BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF041M10

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011093914.1|  PREDICTED: organic cation/carnitine transpor...    185   2e-51   Sesamum indicum [beniseed]
ref|XP_011093913.1|  PREDICTED: organic cation/carnitine transpor...    185   2e-51   Sesamum indicum [beniseed]
gb|EYU25780.1|  hypothetical protein MIMGU_mgv1a005148mg                179   4e-49   Erythranthe guttata [common monkey flower]
ref|XP_011093921.1|  PREDICTED: organic cation/carnitine transpor...    175   9e-48   Sesamum indicum [beniseed]
ref|XP_011093916.1|  PREDICTED: organic cation/carnitine transpor...    175   9e-48   Sesamum indicum [beniseed]
ref|XP_006353741.1|  PREDICTED: organic cation/carnitine transpor...    172   6e-47   Solanum tuberosum [potatoes]
ref|XP_010323959.1|  PREDICTED: organic cation/carnitine transpor...    172   7e-47   Solanum lycopersicum
ref|XP_009800312.1|  PREDICTED: organic cation/carnitine transpor...    171   2e-46   Nicotiana sylvestris
gb|KDO73404.1|  hypothetical protein CISIN_1g026854mg                   164   3e-46   Citrus sinensis [apfelsine]
ref|XP_009620262.1|  PREDICTED: organic cation/carnitine transpor...    169   2e-45   Nicotiana tomentosiformis
ref|XP_006453138.1|  hypothetical protein CICLE_v10008136mg             164   1e-44   
ref|XP_011017555.1|  PREDICTED: organic cation/carnitine transpor...    166   2e-44   Populus euphratica
ref|XP_006372271.1|  hypothetical protein POPTR_0018s14850g             162   3e-44   
ref|XP_006453137.1|  hypothetical protein CICLE_v10008136mg             164   6e-44   Citrus clementina [clementine]
ref|XP_007023583.1|  Major facilitator superfamily protein isoform 1    164   8e-44   
ref|XP_002527821.1|  sugar transporter, putative                        164   8e-44   
ref|XP_007023584.1|  Major facilitator superfamily protein isoform 2    162   3e-43   
emb|CDP14263.1|  unnamed protein product                                162   6e-43   Coffea canephora [robusta coffee]
gb|KDP45839.1|  hypothetical protein JCGZ_17446                         162   8e-43   Jatropha curcas
ref|XP_009344025.1|  PREDICTED: LOW QUALITY PROTEIN: organic cati...    161   1e-42   
gb|KHG19767.1|  Organic cation/carnitine transporter 7 -like protein    158   4e-42   Gossypium arboreum [tree cotton]
ref|XP_011017563.1|  PREDICTED: organic cation/carnitine transpor...    160   4e-42   Populus euphratica
ref|XP_006372262.1|  hypothetical protein POPTR_0018s14760g             160   4e-42   
ref|XP_009346014.1|  PREDICTED: organic cation/carnitine transpor...    159   4e-42   Pyrus x bretschneideri [bai li]
ref|XP_008348401.1|  PREDICTED: organic cation/carnitine transpor...    159   5e-42   Malus domestica [apple tree]
gb|KDO73405.1|  hypothetical protein CISIN_1g024637mg                   154   6e-42   Citrus sinensis [apfelsine]
gb|KJB68008.1|  hypothetical protein B456_010G222000                    158   1e-41   Gossypium raimondii
ref|XP_010927139.1|  PREDICTED: organic cation/carnitine transpor...    156   2e-41   Elaeis guineensis
gb|KDO37521.1|  hypothetical protein CISIN_1g015075mg                   155   2e-41   Citrus sinensis [apfelsine]
gb|KDO37523.1|  hypothetical protein CISIN_1g015075mg                   155   4e-41   Citrus sinensis [apfelsine]
ref|XP_010927137.1|  PREDICTED: organic cation/carnitine transpor...    157   5e-41   Elaeis guineensis
emb|CAN64534.1|  hypothetical protein VITISV_042940                     156   6e-41   Vitis vinifera
ref|XP_002528039.1|  sugar transporter, putative                        157   6e-41   Ricinus communis
gb|KDO37522.1|  hypothetical protein CISIN_1g015075mg                   155   6e-41   Citrus sinensis [apfelsine]
ref|XP_010034101.1|  PREDICTED: organic cation/carnitine transpor...    156   6e-41   Eucalyptus grandis [rose gum]
ref|XP_006453136.1|  hypothetical protein CICLE_v10008131mg             154   6e-41   
gb|KDO67077.1|  hypothetical protein CISIN_1g010268mg                   156   7e-41   Citrus sinensis [apfelsine]
ref|XP_008796960.1|  PREDICTED: organic cation/carnitine transpor...    156   7e-41   
ref|XP_011467508.1|  PREDICTED: organic cation/carnitine transpor...    156   8e-41   Fragaria vesca subsp. vesca
ref|XP_007215272.1|  hypothetical protein PRUPE_ppa004702mg             156   9e-41   Prunus persica
ref|XP_002273636.1|  PREDICTED: organic cation/carnitine transpor...    156   9e-41   Vitis vinifera
ref|XP_006488615.1|  PREDICTED: organic cation/carnitine transpor...    156   1e-40   Citrus sinensis [apfelsine]
ref|XP_008228025.1|  PREDICTED: organic cation/carnitine transpor...    155   1e-40   Prunus mume [ume]
gb|KDO67076.1|  hypothetical protein CISIN_1g010268mg                   156   1e-40   Citrus sinensis [apfelsine]
ref|XP_004140724.1|  PREDICTED: organic cation/carnitine transpor...    155   1e-40   Cucumis sativus [cucumbers]
ref|XP_004157349.1|  PREDICTED: LOW QUALITY PROTEIN: organic cati...    155   2e-40   
ref|XP_006453135.1|  hypothetical protein CICLE_v10008131mg             155   2e-40   Citrus clementina [clementine]
ref|XP_010278453.1|  PREDICTED: organic cation/carnitine transpor...    155   3e-40   Nelumbo nucifera [Indian lotus]
ref|XP_008456184.1|  PREDICTED: organic cation/carnitine transpor...    155   3e-40   Cucumis melo [Oriental melon]
ref|XP_008342934.1|  PREDICTED: organic cation/carnitine transpor...    145   5e-40   
ref|XP_011093928.1|  PREDICTED: organic cation/carnitine transpor...    154   6e-40   Sesamum indicum [beniseed]
ref|XP_006380839.1|  hypothetical protein POPTR_0007s15120g             153   1e-39   
ref|XP_003604112.1|  Synaptic vesicle 2-related protein                 153   1e-39   Medicago truncatula
ref|XP_007135876.1|  hypothetical protein PHAVU_010G165500g             152   1e-39   Phaseolus vulgaris [French bean]
ref|XP_006380840.1|  transporter-related family protein                 152   2e-39   
ref|XP_006380838.1|  hypothetical protein POPTR_0007s15120g             152   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_002310344.2|  hypothetical protein POPTR_0007s15120g             153   3e-39   
ref|XP_007135877.1|  hypothetical protein PHAVU_010G165500g             152   3e-39   Phaseolus vulgaris [French bean]
ref|XP_004507561.1|  PREDICTED: organic cation/carnitine transpor...    152   3e-39   
gb|KJB23422.1|  hypothetical protein B456_004G097300                    148   4e-39   Gossypium raimondii
ref|XP_006380841.1|  hypothetical protein POPTR_0007s15130g             150   4e-39   
ref|XP_007014586.1|  Major facilitator superfamily protein, putat...    151   6e-39   
ref|XP_007014587.1|  Major facilitator superfamily protein, putat...    151   6e-39   
ref|XP_006582968.1|  PREDICTED: organic cation/carnitine transpor...    149   9e-39   Glycine max [soybeans]
ref|XP_011031262.1|  PREDICTED: organic cation/carnitine transpor...    151   9e-39   Populus euphratica
gb|EYU21187.1|  hypothetical protein MIMGU_mgv1a005199mg                150   9e-39   Erythranthe guttata [common monkey flower]
ref|XP_010928751.1|  PREDICTED: organic cation/carnitine transpor...    149   9e-39   Elaeis guineensis
gb|KHG05838.1|  Organic cation/carnitine transporter 7                  147   1e-38   Gossypium arboreum [tree cotton]
ref|XP_010928752.1|  PREDICTED: organic cation/carnitine transpor...    149   1e-38   Elaeis guineensis
gb|KHN39387.1|  Organic cation/carnitine transporter 7                  149   1e-38   Glycine soja [wild soybean]
ref|XP_002310345.2|  transporter-related family protein                 149   2e-38   
ref|XP_006582967.1|  PREDICTED: organic cation/carnitine transpor...    149   2e-38   
gb|KDO73400.1|  hypothetical protein CISIN_1g011416mg                   147   2e-38   Citrus sinensis [apfelsine]
ref|XP_010928750.1|  PREDICTED: organic cation/carnitine transpor...    149   3e-38   Elaeis guineensis
gb|KHN38113.1|  Organic cation/carnitine transporter 7                  149   3e-38   Glycine soja [wild soybean]
ref|XP_010421981.1|  PREDICTED: organic cation/carnitine transpor...    147   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_011031259.1|  PREDICTED: organic cation/carnitine transpor...    149   4e-38   Populus euphratica
gb|ABK96271.1|  unknown                                                 140   5e-38   Populus trichocarpa x Populus deltoides
ref|XP_006585686.1|  PREDICTED: organic cation/carnitine transpor...    148   6e-38   Glycine max [soybeans]
gb|KJB23424.1|  hypothetical protein B456_004G097300                    148   6e-38   Gossypium raimondii
gb|AFH57281.1|  MFS                                                     148   6e-38   Gossypium hirsutum [American cotton]
gb|KDO73398.1|  hypothetical protein CISIN_1g011416mg                   147   6e-38   Citrus sinensis [apfelsine]
gb|KDO73401.1|  hypothetical protein CISIN_1g011416mg                   147   8e-38   Citrus sinensis [apfelsine]
gb|KJB23421.1|  hypothetical protein B456_004G097300                    148   8e-38   Gossypium raimondii
ref|XP_010465101.1|  PREDICTED: organic cation/carnitine transpor...    147   1e-37   Camelina sativa [gold-of-pleasure]
gb|KDP25026.1|  hypothetical protein JCGZ_22561                         148   1e-37   Jatropha curcas
gb|KDO73399.1|  hypothetical protein CISIN_1g011416mg                   147   1e-37   Citrus sinensis [apfelsine]
ref|XP_006453139.1|  hypothetical protein CICLE_v10008130mg             147   1e-37   Citrus clementina [clementine]
ref|XP_010421982.1|  PREDICTED: organic cation/carnitine transpor...    147   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010421978.1|  PREDICTED: organic cation/carnitine transpor...    147   1e-37   
ref|XP_010499859.1|  PREDICTED: organic cation/carnitine transpor...    147   1e-37   
ref|XP_010552380.1|  PREDICTED: organic cation/carnitine transpor...    147   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_006425192.1|  hypothetical protein CICLE_v10028224mg             146   3e-37   Citrus clementina [clementine]
ref|XP_010696144.1|  PREDICTED: organic cation/carnitine transpor...    146   4e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002882803.1|  hypothetical protein ARALYDRAFT_318077             145   6e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_006407270.1|  hypothetical protein EUTSA_v10020555mg             145   6e-37   Eutrema salsugineum [saltwater cress]
dbj|BAB02515.1|  transporter-like protein                               144   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006474362.1|  PREDICTED: organic cation/carnitine transpor...    143   1e-36   Citrus sinensis [apfelsine]
gb|KDO73389.1|  hypothetical protein CISIN_1g0117562mg                  143   1e-36   Citrus sinensis [apfelsine]
gb|KDO73393.1|  hypothetical protein CISIN_1g0117562mg                  143   1e-36   Citrus sinensis [apfelsine]
gb|KJB56470.1|  hypothetical protein B456_009G120800                    144   2e-36   Gossypium raimondii
ref|NP_187911.1|  nicotinate transporter                                144   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299899.1|  hypothetical protein CARUB_v10016107mg             144   2e-36   Capsella rubella
ref|XP_006453145.1|  hypothetical protein CICLE_v10008343mg             143   2e-36   
ref|XP_010232292.1|  PREDICTED: organic cation/carnitine transpor...    142   2e-36   Brachypodium distachyon [annual false brome]
gb|KDO73394.1|  hypothetical protein CISIN_1g0117562mg                  143   2e-36   Citrus sinensis [apfelsine]
ref|XP_006453141.1|  hypothetical protein CICLE_v10008092mg             140   2e-36   
ref|XP_006652797.1|  PREDICTED: organic cation/carnitine transpor...    144   3e-36   Oryza brachyantha
gb|KDO73388.1|  hypothetical protein CISIN_1g0117562mg                  143   3e-36   Citrus sinensis [apfelsine]
ref|XP_006474361.1|  PREDICTED: organic cation/carnitine transpor...    143   4e-36   Citrus sinensis [apfelsine]
gb|KDO73396.1|  hypothetical protein CISIN_1g017193mg                   141   7e-36   Citrus sinensis [apfelsine]
ref|XP_003562063.1|  PREDICTED: organic cation/carnitine transpor...    142   1e-35   
gb|EMT10390.1|  Putative transporter                                    142   1e-35   
ref|XP_006353753.1|  PREDICTED: organic cation/carnitine transpor...    141   1e-35   Solanum tuberosum [potatoes]
emb|CDY51903.1|  BnaC03g73660D                                          141   2e-35   Brassica napus [oilseed rape]
ref|XP_002466771.1|  hypothetical protein SORBIDRAFT_01g013920          141   2e-35   Sorghum bicolor [broomcorn]
ref|NP_001132445.1|  uncharacterized protein LOC100193898               135   2e-35   
ref|XP_006453143.1|  hypothetical protein CICLE_v10008092mg             140   2e-35   Citrus clementina [clementine]
ref|XP_006453144.1|  hypothetical protein CICLE_v10008092mg             140   3e-35   Citrus clementina [clementine]
ref|XP_009135279.1|  PREDICTED: organic cation/carnitine transpor...    140   3e-35   Brassica rapa
ref|XP_006650328.1|  PREDICTED: organic cation/carnitine transpor...    140   4e-35   Oryza brachyantha
ref|XP_010240389.1|  PREDICTED: organic cation/carnitine transpor...    139   5e-35   Brachypodium distachyon [annual false brome]
gb|KJB23415.1|  hypothetical protein B456_004G097400                    140   6e-35   Gossypium raimondii
ref|XP_006474360.1|  PREDICTED: organic cation/carnitine transpor...    138   1e-34   
gb|EEE61651.1|  hypothetical protein OsJ_16102                          138   1e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009124704.1|  PREDICTED: organic cation/carnitine transpor...    139   1e-34   Brassica rapa
ref|XP_010675319.1|  PREDICTED: organic cation/carnitine transpor...    139   1e-34   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY43379.1|  BnaA01g30100D                                          139   1e-34   Brassica napus [oilseed rape]
ref|XP_010240388.1|  PREDICTED: organic cation/carnitine transpor...    139   1e-34   Brachypodium distachyon [annual false brome]
ref|XP_009620247.1|  PREDICTED: organic cation/carnitine transpor...    139   1e-34   Nicotiana tomentosiformis
gb|ABF97804.1|  major facilitator superfamily protein, expressed        139   1e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006453149.1|  hypothetical protein CICLE_v10008141mg             139   2e-34   Citrus clementina [clementine]
ref|NP_001050729.1|  Os03g0638200                                       138   2e-34   
gb|EAY91140.1|  hypothetical protein OsI_12746                          138   2e-34   Oryza sativa Indica Group [Indian rice]
emb|CAH67747.1|  H0702G05.6                                             138   2e-34   Oryza sativa [red rice]
gb|EEC77965.1|  hypothetical protein OsI_17329                          138   2e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_009800311.1|  PREDICTED: organic cation/carnitine transpor...    138   3e-34   Nicotiana sylvestris
ref|XP_004982355.1|  PREDICTED: organic cation/carnitine transpor...    138   3e-34   Setaria italica
ref|XP_003562078.1|  PREDICTED: organic cation/carnitine transpor...    138   3e-34   Brachypodium distachyon [annual false brome]
ref|XP_002460658.1|  hypothetical protein SORBIDRAFT_02g032700          138   3e-34   Sorghum bicolor [broomcorn]
emb|CAE03655.2|  OSJNBa0060N03.20                                       138   3e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006353755.1|  PREDICTED: organic cation/carnitine transpor...    137   3e-34   Solanum tuberosum [potatoes]
gb|ACF86638.1|  unknown                                                 135   4e-34   Zea mays [maize]
ref|XP_010087072.1|  Organic cation/carnitine transporter 7             137   4e-34   
ref|XP_002466770.1|  hypothetical protein SORBIDRAFT_01g013910          137   4e-34   Sorghum bicolor [broomcorn]
emb|CDY24225.1|  BnaC01g38050D                                          137   5e-34   Brassica napus [oilseed rape]
ref|XP_010675316.1|  PREDICTED: organic cation/carnitine transpor...    137   5e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004983024.1|  PREDICTED: organic cation/carnitine transpor...    137   6e-34   Setaria italica
ref|XP_008669247.1|  PREDICTED: major facilitator superfamily pro...    135   6e-34   
ref|XP_010675318.1|  PREDICTED: organic cation/carnitine transpor...    137   6e-34   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK07186.1|  predicted protein                                      137   7e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002467179.1|  hypothetical protein SORBIDRAFT_01g020990          136   8e-34   
ref|XP_008681210.1|  PREDICTED: uncharacterized protein LOC100193...    135   9e-34   Zea mays [maize]
dbj|BAK04403.1|  predicted protein                                      135   1e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN36932.1|  unknown                                                 135   2e-33   Zea mays [maize]
ref|XP_011093924.1|  PREDICTED: organic cation/carnitine transpor...    135   2e-33   Sesamum indicum [beniseed]
ref|XP_008681209.1|  PREDICTED: uncharacterized protein LOC100193...    135   2e-33   
ref|NP_001106048.1|  major facilitator superfamily protein              135   2e-33   Zea mays [maize]
ref|XP_004957628.1|  PREDICTED: organic cation/carnitine transpor...    135   2e-33   
ref|XP_004957629.1|  PREDICTED: organic cation/carnitine transpor...    135   2e-33   Setaria italica
gb|AFW68691.1|  hypothetical protein ZEAMMB73_097319                    135   2e-33   
ref|XP_004957627.1|  PREDICTED: organic cation/carnitine transpor...    135   2e-33   
ref|NP_001063920.1|  Os09g0559800                                       135   2e-33   
dbj|BAJ87199.1|  predicted protein                                      135   2e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE70213.1|  hypothetical protein OsJ_30325                          135   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008680040.1|  PREDICTED: synaptic vesicle 2-related protei...    135   3e-33   
ref|NP_001151801.1|  synaptic vesicle 2-related protein                 135   3e-33   
ref|XP_006660972.1|  PREDICTED: organic cation/carnitine transpor...    135   3e-33   Oryza brachyantha
ref|XP_008680034.1|  PREDICTED: synaptic vesicle 2-related protei...    135   3e-33   Zea mays [maize]
ref|XP_006660971.1|  PREDICTED: organic cation/carnitine transpor...    135   3e-33   Oryza brachyantha
gb|EMT04717.1|  Synaptic vesicle 2-related protein                      134   4e-33   
ref|XP_006353754.1|  PREDICTED: organic cation/carnitine transpor...    134   6e-33   Solanum tuberosum [potatoes]
ref|XP_003578642.1|  PREDICTED: organic cation/carnitine transpor...    134   8e-33   
ref|XP_010542536.1|  PREDICTED: organic cation/carnitine transpor...    134   1e-32   Tarenaya hassleriana [spider flower]
ref|XP_009397383.1|  PREDICTED: organic cation/carnitine transpor...    132   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004982359.1|  PREDICTED: organic cation/carnitine transpor...    132   1e-32   Setaria italica
ref|XP_002513292.1|  sugar transporter, putative                        133   2e-32   
ref|XP_009397373.1|  PREDICTED: organic cation/carnitine transpor...    132   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004982358.1|  PREDICTED: organic cation/carnitine transpor...    131   5e-32   Setaria italica
ref|XP_008670376.1|  PREDICTED: organic cation/carnitine transpor...    131   5e-32   
ref|XP_004982357.1|  PREDICTED: organic cation/carnitine transpor...    131   5e-32   
tpg|DAA40755.1|  TPA: hypothetical protein ZEAMMB73_392255              131   6e-32   
ref|XP_002964441.1|  hypothetical protein SELMODRAFT_81650              130   9e-32   
ref|XP_002975354.1|  hypothetical protein SELMODRAFT_103160             130   9e-32   
ref|XP_004983097.1|  PREDICTED: organic cation/carnitine transpor...    130   1e-31   Setaria italica
ref|XP_001770703.1|  predicted protein                                  129   5e-31   
dbj|BAJ96217.1|  predicted protein                                      129   5e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008674891.1|  PREDICTED: synaptic vesicle 2-related protei...    128   6e-31   Zea mays [maize]
gb|EMT10389.1|  Synaptic vesicle 2-related protein                      129   6e-31   
gb|EMT01283.1|  Synaptic vesicle 2-related protein                      130   9e-31   
dbj|BAJ90022.1|  predicted protein                                      127   1e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGX85879.1|  copper transporter                                      127   2e-30   Triticum aestivum [Canadian hard winter wheat]
gb|EMS56043.1|  Synaptic vesicle 2-related protein                      129   2e-30   Triticum urartu
gb|AGX85880.1|  copper transporter                                      127   2e-30   Triticum aestivum [Canadian hard winter wheat]
emb|CDP14260.1|  unnamed protein product                                127   2e-30   Coffea canephora [robusta coffee]
emb|CDP14261.1|  unnamed protein product                                126   4e-30   Coffea canephora [robusta coffee]
emb|CDP14262.1|  unnamed protein product                                125   6e-30   Coffea canephora [robusta coffee]
ref|XP_011093923.1|  PREDICTED: organic cation/carnitine transpor...    125   6e-30   Sesamum indicum [beniseed]
ref|XP_011093922.1|  PREDICTED: organic cation/carnitine transpor...    125   7e-30   Sesamum indicum [beniseed]
ref|XP_004243672.1|  PREDICTED: organic cation/carnitine transpor...    125   1e-29   Solanum lycopersicum
gb|EMT01595.1|  Synaptic vesicle 2-related protein                      117   9e-28   
emb|CDX82560.1|  BnaA03g32610D                                          120   2e-27   
gb|EPS64332.1|  hypothetical protein M569_10450                         117   5e-27   Genlisea aurea
gb|EMS60580.1|  Synaptic vesicle 2-related protein                      117   6e-27   Triticum urartu
ref|XP_011018199.1|  PREDICTED: organic cation/carnitine transpor...    115   2e-26   Populus euphratica
dbj|BAJ86078.1|  predicted protein                                      114   5e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96504.1|  predicted protein                                      114   5e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001774058.1|  predicted protein                                  114   7e-26   
dbj|BAJ92143.1|  predicted protein                                      114   9e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006372273.1|  hypothetical protein POPTR_0018s14860g             110   2e-24   
ref|XP_003562867.1|  PREDICTED: organic cation/carnitine transpor...    108   5e-24   Brachypodium distachyon [annual false brome]
gb|EEE67444.1|  hypothetical protein OsJ_24811                          108   4e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002463060.1|  hypothetical protein SORBIDRAFT_02g036920          106   5e-23   
gb|EEC82301.1|  hypothetical protein OsI_26552                          103   6e-22   Oryza sativa Indica Group [Indian rice]
ref|NP_001060053.1|  Os07g0571700                                       103   6e-22   
ref|XP_001753056.1|  predicted protein                                  102   6e-22   
ref|NP_001168223.1|  hypothetical protein                               102   2e-21   Zea mays [maize]
ref|XP_008668303.1|  PREDICTED: hypothetical protein isoform X1         102   2e-21   Zea mays [maize]
ref|XP_004958088.1|  PREDICTED: organic cation/carnitine transpor...    101   3e-21   Setaria italica
ref|XP_011093915.1|  PREDICTED: organic cation/carnitine transpor...    100   6e-21   Sesamum indicum [beniseed]
ref|XP_011094025.1|  PREDICTED: organic cation/carnitine transpor...  98.2    4e-20   Sesamum indicum [beniseed]
ref|XP_004981616.1|  PREDICTED: organic cation/carnitine transpor...  97.1    9e-20   Setaria italica
ref|XP_006374731.1|  hypothetical protein POPTR_0014s00300g           90.9    1e-19   
tpg|DAA50363.1|  TPA: hypothetical protein ZEAMMB73_018003            94.0    1e-18   
ref|XP_004958086.1|  PREDICTED: organic cation/carnitine transpor...  91.3    1e-17   Setaria italica
ref|XP_007510245.1|  predicted protein                                90.9    2e-17   Bathycoccus prasinos
gb|KHF36311.1|  putative niacin/nicotinamide transporter NaiP         87.0    3e-17   Paenibacillus sp. P1XP2
ref|XP_004958087.1|  PREDICTED: organic cation/carnitine transpor...  87.0    2e-16   
ref|WP_009672674.1|  MULTISPECIES: major facilitator transporter      83.6    3e-15   Paenibacillus
ref|XP_001420126.1|  MFS family transporter: sugar                    84.3    4e-15   Ostreococcus lucimarinus CCE9901
ref|WP_042227166.1|  major facilitator transporter                    83.2    5e-15   Paenibacillus chitinolyticus
ref|XP_002499721.1|  major facilitator superfamily                    83.6    6e-15   Micromonas commoda
gb|ADE77746.1|  unknown                                               80.5    7e-15   Picea sitchensis
gb|EMS63401.1|  Synaptic vesicle 2-related protein                    82.8    1e-14   Triticum urartu
gb|EYU25778.1|  hypothetical protein MIMGU_mgv1a0062852mg             74.7    5e-14   Erythranthe guttata [common monkey flower]
ref|WP_027084688.1|  major facilitator transporter                    79.3    9e-14   Cohnella panacarvi
ref|XP_003081589.1|  Synaptic vesicle transporter SVOP and relate...  80.1    1e-13   
ref|WP_020961827.1|  hypothetical protein                             79.0    1e-13   Thermofilum adornatus
gb|AJB42259.1|  Niacin transporter NiaP                               79.0    1e-13   Thermofilum carboxyditrophus 1505
ref|WP_023965369.1|  niacin transporter NiaP                          79.0    1e-13   Paenibacillus sp. JCM 10914
ref|WP_043097935.1|  sugar transporter                                78.6    2e-13   
gb|KFN08985.1|  sugar (and other) transporter family protein          78.2    3e-13   Paenibacillus macerans
ref|WP_036628046.1|  major facilitator transporter                    77.8    3e-13   
ref|WP_007131744.1|  major facilitator transporter                    77.0    5e-13   Paenibacillus lactis
ref|WP_028405052.1|  major facilitator transporter                    77.0    5e-13   Bacillus sp. J13
ref|WP_027889084.1|  major facilitator transporter                    77.4    5e-13   Megamonas hypermegale
ref|WP_027092773.1|  major facilitator transporter                    77.0    6e-13   Cohnella thermotolerans
ref|WP_042161716.1|  major facilitator transporter                    77.0    6e-13   Paenibacillus gorillae
ref|WP_009590119.1|  major facilitator transporter                    76.6    7e-13   Paenibacillus sp. HGF5
gb|ETT61401.1|  major facilitator superfamily protein                 76.6    7e-13   Paenibacillus sp. FSL H8-457
ref|WP_014901441.1|  major facilitator transporter                    77.0    7e-13   Desulfosporosinus meridiei
ref|XP_011444448.1|  PREDICTED: synaptic vesicle 2-related protei...  77.4    7e-13   Crassostrea gigas
ref|WP_015737538.1|  MULTISPECIES: major facilitator transporter      76.6    7e-13   Paenibacillus
ref|WP_043930171.1|  major facilitator transporter                    76.3    9e-13   Bacillus sp. EB01
ref|WP_044479889.1|  major facilitator transporter                    76.3    1e-12   Paenibacillus antibioticophila
ref|WP_042219634.1|  major facilitator transporter                    76.3    1e-12   Paenibacillus borealis
ref|WP_021259515.1|  MULTISPECIES: major facilitator superfamily ...  76.3    1e-12   Paenibacillus
ref|WP_042696909.1|  NiaP-like niacin transporter                     76.3    1e-12   Thermococcus sp. PK
ref|WP_021254401.1|  MULTISPECIES: major facilitator superfamily ...  76.3    1e-12   Paenibacillus
ref|WP_042182772.1|  MULTISPECIES: major facilitator transporter      75.9    1e-12   Paenibacillus
gb|EFU38404.1|  major facilitator superfamily MFS_1                   75.9    1e-12   Paenibacillus vortex V453
ref|WP_034596660.1|  major facilitator transporter                    75.9    1e-12   Desulfosporosinus sp. HMP52
gb|ETT31211.1|  major facilitator superfamily protein                 75.9    1e-12   Paenibacillus sp. FSL R5-808
ref|WP_036643539.1|  major facilitator transporter                    75.9    1e-12   Paenibacillus
ref|WP_040681059.1|  major facilitator transporter                    75.9    1e-12   Paenibacillus
ref|WP_028589276.1|  major facilitator transporter                    75.9    1e-12   Paenibacillus panacisoli
ref|WP_021166906.1|  putative niacin/nicotinamide transporter NaiP    75.9    2e-12   Sporomusa
ref|WP_038574515.1|  major facilitator transporter                    75.5    2e-12   Paenibacillus odorifer
ref|WP_028550216.1|  major facilitator transporter                    75.5    2e-12   
emb|CEF99356.1|  Major facilitator superfamily domain, general su...  75.9    2e-12   Ostreococcus tauri
ref|WP_025677038.1|  major facilitator transporter                    75.5    2e-12   Paenibacillus massiliensis
ref|WP_007953998.1|  major facilitator transporter                    75.5    2e-12   Pelosinus fermentans
ref|WP_041067349.1|  major facilitator transporter                    75.1    2e-12   Cohnella kolymensis
ref|XP_006372272.1|  hypothetical protein POPTR_0018s14850g           73.6    2e-12   
ref|WP_018883249.1|  major facilitator transporter                    75.1    2e-12   Paenibacillus massiliensis
ref|WP_009223181.1|  major facilitator transporter                    75.1    3e-12   Paenibacillus sp. oral taxon 786
ref|WP_039299274.1|  major facilitator transporter                    75.1    3e-12   Paenibacillus
ref|WP_038599911.1|  major facilitator transporter                    74.7    3e-12   Paenibacillus sp. FSL H7-0357
ref|WP_036677382.1|  major facilitator transporter                    74.7    3e-12   Paenibacillus
ref|WP_042141236.1|  major facilitator transporter                    74.7    3e-12   
ref|WP_006555331.1|  aromatic acid:H+ symporter (AAHS) family MFS...  74.7    3e-12   
emb|CAR63523.1|  putative synaptic vesicle 2-related protein          75.1    4e-12   
ref|WP_026563029.1|  major facilitator transporter                    74.7    4e-12   
ref|WP_036651864.1|  major facilitator transporter                    74.3    4e-12   
ref|WP_019000021.1|  major facilitator transporter                    74.7    4e-12   
ref|WP_005674580.1|  major facilitator transporter                    74.7    4e-12   
ref|WP_042193977.1|  major facilitator transporter                    74.3    4e-12   
ref|WP_042132220.1|  major facilitator transporter                    74.3    5e-12   
ref|WP_017687489.1|  major facilitator transporter                    73.9    5e-12   
ref|WP_036614537.1|  MULTISPECIES: major facilitator transporter      73.9    6e-12   
ref|WP_042242629.1|  major facilitator transporter                    73.9    6e-12   
ref|XP_005644961.1|  MFS general substrate transporter                73.9    8e-12   
ref|XP_008779848.1|  PREDICTED: organic cation/carnitine transpor...  72.8    8e-12   
ref|XP_002630184.1|  Hypothetical protein CBG00590                    74.3    8e-12   
gb|EKC38221.1|  Synaptic vesicle 2-related protein                    73.9    8e-12   
ref|WP_018977434.1|  major facilitator transporter                    73.6    8e-12   
ref|WP_016312285.1|  hypothetical protein                             73.6    8e-12   
ref|WP_015561914.1|  MULTISPECIES: Sugar phosphate permease           73.6    9e-12   
ref|WP_008539323.1|  major facilitator transporter                    73.6    9e-12   
ref|WP_028538924.1|  major facilitator transporter                    73.6    9e-12   
ref|WP_039836824.1|  major facilitator transporter                    73.6    9e-12   
ref|WP_039878914.1|  major facilitator transporter                    73.2    1e-11   
ref|XP_003093994.1|  hypothetical protein CRE_16352                   73.6    1e-11   
ref|WP_026263487.1|  major facilitator transporter                    73.2    1e-11   
ref|WP_014793289.1|  major facilitator transporter                    73.2    1e-11   
ref|WP_025704475.1|  major facilitator transporter                    73.2    1e-11   
ref|NP_498960.2|  Protein SVOP-1                                      73.6    1e-11   
ref|WP_006307731.1|  major facilitator transporter                    73.2    1e-11   
ref|WP_012571767.1|  hypothetical protein                             73.2    1e-11   
ref|WP_019849855.1|  major facilitator transporter                    73.2    1e-11   
ref|WP_029194958.1|  major facilitator transporter                    72.8    2e-11   
ref|XP_005108026.1|  PREDICTED: synaptic vesicle 2-related protei...  72.8    2e-11   
ref|WP_031504637.1|  MFS transporter                                  72.4    2e-11   
ref|WP_037287454.1|  major facilitator transporter                    72.4    2e-11   
ref|WP_042660377.1|  hypothetical protein                             72.4    2e-11   
ref|WP_036658951.1|  major facilitator transporter                    72.4    2e-11   
emb|CAP22038.2|  Protein CBG00590                                     72.8    2e-11   
ref|XP_009060022.1|  hypothetical protein LOTGIDRAFT_106739           72.4    3e-11   
ref|WP_005544045.1|  major facilitator transporter                    72.0    3e-11   
ref|WP_041844202.1|  MFS transporter                                  72.0    3e-11   
ref|WP_044876527.1|  major facilitator transporter                    71.6    3e-11   
ref|WP_007778860.1|  major facilitator transporter                    72.0    3e-11   
ref|WP_004436255.1|  major facilitator transporter                    71.6    4e-11   
ref|XP_002114471.1|  hypothetical protein TRIADDRAFT_58334            72.0    4e-11   
ref|WP_017869464.1|  MULTISPECIES: sugar transporter                  71.6    4e-11   
ref|WP_029054771.1|  major facilitator transporter                    71.2    4e-11   
ref|WP_009753192.1|  major facilitator transporter                    71.6    5e-11   
ref|WP_036726620.1|  major facilitator transporter                    71.2    5e-11   
ref|WP_015919348.1|  MFS transporter                                  71.2    5e-11   
gb|ETT70362.1|  major facilitator superfamily protein                 71.2    5e-11   
ref|WP_041071725.1|  major facilitator transporter                    71.2    5e-11   
ref|WP_042679686.1|  NiaP-like niacin transporter                     71.2    6e-11   
ref|WP_043964439.1|  major facilitator transporter                    70.9    6e-11   
ref|WP_004816527.1|  hypothetical protein                             70.9    7e-11   
ref|WP_034302078.1|  major facilitator transporter                    70.9    7e-11   
ref|WP_039273470.1|  major facilitator transporter                    70.9    7e-11   
ref|WP_025689813.1|  major facilitator transporter                    70.9    7e-11   
gb|EYC04008.1|  hypothetical protein Y032_0090g2363                   71.2    7e-11   
dbj|BAL52591.1|  MFS transporter, putative metabolite:H+ symporter    70.9    7e-11   
ref|WP_013970067.1|  MFS transporter                                  70.9    8e-11   
ref|WP_024631083.1|  MULTISPECIES: major facilitator transporter      70.5    8e-11   
emb|CEF66864.1|  Synaptic vesicle 2-related protein                   70.9    8e-11   
ref|XP_009064614.1|  hypothetical protein LOTGIDRAFT_131851           70.9    8e-11   
ref|WP_039211719.1|  major facilitator transporter                    70.9    9e-11   
ref|WP_027397876.1|  major facilitator transporter                    70.9    9e-11   
ref|XP_007525360.1|  PREDICTED: synaptic vesicle 2-related protein    71.2    9e-11   
ref|WP_028530757.1|  major facilitator transporter                    70.5    9e-11   
ref|WP_028401318.1|  major facilitator transporter                    70.5    9e-11   
ref|WP_018714891.1|  hypothetical protein                             70.5    9e-11   
ref|WP_029519051.1|  major facilitator transporter                    70.5    1e-10   
ref|WP_038672240.1|  major facilitator transporter                    70.5    1e-10   
gb|EYC04009.1|  hypothetical protein Y032_0090g2363                   70.9    1e-10   
ref|WP_034314304.1|  major facilitator transporter                    70.1    1e-10   
ref|WP_009438918.1|  major facilitator transporter                    70.5    1e-10   
dbj|GAK39823.1|  major facilitator superfamily protein                70.1    1e-10   
ref|WP_038557565.1|  major facilitator transporter                    70.1    1e-10   
ref|WP_044738760.1|  major facilitator transporter                    70.1    1e-10   
ref|WP_016168523.1|  hypothetical protein                             70.1    1e-10   
ref|XP_009054025.1|  hypothetical protein LOTGIDRAFT_160688           70.1    1e-10   
ref|WP_021685675.1|  transporter, major facilitator family protein    70.1    1e-10   
ref|WP_006534993.1|  major facilitator transporter                    70.1    1e-10   
ref|WP_007930773.1|  MULTISPECIES: major facilitator transporter      70.1    1e-10   
ref|WP_019637978.1|  major facilitator transporter                    69.7    1e-10   
ref|WP_004068806.1|  NiaP-like niacin transporter                     70.1    1e-10   
ref|XP_006380836.1|  hypothetical protein POPTR_0007s15120g           70.1    1e-10   
ref|WP_014751774.1|  MFS transporter                                  70.1    2e-10   
ref|WP_006693132.1|  major facilitator transporter                    69.7    2e-10   
ref|WP_017428336.1|  MULTISPECIES: major facilitator transporter      69.7    2e-10   
ref|WP_040101514.1|  major facilitator transporter                    69.7    2e-10   
ref|WP_015261735.1|  major facilitator transporter                    69.7    2e-10   
ref|WP_036408573.1|  major facilitator transporter                    69.7    2e-10   
ref|WP_004236054.1|  major facilitator transporter                    69.7    2e-10   
ref|WP_009729100.1|  aromatic acid:H+ symporter (AAHS) family MFS...  69.7    2e-10   
ref|WP_032099124.1|  major facilitator transporter                    69.7    2e-10   
ref|WP_025334877.1|  major facilitator transporter                    69.7    2e-10   
ref|WP_038034649.1|  MULTISPECIES: MFS transporter                    69.7    2e-10   
ref|WP_013310025.1|  major facilitator transporter                    69.7    2e-10   
ref|WP_034612688.1|  major facilitator transporter                    69.7    2e-10   
ref|WP_025694381.1|  major facilitator transporter                    69.3    2e-10   
ref|WP_023988307.1|  MULTISPECIES: major facilitator transporter      69.3    2e-10   
ref|WP_025722865.1|  major facilitator transporter                    69.3    2e-10   
ref|WP_004285584.1|  major facilitator transporter                    69.7    2e-10   
ref|WP_023580813.1|  MFS family transporter                           69.3    2e-10   
ref|XP_006374730.1|  hypothetical protein POPTR_0014s00290g           69.7    2e-10   
ref|WP_026678876.1|  major facilitator transporter                    69.3    2e-10   
ref|WP_004082050.1|  MULTISPECIES: MFS transporter                    69.3    2e-10   
ref|WP_009657701.1|  major facilitator transporter                    69.3    2e-10   
ref|WP_042070435.1|  MFS transporter                                  69.3    2e-10   
ref|WP_009656058.1|  major facilitator transporter                    69.3    2e-10   
ref|WP_012003259.1|  MULTISPECIES: MFS transporter                    69.3    2e-10   
ref|WP_027480153.1|  sugar transporter                                69.3    2e-10   
ref|WP_036695349.1|  major facilitator transporter                    69.3    2e-10   
ref|WP_010889530.1|  sugar transporter                                69.3    3e-10   
ref|XP_001945003.1|  PREDICTED: synaptic vesicle 2-related protein    69.3    3e-10   
gb|ETT48243.1|  major facilitator superfamily protein                 68.9    3e-10   
ref|WP_009440040.1|  transporter, major facilitator family protein    69.3    3e-10   
gb|EFQ04455.1|  transporter, major facilitator family protein         68.9    3e-10   
ref|WP_027323568.1|  major facilitator transporter                    68.9    3e-10   
ref|WP_029683590.1|  MFS transporter                                  68.9    3e-10   
ref|WP_007430166.1|  major facilitator transporter                    68.9    3e-10   
ref|WP_013370845.1|  major facilitator transporter                    68.9    3e-10   
ref|WP_016821055.1|  major facilitator transporter                    68.9    3e-10   
ref|WP_029683920.1|  MFS transporter                                  68.9    3e-10   
ref|XP_011175090.1|  PREDICTED: synaptic vesicle 2-related protei...  68.9    3e-10   
ref|WP_004725257.1|  hypothetical protein                             68.9    3e-10   
ref|WP_012310227.1|  major facilitator transporter                    68.9    3e-10   
ref|WP_040571093.1|  major facilitator transporter                    68.9    3e-10   
ref|WP_041089360.1|  major facilitator transporter                    68.6    3e-10   
ref|WP_040773573.1|  major facilitator transporter                    68.9    3e-10   
ref|WP_004282420.1|  major facilitator transporter                    68.9    3e-10   
gb|EFF65784.1|  transporter, major facilitator family protein         68.9    3e-10   
ref|WP_006696931.1|  major facilitator transporter                    68.9    4e-10   
ref|WP_025685603.1|  major facilitator transporter                    68.6    4e-10   
gb|EGT56656.1|  hypothetical protein CAEBREN_14991                    68.9    4e-10   
ref|WP_033842801.1|  major facilitator transporter                    68.6    4e-10   
ref|WP_044645590.1|  major facilitator transporter                    68.6    4e-10   
ref|WP_042206693.1|  major facilitator transporter                    68.6    4e-10   
ref|WP_014281242.1|  major facilitator transporter                    68.6    4e-10   
ref|XP_011175088.1|  PREDICTED: synaptic vesicle 2-related protei...  68.9    4e-10   
ref|WP_036932819.1|  major facilitator transporter                    68.6    4e-10   
gb|ELW63816.1|  Synaptic vesicle 2-related protein                    69.3    4e-10   
ref|WP_010011705.1|  major facilitator transporter                    68.6    4e-10   
ref|WP_027407105.1|  major facilitator transporter                    68.9    4e-10   
ref|WP_003764071.1|  major facilitator transporter                    68.6    4e-10   
ref|WP_006691241.1|  major facilitator transporter                    68.6    4e-10   
ref|XP_011049843.1|  PREDICTED: synaptic vesicle 2-related protei...  68.6    4e-10   
ref|XP_002425260.1|  sugar transporter, putative                      68.6    4e-10   
ref|WP_013401872.1|  MULTISPECIES: major facilitator transporter      68.6    4e-10   
ref|WP_015284050.1|  arabinose efflux permease family protein         68.2    4e-10   
ref|WP_025154276.1|  major facilitator transporter                    68.6    5e-10   
ref|WP_034680204.1|  major facilitator transporter                    68.6    5e-10   
ref|WP_005017207.1|  major facilitator transporter                    68.6    5e-10   
ref|WP_036413878.1|  major facilitator transporter                    68.2    5e-10   
ref|WP_036417948.1|  major facilitator transporter                    68.2    5e-10   
ref|XP_002114472.1|  hypothetical protein TRIADDRAFT_27661            68.6    5e-10   
ref|XP_011049841.1|  PREDICTED: synaptic vesicle 2-related protei...  68.6    5e-10   
gb|ERI11156.1|  transporter, major facilitator family protein         68.2    5e-10   
ref|WP_034672940.1|  major facilitator transporter                    68.6    5e-10   
ref|WP_034684408.1|  major facilitator transporter                    68.6    5e-10   
ref|WP_034671031.1|  major facilitator transporter                    68.6    5e-10   
ref|WP_005022916.1|  MULTISPECIES: major facilitator transporter      68.6    5e-10   
ref|WP_014452265.1|  MFS transporter                                  68.6    5e-10   
ref|WP_034688766.1|  major facilitator transporter                    68.6    5e-10   
gb|EMP53732.1|  Niacin transporter NiaP                               68.2    5e-10   
ref|WP_019413295.1|  major facilitator transporter                    68.2    5e-10   
ref|WP_009311854.1|  major facilitator transporter                    68.2    5e-10   
ref|WP_040303745.1|  major facilitator transporter                    68.2    5e-10   
ref|WP_019394979.1|  MULTISPECIES: major facilitator transporter      68.2    6e-10   
ref|XP_003727034.1|  PREDICTED: synaptic vesicle 2-related protei...  67.4    6e-10   
ref|WP_010116730.1|  major facilitator transporter                    68.2    6e-10   
ref|WP_025717390.1|  major facilitator transporter                    68.2    6e-10   
ref|WP_021094367.1|  major facilitator superfamily permease           68.2    6e-10   
ref|WP_038154672.1|  major facilitator transporter                    68.2    6e-10   
ref|WP_010346236.1|  major facilitator transporter                    68.2    6e-10   
ref|WP_016362638.1|  major facilitator transporter                    68.2    6e-10   
gb|KHF30275.1|  putative niacin/nicotinamide transporter NaiP         66.6    6e-10   
ref|WP_013916991.1|  major facilitator transporter                    68.2    6e-10   
ref|WP_041272601.1|  major facilitator transporter                    67.8    7e-10   
emb|CEG29297.1|  major facilitator family transporter                 67.8    7e-10   
ref|WP_018758805.1|  major facilitator transporter                    67.8    7e-10   
ref|WP_009115818.1|  major facilitator transporter                    67.8    7e-10   
ref|WP_038700955.1|  major facilitator transporter                    67.8    7e-10   
gb|EGQ76875.1|  MFS family major facilitator transporter              67.8    8e-10   
ref|WP_028397158.1|  major facilitator transporter                    67.8    8e-10   
ref|WP_038085798.1|  major facilitator transporter                    67.8    8e-10   
ref|WP_026762154.1|  major facilitator transporter                    67.8    8e-10   
ref|WP_009349284.1|  major facilitator transporter                    67.8    8e-10   
dbj|BAE85712.1|  hypothetical protein                                 67.8    8e-10   
gb|KDO73403.1|  hypothetical protein CISIN_1g011416mg                 67.8    8e-10   
gb|EHJ69047.1|  putative sugar transporter                            67.8    8e-10   
ref|WP_012642410.1|  major facilitator transporter                    67.8    9e-10   
ref|WP_014451179.1|  MFS transporter                                  67.4    9e-10   
ref|WP_026760030.1|  major facilitator transporter                    67.8    9e-10   
ref|WP_037353084.1|  major facilitator transporter                    67.4    9e-10   
ref|WP_036603749.1|  major facilitator transporter                    67.4    1e-09   
ref|WP_015865375.1|  major facilitator transporter                    67.4    1e-09   
ref|WP_031406529.1|  major facilitator transporter                    67.4    1e-09   
gb|AAR01731.1|  putative sugar transporter (alternative splicing ...  67.4    1e-09   
ref|WP_021899505.1|  general substrate transporter                    67.4    1e-09   
ref|XP_308210.3|  AGAP007660-PA                                       67.4    1e-09   
ref|WP_043067223.1|  major facilitator transporter                    67.4    1e-09   
ref|WP_011943708.1|  MULTISPECIES: MFS transporter                    67.4    1e-09   
ref|WP_035064391.1|  major facilitator transporter                    67.4    1e-09   
ref|WP_039862973.1|  major facilitator transporter                    67.4    1e-09   
ref|WP_026765295.1|  major facilitator transporter                    67.4    1e-09   
ref|WP_026136171.1|  major facilitator transporter                    67.0    1e-09   
ref|XP_008193981.1|  PREDICTED: synaptic vesicle 2-related protein    67.4    1e-09   
ref|WP_033019798.1|  major facilitator transporter                    67.0    1e-09   
gb|EFA03313.1|  hypothetical protein TcasGA2_TC013255                 67.4    1e-09   
ref|WP_012744560.1|  MFS transporter                                  67.0    1e-09   
gb|EFX74666.1|  hypothetical protein DAPPUDRAFT_199755                67.0    1e-09   
ref|XP_011136117.1|  PREDICTED: synaptic vesicle 2-related protei...  67.0    2e-09   
ref|WP_013905456.1|  major facilitator family transporter             66.6    2e-09   
ref|WP_024536706.1|  major facilitator transporter                    66.6    2e-09   
ref|WP_043925885.1|  major facilitator transporter                    66.6    2e-09   
ref|WP_003253766.1|  major facilitator transporter                    66.6    2e-09   
ref|XP_011136116.1|  PREDICTED: synaptic vesicle 2-related protei...  67.0    2e-09   
ref|WP_036424279.1|  major facilitator transporter                    66.6    2e-09   
ref|WP_003782980.1|  major facilitator transporter                    66.6    2e-09   
ref|WP_029544182.1|  major facilitator transporter                    66.6    2e-09   



