  193  KDE  185
             D+
Sbjct  570  VDQ  572



>ref|XP_010462057.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Camelina sativa]
Length=607

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 123/183 (67%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR ++P+AS+IRG       K RMG G+F+SF    +   VES RR+ AI Q + 
Sbjct  390  WVVLYDRAVIPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAVSATVESFRRNKAISQGYG  449

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++       S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L      +  
Sbjct  450  NNPNAVVDFSAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMGVAS  509

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS++++++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP 
Sbjct  510  LLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPL  569

Query  193  KDE  185
             D+
Sbjct  570  VDQ  572



>ref|XP_003597728.1| hypothetical protein MTR_2g101640 [Medicago truncatula]
 gb|ABD32293.2| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67979.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=632

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 123/191 (64%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WIVLYDR+L+P+AS++RG  V    K RMG G+F++F + V     ESIRR  AI+    
Sbjct  386  WIVLYDRVLIPLASKLRGKPVRISPKIRMGIGLFLNFLHLVTAAAFESIRRKKAIQAGFL  445

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            +D  G  KMS LW+ PQ  L GI+   NA+ QN+F+  EFPR+MS+I+++L  LG +  +
Sbjct  446  NDTHGVLKMSALWLAPQLCLGGISEAFNAIGQNEFYYKEFPRTMSSISASLCGLGMAAGN  505

Query  361  llms----SINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S    +I  ++   G   WI+ +IN+G YD +Y V+AG+S +N L FL+CS +YGP+
Sbjct  506  LVSSFVFNTIENVTSRGGKEGWISDNINKGRYDKYYMVIAGVSALNLLYFLVCSWAYGPT  565

Query  193  KDEKPVAMEED  161
             D+     +E+
Sbjct  566  VDQVSKVSDEN  576



>ref|XP_006450666.1| hypothetical protein CICLE_v10010188mg [Citrus clementina]
 gb|ESR63906.1| hypothetical protein CICLE_v10010188mg [Citrus clementina]
Length=519

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 121/193 (63%), Gaps = 7/193 (4%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+LLP+AS+I+G       K R+G G+            VE IRR  AI +  S
Sbjct  322  WIGFYDRILLPLASKIKGKPCQLTVKQRLGIGLLCCTASMAAWAIVEGIRRETAISEGIS  381

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D  G  KMS +W++P   L G+A   NA+ Q +F+  E P+SMS+IASTL     ++  
Sbjct  382  DDPRGVVKMSAMWLLPYLVLCGLAAAFNAIGQTEFYYIELPKSMSSIASTLLGVGMSVAS  441

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +AS +M+++++++   GNG WI S+IN+GHYDY+YW+LAGL+M NF+ FL C ++YGP 
Sbjct  442  LVASFVMNTVDDITKRGGNGGWIPSNINKGHYDYYYWLLAGLNMANFIYFLECCKAYGPC  501

Query  193  KD--EKPVAMEED  161
            K    KP+  E+D
Sbjct  502  KGLVSKPLG-EKD  513



>ref|XP_008445025.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Cucumis melo]
Length=533

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 119/183 (65%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDRL+LP+AS+ RG       K+R+G GI        +   VES RR+LAIK+  S
Sbjct  336  WITLYDRLILPLASKCRGKPTRLSAKTRIGIGILCCTLSLAVSAIVESDRRALAIKEGFS  395

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             +      MS  W +P+Y L+GI  G + +AQ +FF +E P++MS++A++L     ++G 
Sbjct  396  DNPNAVVSMSAFWTLPRYILLGIEEGFSVIAQVEFFYNELPKAMSSVATSLLGLNSSVGN  455

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
              AS +M++++ LS   G  SW++S+INEGH DY+YW+L GL   NFL FL CS+SYGPS
Sbjct  456  LAASFIMTTVDNLSEAVGGRSWVSSNINEGHSDYYYWLLFGLLFANFLYFLACSKSYGPS  515

Query  193  KDE  185
            K+E
Sbjct  516  KEE  518



>emb|CDY30141.1| BnaC05g37210D [Brassica napus]
Length=593

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 119/182 (65%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct  391  WVVLYDRAILPLASKIRGRPVRINVKIRMGLGLFISFLAMAVSATVEHYRRRTAISQGLA  450

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA+ L+ LG ++A+
Sbjct  451  NNATATVNISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAAALFGLGMAVAN  510

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I  +  NS   G  SWI  +IN+GHYDY+YWVLA +S VN + ++ CS SYGP+ 
Sbjct  511  ILASVILNVVKNSSKKGGVSWIEDNINKGHYDYYYWVLAIMSFVNVIYYVACSWSYGPTV  570

Query  190  DE  185
            D+
Sbjct  571  DQ  572



>ref|XP_009593688.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
Length=603

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRGN V  GTK RMG GIF S    ++ G +E IRR  AI+Q   
Sbjct  401  WLVLYDRAILPLASKIRGNPVRLGTKERMGIGIFFSCMAMLISGIIEHIRRGKAIEQGLL  460

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++  G   MS +W+VPQ+ L GIA   NA+ Q +F+ SE P+SMS+IA+ +     A+  
Sbjct  461  NNPEGVVAMSAMWLVPQHCLNGIAEAFNAIGQTEFYYSELPKSMSSIAAAMFGLGMAVAN  520

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S+++ L+   G  SW++S+IN G Y+ +YW+LA ++  N L F++CS +YGP 
Sbjct  521  LLASVILSNVDNLTKGEGKESWVSSNINRGRYENYYWLLAIMTGFNLLYFMVCSWAYGPC  580

Query  193  KDEKPVAMEE  164
             +     M E
Sbjct  581  AENMSKKMVE  590



>ref|XP_010545694.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Tarenaya hassleriana]
Length=600

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 122/183 (67%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+FVSF        VE +RR  AI Q ++
Sbjct  387  WVVLYDRAILPLASKIRGRPVRFSVKLRMGLGLFVSFLAMATSAIVEGLRRKKAISQGYA  446

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             +      +S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L     A+  
Sbjct  447  DNAHAVVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAS  506

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++ ++N+++  +G  SW++ + N+GHYDY+ W+LA LS VN + ++ICS +YGP+
Sbjct  507  LLASVILRAVNDVTSRNGGESWVSDNFNKGHYDYYCWLLAILSFVNVIYYIICSWAYGPA  566

Query  193  KDE  185
             D+
Sbjct  567  VDQ  569



>ref|XP_004164040.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=581

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 117/183 (64%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDRL+LP+AS+ RG       K+RMG GI        +   VE  RR+LAIK+  S
Sbjct  384  WIALYDRLILPLASKCRGKPTRLCAKTRMGMGILCCCLSLAVSAIVEGDRRALAIKEGFS  443

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgys---  371
             +      MS  W +P+Y L GIA   NA+ Q +FF +E P++MS++A++L  L  S   
Sbjct  444  DNPNAVVSMSAFWTLPRYILFGIAEALNAIGQIEFFYNELPKAMSSVATSLLGLNSSIGN  503

Query  370  -lasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
              AS +M++++ LS + G  SW++S+INEGH DY+YW+L+GL   NFL +L CS+SYGPS
Sbjct  504  LAASFIMTTVDNLSKSVGVKSWVSSNINEGHSDYYYWLLSGLLFANFLYYLACSKSYGPS  563

Query  193  KDE  185
             +E
Sbjct  564  NEE  566



>emb|CDX97728.1| BnaA05g23510D [Brassica napus]
Length=593

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 117/182 (64%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q   
Sbjct  391  WVVLYDRAILPLASKIRGRPVRINVKIRMGLGLFISFLAMAVSATVEHYRRRTAISQGLR  450

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA+ L+ LG ++A+
Sbjct  451  DNATATVNISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAAALFGLGMAVAN  510

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I  +  NS   G  SWI  +IN+GHYDY+YWVLA +S VN + ++ CS SYGP+ 
Sbjct  511  ILASVILNVVKNSSKKGGVSWIEDNINKGHYDYYYWVLAIMSFVNVIYYVACSWSYGPTV  570

Query  190  DE  185
            D+
Sbjct  571  DQ  572



>ref|XP_009146163.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1 [Brassica rapa]
Length=593

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 117/182 (64%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q   
Sbjct  391  WVVLYDRAILPLASKIRGRPVRINVKIRMGLGLFISFLAMAVSATVEHYRRRTAISQGLR  450

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA+ L+ LG ++A+
Sbjct  451  DNATATVNISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAAALFGLGMAVAN  510

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I  +  NS   G  SWI  +IN+GHYDY+YWVLA +S VN + ++ CS SYGP+ 
Sbjct  511  ILASVILNVVKNSSKKGGVSWIEDNINKGHYDYYYWVLAIMSFVNVIYYVACSWSYGPTV  570

Query  190  DE  185
            D+
Sbjct  571  DQ  572



>ref|XP_004170441.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=500

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 125/187 (67%), Gaps = 4/187 (2%)
 Frame = -1

Query  712  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN  533
            LYDR +LP+AS+IRG  VH G KSRMG G+  S     L   VE+IRR  AI Q    D 
Sbjct  282  LYDRAILPLASKIRGKPVHFGVKSRMGAGLICSAMSMALSAIVENIRRRKAIAQGIVDDL  341

Query  532  LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgysla  365
                 MS LW++PQ+ L G+A   NA+ Q +F+ SEFP++MS++AS+L     A+   LA
Sbjct  342  DAVVDMSALWLIPQHCLNGLAEALNAIGQTEFYYSEFPKTMSSVASSLFGLGMAVANLLA  401

Query  364  sllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  185
            S +MS+++ ++   G  SW++ +IN+GH++ +YW+LA LS++N L +++CS +YGPS D+
Sbjct  402  SAIMSTVDNVTSKGGKESWVSKNINKGHFEKYYWLLAILSVINVLYYVVCSWAYGPSVDQ  461

Query  184  KPVAMEE  164
            +  AM++
Sbjct  462  RRTAMDD  468



>ref|XP_003529761.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=606

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 118/183 (64%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR+++P+AS++RG  V    K RMG G+  SF +      VE+ RR  AI++ H 
Sbjct  386  WVALYDRVIIPIASKLRGKPVRISAKRRMGIGLVFSFLHLATAAIVENERRRRAIREGHI  445

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            +D      MS +W+VPQ  L G+A   NA+ QN+F+ +EFPR+MS+IA+ L+ LG +  +
Sbjct  446  NDTHAVLNMSAMWLVPQLCLSGMAEAFNAIGQNEFYYTEFPRTMSSIAACLFGLGMAAGN  505

Query  361  llmsSINELSINS----GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            +L S I  +  N+    GN  W+  +IN+G YD +YWVLA LS VN L +L+CS +YGP+
Sbjct  506  VLSSLIFSIVENATSRGGNEGWVLDNINKGRYDRYYWVLASLSAVNILYYLVCSWAYGPT  565

Query  193  KDE  185
             D+
Sbjct  566  VDQ  568



>ref|XP_010500813.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Camelina sativa]
Length=608

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 122/183 (67%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR ++P+AS+IRG       K RMG G+F+SF    +   VES RR+ AI Q ++
Sbjct  391  WVVLYDRAVIPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAVSATVESFRRNKAISQGYA  450

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +        S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L      +  
Sbjct  451  NSPNAVVDFSAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMGVAS  510

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS++++++NEL+  +   SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP 
Sbjct  511  LLASVVLNAVNELTSRNDKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPL  570

Query  193  KDE  185
             D+
Sbjct  571  VDQ  573



>emb|CDO98013.1| unnamed protein product [Coffea canephora]
Length=594

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 125/191 (65%), Gaps = 6/191 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V  GTK+RMG G+F +    V+ G VE +RR  A++Q   
Sbjct  383  WLVLYDRAILPLASKIRGKPVRIGTKARMGIGLFFTGLSMVISGVVERVRRRKAVEQGFL  442

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +D      MS +W+VPQY   G A   NA+ Q +F+ SEFPR+MS++AS+L     A+  
Sbjct  443  NDPQALVDMSAMWLVPQYVAGGFAEAFNAIGQIEFYYSEFPRTMSSVASSLFGLGMAVAN  502

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS ++S+++  +   G  SW++S+IN+G Y+ +YW+L+ LS VN + F+ CS +YGP 
Sbjct  503  VLASAVLSTVDRYTTGEGKESWVSSNINKGRYENYYWLLSILSCVNLICFIFCSWAYGPC  562

Query  193  KDEKPVAMEED  161
             D+  V  E+D
Sbjct  563  ADD--VKKEDD  571



>ref|XP_004150292.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=535

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 117/183 (64%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDRL+LP+AS+ RG       K+RMG GI        +   VE  RR+LAIK+  S
Sbjct  338  WIALYDRLILPLASKCRGKPTRLCAKTRMGMGILCCGLSLAVSAIVEGDRRALAIKEGFS  397

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgys---  371
             +      MS  W +P+Y L GIA   NA+ Q +FF +E P++MS++A++L  L  S   
Sbjct  398  DNPNAVVSMSAFWTLPRYILFGIAEALNAIGQIEFFYNELPKAMSSVATSLLGLNSSIGN  457

Query  370  -lasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
              AS +M++++ LS + G  SW++S+INEGH DY+YW+L+GL   NFL +L CS+SYGPS
Sbjct  458  LAASFIMTTVDNLSKSVGVKSWVSSNINEGHSDYYYWLLSGLLFANFLYYLACSKSYGPS  517

Query  193  KDE  185
             +E
Sbjct  518  NEE  520



>gb|KHN04221.1| Putative peptide transporter [Glycine soja]
Length=575

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 118/183 (64%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR+++P+AS++RG  V    K RMG G+  SF +      VE+ RR  AI++ H 
Sbjct  355  WVALYDRVIIPIASKLRGKPVRISAKRRMGIGLVFSFLHLATAAIVENERRRRAIREGHI  414

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            +D      MS +W+VPQ  L G+A   NA+ QN+F+ +EFPR+MS+IA+ L+ LG +  +
Sbjct  415  NDTHAVLNMSAMWLVPQLCLSGMAEAFNAIGQNEFYYTEFPRTMSSIAACLFGLGMAAGN  474

Query  361  llmsSINELSINS----GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            +L S I  +  N+    GN  W+  +IN+G YD +YWVLA LS VN L +L+CS +YGP+
Sbjct  475  VLSSLIFSIVENATSRGGNEGWVLDNINKGRYDRYYWVLASLSAVNILYYLVCSWAYGPT  534

Query  193  KDE  185
             D+
Sbjct  535  VDK  537



>ref|XP_007137205.1| hypothetical protein PHAVU_009G108400g [Phaseolus vulgaris]
 gb|ESW09199.1| hypothetical protein PHAVU_009G108400g [Phaseolus vulgaris]
Length=568

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 118/184 (64%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+++YDR+L+PVAS+IRG     G K ++G G+  S      +  VESIRR +A ++ +S
Sbjct  384  WVIIYDRILVPVASKIRGYPTRMGAKQKIGLGLLTSCAAIASLAIVESIRRKIATEEGYS  443

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIastlyalgy  374
             +     KMS LW++P+  L G+A GS  +  N+FF++E PRSM    ST++    ++  
Sbjct  444  DEAEAVVKMSALWLLPRQILNGLAEGSTVIGNNEFFLTELPRSMSSLASTLSGLGSSVAN  503

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +AS ++S +   S   G+ SW++S+IN+GHYDY+Y ++  L  +N++ FL CS+SYGP 
Sbjct  504  LVASFILSVVERASGGGGHESWVSSNINKGHYDYYYSLICALCFLNYIYFLYCSKSYGPC  563

Query  193  KDEK  182
            KD +
Sbjct  564  KDRR  567



>gb|KGN62823.1| hypothetical protein Csa_2G374650 [Cucumis sativus]
Length=581

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 117/183 (64%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDRL+LP+AS+ RG       K+RMG GI        +   VE  RR+LAIK+  S
Sbjct  384  WIALYDRLILPLASKCRGKPTRLCAKTRMGMGILCCGLSLAVSAIVEGDRRALAIKEGFS  443

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgys---  371
             +      MS  W +P+Y L GIA   NA+ Q +FF +E P++MS++A++L  L  S   
Sbjct  444  DNPNAVVSMSAFWTLPRYILFGIAEALNAIGQIEFFYNELPKAMSSVATSLLGLNSSIGN  503

Query  370  -lasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
              AS +M++++ LS + G  SW++S+INEGH DY+YW+L+GL   NFL +L CS+SYGPS
Sbjct  504  LAASFIMTTVDNLSKSVGVKSWVSSNINEGHSDYYYWLLSGLLFANFLYYLACSKSYGPS  563

Query  193  KDE  185
             +E
Sbjct  564  NEE  566



>ref|XP_009786716.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana sylvestris]
Length=609

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 123/190 (65%), Gaps = 4/190 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+ASRIRG  V  GT+ RMG GIF S    ++ G +E IRR  AIKQ   
Sbjct  401  WLVLYDRAILPLASRIRGKPVRLGTRERMGIGIFFSCMAMLISGIIEHIRRGKAIKQGLL  460

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++  G   MS +W++PQ+ L GIA   NA+ Q +F+ SE P+SMS+IA+ +     A+  
Sbjct  461  NNPEGVVAMSAMWLIPQHCLNGIAEAFNAIGQTEFYYSELPKSMSSIAAAMFGLGMAVAN  520

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S+++ L+   G  SW++S+IN G Y+ +YW+LA ++  N L F++CS +YGP 
Sbjct  521  LLASVILSNVDNLTKREGKESWVSSNINRGRYENYYWLLAIMTGFNLLYFMVCSWAYGPC  580

Query  193  KDEKPVAMEE  164
             +     M E
Sbjct  581  VENMSKKMVE  590



>ref|XP_004141840.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=608

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 125/187 (67%), Gaps = 4/187 (2%)
 Frame = -1

Query  712  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN  533
            LYDR +LP+AS+IRG  VH G KSRMG G+  S     L   VE+IRR  AI Q    D 
Sbjct  390  LYDRAILPLASKIRGKPVHFGVKSRMGAGLICSAMSMALSAIVENIRRRKAIAQGIVDDL  449

Query  532  LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgysla  365
                 MS LW++PQ+ L G+A   NA+ Q +F+ SEFP++MS++AS+L     A+   LA
Sbjct  450  DAVVDMSALWLIPQHCLNGLAEALNAIGQTEFYYSEFPKTMSSVASSLFGLGMAVANLLA  509

Query  364  sllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  185
            S +MS+++ ++   G  SW++ +IN+GH++ +YW+LA LS++N L +++CS +YGPS D+
Sbjct  510  SAIMSTVDNVTSKGGKESWVSKNINKGHFEKYYWLLAILSVINVLYYVVCSWAYGPSVDQ  569

Query  184  KPVAMEE  164
            +  AM++
Sbjct  570  RRTAMDD  576



>ref|XP_004252349.2| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Solanum lycopersicum]
Length=629

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 125/191 (65%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+V+YDR++LP+ SRIRG     GTK RMG GIF S    +L G +E IRR  +I Q   
Sbjct  429  WLVVYDRVILPLGSRIRGKPFRIGTKERMGIGIFFSCMAMLLSGIIEHIRRRKSINQGLL  488

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++  G   MS +W+VPQ+ L GIA   NA+ Q +F+ SE P+SMS+IA+ +     A+  
Sbjct  489  NNPEGIVAMSAMWLVPQHCLNGIAEAFNAIGQIEFYYSELPKSMSSIATAMFGLGTAVAN  548

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S+++ ++   G  SW++S+IN GHY+ +YW+LA ++ +N + F++CS +YGP 
Sbjct  549  LLASVILSNVDSITKREGKESWVSSNINRGHYENYYWLLAIMTCLNLVYFMVCSWAYGPC  608

Query  193  KDEKPVAMEED  161
             + +   M+E 
Sbjct  609  VESRSKKMDEK  619



>gb|KHN04222.1| Putative peptide transporter [Glycine soja]
Length=579

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 124/191 (65%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS++RG  V    K RMG G+  SF + V    VE+ RR  AI + H 
Sbjct  355  WIALYDRVIIPLASKLRGKPVRISAKRRMGLGLLFSFLHLVTAAIVETTRRRRAISEGHI  414

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +D      MS +W+ PQ  L GIA   NA+ QN+F+ +EFP++MS+IAS+L     A+GY
Sbjct  415  NDTHAVLNMSAMWLFPQLCLGGIAEAFNAIGQNEFYYTEFPKTMSSIASSLFGLGMAVGY  474

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             L+SL+ S + +++   G   W++ +IN+G +D +YW+LA +S VN L +L+CS +YGP+
Sbjct  475  VLSSLVFSIVEKVTSRGGKDGWVSDNINKGRFDKYYWLLATMSAVNVLYYLVCSWAYGPT  534

Query  193  KDEKPVAMEED  161
             D++    EE+
Sbjct  535  ADQESKVTEEN  545



>ref|XP_003530142.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=611

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 124/191 (65%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS++RG  V    K RMG G+  SF + V    VE+ RR  AI + H 
Sbjct  387  WIALYDRVIIPLASKLRGKPVRISAKRRMGLGLLFSFLHLVTAAIVETTRRRRAISEGHI  446

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +D      MS +W+ PQ  L GIA   NA+ QN+F+ +EFP++MS+IAS+L     A+GY
Sbjct  447  NDTHAVLNMSAMWLFPQLCLGGIAEAFNAIGQNEFYYTEFPKTMSSIASSLFGLGMAVGY  506

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             L+SL+ S + +++   G   W++ +IN+G +D +YW+LA +S VN L +L+CS +YGP+
Sbjct  507  VLSSLVFSIVEKVTSRGGKDGWVSDNINKGRFDKYYWLLATMSAVNVLYYLVCSWAYGPT  566

Query  193  KDEKPVAMEED  161
             D++    EE+
Sbjct  567  SDQESKVTEEN  577



>gb|KGN45387.1| hypothetical protein Csa_7G447020 [Cucumis sativus]
Length=623

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 125/187 (67%), Gaps = 4/187 (2%)
 Frame = -1

Query  712  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN  533
            LYDR +LP+AS+IRG  VH G KSRMG G+  S     L   VE+IRR  AI Q    D 
Sbjct  405  LYDRAILPLASKIRGKPVHFGVKSRMGAGLICSAMSMALSAIVENIRRRKAIAQGIVDDL  464

Query  532  LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgysla  365
                 MS LW++PQ+ L G+A   NA+ Q +F+ SEFP++MS++AS+L     A+   LA
Sbjct  465  DAVVDMSALWLIPQHCLNGLAEALNAIGQTEFYYSEFPKTMSSVASSLFGLGMAVANLLA  524

Query  364  sllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  185
            S +MS+++ ++   G  SW++ +IN+GH++ +YW+LA LS++N L +++CS +YGPS D+
Sbjct  525  SAIMSTVDNVTSKGGKESWVSKNINKGHFEKYYWLLAILSVINVLYYVVCSWAYGPSVDQ  584

Query  184  KPVAMEE  164
            +  AM++
Sbjct  585  RRTAMDD  591



>ref|XP_006392949.1| hypothetical protein EUTSA_v10011325mg [Eutrema salsugineum]
 gb|ESQ30235.1| hypothetical protein EUTSA_v10011325mg [Eutrema salsugineum]
Length=609

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 123/183 (67%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR ++P+ S+IRG       K RMG G+F+SF    +   VE+ RR  A+ Q ++
Sbjct  390  WVVLYDRAIIPLVSKIRGRPFRLSVKLRMGLGLFISFLAMAISAMVENFRRKKALSQGYA  449

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      +S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L     A+  
Sbjct  450  NNANAVVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAS  509

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS++++++NEL+  +G  SW++ +IN+GHY+Y+YW+LA +S +N + + ICS SYGP 
Sbjct  510  LLASVILNAVNELTSRNGKESWVSDNINKGHYNYYYWLLAIMSFINVIYYAICSWSYGPL  569

Query  193  KDE  185
             D+
Sbjct  570  FDQ  572



>ref|XP_011026625.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=568

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 119/184 (65%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR+++P+ S+++G  V    K RMG GI +S      +   ES RR  AIK+   
Sbjct  381  WVVLYDRIIIPLVSKVKGKIVCLNLKQRMGIGILLSTISMAALAIAESFRRETAIKEGFP  440

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastly----algy  374
             +   +  +S +W++P + L G+A   NA+ QN+FF +E P+SMS++ASTL     +   
Sbjct  441  DNPNAELHISAMWLLPYFVLSGLAEAFNAIGQNEFFYTELPKSMSSVASTLQGLGLSAAS  500

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             ++S ++S++ + +      SW++S+IN GHYDY+YW+L  LS+VNF+ +L+CS+SYGP 
Sbjct  501  LVSSFIVSTVRDFTKGEARESWVSSNINRGHYDYYYWLLTVLSLVNFIYYLVCSKSYGPC  560

Query  193  KDEK  182
            + EK
Sbjct  561  RQEK  564



>ref|XP_002324232.2| hypothetical protein POPTR_0018s00440g [Populus trichocarpa]
 gb|EEF02797.2| hypothetical protein POPTR_0018s00440g [Populus trichocarpa]
Length=573