>ref|XP_011093914.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Sesamum indicum]
Length=495

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 135/185 (73%), Gaps = 5/185 (3%)
 Frame = -1

Query  594  HAICLLISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKI  421
            + + L+ S   SR S    C A++   +       +   F+  +AE+PGLIL+A+LVDK+
Sbjct  310  YGVVLMTSEFSSRQS---KCGAIVIHSNQLTDSSLYQNVFITSFAELPGLILSAILVDKV  366

Query  420  GRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVR  241
            GR+ S++ MYA  F+FLLPL+LHQ+E LTT LL GARMC +GT+T+  I+CPE+YPTS+R
Sbjct  367  GRRISLVLMYAFSFIFLLPLMLHQNELLTTSLLFGARMCLIGTYTVAGIYCPELYPTSIR  426

Query  240  TTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQ  61
            TTG GVA++VGRIAGMICP VAV+ VSGC  MAAI LFE + ++ G SVLLF  ETKG+Q
Sbjct  427  TTGVGVASAVGRIAGMICPYVAVELVSGCHQMAAISLFEAVMILSGTSVLLFKVETKGRQ  486

Query  60   LSDAV  46
            L+D V
Sbjct  487  LNDIV  491



>ref|XP_011093913.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Sesamum indicum]
Length=496

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 135/185 (73%), Gaps = 5/185 (3%)
 Frame = -1

Query  594  HAICLLISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKI  421
            + + L+ S   SR S    C A++   +       +   F+  +AE+PGLIL+A+LVDK+
Sbjct  311  YGVVLMTSEFSSRQS---KCGAIVIHSNQLTDSSLYQNVFITSFAELPGLILSAILVDKV  367

Query  420  GRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVR  241
            GR+ S++ MYA  F+FLLPL+LHQ+E LTT LL GARMC +GT+T+  I+CPE+YPTS+R
Sbjct  368  GRRISLVLMYAFSFIFLLPLMLHQNELLTTSLLFGARMCLIGTYTVAGIYCPELYPTSIR  427

Query  240  TTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQ  61
            TTG GVA++VGRIAGMICP VAV+ VSGC  MAAI LFE + ++ G SVLLF  ETKG+Q
Sbjct  428  TTGVGVASAVGRIAGMICPYVAVELVSGCHQMAAISLFEAVMILSGTSVLLFKVETKGRQ  487

Query  60   LSDAV  46
            L+D V
Sbjct  488  LNDIV  492



>gb|EYU25780.1| hypothetical protein MIMGU_mgv1a005148mg [Erythranthe guttata]
Length=495

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+L+AVLVDK+GR+ SM+ MY+LGF+FLLPL+ HQ E +TT LL G+RM  +GT+
Sbjct  351  AELPGLVLSAVLVDKVGRRISMVIMYSLGFVFLLPLIFHQHELITTSLLFGSRMFIIGTY  410

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+CPE+YPTSVRTTG GVA++VGRIAGMICP+VAV  VSGC  MAA+ LFEV+ ++
Sbjct  411  TVAGIYCPELYPTSVRTTGVGVASAVGRIAGMICPLVAVGLVSGCHQMAAVSLFEVVIIM  470

Query  108  LGLSVLLFPTETKGQQLSDAV  46
             G+SVL FP ETKG++LSD V
Sbjct  471  SGISVLFFPVETKGRKLSDIV  491



>ref|XP_011093921.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Sesamum indicum]
Length=493

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGLIL+A+LVDK+GRK SM+ MY+ GF+ LLPL+ HQ+E LTT LL GARMC +G 
Sbjct  350  FAELPGLILSAILVDKVGRKISMVLMYSFGFISLLPLMFHQNELLTTSLLFGARMCFIGN  409

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F I  I+CPEIYPTSVRTTGAGVA +VG+I GMICP+VAV+ VSGC  MAAI  FEV+ V
Sbjct  410  FKIAGIYCPEIYPTSVRTTGAGVAAAVGKIGGMICPLVAVELVSGCHRMAAIASFEVVMV  469

Query  111  VLGLSVLLFPTETKGQQLSD  52
            +  + VLLF  ETKG +L D
Sbjct  470  LSAICVLLFKVETKGMELHD  489



>ref|XP_011093916.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093917.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093918.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093919.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093920.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Sesamum indicum]
Length=494

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGLIL+A+LVDK+GRK SM+ MY+ GF+ LLPL+ HQ+E LTT LL GARMC +G 
Sbjct  351  FAELPGLILSAILVDKVGRKISMVLMYSFGFISLLPLMFHQNELLTTSLLFGARMCFIGN  410

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F I  I+CPEIYPTSVRTTGAGVA +VG+I GMICP+VAV+ VSGC  MAAI  FEV+ V
Sbjct  411  FKIAGIYCPEIYPTSVRTTGAGVAAAVGKIGGMICPLVAVELVSGCHRMAAIASFEVVMV  470