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 119/184 (65%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR+++P+ S+I+G  V  G K RMG GI +S      +   ES+RR  AIK+  S
Sbjct  381  WVALYDRIIIPLVSKIKGQPVCLGLKKRMGIGILLSTTSMAALAIAESVRRETAIKEGFS  440

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
                    +S    +P  AL G+A     + QN+FF +E P+SMS++ASTL     ++  
Sbjct  441  DRPDAGLHISTFLFLPFLALSGVAEAFTPIGQNEFFYTELPKSMSSVASTLNGIGMSVAS  500

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             ++S ++ ++ +L+   G  SW++S+IN+GHYDY+YW+LA LS+VNFL +L+CS+SYGPS
Sbjct  501  LVSSFIVRAVRDLTTVEGQESWVSSNINKGHYDYYYWLLASLSLVNFLYYLVCSKSYGPS  560

Query  193  KDEK  182
             +E+
Sbjct  561  MEEQ  564



>gb|KDO79783.1| hypothetical protein CISIN_1g039943mg [Citrus sinensis]
Length=581

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 120/191 (63%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+L P+AS+IRG       K RMG G+  S          E++RR++AI +  S
Sbjct  384  WIGFYDRILQPIASKIRGKPCQLRLKQRMGIGLLFSTASMAAWAITETVRRNIAINEGIS  443

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D     KMS +WV+P + L G+A+  N + Q +F+ SE PRSMS+IAS L     ++  
Sbjct  444  DDPRAVVKMSAMWVLPYHVLSGLAMAFNMIGQIEFYYSELPRSMSSIASALHGLGMSVAS  503

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +AS +M++++E++   G   WI S+IN+G YDY+YW+LAGL+M +F+ FL C ++YGP 
Sbjct  504  LVASFIMNAVDEITKRGGKEGWIPSNINKGRYDYYYWLLAGLNMASFIYFLACCKAYGPC  563

Query  193  KDEKPVAMEED  161
            ++E   A++E 
Sbjct  564  REEASEALDEK  574



>ref|XP_006450665.1| hypothetical protein CICLE_v10010641mg [Citrus clementina]
 gb|ESR63905.1| hypothetical protein CICLE_v10010641mg [Citrus clementina]
Length=581

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 120/191 (63%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+L P+AS+IRG       K RMG G+  S          E++RR++AI +  S
Sbjct  384  WIGFYDRILQPIASKIRGKPCQLRLKQRMGIGLLFSTASMAAWAITETVRRNIAINEGIS  443

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D     KMS +WV+P + L G+A+  N + Q +F+ SE PRSMS+IAS L     ++  
Sbjct  444  DDPRAVVKMSAMWVLPYHVLSGLAMAFNMIGQIEFYYSELPRSMSSIASALHGLGMSVAS  503

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +AS +M++++E++   G   WI S+IN+G YDY+YW+LAGL+M +F+ FL C ++YGP 
Sbjct  504  LVASFIMNAVDEITKRGGKEGWIPSNINKGRYDYYYWLLAGLNMASFIYFLACCKAYGPC  563

Query  193  KDEKPVAMEED  161
            ++E   A++E 
Sbjct  564  REEASEALDEK  574



>ref|XP_006476061.1| PREDICTED: probable peptide transporter At1g52190-like [Citrus 
sinensis]
Length=581

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 120/191 (63%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+L P+AS+IRG       K RMG G+  S          E++RR++AI +  S
Sbjct  384  WIGFYDRILQPIASKIRGKPCQLRLKQRMGIGLLFSTASMAAWAITETVRRNIAINEGIS  443

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D     KMS +WV+P + L G+A+  N + Q +F+ SE PRSMS+IAS L     ++  
Sbjct  444  DDPRAVVKMSAMWVLPYHVLSGLAMAFNMIGQIEFYYSELPRSMSSIASALHGLGMSVAS  503

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +AS +M++++E++   G   WI S+IN+G YDY+YW+LAGL+M +F+ FL C ++YGP 
Sbjct  504  LVASFIMNAVDEITKRGGKEGWIPSNINKGRYDYYYWLLAGLNMASFIYFLACCKAYGPC  563

Query  193  KDEKPVAMEED  161
            ++E   A++E 
Sbjct  564  REEASEALDEK  574



>ref|XP_008445024.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Cucumis melo]
Length=581

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 115/183 (63%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDRL+LP+AS+ RG       K+RMG GI        +   VE  RR+LAI++  S
Sbjct  384  WITLYDRLILPLASKCRGKPTRLSAKTRMGLGILCCTLSLAVSAVVEGYRRALAIREGFS  443

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS  W +P+Y L G+A   NA+ Q +FF +E P++MS++A++L     ++G 
Sbjct  444  DDPNAVVSMSAFWTLPRYILFGMAEAFNAIGQIEFFYNELPKAMSSVATSLLGLNSSVGN  503

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
              AS +M++++  S   G  SW++S+IN+GH DY+YW+L GL   N L FL CS+SYGPS
Sbjct  504  LAASFIMTTVDNFSKAVGGKSWVSSNINDGHSDYYYWLLFGLLFANLLYFLACSKSYGPS  563

Query  193  KDE  185
            K+E
Sbjct  564  KEE  566



>ref|XP_011026626.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
 ref|XP_011026627.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
 ref|XP_011026628.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=573

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 119/184 (65%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR+++P  S+I+G+ V  G K RMG GI +S      +   ES+RR  AIK+  S
Sbjct  381  WVALYDRIIIPFVSKIKGHPVRLGLKKRMGIGILLSTTSMAALAIAESVRRETAIKEGFS  440

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
                 +  +S   ++P  AL G+A     + QN+FF +E P+SMS+IASTL     ++  
Sbjct  441  DRPDAELHISTFLLLPFLALSGVAEAFTPIGQNEFFYTELPKSMSSIASTLNGIGLSVAS  500

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             ++S ++ ++ +L+   G  SW++S+IN+GHYDY+YW+LA LS  NFL +L+CS+SYGPS
Sbjct  501  LVSSFMVRAVRDLTKVEGQESWVSSNINKGHYDYYYWLLASLSFANFLYYLVCSKSYGPS  560

Query  193  KDEK  182
             +E+
Sbjct  561  MEEQ  564



>ref|XP_006406868.1| hypothetical protein EUTSA_v10020365mg [Eutrema salsugineum]
 gb|ESQ48321.1| hypothetical protein EUTSA_v10020365mg [Eutrema salsugineum]
Length=588

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 119/182 (65%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct  387  WVVLYDRAILPLASKIRGRPVRISVKIRMGLGLFISFLAMAISATVEHYRRKTAISQGLA  446

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+IA++L+ LG ++A+
Sbjct  447  NNANATVNISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAASLFGLGMAVAN  506

Query  361  llmsSINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            +L S I  +  NS   G  SWI  +IN+GHYDY+YWVL  LS VN + +++CS SYG + 
Sbjct  507  VLASVILNVVKNSSKKGKESWIEDNINKGHYDYYYWVLVILSFVNVVYYVVCSWSYGLTM  566

Query  190  DE  185
            D+
Sbjct  567  DQ  568



>ref|XP_002516546.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45887.1| nitrate transporter, putative [Ricinus communis]
Length=457

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 115/183 (63%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS+++G  +    K RMG GI +S      +   E IRR  AI++  S
Sbjct  262  WITLYDRIIIPLASKLKGKQIRLSLKQRMGIGILLSSASMAALAITERIRRETAIREGFS  321

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMS----TIastlyalgy  374
                    MS LW++P +AL G+A    A+ QN+F+ +E P+ MS    T+     +   
Sbjct  322  DYPNAVVHMSALWLLPHHALGGVAEAFAAIGQNEFYYTELPKCMSSVAATLFEMGLSAAN  381

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             L+SL+M++++  S   G  SW++S+IN+GHYDY+YW+LA LS++NF+ +L CS+SYGP 
Sbjct  382  LLSSLIMTAVDSFSKRGGEESWVSSNINKGHYDYYYWLLASLSLLNFVYYLACSKSYGPC  441

Query  193  KDE  185
            + E
Sbjct  442  RGE  444



>ref|XP_002324231.1| hypothetical protein POPTR_0018s00430g [Populus trichocarpa]
 gb|EEF02796.1| hypothetical protein POPTR_0018s00430g [Populus trichocarpa]
Length=568

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 120/184 (65%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR+++P+ S++ G  V    K RMG GI +S      +   ES RR+ AIK+   
Sbjct  381  WVVLYDRIIIPLVSKVSGKIVCLNLKQRMGIGILLSTISMAALAIAESFRRATAIKEGFP  440

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastly----algy  374
             +   +  +S +W++P + L G+A   NA+ QN+FF +E P+SMS++ASTL     +   
Sbjct  441  DNPNAELHISAMWLLPYFVLSGLAEAFNAIGQNEFFYTELPKSMSSVASTLQGLGLSAAS  500

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             ++S ++S++ + +      SW++S+IN+GHYDY+YW+L  LS+VNF+ +L+CS++YGP 
Sbjct  501  LVSSFIVSAVRDFTKGEAQESWVSSNINKGHYDYYYWILTILSLVNFIYYLVCSKTYGPC  560

Query  193  KDEK  182
            + EK
Sbjct  561  RQEK  564



>ref|XP_007150641.1| hypothetical protein PHAVU_005G169400g [Phaseolus vulgaris]
 gb|ESW22635.1| hypothetical protein PHAVU_005G169400g [Phaseolus vulgaris]
Length=605

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 123/194 (63%), Gaps = 4/194 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR++LP+AS++RG  V    K RMG G+  SF + V+   VE+ RR  AI++ + 
Sbjct  387  WIALYDRVVLPLASKLRGKPVRINAKRRMGLGLLFSFLHLVVSAIVETTRRKRAIEEGYL  446

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastly----algy  374
            ++      MS LW+ PQ  L GIA   NA+ QN+F+ +EFP+SMS++A++L     A G 
Sbjct  447  NNAHAVLHMSALWIFPQLILGGIAEAFNAIGQNEFYYTEFPKSMSSVATSLSGLGMAAGN  506

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             ++S + S I  ++ + G   WI+ +IN+G YD +YWV++GLS +N L +L+CS  YGP+
Sbjct  507  LVSSFVFSVIQNVTSSGGKQGWISDNINKGRYDKYYWVISGLSALNILYYLLCSWVYGPT  566

Query  193  KDEKPVAMEED*RR  152
             DE     EE+  R
Sbjct  567  VDEVSKVGEENGSR  580



>gb|KHM98741.1| Putative peptide transporter [Glycine soja]
Length=603

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 120/183 (66%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR +LP+AS+IRG  V    K RMG G+F SF + V    VES+RR  AIK+ + 
Sbjct  374  WIALYDRAILPLASKIRGKPVRISAKRRMGLGLFFSFIHLVTSAIVESVRRRRAIKEGYL  433

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++  G   MS +W+ PQ  L GIA   NA+ QN+F+ +EFPR+MS++A++L  LG +  +
Sbjct  434  NNANGVLHMSAMWLFPQLCLGGIAEAFNAIGQNEFYYTEFPRTMSSVAASLSGLGMAAGN  493

Query  361  llmsSINELSINS----GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S +  +  N+    G   W+  +IN+G YD +YWV++GLS +N + +LICS +YGP+
Sbjct  494  LVSSFVFSVVQNATSRGGKEGWVLDNINKGRYDKYYWVISGLSALNIVYYLICSWAYGPT  553

Query  193  KDE  185
             ++
Sbjct  554  VEQ  556



>ref|XP_003546477.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=616

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 120/183 (66%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR +LP+AS+IRG  V    K RMG G+F SF + V    VES+RR  AIK+ + 
Sbjct  387  WIALYDRAILPLASKIRGKPVRISAKRRMGLGLFFSFIHLVTSAIVESVRRRRAIKEGYL  446

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++  G   MS +W+ PQ  L GIA   NA+ QN+F+ +EFPR+MS++A++L  LG +  +
Sbjct  447  NNANGVLHMSAMWLFPQLCLGGIAEAFNAIGQNEFYYTEFPRTMSSVAASLSGLGMAAGN  506

Query  361  llmsSINELSINS----GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S +  +  N+    G   W+  +IN+G YD +YWV++GLS +N + +LICS +YGP+
Sbjct  507  LVSSFVFSVVQNATSRGGKEGWVLDNINKGRYDKYYWVISGLSALNIVYYLICSWAYGPT  566

Query  193  KDE  185
             ++
Sbjct  567  VEQ  569



>ref|XP_002516544.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45885.1| nitrate transporter, putative [Ricinus communis]
Length=578

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 123/191 (64%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR+++P+AS++RG  V    K RMG GI +S    +     E  RR  AI++  S
Sbjct  385  WVSLYDRVIVPLASKLRGKPVRLSLKQRMGIGILLSSASMLAFAIAEKNRRERAIREGFS  444

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS+LW++P   L G+A   +A+ QN+F+ +E P+SMS+IA+TL     +   
Sbjct  445  DDPNAVVNMSVLWLLPYLVLCGLAETFSAIGQNEFYYTELPKSMSSIAATLFDMGLSAAN  504

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS +MS+I+  S   G  SW++S+IN+GHYDY+YW+LA LS++NF+ +L CS+ YGP 
Sbjct  505  LLASFIMSTIDSFSKRGGEESWVSSNINKGHYDYYYWLLASLSLLNFVYYLACSKGYGPC  564

Query  193  KDEKPVAMEED  161
            + ++  A ++D
Sbjct  565  RAKEGNAPDDD  575



>ref|XP_010668254.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Beta vulgaris subsp. 
vulgaris]
Length=574

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 125/191 (65%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+++P+A+RI G       + RMG G+ +S    V+   +E +RR  AIK+  S
Sbjct  379  WIGTYDRIIIPLAARIMGKPARLSVRKRMGIGLILSSMSMVVCAIIEGVRRETAIKEGFS  438

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D  G + MS  W++  + + G+A    AV QN+FF SEFP+SM+++A+ L     ++  
Sbjct  439  DDPKGVTDMSAYWLLIHHMVSGMAEALFAVGQNEFFYSEFPKSMASVATNLYGVGMSVAS  498

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +ASL+MSSI+ ++   G  SW++S+IN+ H+DY+YW LAGLS+VNF  +L+CSR+YGPS
Sbjct  499  LIASLIMSSIDSITSRDGKESWVSSNINKAHFDYYYWFLAGLSIVNFFYYLLCSRAYGPS  558

Query  193  KDEKPVAMEED  161
              E+ +  +++
Sbjct  559  LSEQNIFWDDE  569



>ref|XP_003597725.1| hypothetical protein MTR_2g101590 [Medicago truncatula]
 gb|ABD32298.1| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67976.1| nitrate transporter 1 [Medicago truncatula]
Length=637

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 118/179 (66%), Gaps = 4/179 (2%)
 Frame = -1

Query  709  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL  530
            YDR+L+P+AS+IRG  V    K RMG G+F +F + +     E++RR  AIK+ + +D  
Sbjct  393  YDRVLIPLASKIRGKPVIISPKKRMGIGLFFNFLHLITAAIFETVRRKEAIKEGYLNDTH  452

Query  529  GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgy----slas  362
            G  KMS +W+ PQ  L GIA   N + QN+F+  EFP+SMS++A++L  L       ++S
Sbjct  453  GVLKMSAMWLAPQLCLAGIAEMFNVIGQNEFYYKEFPKSMSSVAASLSGLAMGVGNLVSS  512

Query  361  llmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  185
            L++S I   + + GN  W++ +IN+GH+D +YWV+ G++ +N L +L+CS +YGP+ DE
Sbjct  513  LVLSIIESTTPSGGNEGWVSDNINKGHFDKYYWVIVGINALNLLYYLVCSWAYGPTVDE  571



>ref|XP_003597726.1| hypothetical protein MTR_2g101610 [Medicago truncatula]
 gb|ABD32296.1| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67977.1| nitrate transporter 1 [Medicago truncatula]
Length=638

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 118/179 (66%), Gaps = 4/179 (2%)
 Frame = -1

Query  709  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL  530
            YDR+L+P+AS+IRG  V    K RMG G+F +F + +     E++RR  AIK+ + +D  
Sbjct  394  YDRVLIPLASKIRGKPVIISPKKRMGIGLFFNFLHLITAAIFETVRRKEAIKEGYLNDTH  453

Query  529  GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgy----slas  362
            G  KMS +W+ PQ  L GIA   N + QN+F+  EFP+SMS++A++L  L       ++S
Sbjct  454  GVLKMSAMWLAPQLCLAGIAEMFNVIGQNEFYYKEFPKSMSSVAASLSGLAMGVGNLVSS  513

Query  361  llmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  185
            L++S I   + + GN  W++ +IN+GH+D +YWV+ G++ +N L +L+CS +YGP+ DE
Sbjct  514  LVLSIIESTTPSGGNEGWVSDNINKGHFDKYYWVIVGINALNLLYYLVCSWAYGPTVDE  572



>gb|ADG37990.1| AT1G52190-like protein [Capsella grandiflora]
 gb|ADG37991.1| AT1G52190-like protein [Capsella grandiflora]
 gb|ADG37994.1| AT1G52190-like protein [Capsella grandiflora]
Length=201

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 115/170 (68%), Gaps = 4/170 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG       K RMG G+F+SF    +   VES RR+ AI Q + 
Sbjct  32   WVVLYDRAVLPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAVSAMVESFRRNKAISQGYG  91

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      +S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L     A+  
Sbjct  92   NNPNAVVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAS  151

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLF  224
             LAS++++++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S VN + +
Sbjct  152  LLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFVNVIYY  201



>gb|AEN81086.1| AT1G52190-like protein, partial [Capsella rubella]
 gb|AEN81087.1| AT1G52190-like protein, partial [Capsella rubella]
 gb|AEN81088.1| AT1G52190-like protein, partial [Capsella rubella]
 gb|AEN81089.1| AT1G52190-like protein, partial [Capsella rubella]
 gb|AEN81090.1| AT1G52190-like protein, partial [Capsella rubella]
 gb|AEN81091.1| AT1G52190-like protein, partial [Capsella rubella]
 gb|AEN81092.1| AT1G52190-like protein, partial [Capsella rubella]
 gb|AEN81093.1| AT1G52190-like protein, partial [Capsella rubella]
Length=202

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 115/170 (68%), Gaps = 4/170 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG       K RMG G+F+SF    +   VES RR+ AI Q + 
Sbjct  33   WVVLYDRAVLPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAVSAMVESFRRNKAISQGYG  92

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      +S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L     A+  
Sbjct  93   NNPNAVVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAS  152

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLF  224
             LAS++++++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S VN + +
Sbjct  153  LLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFVNVIYY  202



>gb|KDO79779.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
 gb|KDO79780.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
Length=451

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 116/190 (61%), Gaps = 4/190 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR +LP+AS+I+G       K RMG G+  S         VE+ RRS+AI +  S
Sbjct  254  WIGLYDRAVLPLASKIKGKPCQLSLKLRMGIGLLFSTASMTAWAIVEAARRSIAINEGIS  313

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D     +MS +W +P   L G+A+  N + Q +F+ +E P+SMS+IASTL   G S A+
Sbjct  314  DDLRAVVQMSAMWQLPYLVLSGLAMAFNMIGQTEFYYTELPKSMSSIASTLSGAGLSAAN  373

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    ++++   GNG WI S+IN+GHYDY+YW+L  LSM NFL +L C ++YGP 
Sbjct  374  LVASLIMNAVDDITKRGGNGGWIPSNINKGHYDYYYWLLTALSMANFLYYLACCKAYGPF  433

Query  193  KDEKPVAMEE  164
            K     A ++
Sbjct  434  KGRVGTAFDD  443



>gb|KDO79781.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
 gb|KDO79782.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
Length=475

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 116/190 (61%), Gaps = 4/190 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR +LP+AS+I+G       K RMG G+  S         VE+ RRS+AI +  S
Sbjct  278  WIGLYDRAVLPLASKIKGKPCQLSLKLRMGIGLLFSTASMTAWAIVEAARRSIAINEGIS  337

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D     +MS +W +P   L G+A+  N + Q +F+ +E P+SMS+IASTL   G S A+
Sbjct  338  DDLRAVVQMSAMWQLPYLVLSGLAMAFNMIGQTEFYYTELPKSMSSIASTLSGAGLSAAN  397

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    ++++   GNG WI S+IN+GHYDY+YW+L  LSM NFL +L C ++YGP 
Sbjct  398  LVASLIMNAVDDITKRGGNGGWIPSNINKGHYDYYYWLLTALSMANFLYYLACCKAYGPF  457

Query  193  KDEKPVAMEE  164
            K     A ++
Sbjct  458  KGRVGTAFDD  467



>gb|KDP37260.1| hypothetical protein JCGZ_06316 [Jatropha curcas]
Length=611

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 121/183 (66%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+A++I+G  V  G K RMG G+F+S    V+ G VE++RR  AI+  + 
Sbjct  386  WVVLYDRAILPLAAKIKGKPVRLGVKLRMGIGLFISCIAMVVGGIVENVRRRKAIRDGYL  445

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      MS  W++PQ+ L G+A   NA+ Q +F+ SEFP+SMS+IA  L     A+  
Sbjct  446  NNPQAVLNMSASWLIPQFCLNGLAEAFNAIGQTEFYYSEFPKSMSSIAGALNGLGMAVAN  505

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S++N ++   G   W+ S+IN+GH D +YW+LA +S VN + F++CS +YGP 
Sbjct  506  ILASVILSAVNNVTSKGGRDGWVPSNINKGHIDNYYWLLAIMSSVNLVYFVLCSWAYGPC  565

Query  193  KDE  185
            K+ 
Sbjct  566  KER  568



>ref|XP_006359461.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=599

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 124/192 (65%), Gaps = 5/192 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+V+YDR+++P+ SRIRG     GTK RMG GIF S    +L G +E IRR  +I Q   
Sbjct  393  WLVVYDRVIIPLGSRIRGKPFRIGTKERMGIGIFFSCMAMLLSGIIEHIRRRKSIDQGLL  452

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++  G   MS +W+VPQ+ L GIA   NA+ Q +F+ SE P+SMS+IA+ +     A+  
Sbjct  453  NNPEGVVAMSAMWLVPQHCLNGIAEAFNAIGQIEFYYSELPKSMSSIATAMFGLGTAVAN  512

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S+++ ++   G  SW++S+IN GHY+ +YW+LA ++  N + F++CS +YGP 
Sbjct  513  LLASVILSNVDSITKREGKESWVSSNINRGHYENYYWLLAIMTCFNLVYFMVCSWAYGPC  572

Query  193  KDEKPVAM-EED  161
             +     + EED
Sbjct  573  VESGSKKLVEED  584



>ref|XP_006476064.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Citrus sinensis]
 gb|KDO79776.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
Length=539

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 116/190 (61%), Gaps = 4/190 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR +LP+AS+I+G       K RMG G+  S         VE+ RRS+AI +  S
Sbjct  342  WIGLYDRAVLPLASKIKGKPCQLSLKLRMGIGLLFSTASMTAWAIVEAARRSIAINEGIS  401

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D     +MS +W +P   L G+A+  N + Q +F+ +E P+SMS+IASTL   G S A+
Sbjct  402  DDLRAVVQMSAMWQLPYLVLSGLAMAFNMIGQTEFYYTELPKSMSSIASTLSGAGLSAAN  461

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    ++++   GNG WI S+IN+GHYDY+YW+L  LSM NFL +L C ++YGP 
Sbjct  462  LVASLIMNAVDDITKRGGNGGWIPSNINKGHYDYYYWLLTALSMANFLYYLACCKAYGPF  521

Query  193  KDEKPVAMEE  164
            K     A ++
Sbjct  522  KGRVGTAFDD  531



>gb|KDO79777.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
Length=548

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 116/190 (61%), Gaps = 4/190 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR +LP+AS+I+G       K RMG G+  S         VE+ RRS+AI +  S
Sbjct  351  WIGLYDRAVLPLASKIKGKPCQLSLKLRMGIGLLFSTASMTAWAIVEAARRSIAINEGIS  410

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D     +MS +W +P   L G+A+  N + Q +F+ +E P+SMS+IASTL   G S A+
Sbjct  411  DDLRAVVQMSAMWQLPYLVLSGLAMAFNMIGQTEFYYTELPKSMSSIASTLSGAGLSAAN  470

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    ++++   GNG WI S+IN+GHYDY+YW+L  LSM NFL +L C ++YGP 
Sbjct  471  LVASLIMNAVDDITKRGGNGGWIPSNINKGHYDYYYWLLTALSMANFLYYLACCKAYGPF  530

Query  193  KDEKPVAMEE  164
            K     A ++
Sbjct  531  KGRVGTAFDD  540



>ref|XP_010691376.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Beta vulgaris subsp. 
vulgaris]
Length=605

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 122/187 (65%), Gaps = 4/187 (2%)
 Frame = -1

Query  709  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL  530
            YDR+LLP+AS+IRG     G K RMG G+F +F   ++ G VE +RR  AI    ++++ 
Sbjct  393  YDRVLLPLASKIRGKPARLGVKMRMGIGLFCTFMSMLVAGIVEHVRRQRAISLGFANNSE  452

Query  529  GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslasllms  350
            G   MS  W+V Q+   G++   N + Q +FF SE P+SMS+IA+ L+ +G ++ASLL S
Sbjct  453  GVLHMSAFWLVFQHCFSGLSEAFNGIGQTEFFYSEMPKSMSSIATCLFGVGMAVASLLAS  512

Query  349  SI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  182
             I    + ++   G  SW++S+IN+GHYDY+YWVLA +S +N L ++ CS SYGP ++ K
Sbjct  513  VILNLVDGITKKGGKDSWVSSNINKGHYDYYYWVLATISFLNILYYVFCSWSYGPVEERK  572

Query  181  PVAMEED  161
               ++E+
Sbjct  573  NKVIDEE  579



>ref|XP_006450663.1| hypothetical protein CICLE_v10007857mg [Citrus clementina]
 ref|XP_006476063.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Citrus sinensis]
 gb|ESR63903.1| hypothetical protein CICLE_v10007857mg [Citrus clementina]
 gb|KDO79778.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
Length=572

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 116/191 (61%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR +LP+AS+I+G       K RMG G+  S         VE+ RRS+AI +  S
Sbjct  375  WIGLYDRAVLPLASKIKGKPCQLSLKLRMGIGLLFSTASMTAWAIVEAARRSIAINEGIS  434

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D     +MS +W +P   L G+A+  N + Q +F+ +E P+SMS+IASTL   G S A+
Sbjct  435  DDLRAVVQMSAMWQLPYLVLSGLAMAFNMIGQTEFYYTELPKSMSSIASTLSGAGLSAAN  494

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    ++++   GNG WI S+IN+GHYDY+YW+L  LSM NFL +L C ++YGP 
Sbjct  495  LVASLIMNAVDDITKRGGNGGWIPSNINKGHYDYYYWLLTALSMANFLYYLACCKAYGPF  554

Query  193  KDEKPVAMEED  161
            K     A ++ 
Sbjct  555  KGRVGTAFDDK  565



>gb|KEH28715.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=601

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 126/192 (66%), Gaps = 5/192 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS++RG  V    K+RMG G+F SF + V    VE+IRR  AI + + 
Sbjct  393  WIALYDRVVIPLASKLRGKPVRISAKTRMGLGLFFSFLHLVTASIVETIRRRRAINEGYG  452

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +D      MS +W+ PQ  L GIA   N + QN+F+ +EFP++MS+IAS+L     A+GY
Sbjct  453  NDPHSVLNMSAMWLFPQLCLGGIAEAFNVIGQNEFYYTEFPKTMSSIASSLFGLGMAVGY  512

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             ++S L S +  ++ + G   WI+ +IN+G +D +YW++A +S VN L +++CS +YGP+
Sbjct  513  VISSFLFSIVERVTSSGGKDGWISDNINKGRFDKYYWLIATVSGVNILYYVVCSWAYGPT  572

Query  193  KD-EKPVAMEED  161
             D E  V+ +E+
Sbjct  573  ADVESKVSADEE  584



>gb|EPS73537.1| proton-dependent oligopeptide transport family protein [Genlisea 
aurea]
Length=305

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 116/182 (64%), Gaps = 2/182 (1%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI++Y+R++LP+AS+ +G  VH   K+R+G G+F SF    +   VESIRRS+AIK+  +
Sbjct  116  WILVYNRVVLPLASKFKGAPVHINAKTRIGVGLFFSFLAMAVTSLVESIRRSIAIKEGLA  175

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                    MS LW++PQ AL+G A  S   +Q +F+ SE P+S+S+I   L  L     S
Sbjct  176  EFPKATVPMSALWLIPQNALVGFAEASFLTSQVEFYYSEIPKSISSIVWGLSTLSGCFGS  235

Query  361  llmsSINELSINSGN--GSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  188
            LL S +      +    GSW++S+IN+GHYD +Y VL G+SM NF+ FL CS +YGP ++
Sbjct  236  LLASVVLSTVDKATREVGSWVSSNINKGHYDDYYLVLGGISMGNFIYFLACSYAYGPMQE  295

Query  187  EK  182
            E+
Sbjct  296  EE  297



>ref|XP_010648806.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Vitis vinifera]
Length=365

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 111/184 (60%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YD LL+P+ +R  G       K RMG G+ +S     +    E IRR +A KQ   
Sbjct  162  WLPVYDCLLVPILARYTGQLRGLSPKVRMGIGLVLSCMAMAVAAATEMIRRRIATKQGLE  221

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIa----stlyalgy  374
                    MS LW++PQY L+G+A   N + QN+F+ S+FP+SMS++A    +   AL  
Sbjct  222  DQPAATVNMSALWLLPQYVLLGLAEAFNGIGQNEFYYSQFPKSMSSLAGALFTLGLALSS  281

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
               SLL++ +N ++   G  SW++S++N+GH DY+Y ++A L M+NF+ FL+C R YGP 
Sbjct  282  FAGSLLVNVVNSVTTKGGKESWLSSNLNKGHLDYYYGLIAVLGMINFIYFLVCCRLYGPC  341

Query  193  KDEK  182
            +DEK
Sbjct  342  EDEK  345



>gb|ADG37995.1| AT1G52190-like protein [Neslia paniculata]
Length=201

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 116/170 (68%), Gaps = 4/170 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+I+G       K RMG G+F+SF    +   VES RR+ AI Q ++
Sbjct  32   WVVLYDRAVLPLASKIQGRPFRLSVKLRMGLGLFMSFLAMAVSAMVESFRRNKAISQGYA  91

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      +S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L     A+  
Sbjct  92   NNPNAVVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAS  151

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLF  224
             LAS++++++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + +
Sbjct  152  LLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYY  201



>gb|ADG37992.1| AT1G52190-like protein [Capsella grandiflora]
 gb|ADG37993.1| AT1G52190-like protein [Capsella grandiflora]
Length=201

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 114/170 (67%), Gaps = 4/170 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYDR +LP+AS+IRG       K RMG G+F+SF    +   VES RR+ AI Q + 
Sbjct  32   WVVLYDRAVLPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAVSAMVESFRRNKAISQGYG  91

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      +S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+IA++L     A+  
Sbjct  92   NNPNAVVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAS  151

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLF  224
             LAS++++++NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S  N + +
Sbjct  152  LLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFXNVIYY  201



>gb|KGN62822.1| hypothetical protein Csa_2G374640 [Cucumis sativus]
Length=581

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 117/196 (60%), Gaps = 5/196 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI+LYDRL+LP+ASR RG       K+RMG  I        +   VE  RR+LAIK+  S
Sbjct  384  WIILYDRLILPLASRYRGKPTRLSGKTRMGMAIPFCILSLAVSAIVEGYRRALAIKEGFS  443

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIast----lyalgy  374
             D      MS  W +P+Y L GIA    A+ Q +FF +E P++MS++A++        G 
Sbjct  444  DDPNAVVSMSAFWTLPRYILFGIAEAFYAIGQLEFFYNELPKAMSSVATSLLGLSSCAGN  503

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
              AS +M++++  S   G  SW++S+INEGH DY+YW+L GL + NF  +L C+ SYGPS
Sbjct  504  LAASFIMTTVDNFSKTIGVKSWVSSNINEGHNDYYYWLLFGLLVANFFYYLACNNSYGPS  563

Query  193  KDE-KPVAMEED*RRT  149
            K+E + ++  ED   T
Sbjct  564  KEESEDISNAEDYNNT  579



>ref|XP_004164039.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=589

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 118/196 (60%), Gaps = 5/196 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI+LYDRL+LP+ASR RG       K+RMG  I        +   VE  RR+LAIK+  S
Sbjct  392  WIILYDRLILPLASRYRGKPTRLSGKTRMGMAIPFCILSLAVSAIVEGYRRALAIKEGFS  451

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS  W +P+Y L GIA    A+ Q +FF +E P++MS++A++L       G 
Sbjct  452  DDPNAVVSMSAFWTLPRYILFGIAEAFYAIGQLEFFYNELPKAMSSVATSLLGLNTCAGN  511

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
              AS +M++++  S   G  SW++S+INEGH DY+YW+L GL + NF  +L C+ SYGPS
Sbjct  512  LAASFIMTTVDNFSKTIGVKSWVSSNINEGHNDYYYWLLFGLLVANFFYYLACNNSYGPS  571

Query  193  KDE-KPVAMEED*RRT  149
            K+E + ++  ED   T
Sbjct  572  KEESEDISNAEDYNNT  587



>ref|XP_004150293.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=589

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 118/196 (60%), Gaps = 5/196 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI+LYDRL+LP+ASR RG       K+RMG  I        +   VE  RR+LAIK+  S
Sbjct  392  WIILYDRLILPLASRYRGKPTRLSGKTRMGMAIPFCILSLAVSAIVEGYRRALAIKEGFS  451

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS  W +P+Y L GIA    A+ Q +FF +E P++MS++A++L       G 
Sbjct  452  DDPNAVVSMSAFWTLPRYILFGIAEAFYAIGQLEFFYNELPKAMSSVATSLLGLNTCAGN  511

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
              AS +M++++  S   G  SW++S+INEGH DY+YW+L GL + NF  +L C+ SYGPS
Sbjct  512  LAASFIMTTVDNFSKTIGVKSWVSSNINEGHNDYYYWLLFGLLVANFFYYLACNNSYGPS  571

Query  193  KDE-KPVAMEED*RRT  149
            K+E + ++  ED   T
Sbjct  572  KEESEDISNAEDYNNT  587



>ref|XP_003546946.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=584

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 127/188 (68%), Gaps = 6/188 (3%)
 Frame = -1

Query  712  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN  533
            +YDR++LP+AS++RG  V    K RMG G+F SF   V    VESIRR  AI++ + ++ 
Sbjct  386  VYDRVILPLASKVRGKPVTISAKKRMGIGLFFSFLDFVASAVVESIRRRKAIREGYINNP  445

Query  532  LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslasllm  353
                 MS +W++P   L GIA   NA+ Q++F+ SEFP SMS+IA++L++LG ++ +L+ 
Sbjct  446  EAVLDMSAMWLIPHNILCGIAEAFNAIGQSEFYYSEFPSSMSSIAASLFSLGSAVGNLVA  505

Query  352  sSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  185
            S I    ++++   G  SW++ +IN+GHYD +YW+LA +S+VN L +L+CS +YGPS + 
Sbjct  506  SLILSIVDDITSRGGKESWVSDNINKGHYDKYYWLLAIMSVVNILYYLVCSWAYGPSAE-  564

Query  184  KPVAMEED  161
             P + +E+
Sbjct  565  -PASKKEE  571



>gb|KHM98742.1| Putative peptide transporter [Glycine soja]
Length=566

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 127/188 (68%), Gaps = 6/188 (3%)
 Frame = -1

Query  712  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN  533
            +YDR++LP+AS++RG  V    K RMG G+F SF   V    VESIRR  AI++ + ++ 
Sbjct  368  VYDRVILPLASKVRGKPVTISAKKRMGIGLFFSFLDFVASAVVESIRRRKAIREGYINNP  427

Query  532  LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslasllm  353
                 MS +W++P   L GIA   NA+ Q++F+ SEFP SMS+IA++L++LG ++ +L+ 
Sbjct  428  EAVLDMSAMWLIPHNILCGIAEAFNAIGQSEFYYSEFPSSMSSIAASLFSLGSAVGNLVA  487

Query  352  sSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  185
            S I    ++++   G  SW++ +IN+GHYD +YW+LA +S+VN L +L+CS +YGPS + 
Sbjct  488  SLILSIVDDITSRGGKESWVSDNINKGHYDKYYWLLAIMSVVNILYYLVCSWAYGPSAE-  546

Query  184  KPVAMEED  161
             P + +E+
Sbjct  547  -PASKKEE  553



>ref|XP_008445026.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Cucumis melo]
Length=581

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 114/179 (64%), Gaps = 4/179 (2%)
 Frame = -1

Query  709  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL  530
            Y+ L+LP+AS+ RG   H   K+RMG GI        +   VE  RR+LAIK+  S+D  
Sbjct  388  YNCLILPLASKCRGKPTHLSGKTRMGLGILCCTLSLAVSAIVEGDRRALAIKEGFSNDPN  447

Query  529  GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgyslas  362
                MS  W +P+Y L G+A   NA+ Q +FF +E P++MS++A++L     ++G   AS
Sbjct  448  AVVSMSAFWTLPRYILFGMAEAFNAIGQIEFFYNELPKAMSSVATSLLGLNSSVGNLAAS  507

Query  361  llmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  185
             +M++++  S   G  SW++S+IN+GH DY+YW+L GL   NFL FL CS+SYGPSK+E
Sbjct  508  FIMTTVDNFSKAVGGKSWVSSNINDGHSDYYYWLLFGLLFANFLYFLACSKSYGPSKEE  566



>gb|KCW79098.1| hypothetical protein EUGRSUZ_C00542 [Eucalyptus grandis]
Length=537

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 120/183 (66%), Gaps = 5/183 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            ++ LY+R+ L +AS I G  V+   K RMG G+ +S +   ++  VES+RR +A ++EH 
Sbjct  338  FVALYNRVFLRLASAIIGKPVYPSLKQRMGSGLVISIFATSVLAIVESVRRRVATEEEHL  397

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgysl-a  365
             D +G  KMS +W++  Y L+GIA G NA+AQNQF+ SE P++MS+IA+TL+ +  ++  
Sbjct  398  -DGMGVVKMSAMWLLLYYILIGIAEGFNAIAQNQFYYSELPKTMSSIAATLFGVSMAVGN  456

Query  364  sllmsSINELSINSGNGS---WITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +    I+ + + +  G    W+ SDIN+GHYDY++WV+   S +NF+ FL C ++YGP 
Sbjct  457  LVASLIISTVQLVTERGEMEGWVGSDINKGHYDYYFWVITCFSTLNFVYFLACGKAYGPC  516

Query  193  KDE  185
            K E
Sbjct  517  KGE  519



>emb|CDO98012.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 124/183 (68%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++LYDR+LLP+AS+IRG  V  GTK RMG G+F++     +   VE IRR  AI Q   
Sbjct  405  WLILYDRVLLPLASKIRGKPVRVGTKFRMGAGLFMTAMAMAVSAIVEHIRRRKAIDQGFL  464

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++  G   MS +W+VPQ  + G+A   NA+ Q +F+ +EFP+SMS++A++L     A+G 
Sbjct  465  NNPRGLVNMSAMWLVPQNVVAGLAEALNAIGQFEFYYTEFPKSMSSVAASLFGLGMAVGS  524

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+L+S++++ +   G  SW++++IN+G +DY+YW+LA +S +N L +++CS  Y P 
Sbjct  525  LLASVLLSAVDKCTKREGKESWVSNNINKGRFDYYYWLLAIMSFINLLYYILCSWLYEPC  584

Query  193  KDE  185
             D+
Sbjct  585  ADQ  587



>gb|KHG12398.1| hypothetical protein F383_17450 [Gossypium arboreum]
Length=583

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 116/189 (61%), Gaps = 3/189 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+ LP+AS+I+G +V  G K RMG G+  S    V    VE  RR +AI++  S
Sbjct  383  WIPFYDRIALPLASKIKGKSVRLGLKQRMGIGLLCSCASMVASAIVEYTRRKIAIEEGLS  442

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +      MS LW++P Y L G+A   N + Q +F  SE P++MSTIA+ +Y  G  +++
Sbjct  443  DEPPAVVHMSALWILPFYILGGLAEAFNGIGQIEFCYSELPKTMSTIAANIYGFGTFISN  502

Query  361  llmsSINELSIN---SGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            L+ S I  +  N    G  SWI+S++N+GHYDY+Y +LAGLSM+NF+ FL C ++YGP  
Sbjct  503  LVASFITSMVNNVTKRGGESWISSNMNKGHYDYYYCLLAGLSMLNFIYFLSCCKAYGPCH  562

Query  190  DEKPVAMEE  164
             +     E+
Sbjct  563  GDNKNQAEK  571



>ref|XP_010050380.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Eucalyptus grandis]
Length=582

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 120/183 (66%), Gaps = 5/183 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            ++ LY+R+ L +AS I G  V+   K RMG G+ +S +   ++  VES+RR +A ++EH 
Sbjct  383  FVALYNRVFLRLASAIIGKPVYPSLKQRMGSGLVISIFATSVLAIVESVRRRVATEEEHL  442

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgysl-a  365
             D +G  KMS +W++  Y L+GIA G NA+AQNQF+ SE P++MS+IA+TL+ +  ++  
Sbjct  443  -DGMGVVKMSAMWLLLYYILIGIAEGFNAIAQNQFYYSELPKTMSSIAATLFGVSMAVGN  501

Query  364  sllmsSINELSINSGNGS---WITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +    I+ + + +  G    W+ SDIN+GHYDY++WV+   S +NF+ FL C ++YGP 
Sbjct  502  LVASLIISTVQLVTERGEMEGWVGSDINKGHYDYYFWVITCFSTLNFVYFLACGKAYGPC  561

Query  193  KDE  185
            K E
Sbjct  562  KGE  564



>ref|XP_003597722.1| hypothetical protein MTR_2g101560 [Medicago truncatula]
 gb|ABD32300.1| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67973.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=637

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 117/187 (63%), Gaps = 4/187 (2%)
 Frame = -1

Query  709  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL  530
            YDR+L+P+AS+IRG         RMG G+F +F + V+    ESIRR  AI+    ++  
Sbjct  394  YDRVLIPLASKIRGKPASISPMIRMGLGLFFNFLHIVVAAIFESIRRKKAIQAGFLNNTH  453

Query  529  GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslasllm-  353
            G  KMS +W+ PQ  L GIA   N + QN+F+  EFP++MS+++S L  L  +  +L+  
Sbjct  454  GVLKMSAMWLAPQLCLAGIAEAFNVIGQNEFYYKEFPKTMSSVSSALSGLAMAAGNLVSS  513

Query  352  ---sSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  182
               S+I   + + GN  WI+ +IN+GH+D + WV+AG++++N L +L+CS +YGP+ D+ 
Sbjct  514  FVFSTIENTTSSGGNEGWISDNINKGHFDKYLWVIAGINVLNLLYYLVCSWAYGPTADQV  573

Query  181  PVAMEED  161
                EE+
Sbjct  574  SKVSEEE  580



>gb|KJB27308.1| hypothetical protein B456_004G290200 [Gossypium raimondii]
Length=463

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 112/182 (62%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YD++ LP+AS+I+G  V  G K RMG G+  S    V    VE  RR +AI++  S
Sbjct  263  WIAFYDQIALPLASKIKGQPVRLGLKQRMGIGLLCSCASMVASAFVECTRRKIAIEEGFS  322

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +      MS LWV+P Y L G++   NA+A  +F  S  P++MSTIA+ +  LG    +
Sbjct  323  DEPQAVVHMSALWVLPFYVLAGLSEAFNAIALIEFCYSNLPKTMSTIAANVNELGGFTGN  382

Query  361  llmsSINELSIN---SGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            L+ S I  +  N    G  SW++S++N+GHYDY+Y +LAGLSM+NF+ FL+C +++GP  
Sbjct  383  LVASLITSMVDNVTKKGGESWVSSNMNKGHYDYYYCLLAGLSMLNFVYFLVCCKAHGPCH  442

Query  190  DE  185
             +
Sbjct  443  GD  444



>gb|KHN10207.1| Putative peptide transporter [Glycine soja]
Length=562

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 114/183 (62%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+++YDR+L+PVAS+I+G+    G K +MG G+         +  VE IRR +AI++ + 
Sbjct  378  WVIIYDRILVPVASKIKGSPACIGAKQKMGIGLLTGCIAIASLAVVEDIRRKIAIEKGYE  437

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIastlyalgy  374
                    MS LW++P+  L G+A     V QN+FF++E P+SM    ST+     ++  
Sbjct  438  DQPQAVVNMSALWLLPRQILNGLAEALGVVGQNEFFLTELPQSMSSLASTLNGLGSSVAN  497

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +AS ++S ++ ++   G+ SW++S+IN+GHYDY+Y ++  L  VNF+ FL CS+SYGP 
Sbjct  498  LVASFILSVVDNVTGGGGHESWLSSNINKGHYDYYYTLICALCFVNFVYFLYCSKSYGPC  557

Query  193  KDE  185
            K+ 
Sbjct  558  KNR  560



>ref|XP_003522705.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Glycine max]
 ref|XP_006578223.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Glycine max]
Length=568

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 114/183 (62%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+++YDR+L+PVAS+I+G+    G K +MG G+         +  VE IRR +AI++ + 
Sbjct  384  WVIIYDRILVPVASKIKGSPACIGAKQKMGIGLLTGCIAIASLAVVEDIRRKIAIEKGYE  443

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIastlyalgy  374
                    MS LW++P+  L G+A     V QN+FF++E P+SM    ST+     ++  
Sbjct  444  DQPQAVVNMSALWLLPRQILNGLAEALGVVGQNEFFLTELPQSMSSLASTLNGLGSSVAN  503

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +AS ++S ++ ++   G+ SW++S+IN+GHYDY+Y ++  L  VNF+ FL CS+SYGP 
Sbjct  504  LVASFILSVVDNVTGGGGHESWLSSNINKGHYDYYYTLICALCFVNFVYFLYCSKSYGPC  563

Query  193  KDE  185
            K+ 
Sbjct  564  KNR  566



>gb|KJB27309.1| hypothetical protein B456_004G290200 [Gossypium raimondii]
Length=577

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 112/182 (62%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YD++ LP+AS+I+G  V  G K RMG G+  S    V    VE  RR +AI++  S
Sbjct  377  WIAFYDQIALPLASKIKGQPVRLGLKQRMGIGLLCSCASMVASAFVECTRRKIAIEEGFS  436

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +      MS LWV+P Y L G++   NA+A  +F  S  P++MSTIA+ +  LG    +
Sbjct  437  DEPQAVVHMSALWVLPFYVLAGLSEAFNAIALIEFCYSNLPKTMSTIAANVNELGGFTGN  496

Query  361  llmsSINELSIN---SGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            L+ S I  +  N    G  SW++S++N+GHYDY+Y +LAGLSM+NF+ FL+C +++GP  
Sbjct  497  LVASLITSMVDNVTKKGGESWVSSNMNKGHYDYYYCLLAGLSMLNFVYFLVCCKAHGPCH  556

Query  190  DE  185
             +
Sbjct  557  GD  558



>gb|KJB27307.1| hypothetical protein B456_004G290100 [Gossypium raimondii]
Length=583

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 115/184 (63%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+ LP+AS+I+G  V  G K RMG G+  S    V    +E  RR +AI++  S
Sbjct  383  WIPFYDRIALPLASKIKGKPVRLGLKQRMGIGLLCSGSSMVASAIIEYTRRKIAIEEGLS  442

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +      MS LW++P Y L G+A   N + Q +F  SE P++MSTIA+ +Y  G  +++
Sbjct  443  DEPAAVVHMSALWILPFYILGGLAEPFNGIGQIEFCYSELPKTMSTIAANIYGFGTFISN  502

Query  361  llmsSINELSIN---SGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            L+ S I  +  N    G  SWI+S++N+GHYDY+Y +LAGLSM+NF+ FL C ++YGP  
Sbjct  503  LVASFITSMVDNVTKRGGESWISSNMNKGHYDYYYCLLAGLSMLNFIYFLACCKAYGPCH  562

Query  190  -DEK  182
             D+K
Sbjct  563  GDDK  566



>gb|KCW69640.1| hypothetical protein EUGRSUZ_F03048 [Eucalyptus grandis]
Length=533

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 116/180 (64%), Gaps = 4/180 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++LYDR++LP+AS++RG  V  G K RMG G+ +S    V+   VE +RR  A+++   
Sbjct  309  WVILYDRVVLPLASKVRGKPVRLGVKLRMGIGLLLSCMAMVVSAIVEHVRRKRALEEGLR  368

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             +      MS +W+VPQY L G A    A+ Q +F+ SEFPRSMS+IA+ L     A+  
Sbjct  369  ENPRAVVGMSAMWLVPQYCLNGFAEAFTAIGQTEFYYSEFPRSMSSIAACLFGLGMAVAN  428

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS ++S+++ L+  +   SW++S+INEG YD +YW+LA +S++N + FL CS  YGP 
Sbjct  429  LLASAIVSAVDSLTSGTTRISWVSSNINEGRYDNYYWLLAIMSLLNVVYFLFCSWMYGPC  488



>ref|XP_010668239.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Beta vulgaris subsp. 
vulgaris]
Length=565

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 121/191 (63%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI +YD +++P+A+++ G   H   ++RMG G+ +SF   V +  +E +RR  AIK+  S
Sbjct  371  WIAIYDLIVIPLATKLFGKRAHLSARTRMGIGLLLSFVSMVAMAIIERVRRETAIKEGFS  430

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             +  G + MS LW++  +   G+A     V Q++FF SEFP+SM ++A+ L     +L  
Sbjct  431  DNPNGVTHMSALWLLLHHWFSGMAEAFFVVGQSEFFCSEFPKSMLSVATNLNGVGMSLAS  490

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
              AS+L++ IN ++   G  SW++S+IN+ H+DY+YWV+  LS++NF  +LIC+++YG S
Sbjct  491  VFASILLNGINYITSKDGQESWVSSNINKAHFDYYYWVITALSLLNFFYYLICNKAYGTS  550