Query  111  VLGLSVLLFPTETKGQQLSD  52
            +  + VLLF  ETKG +L D
Sbjct  471  LSAICVLLFKVETKGMELHD  490



>ref|XP_006353741.1| PREDICTED: organic cation/carnitine transporter 7-like [Solanum 
tuberosum]
Length=481

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+++AV+V+K+GRK+SM  MY +G LFL PLV+ Q+EALTT LL GAR+  +GTF
Sbjct  339  AELPGLLISAVVVEKVGRKYSMALMYIMGSLFLFPLVVPQNEALTTALLFGARIWFIGTF  398

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++CPEIYPTSVR+TG GVA++VGRIAGM+ PIVAVQ V GC  MAAIILFEV+ ++
Sbjct  399  TLAGVYCPEIYPTSVRSTGCGVASAVGRIAGMVSPIVAVQLVRGCHQMAAIILFEVVVIL  458

Query  108  LGLSVLLFPTETKGQQLSDAV  46
              +SVLLFP ETKG++L D V
Sbjct  459  SAISVLLFPVETKGRELVDHV  479



>ref|XP_010323959.1| PREDICTED: organic cation/carnitine transporter 7 [Solanum lycopersicum]
Length=482

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+++AV+V+K+GRK+SM  MY  G LFL PLV+ Q+EALTT LL GAR+  +GTF
Sbjct  340  AELPGLLISAVVVEKVGRKYSMALMYIFGSLFLFPLVVPQNEALTTALLFGARIWFIGTF  399

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++CPEIYPTSVR+TG GVA++VGRIAGM+ PIVAVQ V GC  MAAIILFEV+ ++
Sbjct  400  TLAGVYCPEIYPTSVRSTGCGVASAVGRIAGMVSPIVAVQLVRGCHQMAAIILFEVVVIL  459

Query  108  LGLSVLLFPTETKGQQLSDAV  46
              +SVLLFP ETKG++L D V
Sbjct  460  SAISVLLFPVETKGRELVDHV  480



>ref|XP_009800312.1| PREDICTED: organic cation/carnitine transporter 7 [Nicotiana 
sylvestris]
Length=481

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+ + ++V+K+GRKFSM  MY LGFLFL PLV+ Q+E L+T+LL GAR+  +GTF
Sbjct  339  AELPGLLFSVLVVEKVGRKFSMALMYVLGFLFLFPLVVPQNEVLSTVLLFGARIWVIGTF  398

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++CPEIYPTSVRTTG GVA+SVGRIAGM+ P+VAVQ V GC  MAAIILFEV+ ++
Sbjct  399  TLAGVYCPEIYPTSVRTTGYGVASSVGRIAGMVSPLVAVQLVRGCHQMAAIILFEVVLIL  458

Query  108  LGLSVLLFPTETKGQQLSDAV  46
              +SVLLFP ETKG++L D V
Sbjct  459  SAISVLLFPVETKGRELVDHV  479



>gb|KDO73404.1| hypothetical protein CISIN_1g026854mg [Citrus sinensis]
Length=232

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGLIL+A++VDKIGRK SM+ M+ L  +FLLPLV HQ   +TT+LL G RMC  GT
Sbjct  86   FAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAVVTTVLLFGVRMCATGT  145

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
             T+  I+ PEIYPTS RTTGAGVA++VGR+ GM+CP+VAV  V+ C +  A+ILFEV+ V
Sbjct  146  ITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVCPLVAVGLVTSCHLRLAVILFEVVFV  205

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
            +   S LLFP ETKG++L DAV A
Sbjct  206  LAIASSLLFPFETKGRELKDAVDA  229



>ref|XP_009620262.1| PREDICTED: organic cation/carnitine transporter 7 [Nicotiana 
tomentosiformis]
Length=480

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+ + ++V+K+GRKFSM  MY LGFLFL PLV+ Q+E L+T+LL GAR+  +GTF
Sbjct  338  AELPGLLFSVLVVEKVGRKFSMALMYVLGFLFLFPLVVPQNEVLSTVLLFGARIWVIGTF  397

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++CPEIYPTSVRTTG GVA+SVGRIAGM+ P+VAV  V GC  MAAIILFEV+ ++
Sbjct  398  TLAGVYCPEIYPTSVRTTGCGVASSVGRIAGMVSPLVAVHLVRGCHQMAAIILFEVVLIL  457

Query  108  LGLSVLLFPTETKGQQLSDAV  46
              +SVLLFP ETKG++L D V
Sbjct  458  SAISVLLFPVETKGRELVDHV  478



>ref|XP_006453138.1| hypothetical protein CICLE_v10008136mg [Citrus clementina]
 gb|ESR66378.1| hypothetical protein CICLE_v10008136mg [Citrus clementina]
Length=388

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGLIL+A++VDKIGRK SM+ M+ L  +FLLPLV HQ   +TT+LL G RMC  GT
Sbjct  242  FAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAVVTTVLLFGVRMCATGT  301

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
             T+  I+ PEIYPTS RTTGAGVA++VGR+ GM+CP+VAV  V+ C +  A+ILFEV+ V
Sbjct  302  ITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVCPLVAVGLVTSCHLRLAVILFEVVFV  361

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
            +   S LLFP ETKG++L DAV A
Sbjct  362  LAIASSLLFPFETKGRELKDAVDA  385



>ref|XP_011017555.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
Length=510

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PG++L+A++VD+ GRK SM FM+ L  +FLLPLV HQ   LTT LL GARMC +GTF
Sbjct  363  AELPGILLSAIIVDRFGRKLSMAFMFVLACIFLLPLVFHQHATLTTALLFGARMCAIGTF  422

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PE+YPT++R TGAGVAN+VGRI GM+CP+VAV  V+GC +  AIILFEV+ V+
Sbjct  423  TVAAIYAPEVYPTAIRATGAGVANAVGRIGGMVCPLVAVGLVAGCHLKEAIILFEVVIVI  482

Query  108  LGLSVLLFPTETKGQQLSDAVVAS  37
              + VLLFP ET G++LSD++ AS
Sbjct  483  SVVCVLLFPFETSGRELSDSLAAS  506



>ref|XP_006372271.1| hypothetical protein POPTR_0018s14850g [Populus trichocarpa]
 gb|ERP50068.1| hypothetical protein POPTR_0018s14850g [Populus trichocarpa]
Length=342

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PG++L+A++VD+ GRK S+ FM+ L  +FLLPLV HQ   LTT LL GARMC +GTF
Sbjct  191  AELPGILLSAIIVDRFGRKLSVAFMFVLACIFLLPLVFHQHATLTTALLFGARMCAIGTF  250

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PE+YPT +R TGAGVAN+VGRI GM+CP+VAV  V+GC +  AIILFEV+ V+
Sbjct  251  TVAAIYAPEVYPTVIRATGAGVANAVGRIGGMVCPLVAVGLVAGCHLKEAIILFEVVIVI  310

Query  108  LGLSVLLFPTETKGQQLSDAVVAS  37
              + VLLFP ET G++LSD++ AS
Sbjct  311  SVVCVLLFPFETSGRELSDSLAAS  334



>ref|XP_006453137.1| hypothetical protein CICLE_v10008136mg [Citrus clementina]
 ref|XP_006474365.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Citrus sinensis]
 ref|XP_006474366.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Citrus sinensis]
 gb|ESR66377.1| hypothetical protein CICLE_v10008136mg [Citrus clementina]
Length=485

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGLIL+A++VDKIGRK SM+ M+ L  +FLLPLV HQ   +TT+LL G RMC  GT
Sbjct  339  FAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAVVTTVLLFGVRMCATGT  398

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
             T+  I+ PEIYPTS RTTGAGVA++VGR+ GM+CP+VAV  V+ C +  A+ILFEV+ V
Sbjct  399  ITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVCPLVAVGLVTSCHLRLAVILFEVVFV  458

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
            +   S LLFP ETKG++L DAV A
Sbjct  459  LAIASSLLFPFETKGRELKDAVDA  482



>ref|XP_007023583.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007023585.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007023586.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY26205.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY26207.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY26208.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=496

 Score =   164 bits (416),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+L+A  VDK GRKFSM  M+ L  +FL PLV HQ +ALTT LL GAR+C   T
Sbjct  345  FAEFPGLLLSAATVDKFGRKFSMSIMFFLCCIFLPPLVFHQPQALTTGLLFGARICITTT  404

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPTS+R+TG GVA+SVGRI GM+CP+VAV  V GC   AAI+LFE++  
Sbjct  405  FTVVYIYAPEIYPTSIRSTGVGVASSVGRIGGMVCPLVAVGLVHGCHQTAAILLFEIVIF  464

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G+ VL FP ETKG+ LSD++ +S
Sbjct  465  VSGICVLFFPLETKGRDLSDSISSS  489



>ref|XP_002527821.1| sugar transporter, putative [Ricinus communis]
 gb|EEF34573.1| sugar transporter, putative [Ricinus communis]
Length=498

 Score =   164 bits (416),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PG+IL+A+ VD+ GRK SM+FM+    +FLLPLV HQ   L T  L GARMC +GTF
Sbjct  346  AELPGIILSAITVDRFGRKRSMIFMFVAACIFLLPLVSHQSAVLRTSFLFGARMCAIGTF  405

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            TI  I+CPE+YPT VRTTG+GVA++ GRI GMICP+VAV  V+GC + A II+FEV+A +
Sbjct  406  TIACIYCPELYPTPVRTTGSGVASAAGRIGGMICPLVAVGLVTGCHVEAGIIVFEVVAAI  465

Query  108  LGLSVLLFPTETKGQQLSDAV  46
              + +L FP ETKG +LSD+V
Sbjct  466  SAICLLFFPYETKGCELSDSV  486



>ref|XP_007023584.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY26206.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
Length=488

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+L+A  VDK GRKFSM  M+ L  +FL PLV HQ +ALTT LL GAR+C   T
Sbjct  345  FAEFPGLLLSAATVDKFGRKFSMSIMFFLCCIFLPPLVFHQPQALTTGLLFGARICITTT  404

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPTS+R+TG GVA+SVGRI GM+CP+VAV  V GC   AAI+LFE++  
Sbjct  405  FTVVYIYAPEIYPTSIRSTGVGVASSVGRIGGMVCPLVAVGLVHGCHQTAAILLFEIVIF  464

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            V G+ VL FP ETKG+ LSD++
Sbjct  465  VSGICVLFFPLETKGRDLSDSI  486



>emb|CDP14263.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLH-QDEALTTLLLSGARMCCLG  295
            +AE+PGLIL+A++VD +GRK SM  MY   F+FLLPL    Q E LTT LL GARM  +G
Sbjct  327  FAELPGLILSAIIVDFLGRKRSMALMYLFSFIFLLPLFFKPQHEFLTTGLLFGARMFVIG  386

Query  294  TFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIA  115
            TFTI  I+CPEIYPT+VR+TG GVA++VGRI GMICP+VAVQ V+GC ++ A+I FEV+ 
Sbjct  387  TFTIVGIYCPEIYPTAVRSTGYGVASAVGRIGGMICPLVAVQLVTGCHLVPALIFFEVVI  446

Query  114  VVLGLSVLLFPTETKGQQLSDAVVA  40
             + G+ V+LFP ETKG++L+D + A
Sbjct  447  ALSGICVMLFPFETKGRKLADTIAA  471



>gb|KDP45839.1| hypothetical protein JCGZ_17446 [Jatropha curcas]
Length=493

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLIL+AV++D++GRK S++FM+ L F+FLLPLV +Q    TT+LL GARM  + TF
Sbjct  340  AELPGLILSAVVLDRVGRKLSLIFMFVLAFVFLLPLVAYQPAIWTTVLLFGARMFVVATF  399

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+CPE+YPTSVR TG GVA+++GRI GM+CP+VAV  V+ C+I  AI+LFEVI   
Sbjct  400  TVACIYCPELYPTSVRATGYGVASAMGRIGGMVCPLVAVGLVNSCQIEEAIVLFEVIIAT  459

Query  108  LGLSVLLFPTETKGQQLSDAVVA  40
              +SVL FP ETKG++LSD+V A
Sbjct  460  SAISVLFFPFETKGRELSDSVAA  482



>ref|XP_009344025.1| PREDICTED: LOW QUALITY PROTEIN: organic cation/carnitine transporter 
7-like [Pyrus x bretschneideri]
Length=501

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+++A  VDK+GRK SM  M+ L  +FLLPLV+HQ + LTT+LL GAR+C  G+
Sbjct  348  FAEFPGLLISAATVDKLGRKLSMSSMFFLCCIFLLPLVVHQSQGLTTILLFGARICITGS  407

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG G+A+++GRI GM+CP+VAV  V GC   A+I+LFE+I  
Sbjct  408  FTIVFIYAPEIYPTSVRTTGVGIASAMGRIGGMVCPLVAVGLVHGCHQTASILLFEIIIF  467

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS*T  31
            + G+ VLLFP ETKG +LSD +  S T
Sbjct  468  LSGICVLLFPFETKGLELSDTISDSKT  494



>gb|KHG19767.1| Organic cation/carnitine transporter 7 -like protein [Gossypium 
arboreum]
Length=413

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+++A  VD+ GRKFSM  M+ L  +FL PLV+HQ + LTT LL GAR+C   +
Sbjct  262  FAEFPGLLISAFTVDRFGRKFSMSAMFFLCCIFLFPLVVHQPQGLTTGLLFGARICITAS  321

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPTSVR+TG G+A+S+GRI GM+CP+VAV  V GC   AAI+LFEVI  
Sbjct  322  FTVMYIYAPEIYPTSVRSTGVGIASSMGRIGGMVCPLVAVGLVHGCHQTAAIMLFEVIIF  381

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G+ VLLFP ET G+ LSD++ +S
Sbjct  382  VAGICVLLFPVETMGRDLSDSISSS  406



>ref|XP_011017563.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
 ref|XP_011017564.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
 ref|XP_011017565.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
 ref|XP_011017566.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
 ref|XP_011017567.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
 ref|XP_011017568.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
Length=507

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+L+A++VD++GRK SM  M   G +FL PL+ +    LTT +L GARMC +G+F
Sbjct  354  AELPGLLLSAIIVDRLGRKLSMALMLVWGCIFLFPLLFNVSANLTTAMLFGARMCVMGSF  413

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            TI  ++ PE+YPT+VR TGAGVA+SVGRI GMICP+VAV  V+GC +  AIILFEV+  +
Sbjct  414  TIATLYAPELYPTAVRATGAGVASSVGRIGGMICPLVAVGLVTGCYLTEAIILFEVVMAI  473

Query  108  LGLSVLLFPTETKGQQLSDAV  46
               S LLFP ETKGQ+LSD+V
Sbjct  474  SAFSCLLFPFETKGQELSDSV  494



>ref|XP_006372262.1| hypothetical protein POPTR_0018s14760g [Populus trichocarpa]
 gb|ERP50059.1| hypothetical protein POPTR_0018s14760g [Populus trichocarpa]
Length=507

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+L+A++VD++GRK SM  M  LG +FL PL+ +    LTT +L GARMC +G+F
Sbjct  354  AELPGLLLSAIIVDRLGRKLSMALMLVLGCIFLFPLLFNVSANLTTAMLFGARMCVMGSF  413

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            TI  ++ PE+YPT+VR TGAGVA+SVGRI GMICP+VAV  V+GC +  AIILFEV+  +
Sbjct  414  TIATLYAPELYPTAVRATGAGVASSVGRIGGMICPLVAVGLVTGCYLTEAIILFEVVMAI  473

Query  108  LGLSVLLFPTETKGQQLSDAV  46
               S LLFP ETKGQ+LSD+V
Sbjct  474  SAFSSLLFPFETKGQELSDSV  494



>ref|XP_009346014.1| PREDICTED: organic cation/carnitine transporter 7-like [Pyrus 
x bretschneideri]
Length=496

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+L+A +VDK+GRK SM  M+ +  +FLLPLV+HQ + LTT LL GAR+C   T
Sbjct  344  FAEFPGLLLSAAMVDKLGRKLSMSAMFFICCIFLLPLVVHQSQGLTTSLLFGARICITAT  403

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTS+RTTG G+A+S+GRI GMICP+VAV  V GC   A+I+LFE++  
Sbjct  404  FTIVYIYAPEIYPTSIRTTGVGIASSMGRIGGMICPLVAVGLVHGCHQTASILLFEIVIF  463

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            + G+ VLLFP ET G++LSD++  S
Sbjct  464  LSGVCVLLFPFETMGRELSDSISDS  488



>ref|XP_008348401.1| PREDICTED: organic cation/carnitine transporter 7-like [Malus 
domestica]
 ref|XP_008348402.1| PREDICTED: organic cation/carnitine transporter 7-like [Malus 
domestica]
 ref|XP_008348403.1| PREDICTED: organic cation/carnitine transporter 7-like [Malus 
domestica]
Length=493

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGL+++A  VDK+GRK SM  M+ L  +FLLPLV+HQ + LTT+LL GAR+C  G+F
Sbjct  345  AEFPGLLISAATVDKLGRKLSMSSMFFLCCIFLLPLVVHQSQGLTTILLFGARICITGSF  404

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            TI  I+ PEIYPTSVRTTG G+A+++GRI GM+CP+VAV  V GC   A+I+LFE+I  +
Sbjct  405  TIIYIYAPEIYPTSVRTTGVGIASAMGRIGGMLCPLVAVGLVHGCHQTASILLFEIIIFL  464

Query  108  LGLSVLLFPTETKGQQLSDAVVAS*T  31
             G+ VLLFP ETKG +LSD +  S T
Sbjct  465  SGICVLLFPFETKGLELSDTISDSKT  490



>gb|KDO73405.1| hypothetical protein CISIN_1g024637mg [Citrus sinensis]
Length=265

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLIL+A++VDKIGRK SM+ M+    +FLLPLV HQ   +TTLLL G RMC  GT 
Sbjct  120  AELPGLILSAIIVDKIGRKLSMVLMFVSACIFLLPLVFHQSAVVTTLLLFGVRMCVTGTI  179

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PEIYPT  RTTG GVA+S+G++ GM+CP+VAV  V+ C +  A+ILFEV+ V+
Sbjct  180  TVATIYAPEIYPTPARTTGFGVASSLGKVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVL  239

Query  108  LGLSVLLFPTETKGQQLSDAVVA  40
               S LLFP ET G++L D V A
Sbjct  240  AIASSLLFPFETMGRELKDTVDA  262



>gb|KJB68008.1| hypothetical protein B456_010G222000 [Gossypium raimondii]
 gb|KJB68009.1| hypothetical protein B456_010G222000 [Gossypium raimondii]
 gb|KJB68010.1| hypothetical protein B456_010G222000 [Gossypium raimondii]
 gb|KJB68012.1| hypothetical protein B456_010G222000 [Gossypium raimondii]
 gb|KJB68013.1| hypothetical protein B456_010G222000 [Gossypium raimondii]
Length=496

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+++A  VD+ GRKFSM  M+ L  +FL PLV+HQ + LTT LL GAR+C   +
Sbjct  345  FAEFPGLLISAFTVDRFGRKFSMSAMFFLCCIFLFPLVVHQPQGLTTGLLFGARICITAS  404

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPTSVR+TG G+A+S+GRI GM+CP+VAV  V GC   AAI+LFEVI  
Sbjct  405  FTVMYIYAPEIYPTSVRSTGVGIASSMGRIGGMVCPLVAVGLVHGCHQTAAIMLFEVIIF  464

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G+ VLLFP ET G+ LSD++ +S
Sbjct  465  VAGICVLLFPVETMGRDLSDSISSS  489



>ref|XP_010927139.1| PREDICTED: organic cation/carnitine transporter 7 isoform X2 
[Elaeis guineensis]
Length=402

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AEVPGL+L+AV+VD++GRK SM  +  +  +FLLPL+ HQ+EALTT LL GAR C +G+
Sbjct  260  FAEVPGLLLSAVIVDRVGRKLSMAGLLFVSCIFLLPLIFHQEEALTTTLLFGARACIMGS  319

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPTSVR TG G+A+SVGRI G+ICP+VAV  V GC    AI+LFE + +
Sbjct  320  FTIIYIYAPEVYPTSVRATGVGIASSVGRIGGIICPLVAVGLVHGCHQAGAILLFESVIL  379

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + GL+ L  P ET G+ L+D+V
Sbjct  380  LSGLATLFLPLETSGRALTDSV  401



>gb|KDO37521.1| hypothetical protein CISIN_1g015075mg [Citrus sinensis]
Length=357

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLIL+A++VDKIGRK SM+ M+    +FLLPLV HQ   +TT+LL G RMC  GT 
Sbjct  212  AELPGLILSAIIVDKIGRKLSMVLMFVSACIFLLPLVFHQSAVVTTVLLFGVRMCVTGTI  271

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PEIYPTS RTTG GVA+S+G++ GM+CP+VAV  V+ C +  A+ILFEV+ V+
Sbjct  272  TVATIYAPEIYPTSARTTGFGVASSLGKVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVL  331

Query  108  LGLSVLLFPTETKGQQLSDAVVA  40
               S LLFP ET G++L D V A
Sbjct  332  AIASSLLFPFETMGRELKDTVDA  354



>gb|KDO37523.1| hypothetical protein CISIN_1g015075mg [Citrus sinensis]
 gb|KDO37524.1| hypothetical protein CISIN_1g015075mg [Citrus sinensis]
 gb|KDO37525.1| hypothetical protein CISIN_1g015075mg [Citrus sinensis]
Length=388

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLIL+A++VDKIGRK SM+ M+    +FLLPLV HQ   +TT+LL G RMC  GT 
Sbjct  243  AELPGLILSAIIVDKIGRKLSMVLMFVSACIFLLPLVFHQSAVVTTVLLFGVRMCVTGTI  302

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PEIYPTS RTTG GVA+S+G++ GM+CP+VAV  V+ C +  A+ILFEV+ V+
Sbjct  303  TVATIYAPEIYPTSARTTGFGVASSLGKVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVL  362

Query  108  LGLSVLLFPTETKGQQLSDAVVA  40
               S LLFP ET G++L D V A
Sbjct  363  AIASSLLFPFETMGRELKDTVDA  385



>ref|XP_010927137.1| PREDICTED: organic cation/carnitine transporter 7 isoform X1 
[Elaeis guineensis]
 ref|XP_010927138.1| PREDICTED: organic cation/carnitine transporter 7 isoform X1 
[Elaeis guineensis]
Length=487

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AEVPGL+L+AV+VD++GRK SM  +  +  +FLLPL+ HQ+EALTT LL GAR C +G+
Sbjct  345  FAEVPGLLLSAVIVDRVGRKLSMAGLLFVSCIFLLPLIFHQEEALTTTLLFGARACIMGS  404

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPTSVR TG G+A+SVGRI G+ICP+VAV  V GC    AI+LFE + +
Sbjct  405  FTIIYIYAPEVYPTSVRATGVGIASSVGRIGGIICPLVAVGLVHGCHQAGAILLFESVIL  464

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + GL+ L  P ET G+ L+D+V
Sbjct  465  LSGLATLFLPLETSGRALTDSV  486



>emb|CAN64534.1| hypothetical protein VITISV_042940 [Vitis vinifera]
Length=461

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+L+A  VD +GRK SM  M+ L  +FLLPLV HQ + LTT LL GAR+C   T
Sbjct  310  FAEFPGLLLSAATVDILGRKLSMSAMFFLCCIFLLPLVFHQPQGLTTALLFGARICITVT  369

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPTSVRTTG GVA+SVGRI GM+CP+VAV  V GC   AA+ILFE++  
Sbjct  370  FTVVYIYAPEIYPTSVRTTGVGVASSVGRIGGMLCPLVAVGLVHGCHQAAAVILFEIVIF  429

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            + G+ V+LFP ETKG++L D + +S
Sbjct  430  ISGICVILFPFETKGRELKDTLSSS  454



>ref|XP_002528039.1| sugar transporter, putative [Ricinus communis]
 gb|EEF34357.1| sugar transporter, putative [Ricinus communis]
Length=497

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PG++L+A++VD+ GRK SM  M+   ++FLLPLV  Q + LTT LL GARM  LGT
Sbjct  344  FAELPGILLSAMMVDRFGRKLSMAIMFIFAWIFLLPLVSRQSDILTTGLLFGARMFSLGT  403

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PE+YPTS+R+TGAG A++VGRI GM+CP+VAV  VS C   AAIILFEV+  
Sbjct  404  FTVASIYAPELYPTSIRSTGAGTASAVGRIGGMVCPLVAVALVSNCHFKAAIILFEVVIA  463

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
            +  + +LLFP ET G++LSD + A
Sbjct  464  ITVVCILLFPFETSGRELSDRLAA  487



>gb|KDO37522.1| hypothetical protein CISIN_1g015075mg [Citrus sinensis]
Length=413

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLIL+A++VDKIGRK SM+ M+    +FLLPLV HQ   +TT+LL G RMC  GT 
Sbjct  268  AELPGLILSAIIVDKIGRKLSMVLMFVSACIFLLPLVFHQSAVVTTVLLFGVRMCVTGTI  327

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PEIYPTS RTTG GVA+S+G++ GM+CP+VAV  V+ C +  A+ILFEV+ V+
Sbjct  328  TVATIYAPEIYPTSARTTGFGVASSLGKVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVL  387

Query  108  LGLSVLLFPTETKGQQLSDAVVA  40
               S LLFP ET G++L D V A
Sbjct  388  AIASSLLFPFETMGRELKDTVDA  410



>ref|XP_010034101.1| PREDICTED: organic cation/carnitine transporter 7 [Eucalyptus 
grandis]
 gb|KCW54001.1| hypothetical protein EUGRSUZ_J03196 [Eucalyptus grandis]
 gb|KCW54002.1| hypothetical protein EUGRSUZ_J03196 [Eucalyptus grandis]
Length=497

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+++A +VDK+GRK SM  M  L  +FLLPLV+HQ   LTT LL GAR+C   +
Sbjct  346  FAEFPGLLISAAIVDKLGRKLSMSSMLFLCCIFLLPLVVHQPAGLTTSLLFGARICITAS  405

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPTS+RTTG GVA+S+GRI GMICP+VAV  + GC   A+IILFE++  
Sbjct  406  FTIIYIYAPEVYPTSIRTTGVGVASSIGRIGGMICPLVAVALIKGCHQTASIILFEIVIF  465

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G+  +LFP ETKG+ LSD + +S
Sbjct  466  VSGICAVLFPFETKGRDLSDTIASS  490



>ref|XP_006453136.1| hypothetical protein CICLE_v10008131mg [Citrus clementina]
 gb|ESR66376.1| hypothetical protein CICLE_v10008131mg [Citrus clementina]
Length=388

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLIL+A++VDKIGRK SM+ M+    +FLLPLV HQ   +TTLLL G RMC  GT 
Sbjct  243  AELPGLILSAIIVDKIGRKLSMVLMFVSACIFLLPLVFHQSAVVTTLLLFGVRMCVTGTI  302

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PEIYPT  RTTG GVA+S+G++ GM+CP+VAV  V+ C +  A+ILFEV+ V+
Sbjct  303  TVATIYAPEIYPTPARTTGFGVASSLGKVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVL  362

Query  108  LGLSVLLFPTETKGQQLSDAVVA  40
               S LLFP ET G++L D V A
Sbjct  363  AIASSLLFPFETMGRELKDTVDA  385



>gb|KDO67077.1| hypothetical protein CISIN_1g010268mg [Citrus sinensis]
Length=487