Query  193  KDEKPVAMEED  161
             DE+     ED
Sbjct  551  SDEQDDNFNED  561



>gb|KHN47833.1| Putative peptide transporter [Glycine soja]
Length=593

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 113/183 (62%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR+++P+AS++RG  V    K RMG G+  SF +      VE+ RR  AI++ H 
Sbjct  373  WVALYDRVIIPIASKLRGKPVRISAKRRMGIGLVFSFLHLATAAIVENTRRRRAIREGHI  432

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D      MS +W+VPQ  L G+A   NA+ QN+F+ +EFPR+MS+IA+ L+ LG +  +
Sbjct  433  DDTNAVLNMSAMWLVPQLCLSGMAEAFNAIGQNEFYYTEFPRTMSSIAACLFGLGMAAGN  492

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            +L S I      ++   G   W+  +IN+G YD +Y VLA L+ VN L +L+CS +Y P+
Sbjct  493  VLSSLIFSIVENVTSRGGKQGWVLDNINKGSYDRYYCVLASLAAVNILYYLVCSWAYVPT  552

Query  193  KDE  185
             D+
Sbjct  553  VDQ  555



>ref|XP_007012104.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY29723.1| Major facilitator superfamily protein [Theobroma cacao]
Length=585

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 116/192 (60%), Gaps = 3/192 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+ LP+AS+++G  V  G K R G GI  S    V +  VE IRR +AI++  S
Sbjct  385  WIAFYDRIALPLASKMKGKPVRLGLKQRTGIGILCSCASMVALAIVEYIRREIAIQEGLS  444

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +      MS LW++P   L G+A     V Q +FF +E P++MS+I S L+ LG  +AS
Sbjct  445  DEPQAMVHMSALWLLPYNVLSGLAEAFAGVGQIEFFYAELPKTMSSIGSNLFGLGAFVAS  504

Query  361  llmsSINEL---SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            L+ S I          G  SW++S++N+GHYDY+YW+L GLS++NF+ FL CS++YGP +
Sbjct  505  LVASFITSAVDDVTKRGGESWVSSNVNKGHYDYYYWLLFGLSILNFMYFLACSKAYGPCR  564

Query  190  DEKPVAMEED*R  155
             +  V  +   R
Sbjct  565  GDDEVQSQATRR  576



>ref|XP_003531668.2| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Glycine max]
Length=610

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 113/183 (62%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR+++P+AS++RG  V    K RMG G+  SF +      VE+ RR  AI++ H 
Sbjct  390  WVALYDRVIIPIASKLRGKPVRISAKRRMGIGLVFSFLHLATAAIVENTRRRRAIREGHI  449

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D      MS +W+VPQ  L G+A   NA+ QN+F+ +EFPR+MS+IA+ L+ LG +  +
Sbjct  450  DDTNAVLNMSAMWLVPQLCLSGMAEAFNAIGQNEFYYTEFPRTMSSIAACLFGLGMAAGN  509

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            +L S I      ++   G   W+  +IN+G YD +Y VLA L+ VN L +L+CS +Y P+
Sbjct  510  VLSSLIFSIVENVTSRGGKQGWVLDNINKGSYDRYYCVLASLAAVNILYYLVCSWAYVPT  569

Query  193  KDE  185
             D+
Sbjct  570  VDQ  572



>gb|KEH41919.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=503

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 116/183 (63%), Gaps = 12/183 (7%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WIV YDR+L+P+AS+IRG  V    K RMG G+F+SF Y+V     E+IRR  A      
Sbjct  325  WIVFYDRVLIPLASKIRGKPVKISAKKRMGIGLFLSFLYSVNAAIFETIRRRNA------  378

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
              N G  +MS LW+ PQ  L GI+   N + QN+F+ +EFP +MS++A++L  LG +  S
Sbjct  379  --NNGVLEMSALWLAPQLCLAGISEAVNFIGQNEFYYTEFPSTMSSVAASLSGLGMAAGS  436

Query  361  llmsSINELSINS----GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S +  +  N+    G   WI+ DIN+GH+D + W++AG+S  N L ++ICS +YGP+
Sbjct  437  LVSSLLFSIVENTTSRGGKDGWISDDINKGHFDKYSWLIAGISAFNILYYIICSWAYGPA  496

Query  193  KDE  185
             +E
Sbjct  497  VEE  499



>gb|KEH41920.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=574

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 116/183 (63%), Gaps = 12/183 (7%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WIV YDR+L+P+AS+IRG  V    K RMG G+F+SF Y+V     E+IRR  A      
Sbjct  396  WIVFYDRVLIPLASKIRGKPVKISAKKRMGIGLFLSFLYSVNAAIFETIRRRNA------  449

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
              N G  +MS LW+ PQ  L GI+   N + QN+F+ +EFP +MS++A++L  LG +  S
Sbjct  450  --NNGVLEMSALWLAPQLCLAGISEAVNFIGQNEFYYTEFPSTMSSVAASLSGLGMAAGS  507

Query  361  llmsSINELSINS----GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S +  +  N+    G   WI+ DIN+GH+D + W++AG+S  N L ++ICS +YGP+
Sbjct  508  LVSSLLFSIVENTTSRGGKDGWISDDINKGHFDKYSWLIAGISAFNILYYIICSWAYGPA  567

Query  193  KDE  185
             +E
Sbjct  568  VEE  570



>ref|XP_010062498.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Eucalyptus grandis]
Length=601

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 116/180 (64%), Gaps = 4/180 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++LYDR++LP+AS++RG  V  G K RMG G+ +S    V+   VE +RR  A+++   
Sbjct  377  WVILYDRVVLPLASKVRGKPVRLGVKLRMGIGLLLSCMAMVVSAIVEHVRRKRALEEGLR  436

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             +      MS +W+VPQY L G A    A+ Q +F+ SEFPRSMS+IA+ L     A+  
Sbjct  437  ENPRAVVGMSAMWLVPQYCLNGFAEAFTAIGQTEFYYSEFPRSMSSIAACLFGLGMAVAN  496

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS ++S+++ L+  +   SW++S+INEG YD +YW+LA +S++N + FL CS  YGP 
Sbjct  497  LLASAIVSAVDSLTSGTTRISWVSSNINEGRYDNYYWLLAIMSLLNVVYFLFCSWMYGPC  556



>ref|XP_004235680.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Solanum lycopersicum]
Length=597

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 118/182 (65%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YDR++LP+AS+IRG  V      RMG GIF+S    V+ G VE +RR  AI Q   
Sbjct  398  WVFFYDRMMLPLASKIRGRPVRLKPIVRMGIGIFISCMSMVVSGIVEHVRRRKAINQGLL  457

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +++ G  +MS LW++   +L GIA   +A+   +F+ SE P+SMS+IAS L     A+  
Sbjct  458  NNSQGLVEMSALWLIIPNSLNGIAEAFSAIGSTEFYYSELPKSMSSIASALLGLGMAVAS  517

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S++++ +   G  SW++S+IN+GHY+Y+YW+LA L+  N L F+ C R YGPS
Sbjct  518  LLASVILSAVDKYTKGEGTESWVSSNINKGHYEYYYWLLAVLTAFNLLYFVACCRQYGPS  577

Query  193  KD  188
             D
Sbjct  578  AD  579



>ref|XP_006486908.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X4 [Citrus sinensis]
Length=479

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 118/190 (62%), Gaps = 4/190 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YDR+LLP+AS+I+G       K RMG G+  S          E++RR +AI +  S
Sbjct  282  WVGFYDRILLPLASKIKGKPCQLSLKQRMGIGLLFSTASMAAWAITETVRRRIAIDEGLS  341

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D     +MS +W++P   L G+A+  N + Q +F+ SE P+SMS+IAS       +   
Sbjct  342  DDPRAVVQMSAMWLLPYLVLSGLAMAFNMIGQTEFYYSELPKSMSSIASAFLGVGMSAAS  401

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +ASL+M+++++++ + G   WI S+IN+GHYD+++W+L+ L+M NF+ FL C ++YGP 
Sbjct  402  LVASLIMNAVDDVTRSGGKQGWIPSNINKGHYDHYFWLLSALNMANFVYFLACCKAYGPC  461

Query  193  KDEKPVAMEE  164
            + E   A+++
Sbjct  462  RVEVHKALDD  471



>ref|XP_006486906.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486907.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X3 [Citrus sinensis]
Length=585

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 118/190 (62%), Gaps = 4/190 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YDR+LLP+AS+I+G       K RMG G+  S          E++RR +AI +  S
Sbjct  388  WVGFYDRILLPLASKIKGKPCQLSLKQRMGIGLLFSTASMAAWAITETVRRRIAIDEGLS  447

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D     +MS +W++P   L G+A+  N + Q +F+ SE P+SMS+IAS       +   
Sbjct  448  DDPRAVVQMSAMWLLPYLVLSGLAMAFNMIGQTEFYYSELPKSMSSIASAFLGVGMSAAS  507

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +ASL+M+++++++ + G   WI S+IN+GHYD+++W+L+ L+M NF+ FL C ++YGP 
Sbjct  508  LVASLIMNAVDDVTRSGGKQGWIPSNINKGHYDHYFWLLSALNMANFVYFLACCKAYGPC  567

Query  193  KDEKPVAMEE  164
            + E   A+++
Sbjct  568  RVEVHKALDD  577



>ref|XP_006486905.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Citrus sinensis]
Length=585

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 118/190 (62%), Gaps = 4/190 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YDR+LLP+AS+I+G       K RMG G+  S          E++RR +AI +  S
Sbjct  388  WVGFYDRILLPLASKIKGKPCQLSLKQRMGIGLLFSTASMAAWAITETVRRRIAIDEGLS  447

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D     +MS +W++P   L G+A+  N + Q +F+ SE P+SMS+IAS       +   
Sbjct  448  DDPRAVVQMSAMWLLPYLVLSGLAMAFNMIGQTEFYYSELPKSMSSIASAFLGVGMSAAS  507

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +ASL+M+++++++ + G   WI S+IN+GHYD+++W+L+ L+M NF+ FL C ++YGP 
Sbjct  508  LVASLIMNAVDDVTRSGGKQGWIPSNINKGHYDHYFWLLSALNMANFVYFLACCKAYGPC  567

Query  193  KDEKPVAMEE  164
            + E   A+++
Sbjct  568  RVEVHKALDD  577



>ref|XP_010047267.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 1.2 
[Eucalyptus grandis]
Length=591

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 120/183 (66%), Gaps = 5/183 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            ++ LY+R+ L +AS I G  V+   K RMG G+ +S +   ++  VES+RR +A ++EH 
Sbjct  392  FVALYNRVFLRLASAIIGKPVYPSLKQRMGSGLAISIFATSVLAIVESVRRRVATEEEHL  451

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgysl--  368
             D +G  KMS +W++  Y L+GIA G NA+AQNQF+  E P++MS++A+TL+ +  ++  
Sbjct  452  -DGMGVVKMSAMWLLLYYILIGIAEGFNAIAQNQFYYLELPKTMSSVAATLFGVSMAVGN  510

Query  367  -asllmsSINELSINSGN-GSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
              + L+ SI +L    G    W+ SDIN+GHYDY++WV+   S +NF+ FL C ++YGP 
Sbjct  511  LVASLIISIVQLVTERGEMEGWVGSDINKGHYDYYFWVITCFSTLNFVYFLACGKAYGPC  570

Query  193  KDE  185
            K E
Sbjct  571  KGE  573



>ref|XP_010318544.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Solanum 
lycopersicum]
Length=623

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 118/182 (65%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR++LP+AS+IRG  V      RMG GIFVS    ++ G +E IRR  AI Q   
Sbjct  406  WVFLYDRVMLPLASKIRGRPVRLKPIVRMGLGIFVSCMSMLVSGIIEHIRRRRAINQGLL  465

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +++ G  +MS LW++   +L GIA   NA+   +F+ SE P+SMS+IAS L     A+  
Sbjct  466  NNSQGLVEMSALWLIIPNSLNGIAEALNAIGATEFYYSELPKSMSSIASALLGLGMAVAN  525

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S++++ +   G  SWI+S+IN+GHY+Y+YW+LA L+  N L F+ C   YGPS
Sbjct  526  LLASVILSAVDKYTKGKGKESWISSNINKGHYEYYYWLLALLTAFNLLYFMACCWQYGPS  585

Query  193  KD  188
             D
Sbjct  586  VD  587



>ref|XP_004235682.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X3 [Solanum 
lycopersicum]
Length=616

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 118/182 (65%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR++LP+AS+IRG  V      RMG GIFVS    ++ G +E IRR  AI Q   
Sbjct  399  WVFLYDRVMLPLASKIRGRPVRLKPIVRMGLGIFVSCMSMLVSGIIEHIRRRRAINQGLL  458

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +++ G  +MS LW++   +L GIA   NA+   +F+ SE P+SMS+IAS L     A+  
Sbjct  459  NNSQGLVEMSALWLIIPNSLNGIAEALNAIGATEFYYSELPKSMSSIASALLGLGMAVAN  518

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S++++ +   G  SWI+S+IN+GHY+Y+YW+LA L+  N L F+ C   YGPS
Sbjct  519  LLASVILSAVDKYTKGKGKESWISSNINKGHYEYYYWLLALLTAFNLLYFMACCWQYGPS  578

Query  193  KD  188
             D
Sbjct  579  VD  580



>ref|XP_010318543.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X1 [Solanum 
lycopersicum]
Length=615

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 118/182 (65%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR++LP+AS+IRG  V      RMG GIFVS    ++ G +E IRR  AI Q   
Sbjct  398  WVFLYDRVMLPLASKIRGRPVRLKPIVRMGLGIFVSCMSMLVSGIIEHIRRRRAINQGLL  457

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +++ G  +MS LW++   +L GIA   NA+   +F+ SE P+SMS+IAS L     A+  
Sbjct  458  NNSQGLVEMSALWLIIPNSLNGIAEALNAIGATEFYYSELPKSMSSIASALLGLGMAVAN  517

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S++++ +   G  SWI+S+IN+GHY+Y+YW+LA L+  N L F+ C   YGPS
Sbjct  518  LLASVILSAVDKYTKGKGKESWISSNINKGHYEYYYWLLALLTAFNLLYFMACCWQYGPS  577

Query  193  KD  188
             D
Sbjct  578  VD  579



>emb|CBI20867.3| unnamed protein product [Vitis vinifera]
Length=1181

 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 111/184 (60%), Gaps = 4/184 (2%)
 Frame = -1

Query  721   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
             W+ +YD LL+P+ +R  G       K RMG G+ +S     +    E IRR +A KQ   
Sbjct  978   WLPVYDCLLVPILARYTGQLRGLSPKVRMGIGLVLSCMAMAVAAATEMIRRRIATKQGLE  1037

Query  541   SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIa----stlyalgy  374
                     MS LW++PQY L+G+A   N + QN+F+ S+FP+SMS++A    +   AL  
Sbjct  1038  DQPAATVNMSALWLLPQYVLLGLAEAFNGIGQNEFYYSQFPKSMSSLAGALFTLGLALSS  1097

Query  373   slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
                SLL++ +N ++   G  SW++S++N+GH DY+Y ++A L M+NF+ FL+C R YGP 
Sbjct  1098  FAGSLLVNVVNSVTTKGGKESWLSSNLNKGHLDYYYGLIAVLGMINFIYFLVCCRLYGPC  1157

Query  193   KDEK  182
             +DEK
Sbjct  1158  EDEK  1161


 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 116/191 (61%), Gaps = 6/191 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKV-ESIRRSLAIKQEH  545
            WI +YD +L+P+ +R  G       K RMG G+ +S   A+ VG + ES+RR +A +Q  
Sbjct  387  WIPIYDIVLVPILARYTGCPRGLSMKFRMGIGLVLS-CVAMAVGAITESVRRRIANEQGL  445

Query  544  SSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyal----g  377
                     MS +W++PQ+ L G A   +A+ Q +F+ S+F +SMS+IA  L+ +     
Sbjct  446  DEQPAATLNMSAMWLLPQFILFGFAEAFSAIGQIEFYYSQFSKSMSSIAVALFTVGIAGS  505

Query  376  yslasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  197
              + SLL++ +N ++   G  SW++S++N+GH DY+YW++  L ++N + FL+C  SYGP
Sbjct  506  NLVGSLLVNVVNSVTSKGGKESWLSSNLNKGHLDYYYWLITILCLINIIYFLVCCWSYGP  565

Query  196  SKDEKPVAMEE  164
             +DEKP   +E
Sbjct  566  FEDEKPGISDE  576



>gb|KHG04534.1| hypothetical protein F383_29859 [Gossypium arboreum]
Length=580

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 115/180 (64%), Gaps = 4/180 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++ YDR +LP+AS+I+G  V  G K RMG G+F++    V+   VE+ RR  AI+    
Sbjct  388  WVIFYDRAILPMASKIKGKPVRIGVKLRMGIGLFLTCIAMVVSAIVENARRKEAIRSGFQ  447

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++     KMS +W+VPQ+ L G A    A+ Q +FF SE P+SMS+IA+ L     A+  
Sbjct  448  NNPTAVVKMSAMWLVPQFCLNGFAEAFTAIGQTEFFYSELPKSMSSIAAALFGLGLAVAN  507

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S I++++   G  SW++S+IN+G  D +YWVLA LS +N   + +C+ +YGP+
Sbjct  508  VLASVVVSIIDDITSKGGKESWVSSNINKGRIDNYYWVLAILSFINLFYYFLCAWAYGPT  567



>ref|XP_006486909.1| PREDICTED: probable peptide transporter At1g52190-like [Citrus 
sinensis]
Length=585

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 117/190 (62%), Gaps = 4/190 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YDR+LLP+AS+I+G       K RMG G+  S          E++RR +AI +  S
Sbjct  388  WVGFYDRILLPLASKIKGKPCQLSLKQRMGIGLLFSTASMAAWAITETVRRRIAIDEGLS  447

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D     +MS +W++P   L G+A+  N + Q +F+ SE P+SMS+IAS L  +G S AS
Sbjct  448  DDPRAVVQMSAMWLLPYLVLSGLAMAFNMIGQTEFYYSELPKSMSSIASALLGVGLSAAS  507

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    + ++ + G   WI S+IN+GHYD+++W+L+ L+M NF+ FL C ++YGP 
Sbjct  508  LVASLIMNSVDGITRSRGKQGWIPSNINKGHYDHYFWLLSALNMANFVYFLACCKAYGPC  567

Query  193  KDEKPVAMEE  164
            + E   A+++
Sbjct  568  RVEVHKALDD  577



>gb|KJB56778.1| hypothetical protein B456_009G135700 [Gossypium raimondii]
Length=579

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 115/180 (64%), Gaps = 4/180 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++ YDR +LP+AS+I+G  V  G K RMG G+F++    V+   VE+ RR  AI+    
Sbjct  388  WVIFYDRAILPMASKIKGKPVRIGVKLRMGIGLFLTCIAMVVSAIVENARRKEAIRSGFQ  447

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++     KMS +W+VPQ+ L G A    A+ Q +FF SE P+SMS+IA+ L     A+  
Sbjct  448  NNPTAVVKMSAMWLVPQFCLNGFAEAFTAIGQTEFFYSELPKSMSSIAAALFGLGLAVAN  507

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S I++++   G  SW++S+IN+G  D +YWVLA LS +N   + +C+ +YGP+
Sbjct  508  VLASVVVSIIDDITSKGGKESWVSSNINKGRIDNYYWVLAILSFINLFYYFLCAWAYGPT  567



>ref|XP_006422797.1| hypothetical protein CICLE_v10029786mg, partial [Citrus clementina]
 gb|ESR36037.1| hypothetical protein CICLE_v10029786mg, partial [Citrus clementina]
Length=584

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 117/190 (62%), Gaps = 4/190 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YDR+LLP+AS+I+G       K RMG G+  S          E++RR +AI +  S
Sbjct  388  WVGFYDRILLPLASKIKGKPCQLSLKQRMGIGLLFSTASMAAWAITETVRRRIAIDEGLS  447

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D     +MS +W++P   L G+A+  N + Q +F+ SE P+SMS+IAS L  +G S AS
Sbjct  448  DDPRAVVQMSAMWLLPYLVLSGLAMAFNMIGQTEFYYSELPKSMSSIASALLGVGLSAAS  507

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    + ++ + G   WI S+IN+GHYD+++W+L+ L+M NF+ FL C ++YGP 
Sbjct  508  LVASLIMNSVDGITRSRGKQGWIPSNINKGHYDHYFWLLSALNMANFVYFLACCKAYGPC  567

Query  193  KDEKPVAMEE  164
            + E   A+++
Sbjct  568  RVEVHKALDD  577



>ref|XP_009783586.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana sylvestris]
Length=613

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 119/182 (65%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR+LLP+AS+IRG  V      RMG GIF+S    ++ G VE +RR  AI Q   
Sbjct  400  WVFLYDRMLLPLASKIRGRPVRLTPIVRMGIGIFISCMSMLVSGIVEHVRRRRAINQGLL  459

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++  G  +MS +W++ Q +L GIA   +A+ Q +F+ SE PRSMS++AS L     A+  
Sbjct  460  NNPEGLVEMSAMWLILQNSLNGIAEAFSAIGQTEFYYSELPRSMSSLASALLGLGMAVAN  519

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S++++ +   G  SW++S IN+GHY+Y+YW+LA ++  N + F++C  +YGP 
Sbjct  520  LLASVILSAVDKHTKGEGKESWVSSSINKGHYEYYYWLLAIMTAFNLIYFMVCKWAYGPC  579

Query  193  KD  188
             D
Sbjct  580  VD  581



>ref|XP_006422799.1| hypothetical protein CICLE_v10028344mg [Citrus clementina]
 gb|ESR36039.1| hypothetical protein CICLE_v10028344mg [Citrus clementina]
Length=479

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 115/189 (61%), Gaps = 4/189 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YDR+LLP+AS+I+G       K RMG G+  S          E++RR +AI +  S
Sbjct  282  WVGFYDRILLPLASKIKGKPCQLSLKQRMGIGLLFSTASMAAWAITETVRRRIAIDEGLS  341

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D     +MS +W++P   L G+A+  N + Q +F+ SE P+SMS+IAS    +G S AS
Sbjct  342  DDPRAVVQMSAMWLLPYLVLSGLAMAFNMIGQTEFYYSELPKSMSSIASAYLGVGLSAAS  401

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    + ++ + G   WI S+IN+GHYD+++W+L+ L+M NF+ FL C ++YGP 
Sbjct  402  LVASLIMNSVDGITRSRGKQGWIPSNINKGHYDHYFWLLSALNMANFVYFLACCKAYGPC  461

Query  193  KDEKPVAME  167
            + E   A++
Sbjct  462  RVEVHKALD  470



>ref|XP_009628045.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
Length=613

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 119/182 (65%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR++LP+AS+IRG  V      RMG GIFVS    ++ G VE +RR  AI Q   
Sbjct  400  WVFLYDRVMLPLASKIRGRPVRLTPIVRMGIGIFVSCMSMLVSGIVEHVRRRRAINQGLL  459

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++  G  +MS +W++ Q +L GIA   +A+ Q +F+ SE PRSMS++AS L     A+  
Sbjct  460  NNPDGLVEMSAMWLILQNSLNGIAEAFSAIGQTEFYYSELPRSMSSLASALLGLGMAVAN  519

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S++++ +   G  SW++S IN+GHY+Y+YW+LA ++  N L F++C  +YGP 
Sbjct  520  LLASVILSAVDKHTKGEGKESWVSSSINKGHYEYYYWLLAIMTAFNMLYFMVCKWAYGPC  579

Query  193  KD  188
             D
Sbjct  580  VD  581



>ref|XP_006422795.1| hypothetical protein CICLE_v10029930mg, partial [Citrus clementina]
 gb|ESR36035.1| hypothetical protein CICLE_v10029930mg, partial [Citrus clementina]
Length=584

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 117/190 (62%), Gaps = 4/190 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YDR+LLP+AS+I+G       K RMG G+  S          E++RR +AI +  S
Sbjct  388  WVGFYDRILLPLASKIKGKPCQLSLKQRMGIGLLFSTASMAAWAITETVRRRIAIDEGLS  447

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D     +MS +W++P   L G+A+  N + Q +F+ SE P+SMS+IAS L  +G S AS
Sbjct  448  DDPRTVVQMSAMWLLPYLVLSGLAMAFNMIGQTEFYYSELPKSMSSIASALLGVGLSAAS  507

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    + ++ + G   WI S+IN+GHYD+++W+L+ L+M NF+ FL C ++YGP 
Sbjct  508  LVASLIMNSVDGITRSRGKQGWIPSNINKGHYDHYFWLLSALNMANFVYFLACCKAYGPC  567

Query  193  KDEKPVAMEE  164
            + E   A+++
Sbjct  568  RVEVHKALDD  577



>ref|XP_007024218.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY26840.1| Major facilitator superfamily protein [Theobroma cacao]
Length=605

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 116/183 (63%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++LYDR +LP+AS+I+G  V  G K RMG G+F++    V+   VE+ RR  AI+    
Sbjct  386  WVILYDRAILPMASKIKGKPVRLGVKLRMGIGLFLTCMAMVVSAIVENARRRKAIRDGFL  445