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+LAA +VD++GRK SM  M+    +FL+PL+  Q + LTT LL GAR+C   T
Sbjct  338  FAEFPGLLLAAAMVDRLGRKLSMSSMFFCCCIFLVPLLFQQPKGLTTGLLFGARICITVT  397

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  ++ PEIYPTSVRTTG GVA+S+GRI GM+CP+VAV  V GC   AA+ILFE++ +
Sbjct  398  FTVVYVYAPEIYPTSVRTTGVGVASSIGRIGGMVCPLVAVALVHGCHQTAALILFELVIL  457

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            + G+SVLLFP ET G+ LSD++ +S
Sbjct  458  LSGISVLLFPFETTGRGLSDSLPSS  482



>ref|XP_008796960.1| PREDICTED: organic cation/carnitine transporter 7 [Phoenix dactylifera]
Length=512

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AEVPGL+L+AV+VD++GRK SM  + ++  +FLLPL+ HQ+EALTT LL GAR C +G+
Sbjct  370  FAEVPGLLLSAVIVDRVGRKLSMAGLLSISCIFLLPLIFHQEEALTTTLLFGARACIMGS  429

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPTSVR TG G+A+S+GRI G+ICP+VAV  V GC    AI+LFE + +
Sbjct  430  FTIIYIYAPEVYPTSVRVTGVGIASSMGRIGGIICPLVAVGLVRGCHQTGAILLFESVIL  489

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            V G++    P ET G++L+D+V
Sbjct  490  VSGVATFFLPLETSGRELTDSV  511



>ref|XP_011467508.1| PREDICTED: organic cation/carnitine transporter 7 [Fragaria vesca 
subsp. vesca]
Length=495

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGLI++A  VD++GRK SM  M+ L  LFLLPLV+HQ E LTT LL GAR+C   T
Sbjct  343  FAELPGLIISAATVDRLGRKLSMSGMFFLCCLFLLPLVVHQPEGLTTALLFGARICITAT  402

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG GV +++GRI GMICP+VAV  V GC   A+I+LFEV+ +
Sbjct  403  FTIVYIYAPEIYPTSVRTTGVGVGSAMGRIGGMICPLVAVALVHGCHQTASILLFEVVIL  462

Query  111  VLGLSVLLFPTETKGQQL  58
            + G+ V+LFP ETKG++L
Sbjct  463  LSGICVMLFPFETKGREL  480



>ref|XP_007215272.1| hypothetical protein PRUPE_ppa004702mg [Prunus persica]
 gb|EMJ16471.1| hypothetical protein PRUPE_ppa004702mg [Prunus persica]
Length=495

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+++A  VD++GRK SM  M+ L  +FLLPLV+ Q + LTT LL GAR+C   T
Sbjct  345  FAELPGLLISAATVDRLGRKLSMSAMFFLCCIFLLPLVIQQSQGLTTSLLFGARICITAT  404

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG GVA+++GRI GMICP+VAV  V GC   A+I+LFE++  
Sbjct  405  FTIVYIYAPEIYPTSVRTTGVGVASAMGRIGGMICPLVAVGLVHGCHQTASILLFEIVIF  464

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            + G+ VLLFP ETKG++LSD V ++
Sbjct  465  LSGVCVLLFPFETKGRELSDTVSSN  489



>ref|XP_002273636.1| PREDICTED: organic cation/carnitine transporter 7 [Vitis vinifera]
 emb|CBI18371.3| unnamed protein product [Vitis vinifera]
Length=495

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+L+A  VD +GRK SM  M+ L  +FLLPLV HQ + LTT LL GAR+C   T
Sbjct  344  FAEFPGLLLSAATVDILGRKLSMSAMFFLCCIFLLPLVFHQPQGLTTALLFGARICITVT  403

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPTSVRTTG GVA+SVGRI GM+CP+VAV  V GC   AA+ILFE++  
Sbjct  404  FTVVYIYAPEIYPTSVRTTGVGVASSVGRIGGMLCPLVAVGLVHGCHQAAAVILFEIVIF  463

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            + G+ V+LFP ETKG++L D + +S
Sbjct  464  ISGICVILFPFETKGRELKDTLSSS  488



>ref|XP_006488615.1| PREDICTED: organic cation/carnitine transporter 7-like [Citrus 
sinensis]
Length=514

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+LAA +VD++GRK SM  M+    +FL+PL+  Q + LTT LL GAR+C   T
Sbjct  365  FAEFPGLLLAAAMVDRLGRKLSMSSMFFCCCIFLVPLLFQQPKGLTTGLLFGARICITVT  424

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  ++ PEIYPTSVRTTG GVA+S+GRI GM+CP+VAV  V GC   AA+ILFE++ +
Sbjct  425  FTVVYVYAPEIYPTSVRTTGVGVASSIGRIGGMVCPLVAVALVHGCHQTAALILFELVIL  484

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            + G+SVLLFP ET G+ LSD++ +S
Sbjct  485  LSGISVLLFPFETTGRGLSDSLPSS  509



>ref|XP_008228025.1| PREDICTED: organic cation/carnitine transporter 7 [Prunus mume]
Length=495

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+++A  VD++GRK SM  M+ L  +FLLPLV+ Q + LTT LL GAR+C   T
Sbjct  345  FAELPGLLISAATVDRLGRKLSMSAMFFLCCIFLLPLVIQQSQGLTTSLLFGARICITAT  404

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG GVA+++GRI GMICP+VAV  V GC   A+I+LFE++  
Sbjct  405  FTIVYIYAPEIYPTSVRTTGVGVASAMGRIGGMICPLVAVGLVHGCHQTASILLFEIVIF  464

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            + G+ VLLFP ETKG++LSD V ++
Sbjct  465  LSGVCVLLFPFETKGRELSDTVSSN  489



>gb|KDO67076.1| hypothetical protein CISIN_1g010268mg [Citrus sinensis]
Length=514

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+LAA +VD++GRK SM  M+    +FL+PL+  Q + LTT LL GAR+C   T
Sbjct  365  FAEFPGLLLAAAMVDRLGRKLSMSSMFFCCCIFLVPLLFQQPKGLTTGLLFGARICITVT  424

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  ++ PEIYPTSVRTTG GVA+S+GRI GM+CP+VAV  V GC   AA+ILFE++ +
Sbjct  425  FTVVYVYAPEIYPTSVRTTGVGVASSIGRIGGMVCPLVAVALVHGCHQTAALILFELVIL  484

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            + G+SVLLFP ET G+ LSD++ +S
Sbjct  485  LSGISVLLFPFETTGRGLSDSLPSS  509



>ref|XP_004140724.1| PREDICTED: organic cation/carnitine transporter 7-like [Cucumis 
sativus]
 gb|KGN57483.1| hypothetical protein Csa_3G198470 [Cucumis sativus]
Length=502

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+L+AV+VDK+GRK SM  M+ LG +FL PLV ++ + LTT LL GAR+C   T
Sbjct  361  FAEFPGLLLSAVMVDKLGRKLSMSSMFFLGAIFLFPLVFYRSDGLTTGLLFGARVCITST  420

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPTS+RTTG GVA+SVGRI GM CP+VAV  V GC    AII FE++ +
Sbjct  421  FTVVYIYAPEIYPTSIRTTGVGVASSVGRIGGMTCPLVAVALVKGCHQTMAIIFFEIVFI  480

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G+ V+LFP ETKGQ L + V
Sbjct  481  LSGICVMLFPFETKGQDLPEKV  502



>ref|XP_004157349.1| PREDICTED: LOW QUALITY PROTEIN: organic cation/carnitine transporter 
7-like [Cucumis sativus]
Length=502

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+L+AV+VDK+GRK SM  M+ LG +FL PLV ++ + LTT LL GAR+C   T
Sbjct  361  FAEFPGLLLSAVMVDKLGRKLSMSSMFFLGAIFLFPLVFYRSDGLTTGLLFGARVCITST  420

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPTS+RTTG GVA+SVGRI GM CP+VAV  V GC    AII FE++ +
Sbjct  421  FTVVYIYAPEIYPTSIRTTGVGVASSVGRIGGMTCPLVAVALVKGCHQTMAIIFFEIVFI  480

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G+ V+LFP ETKGQ L + V
Sbjct  481  LSGICVMLFPFETKGQDLPEKV  502



>ref|XP_006453135.1| hypothetical protein CICLE_v10008131mg [Citrus clementina]
 ref|XP_006474364.1| PREDICTED: organic cation/carnitine transporter 7-like [Citrus 
sinensis]
 gb|ESR66375.1| hypothetical protein CICLE_v10008131mg [Citrus clementina]
Length=485

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLIL+A++VDKIGRK SM+ M+    +FLLPLV HQ   +TTLLL G RMC  GT 
Sbjct  340  AELPGLILSAIIVDKIGRKLSMVLMFVSACIFLLPLVFHQSAVVTTLLLFGVRMCVTGTI  399

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PEIYPT  RTTG GVA+S+G++ GM+CP+VAV  V+ C +  A+ILFEV+ V+
Sbjct  400  TVATIYAPEIYPTPARTTGFGVASSLGKVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVL  459

Query  108  LGLSVLLFPTETKGQQLSDAVVA  40
               S LLFP ET G++L D V A
Sbjct  460  AIASSLLFPFETMGRELKDTVDA  482



>ref|XP_010278453.1| PREDICTED: organic cation/carnitine transporter 7 [Nelumbo nucifera]
 ref|XP_010278454.1| PREDICTED: organic cation/carnitine transporter 7 [Nelumbo nucifera]
 ref|XP_010278455.1| PREDICTED: organic cation/carnitine transporter 7 [Nelumbo nucifera]
Length=496

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 107/145 (74%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+L+A  +D++GRKF+M  M+ LG +FLLPLV+HQ E LTT LL GAR+C  GT
Sbjct  345  FAEFPGLLLSAATIDRVGRKFTMSAMFFLGCIFLLPLVIHQAEILTTGLLFGARICITGT  404

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F +  I+ PEIYPTS+R TG GVA+SVGRI GMICPIVAV  V  C   A+I LF ++  
Sbjct  405  FAVVYIYAPEIYPTSIRATGLGVASSVGRIGGMICPIVAVGLVHSCHQTASIFLFVIVMF  464

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            + G  V+LFP ETKG++LSD V  S
Sbjct  465  LSGFCVMLFPFETKGRELSDTVSGS  489



>ref|XP_008456184.1| PREDICTED: organic cation/carnitine transporter 7 [Cucumis melo]
Length=502

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+L+AV+VDK+GRK SM  M+ LG +FL PLV ++ + LTT LL GAR+C   T
Sbjct  361  FAEFPGLLLSAVMVDKLGRKLSMSSMFFLGAIFLFPLVFYRSDGLTTGLLFGARVCITST  420

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPTS+RTTG GVA+SVGRI GM CP+VAV  V GC    AI+ FE++ +
Sbjct  421  FTVVYIYAPEIYPTSIRTTGVGVASSVGRIGGMTCPLVAVALVKGCHQTVAIVFFEIVFI  480

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G+ V+LFP ETKGQ L + V
Sbjct  481  LSGICVVLFPFETKGQDLPEKV  502



>ref|XP_008342934.1| PREDICTED: organic cation/carnitine transporter 7-like [Malus 
domestica]
Length=141

 Score =   145 bits (367),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -1

Query  435  LVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIY  256
            +VDK+GRK SM  M+ +  +FLLPLV+HQ + LTT LL GAR+C   TFTI  I+ PEIY
Sbjct  1    MVDKLGRKLSMSAMFFICCIFLLPLVVHQSQGLTTSLLFGARICITATFTIVYIYAPEIY  60

Query  255  PTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTE  76
            PTS+RTTG G+A+S+GRI GMICP+VAV  V GC   A+I+LFE++  + G+ VLLFP E
Sbjct  61   PTSIRTTGVGIASSMGRIGGMICPLVAVGLVHGCHQTASILLFEIVIFLSGVCVLLFPFE  120

Query  75   TKGQQLSDAVVAS  37
            TKG++LSD++  S
Sbjct  121  TKGRELSDSLSDS  133



>ref|XP_011093928.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum 
indicum]
 ref|XP_011093929.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum 
indicum]
Length=485

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AEVPGLIL+A +VD++GRKFSM+ M+ L  L LLPL+ HQ+E LTT LL GAR     TF
Sbjct  340  AEVPGLILSAFIVDRVGRKFSMVIMFVLASLLLLPLLAHQNEILTTTLLFGARTFISATF  399

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  I+CPE+YPT++R TG G+A ++GRI GMICP+VAV  V+ C+   A+ILF+V  ++
Sbjct  400  VVACIYCPEVYPTNIRATGVGIATAIGRIGGMICPLVAVGLVNDCQQAYAVILFQVTIIL  459

Query  108  LGLSVLLFPTETKGQQLSDAVVAS  37
              L VLL P ETKG+ L+DA+ A 
Sbjct  460  SALCVLLSPFETKGRNLADALAAD  483



>ref|XP_006380839.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
 gb|ERP58636.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
Length=490

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGLI++A++VD+IGRK SM  ++ +  +FLLPLV+HQ   +TT+LL GAR+C  GT
Sbjct  333  FAEFPGLIVSALIVDRIGRKLSMAALFFVACIFLLPLVVHQSPRITTILLFGARICITGT  392

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVR+TG GVA+++GRI GMICP+VAV  V GC   AA++LF  +  
Sbjct  393  FTIVFIYAPEIYPTSVRSTGMGVASAMGRIGGMICPLVAVSLVQGCHQTAALVLFVCVMF  452

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G  V+LFP ETKG +L+++V ++
Sbjct  453  VAGCCVMLFPHETKGLELTESVSST  477



>ref|XP_003604112.1| Synaptic vesicle 2-related protein [Medicago truncatula]
 gb|AES86309.1| organic cation/carnitine transporter-like protein [Medicago truncatula]
Length=499

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+L+AV VDK+GRK SM  M+ +  +FLLPL  +  E LTT LL GAR+C   T
Sbjct  349  FAELPGLLLSAVAVDKLGRKLSMSIMFFMCCIFLLPLTFYLPEDLTTGLLFGARICITVT  408

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG GVA+SVGRI GM+CP+VAV  V GC   AA++LF ++A+
Sbjct  409  FTIVYIYAPEIYPTSVRTTGVGVASSVGRIGGMLCPLVAVGLVHGCHQTAAVLLFIIVAL  468

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            V G+ V+ FP ET GQ+L D V
Sbjct  469  VSGICVVFFPFETMGQELQDTV  490



>ref|XP_007135876.1| hypothetical protein PHAVU_010G165500g [Phaseolus vulgaris]
 gb|ESW07870.1| hypothetical protein PHAVU_010G165500g [Phaseolus vulgaris]
Length=414

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+L+AV VDK+GRK SM  M+ +  +FLLPLV +  E LTT LL  AR+C   T
Sbjct  271  FAELPGLLLSAVAVDKLGRKLSMSSMFFMCSIFLLPLVFYLPEGLTTGLLFLARICITAT  330

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPTSVRTTG G+A++VGRI GMICP+VAV  V GC   AA++LFEVIA+
Sbjct  331  FTIVYIYAPEMYPTSVRTTGVGIASAVGRIGGMICPLVAVGLVHGCHQTAAVLLFEVIAL  390

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G+ V+  P ET GQ+L D+V
Sbjct  391  LSGICVMFLPIETMGQELRDSV  412



>ref|XP_006380840.1| transporter-related family protein [Populus trichocarpa]
 gb|ERP58637.1| transporter-related family protein [Populus trichocarpa]
Length=506

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGLI++A++VD+IGRK SM  ++ +  +FLLPLV+HQ   +TT+LL GAR+C  GT
Sbjct  349  FAEFPGLIVSALIVDRIGRKLSMAALFFVACIFLLPLVVHQSPRITTILLFGARICITGT  408

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVR+TG GVA+++GRI GMICP+VAV  V GC   AA++LF  +  
Sbjct  409  FTIVFIYAPEIYPTSVRSTGMGVASAMGRIGGMICPLVAVSLVQGCHQTAALVLFVCVMF  468

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G  V+LFP ETKG +L+++V ++
Sbjct  469  VAGCCVMLFPHETKGLELTESVSST  493



>ref|XP_006380838.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
 gb|ERP58635.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
Length=529

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGLI++A++VD+IGRK SM  ++ +  +FLLPLV+HQ   +TT+LL GAR+C  GT
Sbjct  372  FAEFPGLIVSALIVDRIGRKLSMAALFFVACIFLLPLVVHQSPRITTILLFGARICITGT  431

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVR+TG GVA+++GRI GMICP+VAV  V GC   AA++LF  +  
Sbjct  432  FTIVFIYAPEIYPTSVRSTGMGVASAMGRIGGMICPLVAVSLVQGCHQTAALVLFVCVMF  491

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G  V+LFP ETKG +L+++V ++
Sbjct  492  VAGCCVMLFPHETKGLELTESVSST  516



>ref|XP_002310344.2| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
 gb|EEE90794.2| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
Length=601

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGLI++A++VD+IGRK SM  ++ +  +FLLPLV+HQ   +TT+LL GAR+C  GT
Sbjct  444  FAEFPGLIVSALIVDRIGRKLSMAALFFVACIFLLPLVVHQSPRITTILLFGARICITGT  503

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVR+TG GVA+++GRI GMICP+VAV  V GC   AA++LF  +  
Sbjct  504  FTIVFIYAPEIYPTSVRSTGMGVASAMGRIGGMICPLVAVSLVQGCHQTAALVLFVCVMF  563

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G  V+LFP ETKG +L+++V ++
Sbjct  564  VAGCCVMLFPHETKGLELTESVSST  588



>ref|XP_007135877.1| hypothetical protein PHAVU_010G165500g [Phaseolus vulgaris]
 gb|ESW07871.1| hypothetical protein PHAVU_010G165500g [Phaseolus vulgaris]
Length=487

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+L+AV VDK+GRK SM  M+ +  +FLLPLV +  E LTT LL  AR+C   T
Sbjct  344  FAELPGLLLSAVAVDKLGRKLSMSSMFFMCSIFLLPLVFYLPEGLTTGLLFLARICITAT  403

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPTSVRTTG G+A++VGRI GMICP+VAV  V GC   AA++LFEVIA+
Sbjct  404  FTIVYIYAPEMYPTSVRTTGVGIASAVGRIGGMICPLVAVGLVHGCHQTAAVLLFEVIAL  463

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G+ V+  P ET GQ+L D+V
Sbjct  464  LSGICVMFLPIETMGQELRDSV  485



>ref|XP_004507561.1| PREDICTED: organic cation/carnitine transporter 7-like [Cicer 
arietinum]
Length=515

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+L+AV VDK+GRK SM  M+ +  +FLLPL+ +  E+LTT LL GAR+C   T
Sbjct  365  FAELPGLLLSAVAVDKLGRKLSMSSMFFMCCIFLLPLIFYLPESLTTSLLFGARVCITVT  424

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG G+A+SVGRI GM+CP+VAV  V GC    A++LF ++A+
Sbjct  425  FTIVYIYAPEIYPTSVRTTGVGIASSVGRIGGMLCPLVAVGLVHGCHQTIAVLLFVIVAL  484

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            V G+ V+ FP ET GQ+L D V
Sbjct  485  VSGICVMFFPVETMGQELQDTV  506



>gb|KJB23422.1| hypothetical protein B456_004G097300 [Gossypium raimondii]
Length=310

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+L+A+LVD++GRK SM  M+ L F+FL PL++ Q   LTT LL GARM  +GTF
Sbjct  170  AELPGLLLSAILVDRVGRKHSMAIMFGLAFIFLTPLLIQQPAVLTTCLLFGARMNAMGTF  229

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PE+YPTSVRTTGAGVA+++GRI GM+CP+VAV  V+ C   AA+ LF V  VV
Sbjct  230  TVASIYSPELYPTSVRTTGAGVASAIGRIGGMVCPLVAVGLVNECHQTAAVALFLVAIVV  289

Query  108  LGLSVLLFPTETKGQQLSD  52
              + + LFP +TKG++LSD
Sbjct  290  SIVCIQLFPYDTKGRELSD  308



>ref|XP_006380841.1| hypothetical protein POPTR_0007s15130g [Populus trichocarpa]
 gb|ERP58638.1| hypothetical protein POPTR_0007s15130g [Populus trichocarpa]
Length=389

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGLIL+A+++D++GRK SM  M+ +  +FLLPLV+HQ   +TT LL GAR C  GT
Sbjct  230  FAEFPGLILSALVIDRLGRKLSMAAMFFVCCIFLLPLVVHQSTGVTTTLLFGARTCITGT  289

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPT +RTTG GVA+SV RI GM+CP+VAV  V GC   AA++ F  I  
Sbjct  290  FTIVYIYAPELYPTFMRTTGVGVASSVSRIGGMVCPLVAVSLVQGCHQTAAVVFFASIVF  349

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            V G+ VLLFP ETKG  L+D++
Sbjct  350  VAGICVLLFPFETKGLDLADSL  371



>ref|XP_007014586.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY32205.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=493

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+L+A+L+D++GRK SM  M+ + F+FLLPL+  Q   LTT LL GARMC +GTF
Sbjct  349  AELPGLLLSAILIDRVGRKQSMALMFVIAFVFLLPLLTRQSAVLTTCLLFGARMCAMGTF  408

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PE+YPT VR TGAGVA ++GRI G++CP+VAV  V+ C   AA+++F V+ ++
Sbjct  409  TVACIYTPELYPTPVRATGAGVATAMGRIGGVVCPLVAVGLVTECHQTAAVVIFLVVLIL  468

Query  108  LGLSVLLFPTETKGQQLSDAVVAS  37
              + +LLFP ETKG++LSD +V S
Sbjct  469  SVVCILLFPYETKGRELSDTMVGS  492



>ref|XP_007014587.1| Major facilitator superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY32206.1| Major facilitator superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=486

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+L+A+L+D++GRK SM  M+ + F+FLLPL+  Q   LTT LL GARMC +GTF
Sbjct  342  AELPGLLLSAILIDRVGRKQSMALMFVIAFVFLLPLLTRQSAVLTTCLLFGARMCAMGTF  401

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PE+YPT VR TGAGVA ++GRI G++CP+VAV  V+ C   AA+++F V+ ++
Sbjct  402  TVACIYTPELYPTPVRATGAGVATAMGRIGGVVCPLVAVGLVTECHQTAAVVIFLVVLIL  461

Query  108  LGLSVLLFPTETKGQQLSDAVVAS  37
              + +LLFP ETKG++LSD +V S
Sbjct  462  SVVCILLFPYETKGRELSDTMVGS  485



>ref|XP_006582968.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Glycine max]
Length=414

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+L+A  VDK+GRK SM  M+ +  +FLLPL+ +  E LTT  L  AR+C   T
Sbjct  271  FAELPGLLLSAAAVDKLGRKLSMSTMFFMCCIFLLPLLFYLPEGLTTSFLFLARICITAT  330

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPTSVRTTG G+A+SVGRI GMICP++AV  V GC   AA++LFE++A+
Sbjct  331  FTIVYIYAPEMYPTSVRTTGVGIASSVGRIGGMICPLIAVGLVHGCHQTAAVLLFEIVAL  390

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G+ V+ FP ET GQ+L D+V
Sbjct  391  LSGICVMFFPIETMGQELRDSV  412



>ref|XP_011031262.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
Length=529

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGLI++A++VD+IGRK SM  ++ +  +FLLPLV+HQ   +TT+LL GAR+C  GT
Sbjct  372  FAEFPGLIVSALIVDRIGRKLSMAALFFVACIFLLPLVVHQSPRITTILLFGARICITGT  431

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVR+TG GVA+++GRI GMICP+VAV  V GC   AA++LF  +  
Sbjct  432  FTIVFIYAPEIYPTSVRSTGMGVASAMGRIGGMICPLVAVSLVQGCHQTAALVLFVCVMF  491

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G  V+LFP ET G +L+++V ++
Sbjct  492  VAGCCVMLFPHETNGLELTESVSST  516



>gb|EYU21187.1| hypothetical protein MIMGU_mgv1a005199mg [Erythranthe guttata]
Length=493

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+L+A  VDK GRK SM  M+ + F+FLLPLV HQ ++LTT LL GAR+C  GT
Sbjct  342  FAEFPGLVLSAATVDKFGRKNSMAAMFLVCFIFLLPLVFHQPQSLTTGLLFGARICITGT  401

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPTSVRTTG GVA+SVGRI GM+CP+VAV  + GC    AI LFE I  
Sbjct  402  FTILYIYAPEVYPTSVRTTGVGVASSVGRIGGMVCPVVAVSLIHGCHQTIAIFLFEAIIF  461

Query  111  VLGLSVLLFPTETKGQQL  58
            + G+ V LFP ET G QL
Sbjct  462  LSGICVCLFPVETTGLQL  479



>ref|XP_010928751.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Elaeis guineensis]
Length=419

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+L+A +VD+IGRK SM  M  +  +FL PL  HQ EALTT LL GAR+C  G+
Sbjct  276  FAEIPGLVLSAAIVDRIGRKLSMSAMLFISCIFLFPLAFHQTEALTTALLFGARICISGS  335

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  ++ PEIYPTSVRTTG G A+SVGRI G +CP+VAV  V  C    AI LFE++  
Sbjct  336  FTVVYVYAPEIYPTSVRTTGIGTASSVGRIGGAVCPLVAVSMVHACHQTLAISLFELVIF  395

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G++   FP ET G++LSD++
Sbjct  396  LSGMAACFFPFETSGRRLSDSL  417



>gb|KHG05838.1| Organic cation/carnitine transporter 7 [Gossypium arboreum]
Length=310

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+L+A+LVD++GRK SM  M+ L F+FL PL++ Q   LTT LL GARM  +GTF
Sbjct  170  AELPGLLLSAILVDRVGRKQSMAIMFGLAFIFLSPLLIQQPAVLTTCLLFGARMNAMGTF  229

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PE+YPTSVRTTGAGVA+++GRI GM+CP+VAV  V+ C   AA+ LF V  VV
Sbjct  230  TVASIYSPELYPTSVRTTGAGVASAIGRIGGMVCPLVAVGLVNECHQTAAVALFLVAIVV  289

Query  108  LGLSVLLFPTETKGQQLSD  52
              + + LFP +TKG++LSD
Sbjct  290  SIVCIQLFPYDTKGRELSD  308



>ref|XP_010928752.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X3 [Elaeis guineensis]
Length=412

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+L+A +VD+IGRK SM  M  +  +FL PL  HQ EALTT LL GAR+C  G+
Sbjct  269  FAEIPGLVLSAAIVDRIGRKLSMSAMLFISCIFLFPLAFHQTEALTTALLFGARICISGS  328

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  ++ PEIYPTSVRTTG G A+SVGRI G +CP+VAV  V  C    AI LFE++  
Sbjct  329  FTVVYVYAPEIYPTSVRTTGIGTASSVGRIGGAVCPLVAVSMVHACHQTLAISLFELVIF  388

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G++   FP ET G++LSD++
Sbjct  389  LSGMAACFFPFETSGRRLSDSL  410