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             +      MS +W+ PQ+ L G+A    A+ Q +FF SE P+SMS+IA+ L     A+  
Sbjct  446  DNPRAVLDMSAMWLAPQFCLNGLAEAFTAIGQTEFFYSEVPKSMSSIAAALFGLGLAVAN  505

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S I++++   G  SW++S+IN+G  D +YWVLA LS +N L + +C+ +YGP 
Sbjct  506  LLASVVVSIIDDITSRGGKESWVSSNINKGRIDNYYWVLAVLSFINLLYYFVCAWAYGPC  565

Query  193  KDE  185
             ++
Sbjct  566  GEQ  568



>ref|XP_006343082.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Solanum tuberosum]
Length=552

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 119/182 (65%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++LYDR++LP+AS+I+G  V      RMG GIFVS    V+ G +E+IRR  AI +   
Sbjct  356  WVLLYDRVMLPLASKIKGRPVRLKPIVRMGLGIFVSCMSMVVSGIIENIRRRRAISEGLL  415

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +++ G  +MS  W++   +L GIA   NA+   +F+ SE PRS+S+IAS L     A+  
Sbjct  416  NNSQGLVEMSAFWLIIPNSLNGIAKALNAIGATEFYYSELPRSLSSIASALLGLGMAVAS  475

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S++++ +   G  SW++S+IN+GHY+Y+YW+LA L+  N + F+ C   YGPS
Sbjct  476  LLASVILSAVDKYTKGEGTESWVSSNINKGHYEYYYWLLAVLTAFNLIYFVACCSQYGPS  535

Query  193  KD  188
             D
Sbjct  536  VD  537



>gb|KHG18966.1| hypothetical protein F383_07419 [Gossypium arboreum]
Length=577

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 110/182 (60%), Gaps = 3/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YD++ LP+AS+I+G  V    K RMG G+  S    V    VE  RR +A ++  S
Sbjct  377  WIAFYDQIALPLASKIKGKPVRLSLKQRMGIGLLCSCASMVASAFVECTRRKIATEEGFS  436

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +      MS LWV+P Y L G++   NA+A  +F  S  P++MSTIA+ +  LG    +
Sbjct  437  DEPQAVVHMSALWVLPFYVLAGLSEAFNAIALIEFCYSNLPKTMSTIAANVSGLGGFTGN  496

Query  361  llmsSINELSIN---SGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            L+ S I  +  N    G  SW++S++N+GHYDY+Y +LAGLSM+NF+ FL+C +++GP  
Sbjct  497  LVASLITSMVDNVTKKGGESWVSSNMNKGHYDYYYCLLAGLSMLNFVYFLVCCKAHGPCH  556

Query  190  DE  185
             +
Sbjct  557  GD  558



>ref|XP_010320606.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Solanum 
lycopersicum]
Length=556

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 111/182 (61%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+L+P+ S+  G         RMG G+ V+     L    ESIRR LAI++ H 
Sbjct  356  WITFYDRVLVPLLSKYTGQPRGLSPVIRMGIGLIVTCMSMALSAITESIRRQLAIEEGHE  415

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS +W+VPQYAL+G+A GS++V Q +FF S  P+SMS++AS +     A+  
Sbjct  416  DDPSALVNMSAMWLVPQYALLGVAEGSHSVGQIEFFYSLLPKSMSSMASAMYTVGTAVSS  475

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             + S+L+S ++ LS   G  SW++S+IN GH DY++W+L  LS++NF  FL+  R Y P 
Sbjct  476  LVVSILVSGVDWLSSTGGKTSWLSSNINRGHLDYYFWLLTFLSLLNFFYFLLICRLYEPD  535

Query  193  KD  188
             D
Sbjct  536  ND  537



>ref|XP_010254052.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Nelumbo nucifera]
Length=588

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 120/191 (63%), Gaps = 6/191 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+++YDR++LP+  ++ G       K RMG G+ +S     +   VE +RR  AI+Q  S
Sbjct  378  WVIVYDRVVLPLLKKLTGKPHRLSVKQRMGIGLVLSCVAMAVSAVVEKVRRRAAIRQGLS  437

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
                    MS +W+V Q+ L G+A   NA+ Q +F+ S+ P+SMS+IA+ L     A+  
Sbjct  438  DQPQAIVDMSAMWLVAQHCLTGLAEAFNAIGQMEFYYSQLPKSMSSIATALFGLGMAIAN  497

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++ +++E++   G  SW++S++N+GHYDY+YW+LA +  VNFL FL+CS +YG S
Sbjct  498  LLASVIVKAVDEVTKRGGKESWVSSNLNKGHYDYYYWLLAVMGSVNFLYFLVCSWAYGSS  557

Query  193  KDEKPVAMEED  161
              E+PV  + +
Sbjct  558  --EEPVMRDSN  566



>ref|XP_004239355.2| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X1 [Solanum 
lycopersicum]
Length=575

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 111/182 (61%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+L+P+ S+  G         RMG G+ V+     L    ESIRR LAI++ H 
Sbjct  375  WITFYDRVLVPLLSKYTGQPRGLSPVIRMGIGLIVTCMSMALSAITESIRRQLAIEEGHE  434

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS +W+VPQYAL+G+A GS++V Q +FF S  P+SMS++AS +     A+  
Sbjct  435  DDPSALVNMSAMWLVPQYALLGVAEGSHSVGQIEFFYSLLPKSMSSMASAMYTVGTAVSS  494

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             + S+L+S ++ LS   G  SW++S+IN GH DY++W+L  LS++NF  FL+  R Y P 
Sbjct  495  LVVSILVSGVDWLSSTGGKTSWLSSNINRGHLDYYFWLLTFLSLLNFFYFLLICRLYEPD  554

Query  193  KD  188
             D
Sbjct  555  ND  556



>ref|XP_006343081.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=617

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 120/182 (66%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++LYDR++LP+AS+I+G  V      RMG GIFVS    V+ G +E+IRR  AI +   
Sbjct  398  WVLLYDRVMLPLASKIKGRPVRLKPIVRMGLGIFVSCMSMVVSGIIENIRRRRAISEGLL  457

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +++ G  +MS +W++   +L GIA   NA+   +F+ SE P+SMS+IAS L     A+  
Sbjct  458  NNSQGLVEMSAMWLIIPNSLNGIAEALNAIGATEFYYSELPKSMSSIASALLGLGMAVAN  517

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S++++ +   G  SWI+S+IN GHY+Y+YW+LA ++  N L F++C   YGPS
Sbjct  518  LLASVVLSAVDKYTKGEGKESWISSNINRGHYEYYYWLLALMTGFNLLYFVVCCWQYGPS  577

Query  193  KD  188
             D
Sbjct  578  VD  579



>ref|XP_010042085.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like, partial [Eucalyptus 
grandis]
Length=514

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 118/184 (64%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI +YDR+L+P+ASR+         K RMG G+ +S     +   VE  RR+ AI++  +
Sbjct  308  WIGIYDRILVPLASRLTNRPHGLTLKERMGIGLLISSLAMFVSAAVEHKRRTEAIREGFA  367

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +  G  KMS  W+VPQ+ L+G+A   NA+ Q  F+ S+FP+SM++IA  L  LG ++ +
Sbjct  368  ENPNGVLKMSAKWIVPQHCLIGLAEAFNAIGQINFYYSKFPKSMASIAVALLTLGMAVGN  427

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    + LS  S +G+W+++++N+GHYDY+YW+L GLS++NF  +L C+ +Y   
Sbjct  428  LVASLIVTILDRLSKGSRDGTWLSTNVNKGHYDYYYWILGGLSVINFFYYLACAWAYEGG  487

Query  193  KDEK  182
            ++ K
Sbjct  488  EERK  491



>ref|XP_004506900.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X3 [Cicer arietinum]
Length=479

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 114/182 (63%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS+I G  V    K+R+G G+F SF + V    VE+IRR  AI + + 
Sbjct  278  WIALYDRVVIPLASKIIGKPVRISAKTRIGLGLFFSFLHLVTAAIVETIRRRRAIDEGYG  337

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS +W+ PQ  L GIA   NA+ QN+F+ +EFP++MS+IAS+L     A+GY
Sbjct  338  EDPHAVLNMSAMWLFPQLCLGGIAEAFNAIGQNEFYYTEFPKTMSSIASSLFGLGMAVGY  397

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             ++SLL   +  ++   G   WI  +IN+G +D +YWV+A +S VN L +L+CS +Y   
Sbjct  398  VMSSLLFGIVESVTSKGGKDGWILDNINKGRFDKYYWVIAAVSGVNILYYLVCSWAYETP  457

Query  193  KD  188
             D
Sbjct  458  AD  459



>ref|XP_007135665.1| hypothetical protein PHAVU_010G148000g [Phaseolus vulgaris]
 gb|ESW07659.1| hypothetical protein PHAVU_010G148000g [Phaseolus vulgaris]
Length=582

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 114/183 (62%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR ++P+AS++ G  V    K RMG G+  S  +      VE+ RR  AIK+ H 
Sbjct  386  WLALYDRAIIPLASKLIGKPVRISAKRRMGIGLGFSLLHFSTAAIVETTRRRRAIKEGHV  445

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +D      MS +W+VPQ  L G+A   NA+ QN+F+ +EFP +MS+IAS L     A G 
Sbjct  446  NDVHAVLNMSGMWLVPQLFLAGMAEAFNAIGQNEFYYTEFPSTMSSIASCLFGLGMAAGS  505

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            +L+SL+ S++  ++   G   WI  +IN+G YD +YWVLA L+ VN L +L+CS +YGP+
Sbjct  506  ALSSLIFSTVEHVTSRGGKEGWILDNINKGRYDKYYWVLALLNAVNILYYLVCSWAYGPT  565

Query  193  KDE  185
             D+
Sbjct  566  HDQ  568



>ref|XP_004506898.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Cicer arietinum]
 ref|XP_004506899.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Cicer arietinum]
Length=591

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 114/182 (63%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS+I G  V    K+R+G G+F SF + V    VE+IRR  AI + + 
Sbjct  390  WIALYDRVVIPLASKIIGKPVRISAKTRIGLGLFFSFLHLVTAAIVETIRRRRAIDEGYG  449

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS +W+ PQ  L GIA   NA+ QN+F+ +EFP++MS+IAS+L     A+GY
Sbjct  450  EDPHAVLNMSAMWLFPQLCLGGIAEAFNAIGQNEFYYTEFPKTMSSIASSLFGLGMAVGY  509

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             ++SLL   +  ++   G   WI  +IN+G +D +YWV+A +S VN L +L+CS +Y   
Sbjct  510  VMSSLLFGIVESVTSKGGKDGWILDNINKGRFDKYYWVIAAVSGVNILYYLVCSWAYETP  569

Query  193  KD  188
             D
Sbjct  570  AD  571



>ref|XP_006371703.1| hypothetical protein POPTR_0018s00450g [Populus trichocarpa]
 gb|ERP49500.1| hypothetical protein POPTR_0018s00450g [Populus trichocarpa]
Length=584

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 114/181 (63%), Gaps = 4/181 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS++RG     G K ++G GI VS     ++  +E +RR  AI++  S
Sbjct  374  WIALYDRVIIPLASKVRGKPTRLGLKQKIGIGILVSAASMAVLAIIERVRRETAIREGIS  433

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                  + MS +W++P Y L+G +   N V  N+FF +E P+SMS++AS L+++G S AS
Sbjct  434  DIPDAVTHMSAMWLLPFYFLLGFSEAMNGVGLNEFFYTELPKSMSSVASNLFSIGLSAAS  493

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I          +   SW++S+IN+GHYDY+YW+L  L   NF+ +L CS++YGP 
Sbjct  494  LVASFIVSNVRGFISEANQESWVSSNINKGHYDYYYWLLYSLGFANFIYYLACSKAYGPC  553

Query  193  K  191
            K
Sbjct  554  K  554



>ref|XP_011026624.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=576

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 116/181 (64%), Gaps = 4/181 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS+I G     G K ++G G+ VS     ++  +E +RR +AI++  S
Sbjct  374  WIALYDRVIIPLASKITGKPTRVGLKQKIGIGVLVSAASMAVLAIIERVRREIAIREGIS  433

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                  + MS +W++P Y L+G +   N V  N+FF +E P+SMS++AS L+++G S AS
Sbjct  434  DIPDAVTHMSAMWLLPFYFLLGFSEAMNGVGLNEFFYTELPKSMSSVASNLFSIGLSAAS  493

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    +     +   SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP 
Sbjct  494  LVASFIVSNVHGFISEANQESWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGPC  553

Query  193  K  191
            K
Sbjct  554  K  554



>ref|XP_009795448.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Nicotiana 
sylvestris]
Length=581

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 111/183 (61%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+L+P+ S+  G        +RMG G+ VS     L    ESIRR  AI++ H 
Sbjct  378  WITFYDRVLVPLLSKYTGLPRGLSPITRMGIGLIVSCVSMALSAITESIRRQRAIEEGHD  437

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS +W+VPQYAL+G+A  ++AV Q +FF S  P+SMS+IAS +     A+  
Sbjct  438  DDPSALVNMSAMWLVPQYALLGVAEAAHAVGQIEFFYSLLPKSMSSIASAMYTIGTAVSS  497

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             + SLL+S ++ L+   G  SW++S+IN GH DY++W+LA LS++NF  FL+  R Y P 
Sbjct  498  LVGSLLVSGVDRLTSIGGKTSWLSSNINRGHLDYYFWLLAFLSLLNFFYFLVVCRYYEPG  557

Query  193  KDE  185
             D 
Sbjct  558  NDR  560



>gb|KJB59595.1| hypothetical protein B456_009G262700 [Gossypium raimondii]
Length=601

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 121/190 (64%), Gaps = 4/190 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YDR+++P+ S+    +     K RMGFG+ +S     + G VES RR+ AI+Q  +
Sbjct  387  WVAAYDRIVVPLLSKFTKRSQGLSLKERMGFGLIISCVATAVAGLVESKRRAAAIRQGLA  446

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +  G   MS +W+VPQ+ L+G+A G NA+ Q +F+ S+FP+SM++I   L+ LG ++ +
Sbjct  447  DNPYGVVHMSAMWLVPQHCLIGLAEGLNAIGQIEFYYSQFPKSMASIGVALFTLGMAVGN  506

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    N+++   G  SW+++ +N+GHYDY+YW+L  LS++N   +L+C  ++G +
Sbjct  507  LIGSLIVSILNKVTKTHGRVSWVSNSLNKGHYDYYYWLLTALSVINVFYYLLCIWAFGST  566

Query  193  KDEKPVAMEE  164
            ++   V  +E
Sbjct  567  ENGNKVEWDE  576



>ref|XP_006371705.1| hypothetical protein POPTR_0018s00470g [Populus trichocarpa]
 gb|ERP49502.1| hypothetical protein POPTR_0018s00470g [Populus trichocarpa]
Length=517

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 115/181 (64%), Gaps = 4/181 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS+I G     G K ++G GI VS     ++  +E +RR +AI++  S
Sbjct  307  WIALYDRVIIPLASKITGKPTRLGLKQKIGIGILVSAASMAVLAIIERVRREIAIREGIS  366

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                  + MS +W++P Y L+G +   N V  N+FF +E P+SMS++AS L+++G S AS
Sbjct  367  DIPDAVTHMSAMWLLPFYFLLGFSEAMNGVGLNEFFYTELPKSMSSVASNLFSIGLSAAS  426

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I          +   SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP 
Sbjct  427  LVASFIVSNVRGFIGEANQESWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGPC  486

Query  193  K  191
            K
Sbjct  487  K  487



>ref|XP_009795447.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X1 [Nicotiana 
sylvestris]
Length=597

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 111/183 (61%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+L+P+ S+  G        +RMG G+ VS     L    ESIRR  AI++ H 
Sbjct  394  WITFYDRVLVPLLSKYTGLPRGLSPITRMGIGLIVSCVSMALSAITESIRRQRAIEEGHD  453

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS +W+VPQYAL+G+A  ++AV Q +FF S  P+SMS+IAS +     A+  
Sbjct  454  DDPSALVNMSAMWLVPQYALLGVAEAAHAVGQIEFFYSLLPKSMSSIASAMYTIGTAVSS  513

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             + SLL+S ++ L+   G  SW++S+IN GH DY++W+LA LS++NF  FL+  R Y P 
Sbjct  514  LVGSLLVSGVDRLTSIGGKTSWLSSNINRGHLDYYFWLLAFLSLLNFFYFLVVCRYYEPG  573

Query  193  KDE  185
             D 
Sbjct  574  NDR  576



>ref|XP_006371706.1| hypothetical protein POPTR_0018s00470g [Populus trichocarpa]
 gb|ERP49503.1| hypothetical protein POPTR_0018s00470g [Populus trichocarpa]
Length=541

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 115/181 (64%), Gaps = 4/181 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS+I G     G K ++G GI VS     ++  +E +RR +AI++  S
Sbjct  331  WIALYDRVIIPLASKITGKPTRLGLKQKIGIGILVSAASMAVLAIIERVRREIAIREGIS  390

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                  + MS +W++P Y L+G +   N V  N+FF +E P+SMS++AS L+++G S AS
Sbjct  391  DIPDAVTHMSAMWLLPFYFLLGFSEAMNGVGLNEFFYTELPKSMSSVASNLFSIGLSAAS  450

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I          +   SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP 
Sbjct  451  LVASFIVSNVRGFIGEANQESWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGPC  510

Query  193  K  191
            K
Sbjct  511  K  511



>ref|XP_004235683.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Solanum lycopersicum]
Length=603

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 119/182 (65%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR++LP+AS+I+G  V      RMG GIF+S    V+ G +E +RR  AI Q   
Sbjct  386  WVFLYDRMMLPLASKIKGRPVRLKPIVRMGLGIFISCMSVVVSGIIEHVRRIKAINQGLL  445

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +++ G  +MS LW++   +L GIA   +A+   +F+ SE PRSMS+IAS L     A+ Y
Sbjct  446  NNSQGLVEMSSLWLIIPNSLNGIAEAFSAIGSTEFYYSELPRSMSSIASALLGLGMAVAY  505

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S++++ +   G  SW++S+IN+GHY+Y+YW+LA L+  N + F+ C   YGPS
Sbjct  506  LLASVILSAVDKYTEGEGKESWVSSNINKGHYEYYYWLLALLTAFNLIYFMACCWQYGPS  565

Query  193  KD  188
             D
Sbjct  566  VD  567



>ref|XP_011026621.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=579

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 115/181 (64%), Gaps = 4/181 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS+I G     G K ++G GI VS     ++  +E +RR +AI++  S
Sbjct  374  WIALYDRVIIPLASKITGKPTRLGLKQKIGIGILVSAASMAVLAIIERVRREIAIREGIS  433

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                  + MS +W++P Y L+G +   N V  N+FF +E P+SMS++AS L+++G S AS
Sbjct  434  DIPDAVTHMSAMWLLPFYFLLGFSEAMNGVGLNEFFYTELPKSMSSVASNLFSIGLSAAS  493

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I          +   SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP 
Sbjct  494  LVASFIVSNVRGYISEANQESWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGPC  553

Query  193  K  191
            K
Sbjct  554  K  554



>ref|XP_011026623.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=579

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 115/181 (64%), Gaps = 4/181 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS+I G     G K ++G GI VS     ++  +E +RR +AI++  S
Sbjct  374  WIALYDRVIIPLASKITGKPTRLGLKQKIGIGILVSAASMAVLAIIERVRREIAIREGIS  433

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                  + MS +W++P Y L+G +   N V  N+FF +E P+SMS++AS L+++G S AS
Sbjct  434  DIPDAVTHMSAMWLLPFYFLLGFSEAMNGVGLNEFFYTELPKSMSSVASNLFSIGLSAAS  493

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I          +   SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP 
Sbjct  494  LVASFIVSNVRGYISEANQESWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGPC  553

Query  193  K  191
            K
Sbjct  554  K  554



>ref|XP_011013128.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=584

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 114/181 (63%), Gaps = 4/181 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS+I G     G K ++G GI VS     ++  +E +RR +AI++  S
Sbjct  379  WIALYDRVIIPLASKITGKPTRLGLKQKIGIGILVSAASMAVLAIIERVRREIAIREGIS  438

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                  + MS +W++P Y L+G +   N V  N+FF +E P+SMS++AS L+ +G S AS
Sbjct  439  DIPDAVTHMSAMWLLPFYFLLGFSEAMNGVGLNEFFYTELPKSMSSVASNLFNIGLSAAS  498

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I          +   SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP 
Sbjct  499  LVASFIVSNVRGYISEANQESWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGPC  558

Query  193  K  191
            K
Sbjct  559  K  559



>gb|KJB18644.1| hypothetical protein B456_003G064500 [Gossypium raimondii]
Length=591

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 116/183 (63%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++LYDR +LP+AS+++G  V    K RMG G+F++     +   VE+ RR  AI++   
Sbjct  381  WVILYDRAILPMASKLKGKPVRFSVKLRMGIGLFLTCLAMAVSAVVENARRRKAIREGFL  440

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      MS LW+VPQ+ L G+A    A+ Q +FF SE P+SMS+IA+ L     A+  
Sbjct  441  NNPHTVLNMSALWLVPQFCLNGLAEAFTAIGQTEFFYSELPKSMSSIAAALFGLGLAVAN  500

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S I++++   G   W++S+IN+G  D +YWVL  LS++N L + +C+ +YGP 
Sbjct  501  LLASVVVSIIDDITSRGGKEGWVSSNINKGRIDSYYWVLTILSVINLLYYFVCAWAYGPC  560

Query  193  KDE  185
             D+
Sbjct  561  GDQ  563



>ref|XP_010049663.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Eucalyptus grandis]
 gb|KCW82404.1| hypothetical protein EUGRSUZ_C03809 [Eucalyptus grandis]
Length=586

 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 118/184 (64%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI +YDR+++P+ASR+         K RMG G+ +S     +   VE  RR+ AI++  +
Sbjct  380  WIGIYDRIIVPLASRLTNRPHGLTFKERMGIGLLISSVAMFVSAAVEHKRRTEAIREGFA  439

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +  G  KMS  W+VPQ+ L+G+A   NA+ Q  F+ S+FP+SM++IA  L  LG ++ +
Sbjct  440  ENPNGVLKMSAKWIVPQHCLIGLAEAFNAIGQINFYYSKFPKSMASIAVALLTLGMAVGN  499

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    + LS  S +G+W+++++N+GHYDY+YW+L GLS++NF  +L C+ +Y   
Sbjct  500  LVASLIVTILDRLSKGSRDGTWLSTNVNKGHYDYYYWILGGLSVINFFYYLACAWAYEGG  559

Query  193  KDEK  182
            ++ K
Sbjct  560  EERK  563



>ref|XP_006343084.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=594

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 117/182 (64%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR++LP+AS+I+G  V      RMG GIF+S    V+ G VE +RR  AI +   
Sbjct  395  WVFLYDRVMLPLASKIKGRPVRPKPIVRMGIGIFISCISMVVSGIVEHVRRRRAISEGLL  454

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            S++ G  +MS LW++   +L GIA   +A+   +F+ SE P+SMS+IAS L  LG ++AS
Sbjct  455  SNSHGLVEMSALWLIIPNSLNGIAEAFSAIGSTEFYYSELPKSMSSIASALLGLGMAVAS  514

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            LL S I    ++ +   G  SW++S+IN+GHY+Y+YW+LA L+  N L F+ C   YGPS
Sbjct  515  LLASVILNAVDKYTKGEGTESWVSSNINKGHYEYYYWLLALLTGFNLLYFVACCWQYGPS  574

Query  193  KD  188
             D
Sbjct  575  AD  576



>ref|XP_006371704.1| hypothetical protein POPTR_0018s00460g [Populus trichocarpa]
 gb|ERP49501.1| hypothetical protein POPTR_0018s00460g [Populus trichocarpa]
Length=583

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 115/180 (64%), Gaps = 4/180 (2%)
 Frame = -1

Query  718  IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS  539
            I LYDR+++P+AS++RG     G K ++G GI VS     ++  +E +RR +AI++  S 
Sbjct  375  IALYDRVIIPLASKVRGKPTRLGLKQKIGIGILVSAASMAVLAIIERVRREIAIREGISD  434

Query  538  DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslasl  359
                 + MS +W++P Y L+G +   N V  N+FF +E P+SMS++AS L+++G S ASL
Sbjct  435  IPDAVTHMSAMWLLPFYFLLGFSEAMNGVGLNEFFYTELPKSMSSVASNLFSIGLSAASL  494

Query  358  lmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            + S I          +   SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP K
Sbjct  495  VASFIVSNVRGFIREANQESWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGPCK  554



>ref|XP_010519892.1| PREDICTED: protein NRT1/ PTR FAMILY 1.3 [Tarenaya hassleriana]
Length=581

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 112/182 (62%), Gaps = 9/182 (5%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            ++ +YDR+++P+ SRIR      G   RMG G+ +S      +  VE  RR    K +H 
Sbjct  392  FLAIYDRVIVPIGSRIRRKPFRLGLMQRMGTGLVISVMSMAALATVEYFRR----KTKHC  447