>gb|KHN39387.1| Organic cation/carnitine transporter 7 [Glycine soja]
Length=448

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+L+A  VDK+GRK SM  M+ +  +FLLPL+ +  E LTT  L  AR+C   T
Sbjct  305  FAELPGLLLSAAAVDKLGRKLSMSTMFFMCCIFLLPLLFYLPEGLTTSFLFLARICITAT  364

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPTSVRTTG G+A+SVGRI GMICP++AV  V GC   AA++LFE++A+
Sbjct  365  FTIVYIYAPEMYPTSVRTTGVGIASSVGRIGGMICPLIAVGLVHGCHQTAAVLLFEIVAL  424

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G+ V+ FP ET GQ+L D+V
Sbjct  425  LSGICVMFFPIETMGQELRDSV  446



>ref|XP_002310345.2| transporter-related family protein [Populus trichocarpa]
 gb|EEE90795.2| transporter-related family protein [Populus trichocarpa]
Length=487

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGLIL+A+++D++GRK SM  M+ +  +FLLPLV+HQ   +TT LL GAR C  GT
Sbjct  328  FAEFPGLILSALVIDRLGRKLSMAAMFFVCCIFLLPLVVHQSTGVTTTLLFGARTCITGT  387

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPT +RTTG GVA+SV RI GM+CP+VAV  V GC   AA++ F  I  
Sbjct  388  FTIVYIYAPELYPTFMRTTGVGVASSVSRIGGMVCPLVAVSLVQGCHQTAAVVFFASIVF  447

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            V G+ VLLFP ETKG  L+D++
Sbjct  448  VAGICVLLFPFETKGLDLADSL  469



>ref|XP_006582967.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Glycine max]
Length=487

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+L+A  VDK+GRK SM  M+ +  +FLLPL+ +  E LTT  L  AR+C   T
Sbjct  344  FAELPGLLLSAAAVDKLGRKLSMSTMFFMCCIFLLPLLFYLPEGLTTSFLFLARICITAT  403

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPTSVRTTG G+A+SVGRI GMICP++AV  V GC   AA++LFE++A+
Sbjct  404  FTIVYIYAPEMYPTSVRTTGVGIASSVGRIGGMICPLIAVGLVHGCHQTAAVLLFEIVAL  463

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G+ V+ FP ET GQ+L D+V
Sbjct  464  LSGICVMFFPIETMGQELRDSV  485



>gb|KDO73400.1| hypothetical protein CISIN_1g011416mg [Citrus sinensis]
Length=369

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 129/194 (66%), Gaps = 9/194 (5%)
 Frame = -1

Query  594  HAICLLISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKI  421
            +A+ LLIS  LS  S+   C++ L           + ++F+   AE+PGL+LAA+LVD  
Sbjct  183  YAVVLLIS-ELS--SLDTRCRSPLMFSHHPQDANLYIDEFITSLAEIPGLLLAAILVDTA  239

Query  420  GRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVR  241
            GRK S+  M+ L  LFLLPLV +Q   LTT LL GARMC +G FT+++I+  EIYPTSVR
Sbjct  240  GRKLSITIMFTLSCLFLLPLVTYQSNILTTGLLFGARMCVMGAFTVSLIYAAEIYPTSVR  299

Query  240  TTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQ  61
            +TGAG AN++GRI GM+CP+VAV  V+ C  M A++L  V+ V   LSV+L P ETKGQ+
Sbjct  300  STGAGAANAMGRIGGMVCPLVAVALVANCHQMTAVVLLVVVIVTSILSVMLIPFETKGQE  359

Query  60   LSDAVVAS*TFVSD  19
            LSD V     F SD
Sbjct  360  LSDTV----DFTSD  369



>ref|XP_010928750.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Elaeis guineensis]
Length=497

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+L+A +VD+IGRK SM  M  +  +FL PL  HQ EALTT LL GAR+C  G+
Sbjct  354  FAEIPGLVLSAAIVDRIGRKLSMSAMLFISCIFLFPLAFHQTEALTTALLFGARICISGS  413

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  ++ PEIYPTSVRTTG G A+SVGRI G +CP+VAV  V  C    AI LFE++  
Sbjct  414  FTVVYVYAPEIYPTSVRTTGIGTASSVGRIGGAVCPLVAVSMVHACHQTLAISLFELVIF  473

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G++   FP ET G++LSD++
Sbjct  474  LSGMAACFFPFETSGRRLSDSL  495



>gb|KHN38113.1| Organic cation/carnitine transporter 7 [Glycine soja]
Length=487

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+L+A  VDK+GRK SM  M+ +  +FLLPL+ +  E LTT  L  AR+C   T
Sbjct  344  FAELPGLLLSAAAVDKLGRKLSMSIMFFMCCIFLLPLLFYLPEGLTTSFLFLARICITAT  403

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPTSVRTTG G+A+SVGRI GMICP+VAV  V GC   AA++LFE++++
Sbjct  404  FTIVYIYAPEMYPTSVRTTGVGIASSVGRIGGMICPLVAVGLVHGCHQTAAVLLFEIVSL  463

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            V G+ V+ FP ET GQ+L ++V
Sbjct  464  VSGICVMFFPIETMGQELRNSV  485



>ref|XP_010421981.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Camelina sativa]
Length=401

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AEVPGL+L+A +VD++GRK SM  M      FLLPL+ HQ   +TT LL G R+C    
Sbjct  249  FAEVPGLLLSAAMVDRLGRKVSMASMLFTCCFFLLPLLSHQSPFITTALLFGGRICISAA  308

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VRTTG GVA+SVGRI G++CP+VAV  V GC    A++LFE++ +
Sbjct  309  FTVVYIYAPEIYPTAVRTTGVGVASSVGRIGGVLCPLVAVGLVHGCHQTIAVLLFEIVIL  368

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G+ V LFP ET G+ L+D++ AS
Sbjct  369  VSGICVCLFPFETSGRDLTDSISAS  393



>ref|XP_011031259.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
Length=503

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGLIL+A+++D++GRK SM  M+ +  +FLLPLV+HQ   +TT LL GAR C  GT
Sbjct  344  FAEFPGLILSALVIDRLGRKLSMAAMFFVCCIFLLPLVVHQSTGVTTALLFGARTCITGT  403

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPT +RTTG GVA+SV RI GM+CP+VAV  V GC   AA++ F  I  
Sbjct  404  FTIVYIYAPELYPTFMRTTGVGVASSVSRIGGMVCPLVAVSLVQGCHQTAAVVFFASIVF  463

Query  111  VLGLSVLLFPTETKGQQLSD  52
            V G+ VLLFP ETKG  L+D
Sbjct  464  VAGICVLLFPFETKGLDLAD  483



>gb|ABK96271.1| unknown [Populus trichocarpa x Populus deltoides]
Length=131

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -1

Query  405  MMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVRTTGAG  226
            M FM+ L  +FLLPLV HQ   LTT LL GARMC +GTFT+  I+ PE+YPT++R TGAG
Sbjct  1    MAFMFVLACIFLLPLVFHQHATLTTALLFGARMCAIGTFTVAAIYAPEVYPTAIRATGAG  60

Query  225  VANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQLSDAV  46
            VAN+VGRI GM+CP+VAV  V+GC +  AIILFEV+ V+  + VLLFP ET G++LSD++
Sbjct  61   VANAVGRIGGMVCPLVAVGLVAGCHLKEAIILFEVLIVISVVCVLLFPFETSGRELSDSL  120

Query  45   VAS  37
             AS
Sbjct  121  AAS  123



>ref|XP_006585686.1| PREDICTED: organic cation/carnitine transporter 7-like [Glycine 
max]
Length=487

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+L+A  VDK+GRK SM  M+ +  +FLLPL+ +  E LTT  L  AR+C   T
Sbjct  344  FAELPGLLLSAAAVDKLGRKLSMSIMFFMCCIFLLPLLFYLPEGLTTSFLFLARICITAT  403

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PE+YPTSVRTTG G+A+SVGRI GMICP+VAV  V GC   AA++LFE++++
Sbjct  404  FTIVYIYAPEMYPTSVRTTGVGIASSVGRIGGMICPLVAVGLVHGCHQTAAVLLFEIVSL  463

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            V G+ V+ FP ET GQ+L + V
Sbjct  464  VSGICVMFFPIETMGQELRNNV  485



>gb|KJB23424.1| hypothetical protein B456_004G097300 [Gossypium raimondii]
Length=482

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+L+A+LVD++GRK SM  M+ L F+FL PL++ Q   LTT LL GARM  +GTF
Sbjct  342  AELPGLLLSAILVDRVGRKHSMAIMFGLAFIFLTPLLIQQPAVLTTCLLFGARMNAMGTF  401

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PE+YPTSVRTTGAGVA+++GRI GM+CP+VAV  V+ C   AA+ LF V  VV
Sbjct  402  TVASIYSPELYPTSVRTTGAGVASAIGRIGGMVCPLVAVGLVNECHQTAAVALFLVAIVV  461

Query  108  LGLSVLLFPTETKGQQLSD  52
              + + LFP +TKG++LSD
Sbjct  462  SIVCIQLFPYDTKGRELSD  480



>gb|AFH57281.1| MFS [Gossypium hirsutum]
Length=482

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+L+A+LVD++GRK SM  M+ L F+FL PL++ Q   LTT LL GARM  +GTF
Sbjct  342  AELPGLLLSAILVDRVGRKHSMAIMFGLAFIFLTPLLIQQPAVLTTCLLFGARMNAMGTF  401

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PE+YPTSVRTTGAGVA+++GRI GM+CP+VAV  V+ C   AA+ LF V  VV
Sbjct  402  TVASIYSPELYPTSVRTTGAGVASAIGRIGGMVCPLVAVGLVNECHQTAAVALFLVAIVV  461

Query  108  LGLSVLLFPTETKGQQLSD  52
              + + LFP +TKG++LSD
Sbjct  462  SIVCIQLFPYDTKGRELSD  480



>gb|KDO73398.1| hypothetical protein CISIN_1g011416mg [Citrus sinensis]
Length=447

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 129/194 (66%), Gaps = 9/194 (5%)
 Frame = -1

Query  594  HAICLLISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKI  421
            +A+ LLIS  LS  S+   C++ L           + ++F+   AE+PGL+LAA+LVD  
Sbjct  261  YAVVLLIS-ELS--SLDTRCRSPLMFSHHPQDANLYIDEFITSLAEIPGLLLAAILVDTA  317

Query  420  GRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVR  241
            GRK S+  M+ L  LFLLPLV +Q   LTT LL GARMC +G FT+++I+  EIYPTSVR
Sbjct  318  GRKLSITIMFTLSCLFLLPLVTYQSNILTTGLLFGARMCVMGAFTVSLIYAAEIYPTSVR  377

Query  240  TTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQ  61
            +TGAG AN++GRI GM+CP+VAV  V+ C  M A++L  V+ V   LSV+L P ETKGQ+
Sbjct  378  STGAGAANAMGRIGGMVCPLVAVALVANCHQMTAVVLLVVVIVTSILSVMLIPFETKGQE  437

Query  60   LSDAVVAS*TFVSD  19
            LSD V     F SD
Sbjct  438  LSDTV----DFTSD  447



>gb|KDO73401.1| hypothetical protein CISIN_1g011416mg [Citrus sinensis]
 gb|KDO73402.1| hypothetical protein CISIN_1g011416mg [Citrus sinensis]
Length=427

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 129/194 (66%), Gaps = 9/194 (5%)
 Frame = -1

Query  594  HAICLLISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKI  421
            +A+ LLIS  LS  S+   C++ L           + ++F+   AE+PGL+LAA+LVD  
Sbjct  241  YAVVLLIS-ELS--SLDTRCRSPLMFSHHPQDANLYIDEFITSLAEIPGLLLAAILVDTA  297

Query  420  GRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVR  241
            GRK S+  M+ L  LFLLPLV +Q   LTT LL GARMC +G FT+++I+  EIYPTSVR
Sbjct  298  GRKLSITIMFTLSCLFLLPLVTYQSNILTTGLLFGARMCVMGAFTVSLIYAAEIYPTSVR  357

Query  240  TTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQ  61
            +TGAG AN++GRI GM+CP+VAV  V+ C  M A++L  V+ V   LSV+L P ETKGQ+
Sbjct  358  STGAGAANAMGRIGGMVCPLVAVALVANCHQMTAVVLLVVVIVTSILSVMLIPFETKGQE  417

Query  60   LSDAVVAS*TFVSD  19
            LSD V     F SD
Sbjct  418  LSDTV----DFTSD  427



>gb|KJB23421.1| hypothetical protein B456_004G097300, partial [Gossypium raimondii]
Length=556

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+L+A+LVD++GRK SM  M+ L F+FL PL++ Q   LTT LL GARM  +GTF
Sbjct  416  AELPGLLLSAILVDRVGRKHSMAIMFGLAFIFLTPLLIQQPAVLTTCLLFGARMNAMGTF  475

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PE+YPTSVRTTGAGVA+++GRI GM+CP+VAV  V+ C   AA+ LF V  VV
Sbjct  476  TVASIYSPELYPTSVRTTGAGVASAIGRIGGMVCPLVAVGLVNECHQTAAVALFLVAIVV  535

Query  108  LGLSVLLFPTETKGQQLSD  52
              + + LFP +TKG++LSD
Sbjct  536  SIVCIQLFPYDTKGRELSD  554



>ref|XP_010465101.1| PREDICTED: organic cation/carnitine transporter 7 [Camelina sativa]
Length=500

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AEVPGL+L+A +VD++GRK SM  M      FLLPL+ HQ   +TT LL G R+C    
Sbjct  348  FAEVPGLLLSAAMVDRLGRKVSMASMLFTCCFFLLPLLSHQSPFITTALLFGGRICISAA  407

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VRTTG GVA+SVGRI G++CP+VAV  V GC    A++LFE++ +
Sbjct  408  FTVVYIYAPEIYPTAVRTTGVGVASSVGRIGGVLCPLVAVGLVHGCHQTIAVLLFEIVIL  467

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G+ V LFP ET G+ L+D++ AS
Sbjct  468  VSGICVCLFPFETSGRDLTDSISAS  492



>gb|KDP25026.1| hypothetical protein JCGZ_22561 [Jatropha curcas]
Length=572

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGLIL+A+ VD+ GRK SM  M+ +  +FLLPLV+HQ  ALTT LL GAR+C   T
Sbjct  415  FAEFPGLILSALTVDRFGRKLSMAAMFFICCIFLLPLVVHQSSALTTALLFGARICITET  474

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPTSVRTTG GVA+S+GRI GM+CP+VAV  V GC    AI+LF  +  
Sbjct  475  FTVVYIYAPEIYPTSVRTTGVGVASSMGRIGGMVCPLVAVSLVQGCHQTTAILLFVGVVF  534

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
              G+ V  FP ET G++L+D++ ++
Sbjct  535  ASGICVSFFPFETMGRELADSISST  559



>gb|KDO73399.1| hypothetical protein CISIN_1g011416mg [Citrus sinensis]
Length=486

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 129/194 (66%), Gaps = 9/194 (5%)
 Frame = -1

Query  594  HAICLLISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKI  421
            +A+ LLIS  LS  S+   C++ L           + ++F+   AE+PGL+LAA+LVD  
Sbjct  300  YAVVLLIS-ELS--SLDTRCRSPLMFSHHPQDANLYIDEFITSLAEIPGLLLAAILVDTA  356

Query  420  GRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVR  241
            GRK S+  M+ L  LFLLPLV +Q   LTT LL GARMC +G FT+++I+  EIYPTSVR
Sbjct  357  GRKLSITIMFTLSCLFLLPLVTYQSNILTTGLLFGARMCVMGAFTVSLIYAAEIYPTSVR  416

Query  240  TTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQ  61
            +TGAG AN++GRI GM+CP+VAV  V+ C  M A++L  V+ V   LSV+L P ETKGQ+
Sbjct  417  STGAGAANAMGRIGGMVCPLVAVALVANCHQMTAVVLLVVVIVTSILSVMLIPFETKGQE  476

Query  60   LSDAVVAS*TFVSD  19
            LSD V     F SD
Sbjct  477  LSDTV----DFTSD  486



>ref|XP_006453139.1| hypothetical protein CICLE_v10008130mg [Citrus clementina]
 ref|XP_006453140.1| hypothetical protein CICLE_v10008130mg [Citrus clementina]
 ref|XP_006474363.1| PREDICTED: organic cation/carnitine transporter 7-like [Citrus 
sinensis]
 gb|ESR66379.1| hypothetical protein CICLE_v10008130mg [Citrus clementina]
 gb|ESR66380.1| hypothetical protein CICLE_v10008130mg [Citrus clementina]
Length=486

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 129/194 (66%), Gaps = 9/194 (5%)
 Frame = -1

Query  594  HAICLLISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKI  421
            +A+ LLIS  LS  S+   C++ L           + ++F+   AE+PGL+LAA+LVD  
Sbjct  300  YAVVLLIS-ELS--SLDTRCRSPLMFSHHPQDANLYIDEFITSLAEIPGLLLAAILVDTA  356

Query  420  GRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVR  241
            GRK S+  M+ L  LFLLPLV +Q   LTT LL GARMC +G FT+++I+  EIYPTSVR
Sbjct  357  GRKLSITIMFTLSCLFLLPLVTYQSNILTTGLLFGARMCVMGAFTVSLIYAAEIYPTSVR  416

Query  240  TTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQ  61
            +TGAG AN++GRI GM+CP+VAV  V+ C  M A++L  V+ V   LSV+L P ETKGQ+
Sbjct  417  STGAGAANAMGRIGGMVCPLVAVALVANCHQMTAVVLLVVVIVTSILSVMLIPFETKGQE  476

Query  60   LSDAVVAS*TFVSD  19
            LSD V     F SD
Sbjct  477  LSDTV----DFTSD  486



>ref|XP_010421982.1| PREDICTED: organic cation/carnitine transporter 7-like [Camelina 
sativa]
 ref|XP_010421983.1| PREDICTED: organic cation/carnitine transporter 7-like [Camelina 
sativa]
 ref|XP_010421984.1| PREDICTED: organic cation/carnitine transporter 7-like [Camelina 
sativa]
Length=500

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AEVPGL+L+A +VD++GRK SM  M      FLLPL+ HQ   +TT LL G R+C    
Sbjct  348  FAEVPGLLLSAAMVDRLGRKVSMASMLFTCCFFLLPLLSHQSPFITTALLFGGRICISAA  407

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VRTTG GVA+SVGRI G++CP+VAV  V GC    A++LFE++ +
Sbjct  408  FTVVYIYAPEIYPTAVRTTGVGVASSVGRIGGVLCPLVAVGLVHGCHQTIAVLLFEIVIL  467

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G+ V LFP ET G+ L+D++ AS
Sbjct  468  VSGICVCLFPFETSGRDLTDSISAS  492



>ref|XP_010421978.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Camelina sativa]
 ref|XP_010421979.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Camelina sativa]
 ref|XP_010421980.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Camelina sativa]
Length=500

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AEVPGL+L+A +VD++GRK SM  M      FLLPL+ HQ   +TT LL G R+C    
Sbjct  348  FAEVPGLLLSAAMVDRLGRKVSMASMLFTCCFFLLPLLSHQSPFITTALLFGGRICISAA  407

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VRTTG GVA+SVGRI G++CP+VAV  V GC    A++LFE++ +
Sbjct  408  FTVVYIYAPEIYPTAVRTTGVGVASSVGRIGGVLCPLVAVGLVHGCHQTIAVLLFEIVIL  467

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G+ V LFP ET G+ L+D++ AS
Sbjct  468  VSGICVCLFPFETSGRDLTDSISAS  492



>ref|XP_010499859.1| PREDICTED: organic cation/carnitine transporter 7-like [Camelina 
sativa]
 ref|XP_010499865.1| PREDICTED: organic cation/carnitine transporter 7-like [Camelina 
sativa]
Length=500

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AEVPGL+L+A +VD++GRK SM  M      FLLPL+ HQ   +TT LL G R+C    
Sbjct  348  FAEVPGLLLSAAMVDRLGRKVSMASMLFTCCFFLLPLLSHQSPFITTALLFGGRICISAA  407

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VRTTG GVA+SVGRI G++CP+VAV  V GC    A++LFE++ +
Sbjct  408  FTVVYIYAPEIYPTAVRTTGVGVASSVGRIGGVLCPLVAVGLVHGCHQTIAVLLFEIVIL  467

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G+ V LFP ET G+ L+D++ AS
Sbjct  468  VSGICVCLFPFETSGRDLTDSISAS  492



>ref|XP_010552380.1| PREDICTED: organic cation/carnitine transporter 7 [Tarenaya hassleriana]
Length=503

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL++AA +VD++GR+ SM  M+ L  LFLLPL+ HQ   LTT LL GAR+C   T
Sbjct  346  FAEFPGLLVAAAMVDRVGRRLSMSSMFFLCCLFLLPLISHQPLGLTTALLFGARVCITAT  405

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG GV +SVGRI GM+CP+VAV  V GC   A+I LF  I +
Sbjct  406  FTIIYIYAPEIYPTSVRTTGVGVGSSVGRIGGMVCPLVAVGLVHGCHQTASIFLFLCIIL  465

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G+ V  FP ET G+ LSD V
Sbjct  466  LSGICVCFFPLETSGRNLSDTV  487



>ref|XP_006425192.1| hypothetical protein CICLE_v10028224mg [Citrus clementina]
 gb|ESR38432.1| hypothetical protein CICLE_v10028224mg [Citrus clementina]
Length=514

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+LAA +VD++GRK SM  M+    +FL+PL+  Q + LTT LL GAR+C   T
Sbjct  365  FAEFPGLLLAAAVVDRLGRKLSMSSMFFCCCIFLVPLLFQQPKGLTTGLLFGARICITVT  424

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  ++ PEIYPTSVRTTG GVA+S+GRI GM+CP+VAV  V GC   AA+ILFE++ +
Sbjct  425  FTVVYVYAPEIYPTSVRTTGVGVASSIGRIGGMVCPLVAVALVHGCHQTAALILFELVIL  484

Query  111  VLGLSVLLFPTETKGQ  64
            + G+SVL FP ET G+
Sbjct  485  LSGISVLFFPFETMGR  500



>ref|XP_010696144.1| PREDICTED: organic cation/carnitine transporter 7 [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGL+L+A +VDK+GRK SM  M+ L  LFLLPL  +Q   L T LL GAR+C   TF
Sbjct  352  AEFPGLLLSAAMVDKLGRKVSMASMFFLCCLFLLPLAFNQSGGLVTPLLFGARICITATF  411

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            TI  I+ PEIYPTSVRTTG GVA+S+GRI GM CP+VAV  + GC   AAI+LFE +  V
Sbjct  412  TIVYIYAPEIYPTSVRTTGVGVASSMGRIGGMTCPLVAVSLIHGCHRTAAILLFEAVIFV  471

Query  108  LGLSVLLFPTETKGQQLSDAVVAS  37
             G+ V+ FP ET G +L+D +  S
Sbjct  472  SGVCVMFFPIETAGCELTDDLSDS  495



>ref|XP_002882803.1| hypothetical protein ARALYDRAFT_318077 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59062.1| hypothetical protein ARALYDRAFT_318077 [Arabidopsis lyrata subsp. 
lyrata]
Length=500

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+++A +VD++GRK SM  M     +FLLPL+ HQ   +TT LL G R+C    
Sbjct  348  FAEFPGLLISAAMVDRLGRKVSMASMLFTCCIFLLPLLSHQSPFITTALLFGGRICISAA  407

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VRTTG GVA+SVGRI G++CP+VAV  V GC    A++LFEV+ +
Sbjct  408  FTVVYIYAPEIYPTAVRTTGVGVASSVGRIGGILCPLVAVGLVHGCHQTIAVLLFEVVIL  467

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G+ V LFP ET G+ L+D++ AS
Sbjct  468  VSGICVCLFPFETSGRDLTDSISAS  492



>ref|XP_006407270.1| hypothetical protein EUTSA_v10020555mg [Eutrema salsugineum]
 gb|ESQ48723.1| hypothetical protein EUTSA_v10020555mg [Eutrema salsugineum]
Length=505

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+++A +VD++GRK SM  M  +  +FL PL+ HQ   LTT LL G R+C    
Sbjct  353  FAEFPGLLISAAMVDRLGRKVSMSSMLFICCIFLFPLLTHQSPFLTTALLFGGRICISAA  412

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VRTTG GVA+SVGRI G++CP+VAV  V GC    A++LFEV+ +
Sbjct  413  FTVVYIYAPEIYPTAVRTTGVGVASSVGRIGGVLCPLVAVGLVHGCHQTIAVLLFEVVIL  472

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            + G+ V LFP ET G++L+D + AS
Sbjct  473  ISGICVCLFPFETSGRELTDTISAS  497



>dbj|BAB02515.1| transporter-like protein [Arabidopsis thaliana]
Length=470

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+++A +VD++GRK SM  M     +FLLPL+ HQ   +TT+LL G R+C    
Sbjct  318  FAEFPGLLISAAMVDRLGRKASMASMLFTCCIFLLPLLSHQSPFITTVLLFGGRICISAA  377

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VRTTG GV +SVGRI G++CP+VAV  V GC    A++LFEV+ +
Sbjct  378  FTVVYIYAPEIYPTAVRTTGVGVGSSVGRIGGILCPLVAVGLVHGCHQTIAVLLFEVVIL  437

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G+ V LFP ET G+ L+D++ AS
Sbjct  438  VSGICVCLFPFETSGRDLTDSISAS  462



>ref|XP_006474362.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Citrus sinensis]
Length=408

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+ AA+LVD++GRK SM  M+    +FLLPLV  Q   L T LLSGARM  +GT
Sbjct  254  FAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGT  313

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F I  IF PEIYPTS+R+TGAGVA +VGRI GM+CP+VAV  V+ C   AAI+L E + V
Sbjct  314  FIIANIFAPEIYPTSMRSTGAGVAYAVGRIGGMVCPLVAVGLVTSCHQTAAILLLEALIV  373

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            +  + +LL P ETKG++L + +
Sbjct  374  LSVVVILLIPFETKGKELVNTI  395



>gb|KDO73389.1| hypothetical protein CISIN_1g0117562mg [Citrus sinensis]
 gb|KDO73390.1| hypothetical protein CISIN_1g0117562mg [Citrus sinensis]
 gb|KDO73391.1| hypothetical protein CISIN_1g0117562mg [Citrus sinensis]
 gb|KDO73392.1| hypothetical protein CISIN_1g0117562mg [Citrus sinensis]
Length=406

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+ AA+LVD++GRK SM  M+    +FLLPLV  Q   L T LLSGARM  +GT
Sbjct  252  FAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGT  311

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F I  IF PEIYPTS+R+TGAGVA +VGRI GM+CP+VAV  V+ C   AAI+L E + V
Sbjct  312  FIIANIFAPEIYPTSMRSTGAGVAYAVGRIGGMVCPLVAVGLVTSCHQTAAILLLEALIV  371

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            +  + +LL P ETKG++L + +
Sbjct  372  LSVVVILLIPFETKGKELVNTI  393



>gb|KDO73393.1| hypothetical protein CISIN_1g0117562mg [Citrus sinensis]
Length=408

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+ AA+LVD++GRK SM  M+    +FLLPLV  Q   L T LLSGARM  +GT
Sbjct  254  FAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGT  313