Query  541  SDNLGDSK-MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgysla  365
             D   D K MS  W++P   L G+A   NA+AQN+FF  E P++MS+IA+TL+ L  + A
Sbjct  448  PDKTDDCKEMSATWLLPYMVLSGVAEALNAIAQNEFFYGELPKTMSSIATTLFGLSMAAA  507

Query  364  sllm----sSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  197
            SL+     S+++ L+ +   GSW++ DIN GH DY+YWV++GL ++N L F+ CSR+YG 
Sbjct  508  SLISGWFVSAVDSLTGDGRGGSWVSGDINSGHLDYYYWVISGLCVINVLYFVHCSRAYGK  567

Query  196  SK  191
             K
Sbjct  568  CK  569



>ref|XP_009628173.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
 ref|XP_009628174.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
Length=580

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 110/183 (60%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+L+P+ S+  G         RMG G+ VS     L    ESIRR  AI++ H 
Sbjct  377  WITFYDRVLVPLLSKYIGLARGLSPIIRMGIGLIVSCVSMALSAITESIRRQRAIEEGHD  436

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS +W VPQYAL+G+A  ++AV Q +FF S  P+SMS+IAS +     A+  
Sbjct  437  DDPSALVNMSAMWFVPQYALLGVAEAAHAVGQIEFFYSLLPKSMSSIASAMYTIGTAMSS  496

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             + SLL+S ++ L+   G  SW++S+IN GH DY++W+LA LS++NFL FL+  R Y P 
Sbjct  497  LVGSLLVSGVDWLTSTRGKTSWLSSNINRGHLDYYFWLLAFLSLLNFLYFLVVCRYYEPG  556

Query  193  KDE  185
             D 
Sbjct  557  NDR  559



>ref|XP_002324233.2| hypothetical protein POPTR_0018s00480g, partial [Populus trichocarpa]
 gb|EEF02798.2| hypothetical protein POPTR_0018s00480g, partial [Populus trichocarpa]
Length=552

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 114/179 (64%), Gaps = 4/179 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS+I G     G K ++G GI VS     ++  +E +RR +AI++  S
Sbjct  374  WIALYDRVIIPLASKITGKPTRLGLKQKIGIGILVSAASMAVLAIIERVRREIAIREGIS  433

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                  + MS +W++P Y L+G +   N V  N+FF +E P+SMS++AS L+++G S AS
Sbjct  434  DIPDAVTHMSAMWLLPFYFLLGFSEAMNGVGLNEFFYTELPKSMSSVASNLFSIGLSAAS  493

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  197
            L+ S I          +   SW++S+IN+GHYDY+YW+L+ L   NF+ +L CS++YGP
Sbjct  494  LVASFIVSNVRGFIGEANQESWVSSNINKGHYDYYYWLLSSLGFANFIYYLACSKAYGP  552



>ref|XP_002324234.2| hypothetical protein POPTR_0018s00490g [Populus trichocarpa]
 gb|EEF02799.2| hypothetical protein POPTR_0018s00490g [Populus trichocarpa]
Length=581

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 119/189 (63%), Gaps = 4/189 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+ +P+AS+IRG     G K R+G GI  S      +  +ES+RR  AIK+  S
Sbjct  384  WIALYDRVAIPLASKIRGKPTRLGLKQRIGIGILSSSAAMAALAIIESVRRKTAIKEGFS  443

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D      +S LW++  + + G A     + QN+FF +E P+SMS++AS L+ +G S+++
Sbjct  444  DDPNSVLHISALWLLLYFFITGFAEAFCGIGQNEFFYTELPKSMSSVASNLFEMGLSVSN  503

Query  361  llmsSINELSINSGNG----SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S +  +  N   G    SW++S+IN+GHYDY+YW+LAGLS+ NF+ +  CS++YGP 
Sbjct  504  LIASLLVTIVRNFFKGNDQESWLSSNINKGHYDYYYWLLAGLSLANFIYYRACSKAYGPC  563

Query  193  KDEKPVAME  167
            K ++  A +
Sbjct  564  KGQEGNATD  572



>ref|XP_006343083.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=594

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 117/182 (64%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR++LP+AS+I+G  V      RMG GIF+S    V+ G VE +RR  AI +   
Sbjct  395  WVFLYDRVMLPLASKIKGRPVRLKPIVRMGIGIFISCISMVVSGIVEHVRRRRAINEGLL  454

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            +++ G  +MS LW+V   +L GIA   +A+   +F+  E P+SMS+IAS L     A+  
Sbjct  455  NNSHGLVEMSALWLVIPNSLNGIAEAFSAIGSTEFYYLELPKSMSSIASALLGLGMAVAS  514

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS++++++++ +   G  SW++S+IN+GHY+Y+YW+LA L+  N L F+ C   YGPS
Sbjct  515  LLASVILNAVDKYTKGEGTESWVSSNINKGHYEYYYWLLALLTACNLLYFVACCWQYGPS  574

Query  193  KD  188
             D
Sbjct  575  AD  576



>ref|XP_007150640.1| hypothetical protein PHAVU_005G169300g [Phaseolus vulgaris]
 gb|ESW22634.1| hypothetical protein PHAVU_005G169300g [Phaseolus vulgaris]
Length=478

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 119/179 (66%), Gaps = 4/179 (2%)
 Frame = -1

Query  712  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN  533
            +YDR++LP+AS++RG  V    K R+G G+F S    V    VESIRR  AI++ +  + 
Sbjct  280  VYDRVILPLASKVRGKPVTVSAKRRIGIGLFFSILDFVTSAIVESIRRKKAIQEGYIDNP  339

Query  532  LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslasllm  353
                KMS +W++P   L GIA   NA+ Q++F+ SEFP SMS+IA+++++LG ++ SL+ 
Sbjct  340  EAVLKMSAMWLIPHNVLCGIAEAFNAIGQSEFYYSEFPSSMSSIAASMFSLGSAVGSLVA  399

Query  352  sSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  188
            S I    + ++   G  SW++ +IN+GHYD +YW+LA +S VNFL +L+C  +YGPS +
Sbjct  400  SLILSIVDNITSKGGKQSWVSDNINKGHYDNYYWLLAIMSAVNFLYYLVCCWAYGPSAE  458



>ref|XP_003597729.1| hypothetical protein MTR_2g101650 [Medicago truncatula]
 gb|ABD32292.2| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67980.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=592

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 121/187 (65%), Gaps = 4/187 (2%)
 Frame = -1

Query  712  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN  533
            +YDR+ LP+AS+IRG  V    K R+G GIF S    V+   VE+IRR  AI++ +  + 
Sbjct  390  VYDRIFLPLASKIRGKQVTISAKKRIGIGIFFSILDLVVSAIVETIRRKKAIQEGYIDNP  449

Query  532  LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgys----la  365
                 MS +W++P   L G++   NA+ Q++F+ S+FP SMS+IA++L+ LG +    LA
Sbjct  450  KAVLNMSAMWLIPHNILCGMSEAFNAIGQSEFYYSQFPSSMSSIAASLFTLGSAFGNLLA  509

Query  364  sllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  185
            SL++S +++++   G  SW++ ++N+G YD +YW+L  +S++N + +LICS +YGPS  E
Sbjct  510  SLIVSIVDDITSRGGKESWVSDNVNKGRYDKYYWLLTIMSILNIMYYLICSWTYGPSDVE  569

Query  184  KPVAMEE  164
                 EE
Sbjct  570  ATSEKEE  576



>ref|XP_008352327.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Malus domestica]
Length=328

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 115/183 (63%), Gaps = 3/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+++P+ S+          K R+G G+ +S     +  +VE  RR  AI++  S
Sbjct  121  WVAIYDRIIVPLISKYTKRPRGLSFKQRIGGGLAISCLAMAVAAEVERHRRQTAIREGFS  180

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            +   G   MS  W++PQ+ L+G+A   NA+ Q +F+ S+FP+SMS+IA  L  LG+ + S
Sbjct  181  NKPEGVVGMSAKWIIPQHCLIGLAEALNAIGQLEFYYSQFPKSMSSIAVALLTLGFGVGS  240

Query  361  llmsSINEL---SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            L+ S +  +   +   G  SW++S++N+ HYDY+YW++AGLS+VN   FL+CS +YG  +
Sbjct  241  LVGSLLVTIIADATRKGGVSWVSSNLNKAHYDYYYWIVAGLSVVNVFYFLLCSWAYGHCE  300

Query  190  DEK  182
            D+K
Sbjct  301  DKK  303



>ref|XP_006355955.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X3 [Solanum tuberosum]
Length=577

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 114/192 (59%), Gaps = 5/192 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+ +P+ S+  G        +RMG G+ VS     L    ESIRR  AI + H 
Sbjct  377  WITFYDRVFVPLLSKYTGRPRGLSPVTRMGIGLAVSCMSMALSAITESIRRKRAIAEGHE  436

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D      MS +W VPQYAL+GIA  ++AV Q +FF +  P+SM++IAS +Y +G +++S
Sbjct  437  DDPHALVNMSAMWFVPQYALLGIAEATHAVGQIEFFYTLLPKSMASIASAMYTVGTAVSS  496

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S +    + L+   G  SW+ S+IN+GH DY +W+LA +S +N L FL+  R Y   
Sbjct  497  LIGSFLVSSEDWLTSRGGKTSWLASNINKGHLDYHFWILAFMSFLNLLYFLVICRFYDTG  556

Query  193  KDEKP-VAMEED  161
             DE P VA EE+
Sbjct  557  NDELPHVANEEE  568



>ref|XP_006355953.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Solanum tuberosum]
Length=580

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 114/192 (59%), Gaps = 5/192 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+ +P+ S+  G        +RMG G+ VS     L    ESIRR  AI + H 
Sbjct  380  WITFYDRVFVPLLSKYTGRPRGLSPVTRMGIGLAVSCMSMALSAITESIRRKRAIAEGHE  439

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D      MS +W VPQYAL+GIA  ++AV Q +FF +  P+SM++IAS +Y +G +++S
Sbjct  440  DDPHALVNMSAMWFVPQYALLGIAEATHAVGQIEFFYTLLPKSMASIASAMYTVGTAVSS  499

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S +    + L+   G  SW+ S+IN+GH DY +W+LA +S +N L FL+  R Y   
Sbjct  500  LIGSFLVSSEDWLTSRGGKTSWLASNINKGHLDYHFWILAFMSFLNLLYFLVICRFYDTG  559

Query  193  KDEKP-VAMEED  161
             DE P VA EE+
Sbjct  560  NDELPHVANEEE  571



>ref|XP_002514272.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF48226.1| nitrate transporter, putative [Ricinus communis]
Length=595

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 116/185 (63%), Gaps = 6/185 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YD++L+P  ++I         K RMG G+ +S     + G VE  RR+ A+ +  +
Sbjct  382  WVAIYDQVLVPRIAKITKRPRGLTNKQRMGMGLALSCLATAMAGAVEHQRRATALNEGLA  441

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                G   MS +W+VPQ+ L G+A   NA+ Q +F+ S+FP++M++I   L++LG +  +
Sbjct  442  DKPKGQVNMSAMWLVPQHCLTGLAEALNAIGQIEFYYSQFPKTMTSIGVALFSLGMAFGN  501

Query  361  llmsSI-----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  197
            L+ S I     +  S N    SW+++++N+GHYDY+YW+L+GLS+VN   +LICSR+YG 
Sbjct  502  LVGSLIVGVLSHATSNNDEKVSWVSNNLNKGHYDYYYWLLSGLSVVNLFYYLICSRAYG-  560

Query  196  SKDEK  182
            S+D +
Sbjct  561  SEDRR  565



>ref|XP_007150639.1| hypothetical protein PHAVU_005G169300g [Phaseolus vulgaris]
 gb|ESW22633.1| hypothetical protein PHAVU_005G169300g [Phaseolus vulgaris]
Length=580

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 119/179 (66%), Gaps = 4/179 (2%)
 Frame = -1

Query  712  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN  533
            +YDR++LP+AS++RG  V    K R+G G+F S    V    VESIRR  AI++ +  + 
Sbjct  382  VYDRVILPLASKVRGKPVTVSAKRRIGIGLFFSILDFVTSAIVESIRRKKAIQEGYIDNP  441

Query  532  LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslasllm  353
                KMS +W++P   L GIA   NA+ Q++F+ SEFP SMS+IA+++++LG ++ SL+ 
Sbjct  442  EAVLKMSAMWLIPHNVLCGIAEAFNAIGQSEFYYSEFPSSMSSIAASMFSLGSAVGSLVA  501

Query  352  sSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  188
            S I    + ++   G  SW++ +IN+GHYD +YW+LA +S VNFL +L+C  +YGPS +
Sbjct  502  SLILSIVDNITSKGGKQSWVSDNINKGHYDNYYWLLAIMSAVNFLYYLVCCWAYGPSAE  560



>ref|XP_004301550.2| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Fragaria vesca 
subsp. vesca]
Length=593

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 115/183 (63%), Gaps = 3/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+L+P+ S+          K R+G G+ +S     +  +VE  RR+ AI++   
Sbjct  382  WVAIYDRILVPLISKYTKRPGGLSFKQRIGTGLVLSCLAMAVASEVERCRRNTAIQEGFE  441

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            ++  G   MS  W+VPQ+ L G+A   NA+ Q +F+ S+FP+SMS+IA  L +LG+ + S
Sbjct  442  NNKHGVVTMSAWWLVPQHCLTGLAEAFNAIGQIEFYYSQFPKSMSSIAVALLSLGFCMGS  501

Query  361  llmsSINELSIN---SGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            L+ S I  +  N    G  SW++S++N+GHYDYFY V+   SMVNFL +L+C R+YG  +
Sbjct  502  LVGSLIVTVMNNVTKKGGVSWVSSNLNQGHYDYFYLVVTIFSMVNFLYYLLCCRAYGCCE  561

Query  190  DEK  182
            D+K
Sbjct  562  DKK  564



>ref|XP_007019700.1| Nitrate transporter, putative [Theobroma cacao]
 gb|EOY16925.1| Nitrate transporter, putative [Theobroma cacao]
Length=603

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 120/183 (66%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+++P+ ++    +    +K RMG G+ +S     +   VES RR+ AI++  +
Sbjct  392  WVAVYDRIIVPLLAKFTKRSRGLTSKERMGVGLAISCMATAVAATVESKRRAAAIRKGLA  451

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgy----  374
             +      MS +W+VPQY+L G+A G NA+ Q +F+ S+FP+SM++I   L+ALG     
Sbjct  452  DNYYMPVDMSAMWLVPQYSLTGLAEGFNAIGQIEFYYSQFPKSMASIGVALFALGMGVGN  511

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             + SLL++ +N ++   G  SW+++++N+GHYDY+YW+L  LS++N L +L+CS +YG  
Sbjct  512  LVGSLLVAILNSVTQKKGEVSWVSTNLNKGHYDYYYWLLTILSVINVLYYLVCSWAYGSC  571

Query  193  KDE  185
            +++
Sbjct  572  ENK  574



>ref|XP_004238698.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Solanum lycopersicum]
Length=579

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 109/183 (60%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+L+P+ S+  G        +RMG G+ VS     L    ESIRR  AI + H 
Sbjct  376  WITFYDRVLVPLLSKYTGRPRGLSPVTRMGIGLTVSCMSMALSAITESIRRKRAIAEGHE  435

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D      MS +W VPQYAL+GIA  ++ V Q +FF +  P+SM++IAS +Y +G +++S
Sbjct  436  DDPNALVNMSAMWFVPQYALLGIAEATHGVGQIEFFYTLLPKSMASIASAMYTVGTAVSS  495

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L  S +    + L+   G  SW++S+IN+GH DY +WVLA +S +N L FL+  R Y   
Sbjct  496  LTGSILVSSEDWLTSRGGKTSWLSSNINKGHLDYHFWVLASMSFLNLLYFLVVCRFYDTG  555

Query  193  KDE  185
            KDE
Sbjct  556  KDE  558



>gb|KEH40281.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=569

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 115/191 (60%), Gaps = 4/191 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WIVLYD +++P AS++R +T     K +MG G+         +  VE  RR LAI +   
Sbjct  378  WIVLYDCVIIPSASKLRRSTTRLRVKQKMGIGLIGICLSTSSLAIVEGKRRKLAIDEGFQ  437

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMS----TIastlyalgy  374
                G   MS++W++P+  L G A   N V QN+F+I E P+SMS    T++    ++G 
Sbjct  438  DFPQGVVNMSVMWLLPRQILDGFAEAFNGVGQNEFYICELPQSMSSVASTLSGLGMSIGN  497

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +ASL++S ++ ++   G  SW++S+IN+GHYDY+YW+L  L + NFL FL  S++YGP 
Sbjct  498  VMASLILSVVDNVTKGEGKESWVSSNINKGHYDYYYWLLFELMLANFLAFLCFSKAYGPC  557

Query  193  KDEKPVAMEED  161
            K E+  +  E+
Sbjct  558  KGEENESQVEE  568



>gb|KJB33640.1| hypothetical protein B456_006G023500 [Gossypium raimondii]
Length=598

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 117/186 (63%), Gaps = 4/186 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YD++++P+ S+    +     K RMG G+ +S     +   VES RR+ AI+Q   
Sbjct  387  WVATYDQIIVPLLSKFTKRSRGFSLKERMGMGLAISCVATAVAAMVESKRRATAIRQGLG  446

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +  G   MS +W+VPQY+L+G+A G NA+ Q +F+ S+FP+SM++I   L+ALG ++ +
Sbjct  447  DEPHGMVHMSAMWLVPQYSLIGLAEGLNAIGQIEFYYSQFPKSMASIGVALFALGMAVGN  506

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    ++L+   G  SW+++++N GHYDY+YW+L  LS++N   +LIC   +G S
Sbjct  507  LVSSLIVGTVDKLTSKGGKQSWVSNNLNMGHYDYYYWILTILSVINVFYYLICCWDFGSS  566

Query  193  KDEKPV  176
             ++  +
Sbjct  567  DNKNKI  572



>ref|XP_006355954.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Solanum tuberosum]
Length=579

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 114/182 (63%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+L+P+ S+  G        +RMG G+ VS     L    ESIR+  AI++ H 
Sbjct  376  WITFYDRVLVPLLSKYTGRPRGLSPVTRMGIGLLVSCMSMALSAITESIRQQKAIEEGHE  435

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D      MS +W+VPQY L+G+A  ++AV Q +FF S FP+SMS+IAS +Y +G +++S
Sbjct  436  DDPHALVNMSAMWLVPQYLLLGVAEAAHAVGQIEFFYSLFPKSMSSIASAMYTIGTAVSS  495

Query  361  ll----msSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+    +S ++ L+   G  SW++S+IN+GH DY++W+LA LS++NF  F++  R Y   
Sbjct  496  LVGSFLVSGVDWLTSTGGKTSWLSSNINKGHLDYYFWLLAFLSLLNFFYFVMVCRLYETG  555

Query  193  KD  188
             D
Sbjct  556  ND  557



>ref|XP_006355956.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=584

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 113/182 (62%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+L+P+ S+  G        +RMG G+  S     L    ESIRR  AI++ H 
Sbjct  381  WIAFYDRVLVPLLSKYTGQQRGLSPVTRMGIGLISSGMSIALSAITESIRRQRAIEEGHE  440

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D      MS +W VPQYAL+G+A  ++AV Q +FF + FP+SMS+IAS++Y +G +++S
Sbjct  441  DDPNALVNMSAMWFVPQYALLGVAEATHAVGQVEFFYALFPKSMSSIASSMYTVGTAVSS  500

Query  361  l----lmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L    L+S ++ LS   G  SW++S+IN GH DY++W+L+ LS +NFL FL+  R Y   
Sbjct  501  LIGSILVSGVDWLSSTGGKTSWLSSNINRGHIDYYFWLLSFLSFINFLYFLVVCRFYESL  560

Query  193  KD  188
             D
Sbjct  561  ND  562



>gb|KDP33700.1| hypothetical protein JCGZ_07271 [Jatropha curcas]
Length=596

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 112/178 (63%), Gaps = 4/178 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+L+P  ++I         K RMG G+ +S     + G VE  RR +AI++  +
Sbjct  387  WVAIYDRILVPRIAKITKRPRGLTNKQRMGIGLLLSCVSTAVAGAVEHQRRGMAIREGLA  446

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                    MS +W+VPQ+ L G+A   NA+ Q +F+ S+FP++MS+I   L++LG+   +
Sbjct  447  DKPEDIVNMSAMWLVPQHCLTGLAEAFNAIGQIEFYYSQFPKTMSSIGIALFSLGFGFGN  506

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG  200
            LL S I    ++ +  +G  SW++ ++N GHYDY+YW+LA LS++NF  +L+CSR+YG
Sbjct  507  LLGSLIVAILSDSTKRNGKVSWVSDNLNRGHYDYYYWLLAFLSVINFFYYLLCSRAYG  564



>emb|CDP21642.1| unnamed protein product, partial [Coffea canephora]
Length=575

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 104/177 (59%), Gaps = 4/177 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YDR+L P+ +R  GN        RMG G+ +SF   VL G VESIR   A+++   
Sbjct  381  WVAFYDRVLAPLLARYTGNPQGLSPIVRMGMGLIMSFIAMVLAGVVESIRLKKAVEEGVE  440

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS +W+VPQ   +G+A   NA+ Q QFF   FP+SMS++   +     AL  
Sbjct  441  DDPDAVLDMSAMWLVPQTVCIGLAEALNAIGQIQFFYMLFPKSMSSVGVAMYTFGMALAS  500

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY  203
             + SLL++ IN ++ + G  SW+ +++NEGH DY+YW+L  L+++NF  FL C R Y
Sbjct  501  LIGSLLVNIINSITSHGGKASWLANNLNEGHLDYYYWLLGFLNLINFFYFLFCCRFY  557



>ref|XP_010318545.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Solanum lycopersicum]
Length=581

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 115/182 (63%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR++LP+AS+I+G  V      RMG GIFVS    V+ G +E +RR  AI Q   
Sbjct  385  WVFLYDRVMLPLASKIKGRPVRLKPIVRMGIGIFVSCMSMVVSGIIEHVRRRKAIYQGLL  444

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            S++ G  +MS LW++    L GIA   +++   +F+ SE PRSMS+IAS L     A+  
Sbjct  445  SNSQGLVEMSALWLIIPSCLNGIAEAFSSIGSTEFYYSELPRSMSSIASALLGLGMAVAS  504

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S++++ +   G  SW++S+IN+GHY+Y+YW LA L+  N + F+ C   YG S
Sbjct  505  LLASVILSAVDKYTKGEGKESWVSSNINKGHYEYYYWFLALLTAFNLIYFVACCWQYGTS  564

Query  193  KD  188
             +
Sbjct  565  VE  566



>ref|XP_004238701.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X1 [Solanum lycopersicum]
Length=579

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 114/182 (63%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YDR+L+P+ S+  G        +RMG G+ VS     L    ESIR+  AI++ H 
Sbjct  376  WVTFYDRVLVPLLSKYTGRPRGLSPVTRMGIGLLVSCMSMALSAITESIRQKKAIEEGHE  435

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D      MS +W+VPQY L+G+A  ++AV Q +FF S FP+SM++IAS +Y +G +++S
Sbjct  436  DDPHALVNMSAMWLVPQYLLLGVAEAAHAVGQIEFFYSLFPKSMASIASAMYTIGTAVSS  495

Query  361  l----lmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L    L+S ++ L+   G  SW++S+IN+GH DY++W+LA LS++NF  F++  R Y   
Sbjct  496  LFGSILVSGVDWLTSTGGKTSWLSSNINKGHLDYYFWLLAFLSLLNFFYFVMVCRLYETG  555

Query  193  KD  188
             D
Sbjct  556  ND  557



>gb|KEH16315.1| peptide/nitrate transporter [Medicago truncatula]
Length=503

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 112/179 (63%), Gaps = 12/179 (7%)
 Frame = -1

Query  709  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL  530
            YD +L+P+AS+IRG  V  G K RMG G+F+SF + V     E+IRR  A        N 
Sbjct  329  YDLVLIPLASKIRGKPVKIGAKKRMGIGLFLSFLHLVNAAIFETIRRRNA--------ND  380

Query  529  GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslasllms  350
            G  ++S LW+ PQ  L GI+     + QN+F+ +EFP +MS++A++L  LG +  SL+ S
Sbjct  381  GVLEISALWLAPQLCLAGISEAVKFIGQNEFYYTEFPSTMSSVAASLSGLGMAAGSLVSS  440

Query  349  SINELSINS----GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  185
             +  +  N+    G   WI+ DIN+GH+D + W++AG+S +N L +L+CS +YGP+ +E
Sbjct  441  LLFSIVENTTSRGGKDGWISDDINKGHFDKYSWLIAGISALNILYYLVCSWAYGPAVEE  499



>ref|XP_010098095.1| putative peptide transporter [Morus notabilis]
 gb|EXB74532.1| putative peptide transporter [Morus notabilis]
Length=608

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 120/190 (63%), Gaps = 4/190 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+V+YDR++LP+  +IRG +V    K+RMG G+  SF   V+   VE++RR   I++   
Sbjct  389  WVVIYDRVILPLGLKIRGKSVRIDVKTRMGIGLIFSFLAMVVSAVVENVRRRRVIREGFL  448