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F I  IF PEIYPTS+R+TGAGVA +VGRI GM+CP+VAV  V+ C   AAI+L E + V
Sbjct  314  FIIANIFAPEIYPTSMRSTGAGVAYAVGRIGGMVCPLVAVGLVTSCHQTAAILLLEALIV  373

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            +  + +LL P ETKG++L + +
Sbjct  374  LSVVVILLIPFETKGKELVNTI  395



>gb|KJB56470.1| hypothetical protein B456_009G120800 [Gossypium raimondii]
Length=478

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGLI+ A+ VD++GR+ SM  ++ +  + + PLV  Q E +TT LL G+R+C   T
Sbjct  330  FAEFPGLIIVALTVDRVGRRLSMAVLFFICCVLIFPLVFQQSEMVTTGLLFGSRICITAT  389

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT   I+ PEIYPT+VR+TG G A+S+GRI GM+CP VAV  V GC   AAI +FEVI +
Sbjct  390  FTTLFIYAPEIYPTAVRSTGFGAASSMGRIGGMVCPYVAVALVQGCHETAAIGMFEVIII  449

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G+S+LL P ETKG++LSD V
Sbjct  450  LSGVSILLIPIETKGRKLSDDV  471



>ref|NP_187911.1| nicotinate transporter [Arabidopsis thaliana]
 sp|Q940M4.1|OCT7_ARATH RecName: Full=Organic cation/carnitine transporter 7; Short=AtOCT7 
[Arabidopsis thaliana]
 gb|AAL06921.1| AT3g13050/MGH6_16 [Arabidopsis thaliana]
 gb|AAO42768.1| At3g13050/MGH6_16 [Arabidopsis thaliana]
 gb|AEE75283.1| nicotinate transporter [Arabidopsis thaliana]
Length=500

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+++A +VD++GRK SM  M     +FLLPL+ HQ   +TT+LL G R+C    
Sbjct  348  FAEFPGLLISAAMVDRLGRKASMASMLFTCCIFLLPLLSHQSPFITTVLLFGGRICISAA  407

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VRTTG GV +SVGRI G++CP+VAV  V GC    A++LFEV+ +
Sbjct  408  FTVVYIYAPEIYPTAVRTTGVGVGSSVGRIGGILCPLVAVGLVHGCHQTIAVLLFEVVIL  467

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G+ V LFP ET G+ L+D++ AS
Sbjct  468  VSGICVCLFPFETSGRDLTDSISAS  492



>ref|XP_006299899.1| hypothetical protein CARUB_v10016107mg [Capsella rubella]
 gb|EOA32797.1| hypothetical protein CARUB_v10016107mg [Capsella rubella]
Length=500

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+L+A +VD++GRK SM  M     +FLLPL+ HQ   +TT LL G R+C    
Sbjct  348  FAEFPGLLLSAAMVDRLGRKVSMASMLFTCCIFLLPLLSHQTPFITTALLFGGRICISAA  407

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VRTTG G+A+SVGRI G++CP+VAV  V GC    A++LFE++ +
Sbjct  408  FTVVYIYAPEIYPTAVRTTGVGMASSVGRIGGVLCPLVAVGLVHGCHQTMAVLLFEIVIL  467

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
            V G+ V LFP ET G+ L+D++ AS
Sbjct  468  VSGICVCLFPFETSGRDLTDSISAS  492



>ref|XP_006453145.1| hypothetical protein CICLE_v10008343mg [Citrus clementina]
 ref|XP_006453146.1| hypothetical protein CICLE_v10008343mg [Citrus clementina]
 ref|XP_006453147.1| hypothetical protein CICLE_v10008343mg [Citrus clementina]
 gb|ESR66385.1| hypothetical protein CICLE_v10008343mg [Citrus clementina]
 gb|ESR66386.1| hypothetical protein CICLE_v10008343mg [Citrus clementina]
 gb|ESR66387.1| hypothetical protein CICLE_v10008343mg [Citrus clementina]
Length=434

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+ AA+LVD++GRK SM  M+    +FLLPLV  Q   L T LLSGARM  +GT
Sbjct  280  FAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGT  339

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F I  IF PEIYPTS+R+TGAGVA +VGRI GM+CP+VAV  V+ C   AAI+L E + V
Sbjct  340  FIIANIFAPEIYPTSMRSTGAGVAYAVGRIGGMVCPLVAVGLVTSCHQTAAILLLEALIV  399

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            +  + +LL P ETKG++L + +
Sbjct  400  LSVVVILLIPFETKGKELVNTI  421



>ref|XP_010232292.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Brachypodium distachyon]
Length=363

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLIL+AVLV+ +GRK +M  M      FL PLVLHQ+E LTT LL GAR C +G+ 
Sbjct  226  AEIPGLILSAVLVEWLGRKATMWCMLFTCCAFLEPLVLHQNELLTTALLFGARACAMGSS  285

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPTSVR+TG G+A S+G+I G+ICP+VAV  +  C  M A+++FEV+  +
Sbjct  286  TVICLYAPEVYPTSVRSTGVGIATSIGKIGGVICPLVAVGMLRSCHQMEAVLVFEVVLFL  345

Query  108  LGLSVLLFPTETKGQQLS  55
             G++ LLFP ETKG+Q+ 
Sbjct  346  AGVACLLFPVETKGRQID  363



>gb|KDO73394.1| hypothetical protein CISIN_1g0117562mg [Citrus sinensis]
 gb|KDO73395.1| hypothetical protein CISIN_1g0117562mg [Citrus sinensis]
Length=434

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+ AA+LVD++GRK SM  M+    +FLLPLV  Q   L T LLSGARM  +GT
Sbjct  280  FAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGT  339

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F I  IF PEIYPTS+R+TGAGVA +VGRI GM+CP+VAV  V+ C   AAI+L E + V
Sbjct  340  FIIANIFAPEIYPTSMRSTGAGVAYAVGRIGGMVCPLVAVGLVTSCHQTAAILLLEALIV  399

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            +  + +LL P ETKG++L + +
Sbjct  400  LSVVVILLIPFETKGKELVNTI  421



>ref|XP_006453141.1| hypothetical protein CICLE_v10008092mg [Citrus clementina]
 ref|XP_006453142.1| hypothetical protein CICLE_v10008092mg [Citrus clementina]
 gb|ESR66381.1| hypothetical protein CICLE_v10008092mg [Citrus clementina]
 gb|ESR66382.1| hypothetical protein CICLE_v10008092mg [Citrus clementina]
Length=303

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+L+AV+VD++GRK SM  M  L F+FLLPL++HQ   LTT+LL GARM   GTF
Sbjct  166  AELPGLLLSAVIVDRVGRKISMAIMSILTFIFLLPLLIHQPVTLTTVLLFGARMFANGTF  225

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  ++ PE+YPTS+R TGAG+A++VGRI GM+CP+V+V  V+GC   AAI L  V+ V+
Sbjct  226  AVACVYAPEVYPTSLRATGAGIASAVGRIGGMVCPLVSVGLVTGCHQTAAIFLLAVVIVL  285

Query  108  LGLSVLLFPTETKGQQLS  55
              + +LLFP ETKG+++ 
Sbjct  286  SIVCILLFPFETKGKRID  303



>ref|XP_006652797.1| PREDICTED: organic cation/carnitine transporter 7-like [Oryza 
brachyantha]
Length=489

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 103/143 (72%), Gaps = 0/143 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PG IL+A++VD+IGRK SM  M     +FL PLV  + + LT + L GAR+C   +
Sbjct  344  FAEIPGSILSAMIVDRIGRKLSMASMLFTSCVFLFPLVFSRTDMLTRISLFGARLCISAS  403

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG GVA+SVGRI G++CP+VAV  V  C+   AI+LFE++  
Sbjct  404  FTIVYIYAPEIYPTSVRTTGIGVASSVGRIGGILCPLVAVALVHSCQQTTAILLFELVIF  463

Query  111  VLGLSVLLFPTETKGQQLSDAVV  43
            + GL+V  FP ETKG++L+D  V
Sbjct  464  LSGLAVSFFPFETKGRRLNDTEV  486



>gb|KDO73388.1| hypothetical protein CISIN_1g0117562mg [Citrus sinensis]
Length=478

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+ AA+LVD++GRK SM  M+    +FLLPLV  Q   L T LLSGARM  +GT
Sbjct  324  FAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGT  383

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F I  IF PEIYPTS+R+TGAGVA +VGRI GM+CP+VAV  V+ C   AAI+L E + V
Sbjct  384  FIIANIFAPEIYPTSMRSTGAGVAYAVGRIGGMVCPLVAVGLVTSCHQTAAILLLEALIV  443

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            +  + +LL P ETKG++L + +
Sbjct  444  LSVVVILLIPFETKGKELVNTI  465



>ref|XP_006474361.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Citrus sinensis]
Length=493

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+ AA+LVD++GRK SM  M+    +FLLPLV  Q   L T LLSGARM  +GT
Sbjct  339  FAELPGLLTAALLVDRVGRKLSMTIMFIFVCIFLLPLVTLQSNILLTALLSGARMFSMGT  398

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F I  IF PEIYPTS+R+TGAGVA +VGRI GM+CP+VAV  V+ C   AAI+L E + V
Sbjct  399  FIIANIFAPEIYPTSMRSTGAGVAYAVGRIGGMVCPLVAVGLVTSCHQTAAILLLEALIV  458

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            +  + +LL P ETKG++L + +
Sbjct  459  LSVVVILLIPFETKGKELVNTI  480



>gb|KDO73396.1| hypothetical protein CISIN_1g017193mg [Citrus sinensis]
 gb|KDO73397.1| hypothetical protein CISIN_1g017193mg [Citrus sinensis]
Length=375

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+L+AV+VD++GRK SM  M  L F+FLLPL+ HQ   LTT+LL GARM   GTF
Sbjct  238  AELPGLLLSAVIVDRVGRKISMAIMSILTFIFLLPLLTHQPVTLTTVLLFGARMFANGTF  297

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  ++ PE+YPTS+R TGAG+A++VGRI GM+CP+V+V  V+GC   AAI L  V+ V+
Sbjct  298  AVACVYAPEVYPTSLRATGAGIASAVGRIGGMVCPLVSVGLVTGCHQTAAIFLLAVVIVL  357

Query  108  LGLSVLLFPTETKGQQLS  55
              + +LLFP ETKG+++ 
Sbjct  358  SIVCILLFPFETKGKRID  375



>ref|XP_003562063.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010232278.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010232282.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010232286.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Brachypodium distachyon]
Length=481

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLIL+AVLV+ +GRK +M  M      FL PLVLHQ+E LTT LL GAR C +G+ 
Sbjct  344  AEIPGLILSAVLVEWLGRKATMWCMLFTCCAFLEPLVLHQNELLTTALLFGARACAMGSS  403

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPTSVR+TG G+A S+G+I G+ICP+VAV  +  C  M A+++FEV+  +
Sbjct  404  TVICLYAPEVYPTSVRSTGVGIATSIGKIGGVICPLVAVGMLRSCHQMEAVLVFEVVLFL  463

Query  108  LGLSVLLFPTETKGQQLS  55
             G++ LLFP ETKG+Q+ 
Sbjct  464  AGVACLLFPVETKGRQID  481



>gb|EMT10390.1| Putative transporter [Aegilops tauschii]
Length=469

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 117/177 (66%), Gaps = 4/177 (2%)
 Frame = -1

Query  579  LISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKIGRKFS  406
            L++S LS  +   NC + L T         + + F+   AE+PGLI++A+LV+ IGRK +
Sbjct  295  LLTSQLSDSNR--NCPSGLTTVQRQEDANLYRDTFVTSLAEIPGLIVSAILVEWIGRKAT  352

Query  405  MMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVRTTGAG  226
            M  M      FL PLVLHQDE LTT LL GAR C +G+ T+  ++ PE+YPTSVR+TG G
Sbjct  353  MWSMLFTCAAFLGPLVLHQDELLTTALLFGARACAMGSSTVLCLYAPEVYPTSVRSTGVG  412

Query  225  VANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQLS  55
            +A S+G+I G+ICP+VAV  +  C  M A+ +FE++  + G++ +LFP ETKG+++ 
Sbjct  413  IATSIGKIGGVICPLVAVGMLRTCHQMEAVFVFELVLCLAGVACILFPVETKGREID  469



>ref|XP_006353753.1| PREDICTED: organic cation/carnitine transporter 7-like [Solanum 
tuberosum]
Length=473

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PG +L+A++V+K+GRKFSM  MYAL FLFLLPL+  Q  ALTT LL GAR    G F
Sbjct  331  AEIPGFLLSAIMVEKVGRKFSMAVMYALYFLFLLPLLAPQLSALTTALLFGARAFSSGNF  390

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             I  ++C EIYPTSVR+TG GV+ SVG+I  M+ PI+AVQ V GC  MAAII FE + V+
Sbjct  391  LIMGVYCREIYPTSVRSTGIGVSTSVGKIGAMLSPIIAVQLVRGCHQMAAIICFEAVVVL  450

Query  108  LGLSVLLFPTETKGQQLSDAVV  43
               SVLL   ETKG++L D +V
Sbjct  451  SAASVLLISVETKGRELYDTLV  472



>emb|CDY51903.1| BnaC03g73660D [Brassica napus]
Length=500

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+++A +VD++GRK SM  M     +FLLPL+ HQ   LTT LL G R+C    
Sbjct  348  FAELPGLLISAAMVDRLGRKASMSSMLFTCCIFLLPLLTHQSPTLTTALLFGGRICISSA  407

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VRTTG GV +SVGRI G++CP+VAV  V GC    A++LFE + +
Sbjct  408  FTVVYIYAPEIYPTAVRTTGVGVGSSVGRIGGVLCPLVAVGLVHGCHQTIAVLLFEFVIL  467

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            V G+ V LFP ET G++L+D +
Sbjct  468  VSGICVCLFPFETSGRELTDTI  489



>ref|XP_002466771.1| hypothetical protein SORBIDRAFT_01g013920 [Sorghum bicolor]
 gb|EER93769.1| hypothetical protein SORBIDRAFT_01g013920 [Sorghum bicolor]
Length=479

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 118/177 (67%), Gaps = 4/177 (2%)
 Frame = -1

Query  579  LISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKIGRKFS  406
            L+SS LS V+ +  CK+ L           + + F+   AE+PGLIL+A+LVD+ GRK +
Sbjct  305  LLSSQLSDVNRS--CKSGLIFEVHQNDGNLYKDTFITSLAEIPGLILSALLVDRFGRKAT  362

Query  405  MMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVRTTGAG  226
            M  +      FL PLVLHQ+E LTT LL GAR C  GT TI  ++ PE+YPTSVR+TG G
Sbjct  363  MWSLMFACCAFLGPLVLHQNELLTTTLLFGARACGTGTTTILCLYAPEVYPTSVRSTGVG  422

Query  225  VANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQLS  55
            +A ++G+I G+ICP+VAV  +  C  M A+++FE++  + G++ +LFP ETKG+++ 
Sbjct  423  IATAIGKIGGVICPLVAVGMLRNCHQMEAVLVFELVLFLAGVACILFPVETKGREMD  479



>ref|NP_001132445.1| uncharacterized protein LOC100193898 [Zea mays]
 gb|ACF81285.1| unknown [Zea mays]
Length=196

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = -1

Query  594  HAICLLIS--SNLSRVSVAVNCKAVLATfsfffsclfFNEKFLYAEVPGLILAAVLVDKI  421
            + I LL S  SN +R+    + ++V +T +  +  +F +    +AE+PG  L+A++VD+ 
Sbjct  11   YGIVLLTSELSNGNRICAKEDVESVHSTNASLYKNVFISS---FAEIPGSFLSAMIVDRF  67

Query  420  GRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVR  241
            GRK SM  M     +FLLPLV  + + LT + L GAR+C   +FTI  I+ PEIYPT+VR
Sbjct  68   GRKRSMASMLFTSCVFLLPLVFSRTDILTRISLFGARLCISASFTIVYIYAPEIYPTAVR  127

Query  240  TTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQ  61
            TTG G+A+SVGRI G++CP+VAV  V  C+   AI+LFE++  + GL+V  FP ETKG +
Sbjct  128  TTGIGIASSVGRIGGILCPLVAVALVHSCQQTTAILLFELVIFLSGLAVSFFPFETKGCR  187

Query  60   LSDAVV  43
            L+D  V
Sbjct  188  LNDTDV  193



>ref|XP_006453143.1| hypothetical protein CICLE_v10008092mg [Citrus clementina]
 gb|ESR66383.1| hypothetical protein CICLE_v10008092mg [Citrus clementina]
Length=473

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+L+AV+VD++GRK SM  M  L F+FLLPL++HQ   LTT+LL GARM   GTF
Sbjct  336  AELPGLLLSAVIVDRVGRKISMAIMSILTFIFLLPLLIHQPVTLTTVLLFGARMFANGTF  395

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  ++ PE+YPTS+R TGAG+A++VGRI GM+CP+V+V  V+GC   AAI L  V+ V+
Sbjct  396  AVACVYAPEVYPTSLRATGAGIASAVGRIGGMVCPLVSVGLVTGCHQTAAIFLLAVVIVL  455

Query  108  LGLSVLLFPTETKGQQLS  55
              + +LLFP ETKG+++ 
Sbjct  456  SIVCILLFPFETKGKRID  473



>ref|XP_006453144.1| hypothetical protein CICLE_v10008092mg [Citrus clementina]
 gb|ESR66384.1| hypothetical protein CICLE_v10008092mg [Citrus clementina]
Length=496

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+L+AV+VD++GRK SM  M  L F+FLLPL++HQ   LTT+LL GARM   GTF
Sbjct  359  AELPGLLLSAVIVDRVGRKISMAIMSILTFIFLLPLLIHQPVTLTTVLLFGARMFANGTF  418

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  ++ PE+YPTS+R TGAG+A++VGRI GM+CP+V+V  V+GC   AAI L  V+ V+
Sbjct  419  AVACVYAPEVYPTSLRATGAGIASAVGRIGGMVCPLVSVGLVTGCHQTAAIFLLAVVIVL  478

Query  108  LGLSVLLFPTETKGQQLS  55
              + +LLFP ETKG+++ 
Sbjct  479  SIVCILLFPFETKGKRID  496



>ref|XP_009135279.1| PREDICTED: organic cation/carnitine transporter 7-like [Brassica 
rapa]
Length=500

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+++A +VD++GRK SM  M     +FLLPL+ HQ   LTT LL G R+C    
Sbjct  348  FAEFPGLLISAAMVDRLGRKASMSSMLFTCCIFLLPLLTHQSPTLTTALLFGGRICISSA  407

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VRTTG GV +SVGRI G++CP+VAV  V GC    A++LFE + +
Sbjct  408  FTVVYIYAPEIYPTAVRTTGVGVGSSVGRIGGVLCPLVAVGLVHGCHQTIAVLLFEFVIL  467

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            V G+ V LFP ET G++L+D +
Sbjct  468  VSGICVCLFPFETSGRELTDTI  489



>ref|XP_006650328.1| PREDICTED: organic cation/carnitine transporter 7-like [Oryza 
brachyantha]
Length=480

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 103/138 (75%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AEVPGLIL+A++VD  GRK SM FM  +  +F+ PLVL Q+E LTT+LL GAR   +G+F
Sbjct  343  AEVPGLILSAIIVDWFGRKASMWFMLFMCCVFIGPLVLQQNELLTTVLLFGARAVVMGSF  402

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPTSVR+TGAG+A ++GRI G++CP+VAV  +  C  M AI++FE++ + 
Sbjct  403  TVLSLYAPEVYPTSVRSTGAGIATAIGRIGGVVCPLVAVGLLRSCHQMEAILVFELVLLF  462

Query  108  LGLSVLLFPTETKGQQLS  55
             G++  LFP ETKG+ + 
Sbjct  463  AGVACFLFPIETKGRGMD  480



>ref|XP_010240389.1| PREDICTED: organic cation/carnitine transporter 7 isoform X2 
[Brachypodium distachyon]
Length=402

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PG  L+A++VD+ GRK SM  M     +FL PL+  Q + LT + L GAR+C   +
Sbjct  257  FAEIPGSFLSAMVVDRFGRKLSMASMLFTSCVFLFPLIFSQTDILTRISLFGARLCISAS  316

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG G+A+SVGRI G++CP+VAV  V  C+   AI+LFE++  
Sbjct  317  FTIVYIYAPEIYPTSVRTTGIGIASSVGRIGGILCPLVAVALVHNCQQTTAILLFELVVF  376

Query  111  VLGLSVLLFPTETKGQQLSD  52
            + G++V+ FP ETKG +L+D
Sbjct  377  LSGVAVMFFPFETKGCRLND  396



>gb|KJB23415.1| hypothetical protein B456_004G097400 [Gossypium raimondii]
Length=483

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 103/139 (74%), Gaps = 0/139 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL L+A+LVD++GRK +M  M+ L F+FLLPL+  Q   LTT LL GARM  + TF
Sbjct  342  AELPGLFLSALLVDRVGRKQTMSIMFGLAFIFLLPLLTRQSAVLTTCLLFGARMNAMATF  401

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PE+YPTSVRTTGAGVA++VGRI GM+CP+V+V  V+ C    AI ++  + VV
Sbjct  402  TVASIYAPELYPTSVRTTGAGVASAVGRIGGMVCPLVSVALVNACHQTEAIAIYLAVIVV  461

Query  108  LGLSVLLFPTETKGQQLSD  52
              + + LFP +TKG++LSD
Sbjct  462  SLVCIQLFPYDTKGRELSD  480



>ref|XP_006474360.1| PREDICTED: organic cation/carnitine transporter 7-like [Citrus 
sinensis]
Length=397

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 97/143 (68%), Gaps = 0/143 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
             E+PGL+LA ++VD+ GRK S+  M  L F+ +LPL + Q   L T LL GARM   G F
Sbjct  255  GELPGLVLAGIIVDRAGRKLSLTIMLILVFICILPLAMLQSNILITGLLVGARMFAFGAF  314

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            TI  IF PEIYPT  RTTGAGVANS+G+  GM+CP+VAV  V+GC   A +ILF  + + 
Sbjct  315  TIACIFTPEIYPTYTRTTGAGVANSIGKFGGMVCPLVAVGLVTGCHQTAVVILFGAVILF  374

Query  108  LGLSVLLFPTETKGQQLSDAVVA  40
              + V L P ETKGQ+LSD+V A
Sbjct  375  AVICVALIPFETKGQELSDSVYA  397



>gb|EEE61651.1| hypothetical protein OsJ_16102 [Oryza sativa Japonica Group]
Length=424

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 0/143 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PG  L+A++VD+IGRK SM  M     +FL PL+  + + LT + L GAR+C   +
Sbjct  279  FAEIPGSFLSAMIVDRIGRKLSMASMLFTSCVFLFPLIFSRTDILTRVSLFGARLCISAS  338

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG GVA+SVGRI G++CP+VAV  V  C+   AI+LFE++  
Sbjct  339  FTIVYIYAPEIYPTSVRTTGIGVASSVGRIGGILCPLVAVALVHSCQQTTAILLFELVIF  398

Query  111  VLGLSVLLFPTETKGQQLSDAVV  43
            + GL+V  FP ETKG +L+D  V
Sbjct  399  LSGLAVSFFPFETKGCRLNDTEV  421



>ref|XP_009124704.1| PREDICTED: organic cation/carnitine transporter 7 [Brassica rapa]
Length=494

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+++A +VD++GRK +M     L  +FLLPL+ HQ  A+TT LL G R+C    
Sbjct  340  FAEFPGLLISAAMVDRLGRKVTMSSTLFLCCIFLLPLLTHQPPAITTALLFGGRVCVSAA  399

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F +  I+ PEIYPT+VRTTG GVA+SVGRI G++CP+VAV  V GC    A++LFEV+  
Sbjct  400  FAVVYIYAPEIYPTAVRTTGVGVASSVGRIGGVLCPLVAVGLVHGCHQTVAVLLFEVVMF  459

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            V G+ V LFP ET G++L+D +
Sbjct  460  VSGICVCLFPFETSGRELTDTI  481



>ref|XP_010675319.1| PREDICTED: organic cation/carnitine transporter 7-like [Beta 
vulgaris subsp. vulgaris]
Length=497

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL+LAAV+VD++GRK SM  +  L FLF+LPLV+HQ   LTT +L GAR C +G+
Sbjct  345  FAEIPGLVLAAVIVDRLGRKVSMSALLFLCFLFMLPLVVHQSAGLTTAVLFGARACIMGS  404

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  ++ PEIYPT VR+TG G+ +S+ RI GMI P+VA+  V GC    AI+LF  + +
Sbjct  405  FTLMFLYAPEIYPTVVRSTGVGLGSSMARIGGMISPMVAISLVHGCHQTLAILLFVGVVL  464

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS*TF  28
            V  + V+LFP ET G++L+D+   S T+
Sbjct  465  VSAICVMLFPIETMGRELTDSFFDSSTY  492



>emb|CDY43379.1| BnaA01g30100D [Brassica napus]
Length=494

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+++A +VD++GRK +M     L  +FLLPL+ HQ  A+TT LL G R+C    
Sbjct  340  FAEFPGLLISAAMVDRLGRKVTMSSTLFLCCIFLLPLLTHQPPAITTALLFGGRVCVSAA  399

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F +  I+ PEIYPT+VRTTG GVA+SVGRI G++CP+VAV  V GC    A++LFEV+  
Sbjct  400  FAVVYIYAPEIYPTAVRTTGVGVASSVGRIGGVLCPLVAVGLVHGCHQTVAVLLFEVVMF  459

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            V G+ V LFP ET G++L+D +
Sbjct  460  VSGICVCLFPFETSGRELTDTI  481



>ref|XP_010240388.1| PREDICTED: organic cation/carnitine transporter 7 isoform X1 
[Brachypodium distachyon]
Length=488

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PG  L+A++VD+ GRK SM  M     +FL PL+  Q + LT + L GAR+C   +
Sbjct  343  FAEIPGSFLSAMVVDRFGRKLSMASMLFTSCVFLFPLIFSQTDILTRISLFGARLCISAS  402

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG G+A+SVGRI G++CP+VAV  V  C+   AI+LFE++  
Sbjct  403  FTIVYIYAPEIYPTSVRTTGIGIASSVGRIGGILCPLVAVALVHNCQQTTAILLFELVVF  462

Query  111  VLGLSVLLFPTETKGQQLSD  52
            + G++V+ FP ETKG +L+D
Sbjct  463  LSGVAVMFFPFETKGCRLND  482



>ref|XP_009620247.1| PREDICTED: organic cation/carnitine transporter 7-like [Nicotiana 
tomentosiformis]
 ref|XP_009620252.1| PREDICTED: organic cation/carnitine transporter 7-like [Nicotiana 
tomentosiformis]
Length=475

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 109/157 (69%), Gaps = 9/157 (6%)
 Frame = -1

Query  486  NEKFLY--------AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQ-DEALT  334
            N++ LY        AE+PGL+++A++V+K GRKF+M  MY    LFLLPL++ +  EALT
Sbjct  318  NDQSLYRDVLITSVAEIPGLLISAIMVEKGGRKFTMALMYIFCILFLLPLLMPRLHEALT  377

Query  333  TLLLSGARMCCLGTFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGC  154
            T LL GARM     F I+ ++C EIYPT+VR+TG GVA+S+GRI  MI PI+AVQ V   
Sbjct  378  TTLLFGARMLITANFDISNVYCREIYPTTVRSTGIGVASSMGRIGAMISPIIAVQLVRSS  437

Query  153  EIMAAIILFEVIAVVLGLSVLLFPTETKGQQLSDAVV  43
              MAAII+FE + V+    VLLFP ETKG++L D +V
Sbjct  438  HQMAAIIVFEAVLVLSATCVLLFPIETKGRKLIDTLV  474



>gb|ABF97804.1| major facilitator superfamily protein, expressed [Oryza sativa 
Japonica Group]
Length=469

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 99/138 (72%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AEVPGLIL+AVLVD  GRK SM FM      F+ PLVL Q+E LTT+LL GAR   +G+F
Sbjct  332  AEVPGLILSAVLVDWFGRKASMWFMLFTCCAFIGPLVLQQNELLTTVLLFGARAVAMGSF  391

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPTS R+TG G+A ++GRI G++CP+VAV  +  C  M AI++FE++  +
Sbjct  392  TVLCLYAPEVYPTSARSTGVGIATAIGRIGGVVCPLVAVGMLRSCHQMEAILVFELVLFL  451

Query  108  LGLSVLLFPTETKGQQLS  55
             G++  LFP ETKG+ + 
Sbjct  452  AGVACFLFPIETKGRGMD  469



>ref|XP_006453149.1| hypothetical protein CICLE_v10008141mg [Citrus clementina]
 gb|ESR66389.1| hypothetical protein CICLE_v10008141mg [Citrus clementina]
Length=482

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 97/143 (68%), Gaps = 0/143 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
             E+PGL+LA ++VD+ GRK S+  M  L F+ +LPL + Q   L T LL GARM   G F
Sbjct  340  GELPGLVLAGIIVDRAGRKLSLTIMLILVFICILPLAMLQSNILITGLLVGARMFAFGAF  399

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            TI  IF PEIYPT  RTTGAGVANS+G+  GM+CP+VAV  V+GC   A +ILF  + + 
Sbjct  400  TIACIFTPEIYPTYTRTTGAGVANSIGKFGGMVCPLVAVGLVTGCHQTAVVILFGAVILF  459

Query  108  LGLSVLLFPTETKGQQLSDAVVA  40
              + V L P ETKGQ+LSD+V A
Sbjct  460  AVICVALIPFETKGQELSDSVYA  482



>ref|NP_001050729.1| Os03g0638200 [Oryza sativa Japonica Group]
 gb|AAR01732.1| putative sugar transporter (alternative splicing product) [Oryza 
sativa Japonica Group]
 gb|ABF97800.1| major facilitator superfamily protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF97801.1| major facilitator superfamily protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF97803.1| major facilitator superfamily protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12643.1| Os03g0638200 [Oryza sativa Japonica Group]
 gb|EEE59558.1| hypothetical protein OsJ_11843 [Oryza sativa Japonica Group]
Length=480

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 99/138 (72%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AEVPGLIL+AVLVD  GRK SM FM      F+ PLVL Q+E LTT+LL GAR   +G+F
Sbjct  343  AEVPGLILSAVLVDWFGRKASMWFMLFTCCAFIGPLVLQQNELLTTVLLFGARAVAMGSF  402

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPTS R+TG G+A ++GRI G++CP+VAV  +  C  M AI++FE++  +
Sbjct  403  TVLCLYAPEVYPTSARSTGVGIATAIGRIGGVVCPLVAVGMLRSCHQMEAILVFELVLFL  462

Query  108  LGLSVLLFPTETKGQQLS  55
             G++  LFP ETKG+ + 
Sbjct  463  AGVACFLFPIETKGRGMD  480



>gb|EAY91140.1| hypothetical protein OsI_12746 [Oryza sativa Indica Group]
Length=480

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 99/138 (72%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AEVPGLIL+AVLVD  GRK SM FM      F+ PLVL Q+E LTT+LL GAR   +G+F
Sbjct  343  AEVPGLILSAVLVDWFGRKASMWFMLFHCCAFIGPLVLQQNELLTTVLLFGARAVAMGSF  402

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPTS R+TG G+A ++GRI G++CP+VAV  +  C  M AI++FE++  +
Sbjct  403  TVLCLYAPEVYPTSARSTGVGIATAIGRIGGVVCPLVAVGMLRSCHQMEAILVFELVLFL  462

Query  108  LGLSVLLFPTETKGQQLS  55
             G++  LFP ETKG+ + 
Sbjct  463  AGVACFLFPIETKGRGMD  480



>emb|CAH67747.1| H0702G05.6 [Oryza sativa Indica Group]
Length=489

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 0/143 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PG  L+A++VD+IGRK SM  M     +FL PL+  + + LT + L GAR+C   +
Sbjct  344  FAEIPGSFLSAMIVDRIGRKLSMASMLFTSCVFLFPLIFSRTDILTRVSLFGARLCISAS  403

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG GVA+SVGRI G++CP+VAV  V  C+   AI+LFE++  
Sbjct  404  FTIVYIYAPEIYPTSVRTTGIGVASSVGRIGGILCPLVAVALVHSCQQTTAILLFELVIF  463

Query  111  VLGLSVLLFPTETKGQQLSDAVV  43
            + GL+V  FP ETKG +L+D  V
Sbjct  464  LSGLAVSFFPFETKGCRLNDTEV  486



>gb|EEC77965.1| hypothetical protein OsI_17329 [Oryza sativa Indica Group]
Length=529

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 0/143 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PG  L+A++VD+IGRK SM  M     +FL PL+  + + LT + L GAR+C   +
Sbjct  384  FAEIPGSFLSAMIVDRIGRKLSMASMLFTSCVFLFPLIFSRTDILTRVSLFGARLCISAS  443

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG GVA+SVGRI G++CP+VAV  V  C+   AI+LFE++  
Sbjct  444  FTIVYIYAPEIYPTSVRTTGIGVASSVGRIGGILCPLVAVALVHSCQQTTAILLFELVIF  503

Query  111  VLGLSVLLFPTETKGQQLSDAVV  43
            + GL+V  FP ETKG +L+D  V
Sbjct  504  LSGLAVSFFPFETKGCRLNDTEV  526



>ref|XP_009800311.1| PREDICTED: organic cation/carnitine transporter 7-like [Nicotiana 
sylvestris]
Length=475

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 107/157 (68%), Gaps = 9/157 (6%)
 Frame = -1

Query  486  NEKFLY--------AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQ-DEALT  334
            N++ LY        AE+PGL+++A++V+K GRKF+M  MY    LFLLPL++ +  E+LT
Sbjct  318  NDQSLYRNVLITSLAEIPGLLISAIMVEKGGRKFTMALMYIFCILFLLPLLMSRLHESLT  377

Query  333  TLLLSGARMCCLGTFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGC  154
            T LL GARM     F I+ ++C EIYPTSVR+TG GVA+S+GRI  MI PI+AVQ +   
Sbjct  378  TTLLFGARMLITANFDISSVYCREIYPTSVRSTGIGVASSLGRIGAMISPIIAVQLIRDS  437

Query  153  EIMAAIILFEVIAVVLGLSVLLFPTETKGQQLSDAVV  43
              MAAII FE + V+    VL FP ETKG++L D +V
Sbjct  438  HQMAAIIFFEAVLVLSATCVLFFPIETKGRKLIDTLV  474



>ref|XP_004982355.1| PREDICTED: organic cation/carnitine transporter 7-like [Setaria 
italica]
Length=480

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 99/138 (72%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLIL+A+LVD  GRK SM  M      FL PLVLH++E LTT+LL GAR C +G+F
Sbjct  343  AEIPGLILSAILVDWFGRKASMWSMMFACCAFLGPLVLHENELLTTILLFGARACAMGSF  402

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            TI  ++ PE+YP+ VR+TGAG+A ++GR+ G++CP+VAV  +  C  M AI++FEV+  +
Sbjct  403  TILCLYAPEVYPSYVRSTGAGIATAIGRVGGVVCPLVAVAMLRSCHQMEAIVVFEVVLCL  462

Query  108  LGLSVLLFPTETKGQQLS  55
              +  + FP ETKG+ + 
Sbjct  463  AAVGCIFFPVETKGRGMD  480



>ref|XP_003562078.1| PREDICTED: organic cation/carnitine transporter 7-like [Brachypodium 
distachyon]
Length=507

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AEVPGLI++AVLV+ +GRK +M  +  +   FL PLVLHQ+E LTT+ L GAR C +G+
Sbjct  369  FAEVPGLIVSAVLVEWVGRKATMWCLMFICCCFLGPLVLHQNELLTTVFLFGARACAMGS  428

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  ++ PE+YPTSVR+TG G+A ++GRI G++CP+VAV  +  C  + AII+FEV+  
Sbjct  429  FTVLCLYAPEVYPTSVRSTGVGIATAIGRIGGIVCPLVAVGMLRSCHQVEAIIVFEVVLC  488

Query  111  VLGLSVLLFPTETKGQQLS  55
            +  ++ +LFP ETKG++++
Sbjct  489  LAAVACMLFPVETKGREMN  507



>ref|XP_002460658.1| hypothetical protein SORBIDRAFT_02g032700 [Sorghum bicolor]
 gb|EER97179.1| hypothetical protein SORBIDRAFT_02g032700 [Sorghum bicolor]
Length=492

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 100/145 (69%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            + EVPGL+L+A +VDKIGRK SM  M  +  L + PL+  Q E+LTT+ L GAR+C   +
Sbjct  348  FGEVPGLLLSAAIVDKIGRKLSMSSMLYISCLCISPLMFAQTESLTTVFLFGARVCISAS  407

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VR TG G A+S+ R  G++CP+VAV  V  C  MAAI++F  + +
Sbjct  408  FTVLHIYAPEIYPTAVRATGVGFASSIARFGGILCPLVAVGLVHACHQMAAILIFITVML  467

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
              G++V  FP ET G++LSD V A+
Sbjct  468  ASGIAVSYFPLETSGRKLSDHVAAA  492



>emb|CAE03655.2| OSJNBa0060N03.20 [Oryza sativa Japonica Group]
Length=588

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 0/143 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PG  L+A++VD+IGRK SM  M     +FL PL+  + + LT + L GAR+C   +
Sbjct  443  FAEIPGSFLSAMIVDRIGRKLSMASMLFTSCVFLFPLIFSRTDILTRVSLFGARLCISAS  502

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG GVA+SVGRI G++CP+VAV  V  C+   AI+LFE++  
Sbjct  503  FTIVYIYAPEIYPTSVRTTGIGVASSVGRIGGILCPLVAVALVHSCQQTTAILLFELVIF  562

Query  111  VLGLSVLLFPTETKGQQLSDAVV  43
            + GL+V  FP ETKG +L+D  V
Sbjct  563  LSGLAVSFFPFETKGCRLNDTEV  585



>ref|XP_006353755.1| PREDICTED: organic cation/carnitine transporter 7-like [Solanum 
tuberosum]
Length=478

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 100/139 (72%), Gaps = 0/139 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PG ++AA++VDK+GRKFS+  M  LGFL +LPLV  Q  ALTT LL GAR    G+F
Sbjct  336  AEIPGTLVAAIMVDKVGRKFSVALMCGLGFLSILPLVAPQLPALTTALLFGARTFISGSF  395

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             I  ++C EIYPTSVR+TG GVANSVGRI  MI PIV VQ V GC   AAI+ FE + V+
Sbjct  396  AIVGVYCREIYPTSVRSTGIGVANSVGRIGPMISPIVVVQLVRGCHQTAAIVCFEAVLVL  455

Query  108  LGLSVLLFPTETKGQQLSD  52
              +SVLL   ETKG++L D
Sbjct  456  SAVSVLLLSVETKGRELID  474



>gb|ACF86638.1| unknown [Zea mays]
 tpg|DAA50367.1| TPA: hypothetical protein ZEAMMB73_510449 [Zea mays]
Length=334

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL L+AVLVD  GRK SM  M      FL PLVL Q E LTT+LL GAR C +G+F
Sbjct  197  AEIPGLFLSAVLVDWFGRKASMWSMMFACCAFLGPLVLQQTELLTTILLFGARACAMGSF  256

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPT VR+TGAG+A ++GRI G++CP+VAV  +  C  M A+I+FEVI  +
Sbjct  257  TVLCLYAPEVYPTFVRSTGAGIATAIGRIGGVVCPLVAVAMLRSCHQMEALIVFEVILCL  316

Query  108  LGLSVLLFPTETKGQ  64
              ++ + FP ETKG+
Sbjct  317  AAVACMFFPVETKGR  331



>ref|XP_010087072.1| Organic cation/carnitine transporter 7 [Morus notabilis]
 gb|EXB26127.1| Organic cation/carnitine transporter 7 [Morus notabilis]
Length=474

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 107/180 (59%), Gaps = 37/180 (21%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL++AA  VDK+GRK SM  M+ +  + L PLV+HQ + LTT LL GAR C   T
Sbjct  290  FAELPGLLIAAFTVDKLGRKRSMSTMFFVCCICLFPLVVHQTQNLTTGLLFGARTCITAT  349

Query  291  FTITVIFCPE-------------------------------------IYPTSVRTTGAGV  223
            FTI  I+ PE                                     IYPTSVRT+G G+
Sbjct  350  FTIVYIYAPEVKTLLGWHSFSFTMVGRIEKRKCREGLLEENDRVACLIYPTSVRTSGVGL  409

Query  222  ANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQLSDAVV  43
            A+SVGRI GM CP+VA+  + GC   AA+ILFE++  + G+ VLLFP ETKG++L+D V+
Sbjct  410  ASSVGRIGGMTCPLVAIGLIHGCHQTAAVILFEIVVFLSGICVLLFPLETKGRELTDHVL  469



>ref|XP_002466770.1| hypothetical protein SORBIDRAFT_01g013910 [Sorghum bicolor]
 gb|EER93768.1| hypothetical protein SORBIDRAFT_01g013910 [Sorghum bicolor]
Length=483

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 98/138 (71%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL L+AVLVD  GRK SM  M      FL PLVL Q+E LTT+LL GAR C +G+F
Sbjct  346  AEIPGLFLSAVLVDWFGRKASMWSMMFACCAFLGPLVLQQNELLTTILLFGARACAMGSF  405

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPT VR+TGAG+A +VGRI G++CP+VAV  +  C  M A+I+FEVI  +
Sbjct  406  TVLCLYAPEVYPTVVRSTGAGIATAVGRIGGVVCPLVAVAMLRSCHQMEALIVFEVILCL  465

Query  108  LGLSVLLFPTETKGQQLS  55
              ++ + FP ETKG+ + 
Sbjct  466  AAVACIFFPVETKGRGMD  483



>emb|CDY24225.1| BnaC01g38050D [Brassica napus]
Length=492

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+++A  VD++GRK +M     L  +FLLPL+ HQ  A+TT LL G R+C    
Sbjct  339  FAEFPGLLISAATVDRLGRKATMSSTLFLCCIFLLPLLTHQPPAITTALLFGGRVCVSAA  398

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F +  I+ PEIYPT+VRTTG GVA+SVGRI G++CP+VAV  V GC    A++LFEV+  
Sbjct  399  FAVVYIYAPEIYPTAVRTTGVGVASSVGRIGGVLCPLVAVGLVHGCHQTVAVLLFEVVMF  458

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            V G+ V LFP ET G++L+D +
Sbjct  459  VSGICVCLFPFETSGRELTDTI  480



>ref|XP_010675316.1| PREDICTED: organic cation/carnitine transporter 7-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010675317.1| PREDICTED: organic cation/carnitine transporter 7-like [Beta 
vulgaris subsp. vulgaris]
Length=509

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGL++A +L+DK+GRK+SM  M+    +FL PLV H+   +TT+L+ GAR   +GT
Sbjct  341  FAELPGLVIAGILIDKLGRKYSMAIMFVACSIFLFPLVSHRSGTVTTVLMFGARASIMGT  400

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  IF PEIYPTSVR TG G A+S+ R+ GM+ P VAV  V  C  MAAI+LF  + +
Sbjct  401  FTIAFIFAPEIYPTSVRNTGFGTASSMARVGGMVSPYVAVALVQACHQMAAILLFAGMVL  460

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
               ++V+L P ETKG++L+++++++
Sbjct  461  AAAVAVVLIPHETKGRELTESIMSN  485



>ref|XP_004983024.1| PREDICTED: organic cation/carnitine transporter 7-like [Setaria 
italica]
Length=491

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 99/143 (69%), Gaps = 0/143 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PG IL+A++VD+ GR+ SM  M     +FL PLV  + + +T + L GAR+C   +
Sbjct  346  FAEIPGSILSAMVVDRFGRRLSMASMLFTSCVFLFPLVFSRTDIITRISLFGARLCIAAS  405

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG G+A+SVGRI G++CP+VAV  V  C    AIILFE++  
Sbjct  406  FTIVYIYAPEIYPTSVRTTGIGIASSVGRIGGILCPLVAVALVHSCHQTTAIILFEIVVF  465

Query  111  VLGLSVLLFPTETKGQQLSDAVV  43
              GL+V  FP ETKG +L+D  V
Sbjct  466  SSGLAVAFFPFETKGCRLNDTEV  488



>ref|XP_008669247.1| PREDICTED: major facilitator superfamily protein isoform X1 [Zea 
mays]
Length=361

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL L+AVLVD  GRK SM  M      FL PLVL Q E LTT+LL GAR C +G+F
Sbjct  224  AEIPGLFLSAVLVDWFGRKASMWSMMFACCAFLGPLVLQQTELLTTILLFGARACAMGSF  283

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPT VR+TGAG+A ++GRI G++CP+VAV  +  C  M A+I+FEVI  +
Sbjct  284  TVLCLYAPEVYPTFVRSTGAGIATAIGRIGGVVCPLVAVAMLRSCHQMEALIVFEVILCL  343

Query  108  LGLSVLLFPTETKGQQLS  55
              ++ + FP ETKG+ + 
Sbjct  344  AAVACMFFPVETKGRGMD  361



>ref|XP_010675318.1| PREDICTED: organic cation/carnitine transporter 7-like [Beta 
vulgaris subsp. vulgaris]
Length=496

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PGLI+   L+D++GRK SM  M+ L  +FLLPLV+H+ +++TT+ + GAR C +GT
Sbjct  338  FAELPGLIIVGFLIDRLGRKLSMALMFVLCSVFLLPLVVHRSDSITTVFMFGARACIMGT  397

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  IF PEIYPTSVR TG G A+++ R+ GM+ P VAV  +  C   A+I+ F  + +
Sbjct  398  FTIAFIFAPEIYPTSVRNTGFGTASAMARVGGMVSPAVAVALIQSCHQTASILFFTGVVI  457

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
                +V+L P ETKG++L+D+V
Sbjct  458  AAAGAVMLIPYETKGRELADSV  479



>dbj|BAK07186.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=481

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 115/177 (65%), Gaps = 4/177 (2%)
 Frame = -1

Query  579  LISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKIGRKFS  406
            L++S LS  +   NC + L           + + F+   AE+PGLI++AVLV+ IGRK +
Sbjct  307  LLTSQLSDANR--NCPSGLTNIQHQEDANLYRDTFVTSLAEIPGLIVSAVLVEWIGRKAT  364

Query  405  MMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVRTTGAG  226
            M  M      FL PLVLHQ+E  TT LL GAR C +G+ T+  ++ PE+YPTSVR+TG G
Sbjct  365  MWSMLFTCCAFLGPLVLHQNELFTTALLFGARACAMGSSTVLCLYAPEVYPTSVRSTGVG  424

Query  225  VANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQLS  55
            +A S+G+I G+ICP+VAV  +  C  M A+ +FE++  + G++ +LFP ETKG+++ 
Sbjct  425  IATSIGKIGGVICPLVAVGMLRTCHQMEAVFVFELVLCLAGVACVLFPVETKGREID  481



>ref|XP_002467179.1| hypothetical protein SORBIDRAFT_01g020990 [Sorghum bicolor]
 gb|EER94177.1| hypothetical protein SORBIDRAFT_01g020990 [Sorghum bicolor]
Length=491

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = -1

Query  594  HAICLLIS--SNLSRVSVAVNCKAVLATfsfffsclfFNEKFLYAEVPGLILAAVLVDKI  421
            + I LL S  SN +R+    + ++V +T +  +  +F +    +AE+PG  L+A++VD+ 
Sbjct  306  YGIVLLTSELSNGNRICAKQDVESVNSTNASLYKNVFISS---FAEIPGSFLSAMIVDRF  362

Query  420  GRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVR  241
            GRK SM  M     +FL+PLV  + + LT + L GAR+C   +FTI  I+ PEIYPT+VR
Sbjct  363  GRKLSMASMLFTSCVFLVPLVFSRTDILTRISLFGARLCISASFTIVYIYAPEIYPTAVR  422

Query  240  TTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQ  61
            TTG G+A+SVGRI G++CP+VAV  V  C+   AI+LFE++  + GL+V  FP ETKG +
Sbjct  423  TTGIGIASSVGRIGGILCPLVAVALVHSCQQTTAILLFELVIFLSGLAVSFFPFETKGCR  482

Query  60   LSDAVV  43
            L+D  V
Sbjct  483  LNDTEV  488



>ref|XP_008681210.1| PREDICTED: uncharacterized protein LOC100193898 isoform X2 [Zea 
mays]
Length=405

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = -1

Query  594  HAICLLIS--SNLSRVSVAVNCKAVLATfsfffsclfFNEKFLYAEVPGLILAAVLVDKI  421
            + I LL S  SN +R+    + ++V +T +  +  +F +    +AE+PG  L+A++VD+ 
Sbjct  220  YGIVLLTSELSNGNRICAKEDVESVHSTNASLYKNVFISS---FAEIPGSFLSAMIVDRF  276

Query  420  GRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVR  241
            GRK SM  M     +FLLPLV  + + LT + L GAR+C   +FTI  I+ PEIYPT+VR
Sbjct  277  GRKRSMASMLFTSCVFLLPLVFSRTDILTRISLFGARLCISASFTIVYIYAPEIYPTAVR  336

Query  240  TTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQ  61
            TTG G+A+SVGRI G++CP+VAV  V  C+   AI+LFE++  + GL+V  FP ETKG +
Sbjct  337  TTGIGIASSVGRIGGILCPLVAVALVHSCQQTTAILLFELVIFLSGLAVSFFPFETKGCR  396

Query  60   LSDAVV  43
            L+D  V
Sbjct  397  LNDTDV  402



>dbj|BAK04403.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=419

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PG  ++ ++VD+IGR+ SM  M     +FL PLV  + E LT + L GAR+C   +
Sbjct  274  FAEIPGSFVSIMIVDRIGRRLSMASMLLTSCVFLFPLVFSRTEILTRISLFGARLCISAS  333

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG GVA+SVGRI G++CP+VAV  V  C    AI+LFE++  
Sbjct  334  FTIVYIYAPEIYPTSVRTTGIGVASSVGRIGGILCPLVAVALVHNCHQTTAILLFELVVF  393

Query  111  VLGLSVLLFPTETKGQQLSD  52
            + G++V+ FP E KG++L+D
Sbjct  394  LSGVAVMFFPFEMKGRRLND  413



>gb|ACN36932.1| unknown [Zea mays]
 gb|AFW68696.1| hypothetical protein ZEAMMB73_097319 [Zea mays]
Length=463

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = -1

Query  594  HAICLLIS--SNLSRVSVAVNCKAVLATfsfffsclfFNEKFLYAEVPGLILAAVLVDKI  421
            + I LL S  SN +R+    + ++V +T +  +  +F +    +AE+PG  L+A++VD+ 
Sbjct  278  YGIVLLTSELSNGNRICAKEDVESVHSTNASLYKNVFISS---FAEIPGSFLSAMIVDRF  334

Query  420  GRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVR  241
            GRK SM  M     +FLLPLV  + + LT + L GAR+C   +FTI  I+ PEIYPT+VR
Sbjct  335  GRKRSMASMLFTSCVFLLPLVFSRTDILTRISLFGARLCISASFTIVYIYAPEIYPTAVR  394

Query  240  TTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQ  61
            TTG G+A+SVGRI G++CP+VAV  V  C+   AI+LFE++  + GL+V  FP ETKG +
Sbjct  395  TTGIGIASSVGRIGGILCPLVAVALVHSCQQTTAILLFELVIFLSGLAVSFFPFETKGCR  454

Query  60   LSDAVV  43
            L+D  V
Sbjct  455  LNDTDV  460



>ref|XP_011093924.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum 
indicum]
 ref|XP_011093926.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum 
indicum]
 ref|XP_011093927.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum 
indicum]
Length=482

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 97/141 (69%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLI+A V V+++GRK +M  +  L F+ +LPL  HQ+E +TT LL  ARM     F
Sbjct  340  AEIPGLIIATVFVERVGRKLTMGILTMLAFILMLPLSFHQNEVVTTALLFCARMLLFAAF  399

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            +    +  E+YPTS+R TG+G+A SVGRI GMICP+VAV  V GC    A++LF ++ ++
Sbjct  400  STLTTYAKEVYPTSIRATGSGLATSVGRIGGMICPLVAVGLVRGCHQTLAVVLFGIVILI  459

Query  108  LGLSVLLFPTETKGQQLSDAV  46
             GL VLLFP ETKG  L+D V
Sbjct  460  SGLCVLLFPFETKGTPLTDTV  480



>ref|XP_008681209.1| PREDICTED: uncharacterized protein LOC100193898 isoform X1 [Zea 
mays]
 gb|ACN35011.1| unknown [Zea mays]
 gb|ACN35622.2| unknown [Zea mays]
 gb|AFW68694.1| hypothetical protein ZEAMMB73_097319 [Zea mays]
 gb|AFW68695.1| hypothetical protein ZEAMMB73_097319 [Zea mays]
Length=496

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = -1

Query  594  HAICLLIS--SNLSRVSVAVNCKAVLATfsfffsclfFNEKFLYAEVPGLILAAVLVDKI  421
            + I LL S  SN +R+    + ++V +T +  +  +F +    +AE+PG  L+A++VD+ 
Sbjct  311  YGIVLLTSELSNGNRICAKEDVESVHSTNASLYKNVFISS---FAEIPGSFLSAMIVDRF  367

Query  420  GRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVR  241
            GRK SM  M     +FLLPLV  + + LT + L GAR+C   +FTI  I+ PEIYPT+VR
Sbjct  368  GRKRSMASMLFTSCVFLLPLVFSRTDILTRISLFGARLCISASFTIVYIYAPEIYPTAVR  427

Query  240  TTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQ  61
            TTG G+A+SVGRI G++CP+VAV  V  C+   AI+LFE++  + GL+V  FP ETKG +
Sbjct  428  TTGIGIASSVGRIGGILCPLVAVALVHSCQQTTAILLFELVIFLSGLAVSFFPFETKGCR  487

Query  60   LSDAVV  43
            L+D  V
Sbjct  488  LNDTDV  493



>ref|NP_001106048.1| major facilitator superfamily protein [Zea mays]
 gb|ABQ63093.1| major facilitator superfamily protein [Zea mays]
 gb|ABR12535.1| major facilitator superfamily protein [Zea mays]
 gb|ACG30552.1| synaptic vesicle 2-related protein [Zea mays]
 gb|ACN36562.1| unknown [Zea mays]
 tpg|DAA50364.1| TPA: proteinSynaptic vesicle 2 protein , Major facilitator superfamily 
isoform 1 [Zea mays]
 tpg|DAA50365.1| TPA: proteinSynaptic vesicle 2 protein , Major facilitator superfamily 
isoform 2 [Zea mays]
Length=479