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      MS +W++PQ+ L G+A   N + Q +F+ SEFP+SMS+IAS L     A+  
Sbjct  449  NNPHAVVGMSAMWLIPQHCLNGLAEAFNGIGQTEFYYSEFPKSMSSIASALFGLGMAVAS  508

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LAS+++S+++  +   G  SW++ +IN GHYDY+YW+LA +S VN   +L CS +YGP 
Sbjct  509  LLASVVLSAVDNATSRKGKESWVSDNINRGHYDYYYWLLAIMSFVNLFYYLFCSWAYGPC  568

Query  193  KDEKPVAMEE  164
             ++     +E
Sbjct  569  AEQMKKVTDE  578



>ref|XP_011026620.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Populus 
euphratica]
Length=571

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 116/184 (63%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS+IRG     G K R+G GI  S      +  +ES+RR  AI++   
Sbjct  374  WIALYDRVVIPLASKIRGKPSRLGLKQRIGIGILSSSAAMAALAIIESVRRKTAIEEGFY  433

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D      +S LW++  + + G A     + QN+FF +E P+SMS++AS L+ +G S+++
Sbjct  434  DDPNSVLHISALWLLLYFFITGFAEAFCGIGQNEFFYTELPKSMSSVASNLFEMGLSVSN  493

Query  361  llmsSINELSINSGNG----SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S +  +  N   G    SW++S+IN+GHYDY+YW+LAGLS+ NF+ +  C ++YGP 
Sbjct  494  LIASLLVTIVRNFFKGNDQESWLSSNINKGHYDYYYWLLAGLSLANFIYYRACCKAYGPC  553

Query  193  KDEK  182
            K ++
Sbjct  554  KGQE  557



>ref|XP_010320607.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X2 [Solanum lycopersicum]
Length=577

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 114/192 (59%), Gaps = 5/192 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+L+P+ S+  G        +RMG G+ VS     L    ESIRR  AI + H 
Sbjct  377  WITFYDRVLVPLLSKYTGRPRGLSPVTRMGIGLTVSCMSMALSAITESIRRKRAITEGHE  436

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D      MS +W VPQYAL+GIA  ++ V Q +FF +  P+SM++IAS +Y +G +++S
Sbjct  437  DDPNALVNMSAMWFVPQYALLGIAEATHGVGQIEFFYTLLPKSMASIASAMYTVGTAVSS  496

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S +    + L+   G  SW++S+IN+GH DY +W+LA +S +N L FL   R Y   
Sbjct  497  LIGSILVSSEDWLTSRGGKTSWLSSNINKGHLDYHFWLLALMSFLNLLYFLWVCRFYETG  556

Query  193  KDEKP-VAMEED  161
             DE P VA EE+
Sbjct  557  NDELPHVADEEE  568



>ref|XP_004238699.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X3 [Solanum lycopersicum]
Length=576

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 114/192 (59%), Gaps = 5/192 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+L+P+ S+  G        +RMG G+ VS     L    ESIRR  AI + H 
Sbjct  376  WITFYDRVLVPLLSKYTGRPRGLSPVTRMGIGLTVSCMSMALSAITESIRRKRAITEGHE  435

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D      MS +W VPQYAL+GIA  ++ V Q +FF +  P+SM++IAS +Y +G +++S
Sbjct  436  DDPNALVNMSAMWFVPQYALLGIAEATHGVGQIEFFYTLLPKSMASIASAMYTVGTAVSS  495

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S +    + L+   G  SW++S+IN+GH DY +W+LA +S +N L FL   R Y   
Sbjct  496  LIGSILVSSEDWLTSRGGKTSWLSSNINKGHLDYHFWLLALMSFLNLLYFLWVCRFYETG  555

Query  193  KDEKP-VAMEED  161
             DE P VA EE+
Sbjct  556  NDELPHVADEEE  567



>ref|XP_007024207.1| Major facilitator superfamily protein, putative [Theobroma cacao]
 gb|EOY26829.1| Major facilitator superfamily protein, putative [Theobroma cacao]
Length=568

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 116/179 (65%), Gaps = 4/179 (2%)
 Frame = -1

Query  712  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN  533
            LY+R+++P+AS+I+G  V+   + RMG G+F+S     L   VES RR  AI++    + 
Sbjct  379  LYERVIIPLASKIKGEQVYISVQLRMGIGLFLSVIALGLTAIVESARRRKAIQEGLLKNP  438

Query  532  LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslasllm  353
            +    MS++W++PQ+ +MG+A   + +   +F+  EFP++MS+I ++L+ L  + A +L 
Sbjct  439  IAVVNMSVIWLLPQHIVMGVAEAFSTLGYFEFYHREFPKTMSSIGNSLFFLALAFAHILS  498

Query  352  sS----INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKD  188
            S+    +N+ +   G  SW+  ++NE  +D +YW+LAGLS+VN L ++ICSRSYG + +
Sbjct  499  SALFNIVNKTTSRGGKPSWVADNLNEARFDNYYWLLAGLSLVNLLYYIICSRSYGSTAE  557



>ref|XP_011026619.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like isoform X1 [Populus 
euphratica]
Length=581

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 116/184 (63%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI LYDR+++P+AS+IRG     G K R+G GI  S      +  +ES+RR  AI++   
Sbjct  384  WIALYDRVVIPLASKIRGKPSRLGLKQRIGIGILSSSAAMAALAIIESVRRKTAIEEGFY  443

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D      +S LW++  + + G A     + QN+FF +E P+SMS++AS L+ +G S+++
Sbjct  444  DDPNSVLHISALWLLLYFFITGFAEAFCGIGQNEFFYTELPKSMSSVASNLFEMGLSVSN  503

Query  361  llmsSINELSINSGNG----SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S +  +  N   G    SW++S+IN+GHYDY+YW+LAGLS+ NF+ +  C ++YGP 
Sbjct  504  LIASLLVTIVRNFFKGNDQESWLSSNINKGHYDYYYWLLAGLSLANFIYYRACCKAYGPC  563

Query  193  KDEK  182
            K ++
Sbjct  564  KGQE  567



>gb|KEH40283.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=565

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 112/184 (61%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+VLYD +L+P AS++R +      K +MG G+    +    +  VE  RR LAI +   
Sbjct  374  WLVLYDCVLIPSASKLRRSPTRLRVKQKMGIGLLAICFSTASLAIVEGKRRKLAIDEGFI  433

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIastlyalgy  374
                G   MS++W++P+  L G A   N V QN+F+I E P+SM    ST++    ++G 
Sbjct  434  EFPQGVVNMSVMWLLPRQILDGFAEAFNGVGQNEFYICELPQSMSSVASTLSGLGMSIGN  493

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LASL++S ++ ++   G  SW++S+IN+GHYDY+YW+L  L + NFL FL  S++YGP 
Sbjct  494  VLASLILSVVDNVTKGEGKESWVSSNINKGHYDYYYWLLFVLMLANFLGFLWFSKAYGPC  553

Query  193  KDEK  182
            K E+
Sbjct  554  KGEE  557



>gb|KEH21351.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=580

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 116/184 (63%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+++ + S+          K RMG GI +S    ++   VE  RR+ AI++   
Sbjct  377  WVAIYDRIIVSLLSKYTKKGKGLTLKQRMGIGIGISCLATLVAALVEKKRRNEAIREGFI  436

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            +D  G   MS +W+VPQ+ L+G+A   +A+ Q +FF S+FP+SMS+IA +L+ LG+   +
Sbjct  437  NDPKGVVNMSAMWLVPQHCLVGLAEAFSAIGQIEFFYSQFPKSMSSIAVSLFTLGFGTGN  496

Query  361  llmsSINELSIN----SGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ + I +   N     G  SW++++IN+GHYDY+YW+L  LS+VN   FL+CS +YG +
Sbjct  497  LVATIIVKSVKNGTQRGGQVSWLSANINQGHYDYYYWLLTILSLVNMFYFLLCSWAYGST  556

Query  193  KDEK  182
            +D K
Sbjct  557  EDIK  560



>ref|XP_004252058.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Solanum lycopersicum]
Length=586

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 115/191 (60%), Gaps = 6/191 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+V YDR+L+P  SR          K RMG G+ +S    V+   VE  RRS A+ Q  +
Sbjct  387  WLVFYDRVLVPWISRFTRKPRGLSFKQRMGIGLLLSCAAQVVAALVERERRSRALDQGLA  446

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            +  +    MS +W+VPQ+ L G+A   NA+ Q +F+ S+FP+SM+++   L++LG    +
Sbjct  447  NHPVSQVDMSAMWLVPQHCLTGLAEAFNAIGQIEFYYSQFPKSMASVGVALFSLGMGFGN  506

Query  361  llmsSINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I E+    +   G  SW+++++N GHYDY+YWVL  LS+ NF  F++C+ +YG  
Sbjct  507  LVGSLIVEIVDHVTSRGGKVSWVSNNLNLGHYDYYYWVLCLLSVGNFFYFIVCAWAYGSD  566

Query  193  KDEKPVAMEED  161
            +D++    EED
Sbjct  567  EDKR--IWEED  575



>gb|KHN41645.1| Putative peptide transporter [Glycine soja]
Length=573

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 118/193 (61%), Gaps = 8/193 (4%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+V+YDR+L+P+  + R  TV    K RMG G+ +S    ++   VE  RR+ AIK+   
Sbjct  376  WVVVYDRILVPLFPKERVLTV----KQRMGIGLLISCLATLVAALVERKRRNEAIKEGFI  431

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +  G   MS +W+VPQY L G+A G N + Q +F+ S+FP++MS+IA +L ALG  + +
Sbjct  432  DNPKGVVNMSAMWLVPQYCLYGLAEGLNIIGQIEFYYSQFPKTMSSIAVSLCALGIGMGN  491

Query  361  llmsSINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            +L S I ++    +   G  SW+ S+IN GHYDY+Y +L  L++VN L F I SR YG +
Sbjct  492  VLGSLIVKVVKDGTKRGGEASWLASNINRGHYDYYYALLFILNLVNLLCFFIWSRIYGST  551

Query  193  KDEKPVAMEED*R  155
            +D K    E D R
Sbjct  552  RDIKNWEEEVDTR  564



>ref|XP_006353565.1| PREDICTED: probable peptide/nitrate transporter At3g16180-like 
[Solanum tuberosum]
Length=590

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 113/191 (59%), Gaps = 6/191 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YDR+L+P  SR          K RMG G+ +S    V+   VE  RRS A+ +  +
Sbjct  391  WLAFYDRVLVPWISRFTRKPRGLSFKQRMGIGLLLSCAAQVVAALVERERRSRALDEGLA  450

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
               L    MS +W+VPQ+ L G+A   NA+ Q +F+ S+FP+SM++I   L++LG    +
Sbjct  451  DHPLSQVDMSAMWLVPQHCLTGLAEAFNAIGQIEFYYSQFPKSMASIGVALFSLGMGFGN  510

Query  361  llmsSINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I E+    S   G  SW+++++N GHYDY+YWVL  LS+ NF  F++C+ +YG  
Sbjct  511  LIGSLIVEIVDHVSSRGGKVSWVSNNLNLGHYDYYYWVLCLLSVGNFFYFIVCAWAYGSD  570

Query  193  KDEKPVAMEED  161
            +D++    EED
Sbjct  571  EDKR--IWEED  579



>ref|XP_006475660.1| PREDICTED: probable peptide/nitrate transporter At3g16180-like 
isoform X1 [Citrus sinensis]
Length=311

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 111/182 (61%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI +YDR ++P+  +  G+      K RMG G+ +S         VE+ RR  AI Q   
Sbjct  105  WIAIYDRAVVPILVKFTGHPRGLSPKMRMGIGLLLSAVSMAAAAVVENKRRKFAIDQGLV  164

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +      MS +W++PQ++L+G+A   NA+ Q +F+ S+ P+SMS++A  ++ LG ++A+
Sbjct  165  DEPQKVMDMSAMWLIPQFSLIGLAEAFNAIGQIEFYYSQLPKSMSSMAMAIFTLGMAVAN  224

Query  361  ll----msSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            LL    +  ++ ++   G  SW++S++N+GH DYFYW+L  + +VNF  FL+C  +YGPS
Sbjct  225  LLGGLLVKIVDRVTRKHGKESWLSSNLNKGHLDYFYWLLMAMCLVNFGYFLVCCWAYGPS  284

Query  193  KD  188
             D
Sbjct  285  VD  286



>ref|XP_006585587.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Glycine max]
Length=585

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 104/174 (60%), Gaps = 4/174 (2%)
 Frame = -1

Query  694  LPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNLGDSKM  515
            +P AS++RG  V    K RMG G+  SF +      VE+ RR  AI++ H  D      M
Sbjct  374  IPAASKLRGKPVRISAKRRMGIGLVFSFLHLATAAIVENTRRRRAIREGHIDDTNAVLNM  433

Query  514  SILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslasllmsSI---  344
            S +W+VPQ  L G+A   NA+ QN+F+ +EFPR+MS+IA+ L+ LG +  ++L S I   
Sbjct  434  SAMWLVPQLCLSGMAEAFNAIGQNEFYYTEFPRTMSSIAACLFGLGMAAGNVLSSLIFSI  493

Query  343  -NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE  185
               ++   G   W+  +IN+G YD +Y VLA L+ VN L +L+CS +Y P+ D+
Sbjct  494  VENVTSRGGKQGWVLDNINKGSYDRYYCVLASLAAVNILYYLVCSWAYVPTVDQ  547



>ref|XP_010924574.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Elaeis guineensis]
Length=581

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 107/178 (60%), Gaps = 4/178 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDRL++P  ++I G       + RMG G+ +S     +   VE +RR  AI++  +
Sbjct  375  WVAIYDRLIVPRLAKITGRPRGLSLRQRMGIGLAISCIATAVAATVEGMRRRRAIEEGLA  434

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                    MS +W+VPQ  L G+A   N +AQ +F+ SEFP+SM++I  +L +LG  +  
Sbjct  435  DHPSAIVNMSAMWLVPQNCLSGLAEAFNIIAQIEFYYSEFPKSMASIGMSLISLGLGVGD  494

Query  361  llmsSINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG  200
            L+ S I EL    S  +G  SW+ +++N GH+DY+YW+L  LS+ NF  FL+CS +YG
Sbjct  495  LVASLILELVDKRSGRNGRVSWVAANLNRGHFDYYYWILTLLSVCNFFYFLVCSWAYG  552



>ref|XP_003524398.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=573

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 117/193 (61%), Gaps = 8/193 (4%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+V+YDR+L+P+  + R  TV    K RMG G+ +S    ++   VE  RR+ AIK+   
Sbjct  376  WVVVYDRILVPLFPKERVLTV----KQRMGIGLLISCLATLVAALVERKRRNEAIKEGFI  431

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +  G   MS +W+VPQY L G+A G N + Q +F+ S+FP++MS+IA +L ALG  + +
Sbjct  432  DNPKGVVNMSAMWLVPQYCLYGLAEGLNIIGQIEFYYSQFPKTMSSIAVSLCALGIGMGN  491

Query  361  llmsSINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            +L S I ++    +   G  SW+ S+IN GHYDY+Y +L  L++VN L F I SR YG +
Sbjct  492  VLGSLIVKVVKDGTKRGGEASWLASNINRGHYDYYYALLFILNLVNLLCFFIWSRIYGST  551

Query  193  KDEKPVAMEED*R  155
             D K    E D R
Sbjct  552  CDIKNWEEEVDTR  564



>ref|XP_009352687.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Pyrus x bretschneideri]
Length=592

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 114/183 (62%), Gaps = 3/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+++P+ S+          K R+G G+ +S     +  +VE  RR  AI++   
Sbjct  385  WVAIYDRIIVPLISKYTKRPRGLSFKQRIGGGLAISCLAMAVAAEVERHRRQTAIREGFL  444

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            +   G   MS  W++PQ+ L+G+A   NA+ Q +F+ S+FP+SMS+IA  L  LG+ + S
Sbjct  445  NKPDGVVGMSAKWMIPQHCLIGLAEALNAIGQLEFYYSQFPKSMSSIAVALLTLGFGVGS  504

Query  361  llmsSINEL---SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            L+ S +  +   +   G  SW++S++N+ HYDY+YW++AGLS+VN   FL+CS +YG  +
Sbjct  505  LVGSLLVTIIADATRKGGVSWVSSNLNKAHYDYYYWIVAGLSVVNVFYFLLCSWAYGHCE  564

Query  190  DEK  182
            D+K
Sbjct  565  DKK  567



>gb|KDO66443.1| hypothetical protein CISIN_1g007637mg [Citrus sinensis]
Length=595

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 111/182 (61%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI +YDR ++P+  +  G+      K RMG G+ +S         VE+ RR  AI Q   
Sbjct  389  WIAIYDRAVVPILVKFTGHPRGLSPKMRMGIGLLLSAVSMASAAVVENKRRKFAIDQGLV  448

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +      MS +W++PQ++L+G+A   NA+ Q +F+ S+ P+SMS++A  ++ LG ++A+
Sbjct  449  DEPQKVMDMSAMWLIPQFSLIGLAEAFNAIGQIEFYYSQLPKSMSSMAMAIFTLGMAVAN  508

Query  361  ll----msSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            LL    +  ++ ++   G  SW++S++N+GH DYFYW+L  + +VNF  FL+C  +YGPS
Sbjct  509  LLGGLLVKIVDRVTRKHGKESWLSSNLNKGHLDYFYWLLMAMCLVNFGYFLVCCWAYGPS  568

Query  193  KD  188
             D
Sbjct  569  VD  570



>ref|XP_009628044.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
Length=226

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 113/174 (65%), Gaps = 4/174 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI++YDR+L+P+AS+I+G  V      R+G GIF+S    ++ G VE +RR  AI Q   
Sbjct  53   WILIYDRVLIPLASKIKGRQVRLRPIERIGIGIFISCMSMLVSGIVEHVRRRRAISQGLL  112

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++      MS +W++ Q++L GIA    A+ Q +F+ SE P++MS++AS L     A+  
Sbjct  113  NNPNRLVAMSAMWLIIQHSLNGIAKAFIAIGQTEFYYSELPKNMSSLASALFGLGSAVAN  172

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICS  212
             LAS++ S +++L+   G  SWI+S+IN+GHY+ +YW+LA ++  N + F++CS
Sbjct  173  LLASVIFSIVDKLTKGEGEESWISSNINKGHYENYYWLLAIMTAFNLVYFMVCS  226



>ref|XP_006451204.1| hypothetical protein CICLE_v10007800mg [Citrus clementina]
 gb|ESR64444.1| hypothetical protein CICLE_v10007800mg [Citrus clementina]
Length=598

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 110/182 (60%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI +YDR ++P+  +  G+      K RMG G+ +S         VE+ RR  AI Q   
Sbjct  392  WIAIYDRAVVPILVKFTGHPRGLSPKMRMGIGLLLSAVSMASAAVVENKRRKFAIDQGLV  451

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +      MS +W++PQ++L+G+A   NA+ Q +F+ S+ P+SMS++A  ++ LG ++A+
Sbjct  452  DEPQKVMDMSAMWLIPQFSLIGLAEAFNAIGQIEFYYSQLPKSMSSMAMAIFTLGMAVAN  511

Query  361  ll----msSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            LL    +  ++ ++   G  SW+ S++N+GH DYFYW+L  + +VNF  FL+C  +YGPS
Sbjct  512  LLGGLLVKIVDRITRKHGKESWLPSNLNKGHLDYFYWLLMAMCLVNFGYFLVCCWAYGPS  571

Query  193  KD  188
             D
Sbjct  572  VD  573



>ref|XP_009416500.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Musa acuminata 
subsp. malaccensis]
Length=609

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 104/184 (57%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDRL++P  S+I G       + RMG G  +S          E  RR  AI+Q  +
Sbjct  404  WVAIYDRLVVPPLSKITGRPRGFSLRQRMGIGQVLSCMATAAAAVTEGARRRRAIEQGLA  463

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgy----  374
             D  G   MS +W+VPQ  L G+A   N + Q +F+ SEFPRSM+++A +L  LG     
Sbjct  464  DDPQGMVNMSAMWLVPQNCLTGLAEALNLIGQLEFYYSEFPRSMASVAVSLLTLGMGFGN  523

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             ++S++ + +N++S   G  SW+  +IN+GH DY+YW+L  L +VN   F+ CS  YG  
Sbjct  524  LVSSVITALVNKISGADGGASWLDRNINKGHLDYYYWILTLLGIVNIFYFMACSLVYGEE  583

Query  193  KDEK  182
              +K
Sbjct  584  GQDK  587



>ref|XP_010648805.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Vitis vinifera]
Length=589

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 116/191 (61%), Gaps = 6/191 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKV-ESIRRSLAIKQEH  545
            WI +YD +L+P+ +R  G       K RMG G+ +S   A+ VG + ES+RR +A +Q  
Sbjct  387  WIPIYDIVLVPILARYTGCPRGLSMKFRMGIGLVLS-CVAMAVGAITESVRRRIANEQGL  445

Query  544  SSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyal----g  377
                     MS +W++PQ+ L G A   +A+ Q +F+ S+F +SMS+IA  L+ +     
Sbjct  446  DEQPAATLNMSAMWLLPQFILFGFAEAFSAIGQIEFYYSQFSKSMSSIAVALFTVGIAGS  505

Query  376  yslasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP  197
              + SLL++ +N ++   G  SW++S++N+GH DY+YW++  L ++N + FL+C  SYGP
Sbjct  506  NLVGSLLVNVVNSVTSKGGKESWLSSNLNKGHLDYYYWLITILCLINIIYFLVCCWSYGP  565

Query  196  SKDEKPVAMEE  164
             +DEKP   +E
Sbjct  566  FEDEKPGISDE  576



>ref|XP_009789264.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana sylvestris]
Length=473

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 118/182 (65%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ LYDR++LP+AS+IRG  V      RMG GIFVS    ++ G VE +RR  AI Q   
Sbjct  265  WVFLYDRVILPLASKIRGRAVRLTPIVRMGIGIFVSCMSMLVSGIVEHVRRRRAISQGLL  324

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
            ++  G  +MS +W++ Q +L GIA   +A+ Q +F+ SE P SMS++AS L     A+  
Sbjct  325  NNPEGLVEMSAMWLILQNSLNGIAEAFSAIGQTEFYYSELPSSMSSLASALLGLGMAVAN  384

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             LA +++S++++ +   G  SW++S IN+GHY+Y+YW+LA ++  N L F+ICS +YGP 
Sbjct  385  LLAIVILSAVDKYTKGDGKESWVSSSINKGHYEYYYWLLAIMTSFNLLYFMICSWAYGPC  444

Query  193  KD  188
             +
Sbjct  445  AN  446



>ref|XP_009780784.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like, partial [Nicotiana 
sylvestris]
Length=367

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 109/185 (59%), Gaps = 7/185 (4%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++LYDR+L+P+ S+  G        +RMGFG+ +S     L    ESIRR  AI+Q   
Sbjct  161  WLILYDRILVPLLSKYTGLREGLSPITRMGFGLVISCMSMALSAITESIRRQRAIEQGLE  220

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D      MS +W VPQYAL+G A  ++AV Q +F+ S  P+SM++IA  +     A+  
Sbjct  221  DDPKALVNMSAMWFVPQYALLGAAEAAHAVGQIEFYYSILPKSMASIAPAMYTIGTAVLG  280

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY---  203
             + S+L+S ++ L    G  SW++S+IN GH DY++W+L  +S++NF + ++C  +    
Sbjct  281  LVESILVSGVDWLISAGGKTSWLSSNINRGHLDYYFWLLTFMSVINFKIMMVCCTALLNN  340

Query  202  GPSKD  188
            GP  D
Sbjct  341  GPRND  345



>ref|XP_006475659.1| PREDICTED: probable peptide transporter At1g52190-like [Citrus 
sinensis]
Length=585

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 113/184 (61%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+++P+ S+          + R+G G+ +S     +   VE  RRS AI++  +
Sbjct  376  WVAIYDRVVVPLLSKFTNRPRGLSYRQRIGIGLAISCVAMAVAALVERKRRSAAIREGLA  435

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +  G   ++ +W+VPQ  L+G+A   NA+ Q +F+ S+FP++MS+I   L +LG ++ +
Sbjct  436  DNPEGVVALTAMWLVPQNCLIGLAEAFNAIGQIEFYYSQFPKTMSSIGVALLSLGMAVGN  495

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    N ++ + G  SW+++++N  HYDY+YW+L  LS+VNF  F+ CS +YG  
Sbjct  496  LVGSLIVTILNRVTGSGGKVSWVSTNVNRAHYDYYYWILCILSVVNFFYFIACSWAYGSC  555

Query  193  KDEK  182
            +D K
Sbjct  556  EDIK  559



>gb|KDO66442.1| hypothetical protein CISIN_1g007910mg [Citrus sinensis]
Length=585

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 113/184 (61%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+++P+ S+          + R+G G+ +S     +   VE  RRS AI++  +
Sbjct  376  WVAIYDRVVVPLLSKFTNRPRGLSYRQRIGIGLAISCVAMAVAALVERKRRSAAIREGLA  435

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +  G   ++ +W+VPQ  L+G+A   NA+ Q +F+ S+FP++MS+I   L +LG ++ +
Sbjct  436  DNPEGVVALTAMWLVPQNCLIGLAEAFNAIGQIEFYYSQFPKTMSSIGVALLSLGMAVGN  495

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    N ++ + G  SW+++++N  HYDY+YW+L  LS+VNF  F+ CS +YG  
Sbjct  496  LVGSLIVTILNRVTGSGGKVSWVSTNVNRAHYDYYYWILCILSVVNFFYFIACSWAYGSC  555

Query  193  KDEK  182
            +D K
Sbjct  556  EDIK  559



>ref|XP_006355952.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=582

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 110/182 (60%), Gaps = 4/182 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI  YDR+L+P+ S+  G        +RMG G+  S     L    ESIRR  AI++   
Sbjct  379  WIAFYDRVLVPLLSKYTGQPRGLSPVTRMGIGLISSAMSIALSAITESIRRQRAIEEGLE  438

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D      MS +W VPQYAL+G+A  ++ V Q +FF + FP+SMS+IAS++Y +G +++S
Sbjct  439  DDPNALVNMSAMWFVPQYALLGVAAATHGVGQVEFFYALFPKSMSSIASSMYTVGTAVSS  498

Query  361  l----lmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L    L+S ++ LS   G  SW++S+IN+GH DY++W L+ L  +NFL FL+  R Y   
Sbjct  499  LIGSILVSGVDWLSSTGGKTSWLSSNINKGHIDYYFWFLSVLGFLNFLYFLVVCRFYESL  558

Query  193  KD  188
             D
Sbjct  559  ND  560



>ref|XP_006451203.1| hypothetical protein CICLE_v10007831mg [Citrus clementina]
 gb|ESR64443.1| hypothetical protein CICLE_v10007831mg [Citrus clementina]
Length=585

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 113/184 (61%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+++P+ S+          + R+G G+ +S     +   VE  RRS AI++  +
Sbjct  376  WVAIYDRVVVPLLSKFTNRPRGLSYRQRIGIGLAISCVAMAVAALVERKRRSAAIREGLA  435

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +  G   ++ +W+VPQ  L+G+A   NA+ Q +F+ S+FP++MS+I   L +LG ++ +
Sbjct  436  DNPEGVVALTAMWLVPQNCLIGLAEAFNAIGQIEFYYSQFPKTMSSIGVALLSLGMAVGN  495

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    N ++ + G  SW+++++N  HYDY+YW+L  LS+VNF  F+ CS +YG  
Sbjct  496  LVGSLIVTILNRVTGSGGKVSWVSTNVNRAHYDYYYWILCILSVVNFFYFIACSWAYGSC  555

Query  193  KDEK  182
            +D K
Sbjct  556  EDIK  559



>gb|EYU29810.1| hypothetical protein MIMGU_mgv1a020560mg [Erythranthe guttata]
Length=609

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 110/179 (61%), Gaps = 6/179 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W++LYDR+++P+ S+   N       +R+G GIF+S         VE  RR+ AI Q   
Sbjct  388  WVILYDRVIVPLLSKHTNNPRGIKVITRIGIGIFISCMATATAALVERARRAKAIHQGLE  447

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                 +  MS LW++PQ+ L G+    NA+ Q + + S+FP+SM++I+  L+ALG + A+
Sbjct  448  ETPNAEVDMSALWLLPQHCLTGLGEALNAIGQIELYYSQFPKSMASISVALFALGMAFAN  507

Query  361  llmsSINEL------SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY  203
            ++ S I  +      S ++   SW+++++N+GHYDY+YW+L  LS+VNF+ F  CSR++
Sbjct  508  VVGSLIVNIVDVASKSADATKESWVSTNLNKGHYDYYYWILTLLSLVNFIYFYFCSRAF  566



>ref|XP_007204860.1| hypothetical protein PRUPE_ppa023390mg [Prunus persica]
 gb|EMJ06059.1| hypothetical protein PRUPE_ppa023390mg [Prunus persica]
Length=588

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 112/184 (61%), Gaps = 5/184 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+L+P+ S+          K R+G G+ +S        +VE  RR  AI++   
Sbjct  380  WVAIYDRILVPLVSKYTKRPRGFSFKQRIGAGLVISCLATAAAAEVERQRRKTAIQEGFL  439

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyal----gy  374
            S+  G   MS  W+V Q+ L G+A   NA+ Q +F+ S+FP+SMS+IA  L +L    G 
Sbjct  440  SNPKGVVSMSANWLVLQHCLTGLAEALNAIGQLEFYYSQFPKSMSSIAVALLSLGFGFGS  499

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             + SL++S +++++   G  SWI+SD+N  HYDY+YW+L  +S+VNF  FL+CS  YG  
Sbjct  500  LVGSLVVSILDDVTKKYGV-SWISSDLNRAHYDYYYWLLTAMSVVNFFYFLLCSWLYGHC  558

Query  193  KDEK  182
            +D+K
Sbjct  559  EDKK  562



>ref|XP_009609880.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
Length=226

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 107/191 (56%), Gaps = 6/191 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI +YDR+L+P  S+          K R+G G+  S     +   VE  RR+ A  +  +
Sbjct  27   WIAIYDRILVPWISKFTKKPRGLTFKQRIGIGLLFSCAAQAVAALVERERRARAQNEGLA  86

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             + L    MS  W+VPQ+ L G+A   NA+ Q +F+ S+FP+SM++I   L++LG    +
Sbjct  87   KNPLSQVNMSAFWLVPQHCLTGLAEAFNAIGQIEFYYSQFPKSMASIGVALFSLGMGFGN  146

Query  361  llmsSINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            +  S I E+    S   G  SW+++++N GHYDY+YWVL  LS+ N   F++C  +YG  
Sbjct  147  VFGSLIVEIVDHVSSKGGRVSWVSNNLNLGHYDYYYWVLCLLSVGNLFYFIVCGWAYGSD  206

Query  193  KDEKPVAMEED  161
            +D +    EED
Sbjct  207  EDTR--FWEED  215



>ref|XP_002318679.2| hypothetical protein POPTR_0012s08940g [Populus trichocarpa]
 gb|EEE96899.2| hypothetical protein POPTR_0012s08940g [Populus trichocarpa]
Length=589

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 118/193 (61%), Gaps = 7/193 (4%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDRLL+P+ ++          K RMG GI +S       G VE+ RR+ A++Q  +
Sbjct  382  WVAVYDRLLVPLLAKFTNRPQGLSNKQRMGIGIVISCIATATAGAVENKRRATALRQGLA  441

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                    MS  W++PQY L+G+    +AV Q  FF S+FP++M++IA  L++LG ++ +
Sbjct  442  DHPRDVVDMSANWLIPQYCLVGLGEAFSAVGQIDFFYSQFPKTMTSIAVALFSLGMAVGN  501

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    ++++   G  SW++ ++N+GHYDY+YW+L+ LS+VNF  +L+CS ++G  
Sbjct  502  LVASLIIGIVDDVTRRGGKVSWVSDNLNKGHYDYYYWLLSLLSLVNFFYYLLCSWAFGSE  561

Query  193  KDEK---PVAMEE  164
              E+     AMEE
Sbjct  562  DREEYDDGEAMEE  574



>ref|XP_010668218.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Beta vulgaris subsp. 
vulgaris]
Length=598

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 109/183 (60%), Gaps = 4/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YDR L+P+ ++  G     G + RMG G+ +S    ++ G VESIRRS A+KQ  +
Sbjct  399  WVAFYDRALVPLLAKFCGMPRGLGPRLRMGIGLLLSCIALLVAGFVESIRRSNALKQGLA  458

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                    MS  W++PQ  ++G+A G NAV Q +F+ S   +SMS+IA  ++ LG +++S
Sbjct  459  DKPNAVMDMSAYWLIPQLVILGLAEGFNAVGQIEFYYSHLSKSMSSIAMAIFTLGMAVSS  518

Query  361  llmsS----INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S     ++  +   G  SW++ ++N GH DY+YW+++ L ++NF  FL+C R YG  
Sbjct  519  LVSSLLVDIVDTATSTGGKVSWLSRNLNRGHVDYYYWLVSFLCLLNFFYFLVCCRIYGAD  578

Query  193  KDE  185
              E
Sbjct  579  PSE  581



>gb|KHN16613.1| Putative peptide transporter [Glycine soja]
Length=550

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 111/184 (60%), Gaps = 8/184 (4%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+++YDR+L+P+    R  TV    K RMG G+ +S    ++   VE  RR+ AI +   
Sbjct  352  WVIVYDRILVPILPNQRILTV----KLRMGIGLVISCLATLVATLVEKKRRNQAISEGFI  407

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +  G   MS +W+VP Y L G+A G   + Q +FF S+FP++MST+A +L  L   + +
Sbjct  408  DNPKGVVNMSAMWLVPSYCLFGLAQGFTVIGQIEFFYSQFPKTMSTVAVSLSTLNIGVGN  467

Query  361  llmsSINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I ++    +   G  SW+ S+IN GHYDY+Y +L  L++VN + FL+ SR+YG +
Sbjct  468  LVGSLIIKVVKDGTRRGGRASWLASNINRGHYDYYYGLLFILNLVNLVCFLVWSRAYGST  527

Query  193  KDEK  182
            +D K
Sbjct  528  QDIK  531



>ref|XP_009788943.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Nicotiana sylvestris]
 ref|XP_009788944.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Nicotiana sylvestris]
Length=581

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 109/182 (60%), Gaps = 1/182 (1%)
 Frame = -1

Query  718  IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS  539
            + +YDR+L+P  S+I  N      K RMG GI +S     +   VE  RR  A+ +  ++
Sbjct  385  VAIYDRILVPQISKITKNPRGLSFKQRMGIGILLSCAAQAVAALVEKERRVRALSEGLAN  444

Query  538  DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslasl  359
                   MS +W++PQ +L G+A   N + Q +F+ S+FP+SM++I   L ALG  + +L
Sbjct  445  HPFSQVNMSAMWLIPQNSLTGLAEAFNVIGQIEFYYSQFPKSMASIGVALLALGMGVGNL  504

Query  358  lmsSINE-LSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK  182
            + + I +  S   G  SW+ +++N GHYDY+YW+L  LS VNF  F++C+ +YG +++++
Sbjct  505  VGNLIVKYASTRGGKQSWVLNNLNLGHYDYYYWLLCFLSRVNFFYFIVCAWAYGSTEEQQ  564

Query  181  PV  176
             +
Sbjct  565  KI  566



>ref|XP_010051584.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Eucalyptus grandis]
 gb|KCW82406.1| hypothetical protein EUGRSUZ_C03811 [Eucalyptus grandis]
Length=574

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 121/191 (63%), Gaps = 5/191 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+L+P+ SR+         K RMG G+F+S     +   VE  RR+ AI+   +
Sbjct  380  WVGIYDRILVPLVSRLTDRPCGLTFKERMGIGLFISCASMFMSAAVERRRRAEAIRAGFT  439

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             D  G  KMS +W+VPQ+ L G+A   NA+ Q +F+ S+ P+SM +IA  L ALG ++ +
Sbjct  440  EDPHGVLKMSAMWLVPQHCLTGLAEPFNAIGQLEFYYSKLPKSMGSIAVALVALGGAVGN  499

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L  S I    + LS +  +G+WI++++N+GHYDY+YW+LA L+++NF  +L+C+ +Y   
Sbjct  500  LAASLILSILDRLSRSGRDGTWISTNVNKGHYDYYYWILAVLNVINFFYYLVCAWAY-EG  558

Query  193  KDEKPVAMEED  161
             +E+ V  E++
Sbjct  559  GEERQVWDEDE  569



>ref|XP_008793166.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Phoenix dactylifera]
Length=582

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 107/178 (60%), Gaps = 4/178 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDRL++P  + I G       K RMG G+ +S     +   VE  RR  AI+Q  +
Sbjct  377  WVAIYDRLIVPRLANITGRPRGLTLKQRMGIGLVLSCAATAVAATVERTRRRRAIEQGVA  436

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +      MS +W+VPQY L G++   N + Q +F+ SE P++M++IA  L +LG+ +  
Sbjct  437  DNEKAVIDMSAMWLVPQYCLTGLSEAFNIIGQIEFYYSELPKTMASIAVALLSLGWGVGD  496

Query  361  llmsSINEL--SINSGNG--SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG  200
            L+ + I  L   I++GNG   W+ S++NEGHYDY+YW+L  LS+VN   F +CS +YG
Sbjct  497  LVGALIVVLVKKISAGNGRVGWLDSNLNEGHYDYYYWILTLLSVVNVFYFFVCSWAYG  554



>ref|XP_008242634.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Prunus mume]
Length=588

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 109/183 (60%), Gaps = 3/183 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+L+P+ S+          K R+G G+ +S        +VE  RR  AI++   
Sbjct  380  WVAIYDRILVPLVSKYTKRPRGFSFKQRIGAGLVISCLATAAAAEVERQRRKTAIQEGFL  439

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            +   G   MS  W+V Q+ L G+A   NA+ Q +F+ S+FP+SMS+IA  L +LG+   S
Sbjct  440  NYPKGVVSMSANWLVLQHCLTGLAEALNAIGQLEFYYSQFPKSMSSIAVALLSLGFGFGS  499

Query  361  llmsSINEL--SINSGNG-SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK  191
            L+ S +  +   +   +G SWI+SD+N  HYDY+YW+L  +S+VNF  FL+CS  YG  +
Sbjct  500  LVGSLVVSIVDDVTKKDGVSWISSDLNRAHYDYYYWLLTAMSVVNFFYFLLCSWLYGHCE  559

Query  190  DEK  182
            D+K
Sbjct  560  DKK  562



>ref|XP_004151437.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=582

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 117/182 (64%), Gaps = 5/182 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YD++++P+ ++    +     K RMG G+ +S   +++  ++E  RR+ AI +  +
Sbjct  380  WVAIYDQIIVPLLAKFTKKSNGLTLKQRMGIGLVISCLASIVSAEIERKRRNRAIHEGLA  439

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgy----  374
            +   G  ++S +W+VPQ+ L G+A   NA+ Q QFF S+ PRSM++IA  L++LG     
Sbjct  440  NVPGGIVQLSAMWLVPQHCLAGLAEALNAIGQIQFFYSQLPRSMASIAVALFSLGMGGGS  499

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +A+L +S + + +  +G G W+++++N+GHYDY+YWVL+ + + N L +LICS  YG  
Sbjct  500  LVAALTVSVVKKRTKKNGKG-WLSNNLNQGHYDYYYWVLSLMGVANLLYYLICSWFYGDE  558

Query  193  KD  188
            K+
Sbjct  559  KE  560



>ref|XP_006586332.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=647

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 111/184 (60%), Gaps = 8/184 (4%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+++YDR+L+P+    R  TV    K RMG G+ +S    ++   VE  RR+ AI +   
Sbjct  449  WVIVYDRILVPILPNQRILTV----KLRMGIGLVISCLATLVATLVEKKRRNQAISEGFI  504

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
             +  G   MS +W+VP Y L G+A G   + Q +FF S+FP++MST+A +L  L   + +
Sbjct  505  DNPKGVVNMSAMWLVPSYCLFGLAQGFTVIGQIEFFYSQFPKTMSTVAVSLSTLNIGVGN  564

Query  361  llmsSINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I ++    +   G  SW+ S+IN GHYDY+Y +L  L++VN + FL+ SR+YG +
Sbjct  565  LVGSLIIKVVKDGTRRGGRASWLASNINRGHYDYYYGLLFILNLVNLVCFLVWSRAYGST  624

Query  193  KDEK  182
            +D K
Sbjct  625  QDIK  628



>ref|XP_004171650.1| PREDICTED: LOW QUALITY PROTEIN: probable peptide transporter 
At1g52190-like [Cucumis sativus]
Length=582

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 117/182 (64%), Gaps = 5/182 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YD++++P+ ++    +     K RMG G+ +S   +++  ++E  RR+ AI +  +
Sbjct  380  WVAIYDQIIVPLLAKFTKKSNGLTLKQRMGIGLVISCLASIVSAEIERKRRNRAIHEGLA  439

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgy----  374
            +   G  ++S +W+VPQ+ L G+A   NA+ Q QFF S+ PRSM++IA  L++LG     
Sbjct  440  NVPGGIVQLSAMWLVPQHCLAGLAEALNAIGQIQFFYSQLPRSMASIAVALFSLGMGGGS  499

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +A+L +S + + +  +G G W+++++N+GHYDY+YWVL+ + + N L +LICS  YG  
Sbjct  500  LVAALTVSVVKKRTKKNGKG-WLSNNLNQGHYDYYYWVLSLMGVANLLYYLICSWFYGDE  558

Query  193  KD  188
            K+
Sbjct  559  KE  560



>emb|CDP21853.1| unnamed protein product, partial [Coffea canephora]
Length=493

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 102/177 (58%), Gaps = 4/177 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+  YDR+L  + +R  GN        RMG G+ +SF   VL G VESIR   A++    
Sbjct  299  WVAFYDRVLALLLARYTGNPQGLSPIVRMGMGLVMSFIAMVLAGVVESIRLKKAVEDGVE  358

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgysla-  365
             D      MS +W+VPQ   +G+A    A+ Q QFF   FP+SMS++   ++ L  +LA 
Sbjct  359  DDPDAVLDMSAMWLVPQTVCIGLAEALFAIGQIQFFYMLFPKSMSSVGVAMFTLEMALAS  418

Query  364  ---sllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY  203
               SLL++ IN ++ + G  SW+ +++NEGH DY+YW+L  L+++N   FL C R Y
Sbjct  419  LIGSLLVNIINSITSHGGKASWLANNLNEGHLDYYYWLLGFLNLINLFYFLFCCRFY  475



>ref|XP_011040515.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Populus euphratica]
Length=596

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 117/193 (61%), Gaps = 7/193 (4%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDRLL+P+ S+          K RMG GI +S       G VE+ RR+ A++Q  +
Sbjct  388  WVAVYDRLLVPLLSKFTNRPQGLSHKQRMGIGIVISCIATATAGAVENKRRATALRQGLA  447

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                    MS  W++PQ+ L+G+    +A+ Q  FF S+FP++M++IA  L++LG ++ +
Sbjct  448  DHPRDVVDMSANWLIPQHCLVGLGEAFSAIGQIDFFYSQFPKTMTSIAVALFSLGMAVGN  507

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            L+ S I    ++++   G  SW++ ++N+GHYDY+YW+L+ LS+VNF  +L+C  +YG  
Sbjct  508  LVASLIIGIVDDVTRRGGKVSWVSDNLNKGHYDYYYWLLSLLSLVNFFYYLLCGWAYGSE  567

Query  193  KDEK---PVAMEE  164
              E+     AMEE
Sbjct  568  DREEYDDGEAMEE  580



>ref|XP_009774737.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like, partial [Nicotiana 
sylvestris]
Length=576

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 107/184 (58%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            WI +YDR+L+P  S+          K RMG G+ +S         VE  RR+ A+ +  +
Sbjct  376  WIAIYDRILVPWISKFTEKPRGLTFKQRMGIGLLLSCASQGAAALVERERRARALNEGLA  435

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
            +  L    MS +W+VPQ+ L G+A   NA+ Q +F+ S+FP+SM++I   L+ALG    +
Sbjct  436  NHPLSQVDMSAMWLVPQHCLTGLAEAFNAIGQIEFYYSQFPKSMASIGVALFALGMGFGN  495

Query  361  llmsSINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
            +  S I E+    S   G  SW+++++N GHYDY+YWVL  LS+ N   F++C+ +YG  
Sbjct  496  VFGSLIVEIVDHVSSRGGKVSWVSNNLNLGHYDYYYWVLCLLSVGNLFYFIVCAWAYGSD  555

Query  193  KDEK  182
            +D +
Sbjct  556  EDTR  559



>ref|XP_010656492.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Vitis vinifera]
Length=598

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 115/190 (61%), Gaps = 5/190 (3%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            ++V+YDR+L P+  +  GN     TK RMG G+ +S    VL   VESIRR  AI +  +
Sbjct  394  YVVIYDRVLTPILVKYTGNPRGLSTKLRMGLGLLLSLVGTVLCAIVESIRRRTAINEGLA  453

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMST----Iastlyalgy  374
                  + MS +W++PQY+L G+A   NAV Q +F+ S+FP+SM +    + +   AL  
Sbjct  454  DKPDAVTSMSAMWLIPQYSLFGLAEAMNAVGQIEFYYSQFPKSMYSMGMALHTLSTALSS  513

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             + + L+  ++ ++   GN SW++S+IN+GH DY+YW+L  + +VN + + +C  +YGP 
Sbjct  514  LVGAALVRIVDGVTGKGGNVSWLSSNINKGHLDYYYWLLTVMGVVNLVYYFLCCWAYGP-  572

Query  193  KDEKPVAMEE  164
             D +P+  +E
Sbjct  573  MDGEPLVRDE  582



>ref|XP_004503821.1| PREDICTED: probable peptide transporter At1g52190-like [Cicer 
arietinum]
Length=574

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 117/184 (64%), Gaps = 4/184 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W+ +YDR+++P+ ++          K RMG GI +S    ++   VE  RR+ AI++   
Sbjct  371  WVAIYDRVIVPMLTKYTKKGKGLSLKQRMGIGIALSCLATLVAALVEKKRRNEAIREGFI  430

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlya----lgy  374
            ++  G   MS +W+VPQY L+GIA   N + Q +FF S+FP++MS+IA  L+A     G 
Sbjct  431  NNPKGVVNMSAMWLVPQYCLVGIAEAFNVIGQIEFFYSQFPKTMSSIAVALFALGFGAGN  490

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS  194
             +ASL++  + + +   G  SW++S+IN+GHYDY+YW+L+ LS++N L F +CS +YG +
Sbjct  491  LVASLIVMVVKDGTRRGGKVSWLSSNINQGHYDYYYWLLSILSLINLLYFFVCSWAYGST  550

Query  193  KDEK  182
            +D K
Sbjct  551  EDIK  554



>ref|XP_008793165.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Phoenix dactylifera]
Length=610

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 99/178 (56%), Gaps = 4/178 (2%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W   YDR ++PV  +I         K RMG GI  +     +   VE++RR  AI+Q  +
Sbjct  411  WSAGYDRFIVPVLKKITRKPGAFTLKQRMGMGIIAATASMAVAAMVEAVRRRKAIEQGLA  470

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastl----yalgy  374
             D  G  +MS +W++PQY L G+A   + ++Q +F+ +E PRSM++    L         
Sbjct  471  DDMNGVVRMSAMWLIPQYCLSGLAEAFSVISQIEFYYAELPRSMASFGVALWTLGAGFSN  530

Query  373  slasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG  200
             +  L++  +   +  +G G W+ +++N GHYDY+YWVL  +  ++FL FL+CS +YG
Sbjct  531  LVGLLVVKIVTRTTGRNGRGMWLATNLNRGHYDYYYWVLTLMGAIDFLYFLVCSWAYG  588



>ref|XP_003567138.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Brachypodium distachyon]
Length=576

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 100/178 (56%), Gaps = 11/178 (6%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS  542
            W   YDR + PV  RI GN      K R+G G+ ++    V+   VE  RR LA+     
Sbjct  387  WSGSYDRWIAPVLQRITGNPRGLTMKQRIGAGLVLATAGMVVSAAVEGARRRLALSG---  443

Query  541  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlyalgyslas  362
                G   MS  W+VPQ+ALMG+A     + + +FF +E P+SM++ +  L  +   + +
Sbjct  444  ----GGGTMSAFWLVPQFALMGLAEAFGVIGELEFFYTELPKSMASFSMALLYMAMGVGN  499

Query  361  llmsSI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG  200
            L+ S I    +E S + G  SW++SD+N GHYDY+YW+LA L  +NF+ FL C  +YG
Sbjct  500  LVNSLIVKVVHEASRHGGRTSWLSSDLNLGHYDYYYWLLACLGALNFVYFLCCGWAYG  557



>ref|XP_003569868.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Brachypodium distachyon]
Length=586

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 117/198 (59%), Gaps = 14/198 (7%)
 Frame = -1

Query  721  WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVG---KVESIRRSLAIKQ  551
            W+ +YDR+L+   SR+ G       + RMG G+ +   +AV +G   + E++RR+ AI +
Sbjct  385  WVAVYDRVLVGPLSRLTGRARGLSLRQRMGLGLII---FAVAMGVAARTETLRRAAAIAE  441

Query  550  ---EHSSDNLGDS-KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIastlya  383
               +      G + +MS + +VPQ+ LMG+A   N + Q +F+ SEFP++MS+I  +L A
Sbjct  442  GLRDVDPQTTGRTVRMSAMRLVPQHCLMGLAEALNLIGQIEFYYSEFPKTMSSIGVSLLA  501

Query  382  ----lgyslasllmsSINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLIC  215
                 G  L S ++  I+  +   G  SW++S++N GHYDY+Y VLAGLS+ NF+ F+ C
Sbjct  502  LGMGCGALLGSAIVGIISRATGADGRDSWVSSNLNRGHYDYYYMVLAGLSVANFVYFVWC  561

Query  214  SRSYGPSKDEKPVAMEED  161
              +YG     + +A E++
Sbjct  562  GWTYGEEGQNRVMATEDE  579



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425