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL L+AVLVD  GRK SM  M      FL PLVL Q E LTT+LL GAR C +G+F
Sbjct  342  AEIPGLFLSAVLVDWFGRKASMWSMMFACCAFLGPLVLQQTELLTTILLFGARACAMGSF  401

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPT VR+TGAG+A ++GRI G++CP+VAV  +  C  M A+I+FEVI  +
Sbjct  402  TVLCLYAPEVYPTFVRSTGAGIATAIGRIGGVVCPLVAVAMLRSCHQMEALIVFEVILCL  461

Query  108  LGLSVLLFPTETKGQQLS  55
              ++ + FP ETKG+ + 
Sbjct  462  AAVACMFFPVETKGRGMD  479



>ref|XP_004957628.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Setaria italica]
Length=500

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            + EVPGL+L+A +VDK GRK SM  M  +  L + PL+  Q EALTT+ L GAR+C   +
Sbjct  357  FGEVPGLLLSAAIVDKFGRKLSMSSMLYISCLCIAPLMFAQTEALTTVFLFGARVCISAS  416

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VR TG G A+S+ R  G++CP+VAV  V  C   AAI++F  + +
Sbjct  417  FTVLHIYAPEIYPTAVRATGVGFASSIARFGGILCPLVAVGLVHACHQTAAIVIFITVML  476

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
            V G++V  FP ET G++LSD + A
Sbjct  477  VSGVAVSYFPLETSGRKLSDHITA  500



>ref|XP_004957629.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X3 [Setaria italica]
Length=491

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            + EVPGL+L+A +VDK GRK SM  M  +  L + PL+  Q EALTT+ L GAR+C   +
Sbjct  348  FGEVPGLLLSAAIVDKFGRKLSMSSMLYISCLCIAPLMFAQTEALTTVFLFGARVCISAS  407

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VR TG G A+S+ R  G++CP+VAV  V  C   AAI++F  + +
Sbjct  408  FTVLHIYAPEIYPTAVRATGVGFASSIARFGGILCPLVAVGLVHACHQTAAIVIFITVML  467

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
            V G++V  FP ET G++LSD + A
Sbjct  468  VSGVAVSYFPLETSGRKLSDHITA  491



>gb|AFW68691.1| hypothetical protein ZEAMMB73_097319 [Zea mays]
Length=500

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = -1

Query  594  HAICLLIS--SNLSRVSVAVNCKAVLATfsfffsclfFNEKFLYAEVPGLILAAVLVDKI  421
            + I LL S  SN +R+    + ++V +T +  +  +F +    +AE+PG  L+A++VD+ 
Sbjct  315  YGIVLLTSELSNGNRICAKEDVESVHSTNASLYKNVFISS---FAEIPGSFLSAMIVDRF  371

Query  420  GRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVR  241
            GRK SM  M     +FLLPLV  + + LT + L GAR+C   +FTI  I+ PEIYPT+VR
Sbjct  372  GRKRSMASMLFTSCVFLLPLVFSRTDILTRISLFGARLCISASFTIVYIYAPEIYPTAVR  431

Query  240  TTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQ  61
            TTG G+A+SVGRI G++CP+VAV  V  C+   AI+LFE++  + GL+V  FP ETKG +
Sbjct  432  TTGIGIASSVGRIGGILCPLVAVALVHSCQQTTAILLFELVIFLSGLAVSFFPFETKGCR  491

Query  60   LSDAVV  43
            L+D  V
Sbjct  492  LNDTDV  497



>ref|XP_004957627.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Setaria italica]
Length=503

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            + EVPGL+L+A +VDK GRK SM  M  +  L + PL+  Q EALTT+ L GAR+C   +
Sbjct  360  FGEVPGLLLSAAIVDKFGRKLSMSSMLYISCLCIAPLMFAQTEALTTVFLFGARVCISAS  419

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VR TG G A+S+ R  G++CP+VAV  V  C   AAI++F  + +
Sbjct  420  FTVLHIYAPEIYPTAVRATGVGFASSIARFGGILCPLVAVGLVHACHQTAAIVIFITVML  479

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
            V G++V  FP ET G++LSD + A
Sbjct  480  VSGVAVSYFPLETSGRKLSDHITA  503



>ref|NP_001063920.1| Os09g0559800 [Oryza sativa Japonica Group]
 dbj|BAD45955.1| putative SV2 related protein [Oryza sativa Japonica Group]
 dbj|BAF25834.1| Os09g0559800 [Oryza sativa Japonica Group]
Length=490

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 99/144 (69%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            + EVPGLIL+A +VDKIGRK SM  M  +  L + PL++ Q E+LTT+ L GAR+C   +
Sbjct  347  FGEVPGLILSAAIVDKIGRKLSMSSMLYISCLCIAPLMVPQTESLTTIFLFGARICISAS  406

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F +  I+ PEIYPT+VR TG G A+S+ R  G++CP+VAV  V  C   AAI++F  + +
Sbjct  407  FIVLHIYAPEIYPTAVRATGVGFASSIARFGGILCPLVAVGLVHACHQTAAILIFITVML  466

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
            V G++V  FP ET G++LSD + A
Sbjct  467  VSGVAVSYFPLETSGRKLSDHIAA  490



>dbj|BAJ87199.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PG  ++ ++VD+IGR+ SM  M     +FL PLV  + E LT + L GAR+C   +
Sbjct  349  FAEIPGSFVSIMIVDRIGRRLSMASMLFTSCVFLFPLVFSRTEILTRISLFGARLCISAS  408

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG GVA+SVGRI G++CP+VAV  V  C    AI+LFE++  
Sbjct  409  FTIVYIYAPEIYPTSVRTTGIGVASSVGRIGGILCPLVAVALVHNCHQTTAILLFELVVF  468

Query  111  VLGLSVLLFPTETKGQQLSD  52
            + G++V+ FP E KG++L+D
Sbjct  469  LSGVAVMFFPFEMKGRRLND  488



>gb|EEE70213.1| hypothetical protein OsJ_30325 [Oryza sativa Japonica Group]
Length=489

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 99/144 (69%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            + EVPGLIL+A +VDKIGRK SM  M  +  L + PL++ Q E+LTT+ L GAR+C   +
Sbjct  346  FGEVPGLILSAAIVDKIGRKLSMSSMLYISCLCIAPLMVPQTESLTTIFLFGARICISAS  405

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F +  I+ PEIYPT+VR TG G A+S+ R  G++CP+VAV  V  C   AAI++F  + +
Sbjct  406  FIVLHIYAPEIYPTAVRATGVGFASSIARFGGILCPLVAVGLVHACHQTAAILIFITVML  465

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
            V G++V  FP ET G++LSD + A
Sbjct  466  VSGVAVSYFPLETSGRKLSDHIAA  489



>ref|XP_008680040.1| PREDICTED: synaptic vesicle 2-related protein isoform X2 [Zea 
mays]
Length=471

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 116/177 (66%), Gaps = 4/177 (2%)
 Frame = -1

Query  579  LISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKIGRKFS  406
            L++S LS V+ +  CK+ L       +   + + F+   AE+PGLIL+A+LVD+ GRK +
Sbjct  297  LLTSQLSDVNRS--CKSDLVFEVHQNNGNLYKDTFITSLAEIPGLILSALLVDRFGRKAT  354

Query  405  MMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVRTTGAG  226
            M  +      FL PLVLHQ+E LTT LL GAR C  G  T   ++ PE+YPT VR+TG G
Sbjct  355  MSCLMFACCAFLGPLVLHQNELLTTTLLFGARACGTGATTTLCLYAPEVYPTYVRSTGVG  414

Query  225  VANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQLS  55
            +A ++G+I G+ICP+VAV  +  C  M A+++FE++  + G+S +LFP ETKG+++ 
Sbjct  415  IATAIGKIGGVICPLVAVGMLRSCHQMEAVLVFELVLFLAGVSCILFPVETKGREMD  471



>ref|NP_001151801.1| synaptic vesicle 2-related protein [Zea mays]
 gb|ACG44352.1| synaptic vesicle 2-related protein [Zea mays]
Length=479

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 116/177 (66%), Gaps = 4/177 (2%)
 Frame = -1

Query  579  LISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKIGRKFS  406
            L++S LS V+ +  CK+ L       +   + + F+   AE+PGLIL+A+LVD+ GRK +
Sbjct  305  LLTSQLSDVNRS--CKSDLVFEVHQNNGNLYKDTFITSLAEIPGLILSALLVDRFGRKAT  362

Query  405  MMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVRTTGAG  226
            M  +      FL PLVLHQ+E LTT LL GAR C  G  T   ++ PE+YPT VR+TG G
Sbjct  363  MSCLMFACCAFLGPLVLHQNELLTTTLLFGARACGTGATTTLCLYAPEVYPTYVRSTGVG  422

Query  225  VANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQLS  55
            +A ++G+I G+ICP+VAV  +  C  M A+++FE++  + G+S +LFP ETKG+++ 
Sbjct  423  IATAIGKIGGVICPLVAVGMLRSCHQMEAVLVFELVLFLAGVSCILFPVETKGREMD  479



>ref|XP_006660972.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Oryza brachyantha]
Length=490

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 99/144 (69%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            + EVPGLIL+A +VDKIGRK SM  M  +  L + PL++ Q E+LTT+ L GAR+C   +
Sbjct  347  FGEVPGLILSAAIVDKIGRKLSMSTMLYISCLCIAPLMVPQTESLTTIFLFGARVCISAS  406

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F +  I+ PEIYPT+VR TG G A+S+ R  G++CP+VAV  V  C   AAI++F  + +
Sbjct  407  FIVLHIYAPEIYPTAVRATGVGFASSIARFGGILCPLVAVGLVHACHQTAAILIFITVML  466

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
            V G++V  FP ET G++LSD + A
Sbjct  467  VSGVAVSYFPLETSGRKLSDHIAA  490



>ref|XP_008680034.1| PREDICTED: synaptic vesicle 2-related protein isoform X1 [Zea 
mays]
Length=479

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 116/177 (66%), Gaps = 4/177 (2%)
 Frame = -1

Query  579  LISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKIGRKFS  406
            L++S LS V+ +  CK+ L       +   + + F+   AE+PGLIL+A+LVD+ GRK +
Sbjct  305  LLTSQLSDVNRS--CKSDLVFEVHQNNGNLYKDTFITSLAEIPGLILSALLVDRFGRKAT  362

Query  405  MMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVRTTGAG  226
            M  +      FL PLVLHQ+E LTT LL GAR C  G  T   ++ PE+YPT VR+TG G
Sbjct  363  MSCLMFACCAFLGPLVLHQNELLTTTLLFGARACGTGATTTLCLYAPEVYPTYVRSTGVG  422

Query  225  VANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQLS  55
            +A ++G+I G+ICP+VAV  +  C  M A+++FE++  + G+S +LFP ETKG+++ 
Sbjct  423  IATAIGKIGGVICPLVAVGMLRSCHQMEAVLVFELVLFLAGVSCILFPVETKGREMD  479



>ref|XP_006660971.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Oryza brachyantha]
Length=500

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 99/144 (69%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            + EVPGLIL+A +VDKIGRK SM  M  +  L + PL++ Q E+LTT+ L GAR+C   +
Sbjct  357  FGEVPGLILSAAIVDKIGRKLSMSTMLYISCLCIAPLMVPQTESLTTIFLFGARVCISAS  416

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F +  I+ PEIYPT+VR TG G A+S+ R  G++CP+VAV  V  C   AAI++F  + +
Sbjct  417  FIVLHIYAPEIYPTAVRATGVGFASSIARFGGILCPLVAVGLVHACHQTAAILIFITVML  476

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
            V G++V  FP ET G++LSD + A
Sbjct  477  VSGVAVSYFPLETSGRKLSDHIAA  500



>gb|EMT04717.1| Synaptic vesicle 2-related protein [Aegilops tauschii]
Length=502

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PG  ++ ++VD+IGR+ SM  M     +FL PLV  + E LT + L GAR+C   +
Sbjct  357  FAEIPGSFVSIMIVDRIGRRLSMASMLFTSCVFLFPLVFSRTEILTRISLFGARLCISAS  416

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVRTTG GVA+SVGRI G++CP+VAV  V  C    AI+LFE++  
Sbjct  417  FTIVYIYAPEIYPTSVRTTGIGVASSVGRIGGILCPLVAVALVHNCHQTTAILLFELVVF  476

Query  111  VLGLSVLLFPTETKGQQLSD  52
            + G++V+ FP ETKG +L+D
Sbjct  477  LSGVAVMFFPFETKGCRLND  496



>ref|XP_006353754.1| PREDICTED: organic cation/carnitine transporter 7-like [Solanum 
tuberosum]
Length=477

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 99/139 (71%), Gaps = 0/139 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PG +LAA++VDK+GRKFS+  M  L FL LLPL+  Q  ALTT LL GAR    G+F
Sbjct  335  AEIPGTLLAAIMVDKVGRKFSVALMCGLSFLSLLPLLAPQLPALTTALLFGARTFISGSF  394

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             I  ++C EIYPTSVR+TG GVANSVGRI  MI PIV VQ V GC   AAI+ FE + V+
Sbjct  395  VIVGVYCREIYPTSVRSTGIGVANSVGRIGPMISPIVVVQLVRGCHQTAAIVCFEAVLVL  454

Query  108  LGLSVLLFPTETKGQQLSD  52
              +SVLL   ETKG++L D
Sbjct  455  SAVSVLLLSVETKGRELID  473



>ref|XP_003578642.1| PREDICTED: organic cation/carnitine transporter 7-like [Brachypodium 
distachyon]
Length=490

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 97/144 (67%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            + EVPGLIL+A +VDK GRK SM  M  +  L + PL+  Q E+LTT+ L GARMC   +
Sbjct  347  FGEVPGLILSAAIVDKFGRKLSMSSMLYISCLCIAPLMFAQTESLTTVFLFGARMCISAS  406

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F +  I+ PEIYPT+VR TG G+A+S+ R  G++CP+VAV  V  C   AAI++F  + +
Sbjct  407  FIVLHIYAPEIYPTAVRATGVGIASSIARFGGILCPLVAVGLVHACHQTAAIMIFITVML  466

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
            V  ++V  FP ET G++LSD + A
Sbjct  467  VSAVAVSYFPLETSGRKLSDHIAA  490



>ref|XP_010542536.1| PREDICTED: organic cation/carnitine transporter 7-like [Tarenaya 
hassleriana]
 ref|XP_010542537.1| PREDICTED: organic cation/carnitine transporter 7-like [Tarenaya 
hassleriana]
Length=495

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 96/140 (69%), Gaps = 0/140 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL++AA +VDK+GR+ SM     +   FLLPLV HQ   LTT LL GAR+C + +
Sbjct  339  FAEFPGLLVAAAMVDKLGRRLSMSSTLFMCCFFLLPLVSHQPSGLTTALLFGARVCIMAS  398

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVR+ G G+ +SVGRI GM+CP+VAV  V GC   A+I++F  + +
Sbjct  399  FTIVYIYAPEIYPTSVRSIGLGMGSSVGRIGGMVCPLVAVGLVQGCHQTASILMFVALIL  458

Query  111  VLGLSVLLFPTETKGQQLSD  52
            V  + V  FP ET G+ L D
Sbjct  459  VSCICVCFFPLETSGRNLPD  478



>ref|XP_009397383.1| PREDICTED: organic cation/carnitine transporter 7 isoform X2 
[Musa acuminata subsp. malaccensis]
Length=400

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AEVPGLI++A +VD+IGRK SM  M  +  +FL+PLV  +   +TT LL  AR+    +
Sbjct  259  FAEVPGLIISAAIVDRIGRKLSMSSMLFISCVFLIPLVFPRTGEVTTGLLFCARISISAS  318

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVR +G G+A+SVGRI G+ CP+VAV  V GC   AA++LFE++  
Sbjct  319  FTIIYIYAPEIYPTSVRASGIGIASSVGRIGGITCPLVAVGLVHGCHQSAAVLLFELVIF  378

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G++V LFP ET G+ L+D+V
Sbjct  379  LSGIAVCLFPLETSGRDLTDSV  400



>ref|XP_004982359.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X3 [Setaria italica]
Length=362

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 115/177 (65%), Gaps = 4/177 (2%)
 Frame = -1

Query  579  LISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKIGRKFS  406
            L++S LS V+ +  C + L           + + F+   AE+PGLIL+A+LVD  GRK +
Sbjct  188  LLTSQLSDVNRS--CSSDLIFEMHQKDGNLYKDTFITSLAEIPGLILSALLVDWFGRKAT  245

Query  405  MMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVRTTGAG  226
            M  +      FL PLVLHQ+E  TT LL GAR C  G  T+  ++ PE+YPTSVR+TG G
Sbjct  246  MCCLMFACCAFLGPLVLHQNELFTTTLLFGARACGTGGTTVLCLYAPEVYPTSVRSTGVG  305

Query  225  VANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQLS  55
            +A ++G+I G++CP+VAV  +  C  MAAI++FE++  + G++ +LFP ETKG+++ 
Sbjct  306  IATAIGKIGGVVCPLVAVGMLRSCHQMAAILVFELVLFLAGVACILFPVETKGREMD  362



>ref|XP_002513292.1| sugar transporter, putative [Ricinus communis]
 gb|EEF48695.1| sugar transporter, putative [Ricinus communis]
Length=504

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE+PG+ILA + VD+ GRK SM  ++ +  +FLLPLV+HQ   LTT LL  AR+    T
Sbjct  347  FAEIPGIILAGLTVDRFGRKLSMSVVFFICGIFLLPLVVHQSATLTTALLFIARIFITDT  406

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  ++ PE+YPTSVR+TG GVA+S+GRI GM+ P VA+  V GC   AAI+LF  +A 
Sbjct  407  FTVVYVYAPEMYPTSVRSTGVGVASSMGRIGGMVSPYVAIMLVQGCHQAAAILLFMAVAF  466

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
              G+ V LFP +TKG+ L++++
Sbjct  467  ASGICVSLFPFDTKGRDLTESI  488



>ref|XP_009397373.1| PREDICTED: organic cation/carnitine transporter 7 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=486

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AEVPGLI++A +VD+IGRK SM  M  +  +FL+PLV  +   +TT LL  AR+    +
Sbjct  345  FAEVPGLIISAAIVDRIGRKLSMSSMLFISCVFLIPLVFPRTGEVTTGLLFCARISISAS  404

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  I+ PEIYPTSVR +G G+A+SVGRI G+ CP+VAV  V GC   AA++LFE++  
Sbjct  405  FTIIYIYAPEIYPTSVRASGIGIASSVGRIGGITCPLVAVGLVHGCHQSAAVLLFELVIF  464

Query  111  VLGLSVLLFPTETKGQQLSDAV  46
            + G++V LFP ET G+ L+D+V
Sbjct  465  LSGIAVCLFPLETSGRDLTDSV  486



>ref|XP_004982358.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Setaria italica]
Length=480

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 115/177 (65%), Gaps = 4/177 (2%)
 Frame = -1

Query  579  LISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKIGRKFS  406
            L++S LS V+ +  C + L           + + F+   AE+PGLIL+A+LVD  GRK +
Sbjct  306  LLTSQLSDVNRS--CSSDLIFEMHQKDGNLYKDTFITSLAEIPGLILSALLVDWFGRKAT  363

Query  405  MMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVRTTGAG  226
            M  +      FL PLVLHQ+E  TT LL GAR C  G  T+  ++ PE+YPTSVR+TG G
Sbjct  364  MCCLMFACCAFLGPLVLHQNELFTTTLLFGARACGTGGTTVLCLYAPEVYPTSVRSTGVG  423

Query  225  VANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQLS  55
            +A ++G+I G++CP+VAV  +  C  MAAI++FE++  + G++ +LFP ETKG+++ 
Sbjct  424  IATAIGKIGGVVCPLVAVGMLRSCHQMAAILVFELVLFLAGVACILFPVETKGREMD  480



>ref|XP_008670376.1| PREDICTED: organic cation/carnitine transporter 7-like [Zea mays]
 ref|XP_008670377.1| PREDICTED: organic cation/carnitine transporter 7-like [Zea mays]
 tpg|DAA40751.1| TPA: hypothetical protein ZEAMMB73_392255 [Zea mays]
 tpg|DAA40752.1| TPA: hypothetical protein ZEAMMB73_392255 [Zea mays]
 tpg|DAA40753.1| TPA: hypothetical protein ZEAMMB73_392255 [Zea mays]
 tpg|DAA40754.1| TPA: hypothetical protein ZEAMMB73_392255 [Zea mays]
Length=492

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 98/145 (68%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            + EVPGL+L+A +VD IGRK SM  M  +  L + PL+  Q E+LTT+ L  AR+C   +
Sbjct  348  FGEVPGLLLSAAIVDMIGRKLSMSSMLYISCLCISPLMFAQTESLTTIFLFCARVCISAS  407

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VR TG G A+S+ R  G++CP+VAV  V  C  MAAI++F  + +
Sbjct  408  FTVLHIYAPEIYPTAVRATGVGFASSIARFGGILCPLVAVGLVHACHQMAAILIFITVML  467

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
              G++V  FP ET G++LSD V A+
Sbjct  468  ASGIAVSYFPLETSGRKLSDHVAAA  492



>ref|XP_004982357.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Setaria italica]
Length=509

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 99/138 (72%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLIL+A+LVD  GRK +M  +      FL PLVLHQ+E  TT LL GAR C  G  
Sbjct  372  AEIPGLILSALLVDWFGRKATMCCLMFACCAFLGPLVLHQNELFTTTLLFGARACGTGGT  431

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPTSVR+TG G+A ++G+I G++CP+VAV  +  C  MAAI++FE++  +
Sbjct  432  TVLCLYAPEVYPTSVRSTGVGIATAIGKIGGVVCPLVAVGMLRSCHQMAAILVFELVLFL  491

Query  108  LGLSVLLFPTETKGQQLS  55
             G++ +LFP ETKG+++ 
Sbjct  492  AGVACILFPVETKGREMD  509



>tpg|DAA40755.1| TPA: hypothetical protein ZEAMMB73_392255 [Zea mays]
Length=527

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 98/145 (68%), Gaps = 0/145 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            + EVPGL+L+A +VD IGRK SM  M  +  L + PL+  Q E+LTT+ L  AR+C   +
Sbjct  383  FGEVPGLLLSAAIVDMIGRKLSMSSMLYISCLCISPLMFAQTESLTTIFLFCARVCISAS  442

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VR TG G A+S+ R  G++CP+VAV  V  C  MAAI++F  + +
Sbjct  443  FTVLHIYAPEIYPTAVRATGVGFASSIARFGGILCPLVAVGLVHACHQMAAILIFITVML  502

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS  37
              G++V  FP ET G++LSD V A+
Sbjct  503  ASGIAVSYFPLETSGRKLSDHVAAA  527



>ref|XP_002964441.1| hypothetical protein SELMODRAFT_81650 [Selaginella moellendorffii]
 gb|EFJ34774.1| hypothetical protein SELMODRAFT_81650 [Selaginella moellendorffii]
Length=460

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 94/141 (67%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL++AA +VD  GRK SM  ++    LFL PLV  Q E +TT LL GAR C +G+F
Sbjct  320  AELPGLMIAAAMVDYYGRKVSMAVLFIFCGLFLSPLVSPQPEGVTTFLLFGARACIMGSF  379

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            TI  ++ PE+YPTS RTTG G ANS  RI G++CP+VAV  V  C    AI+LF +++ +
Sbjct  380  TILYVYAPEVYPTSSRTTGLGTANSFARIGGILCPLVAVALVRTCHHSLAIMLFTLVSAM  439

Query  108  LGLSVLLFPTETKGQQLSDAV  46
                +  FP ETKG+ L+D V
Sbjct  440  AAALIFSFPIETKGRALTDVV  460



>ref|XP_002975354.1| hypothetical protein SELMODRAFT_103160 [Selaginella moellendorffii]
 gb|EFJ23555.1| hypothetical protein SELMODRAFT_103160 [Selaginella moellendorffii]
Length=460

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 94/141 (67%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL++AA +VD  GRK SM  ++    LFL PLV  Q E +TT LL GAR C +G+F
Sbjct  320  AELPGLMIAAAMVDYYGRKVSMAVLFIFCGLFLSPLVSPQPEGVTTFLLFGARACIMGSF  379

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            TI  ++ PE+YPTS RTTG G ANS  RI G++CP+VAV  V  C    AI+LF +++ +
Sbjct  380  TILYVYAPEVYPTSSRTTGLGTANSFARIGGILCPLVAVALVRTCHHSLAIMLFTLVSAM  439

Query  108  LGLSVLLFPTETKGQQLSDAV  46
                +  FP ETKG+ L+D V
Sbjct  440  AAALIFSFPIETKGRALTDVV  460



>ref|XP_004983097.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Setaria italica]
 ref|XP_004983098.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Setaria italica]
Length=479

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 98/137 (72%), Gaps = 0/137 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGL+++A++VD  GRK +M  +      FL PL +HQ E+LTT LL GAR C +G+ 
Sbjct  342  AEFPGLVISAIIVDWFGRKATMWILLFGCCAFLGPLAVHQKESLTTALLFGARACGMGSS  401

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPTS R+TG G+A ++G+I G++CPI+AV  +  C  M A+++FE++  +
Sbjct  402  TVLCLYAPEVYPTSARSTGVGIATAIGKIGGIVCPIIAVGMLRSCHQMEAVVVFELVLGL  461

Query  108  LGLSVLLFPTETKGQQL  58
             G++ +LFP ETKG+++
Sbjct  462  AGVACILFPVETKGREM  478



>ref|XP_001770703.1| predicted protein [Physcomitrella patens]
 gb|EDQ64527.1| predicted protein [Physcomitrella patens]
Length=468

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
             E+PGL +AA +VD+ GRK SM  ++ L    LLPLV +Q   LTT LL GAR C +G F
Sbjct  322  GELPGLAVAAYIVDRWGRKLSMATLFTLCGASLLPLVHNQPADLTTFLLFGARACIMGAF  381

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  I+ PE+YPTS R+TG G+AN++ R+ G++CP+VAV+ V  C+   A+ LF  + V+
Sbjct  382  TVLYIYAPEVYPTSNRSTGLGIANAIARVGGLLCPVVAVELVRSCQQGLAVSLFTAVPVL  441

Query  108  LGLSVLLFPTETKGQQLSDAVVAS  37
               +V+LFP ET+G+ L+D V  S
Sbjct  442  AAAAVMLFPVETQGKSLTDVVDES  465



>dbj|BAJ96217.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 94/144 (65%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            + EVPGLIL+A +VDK GRK SM  M  +  L + PL+  Q E+LTT+ L GAR+C   +
Sbjct  347  FGEVPGLILSAAIVDKFGRKLSMSLMLYVSCLCIAPLMFAQTESLTTVFLFGARICISAS  406

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F +  I+ PEIYPT+VR TG G A+S+ R  G++CP+VAV  V  C   AAI +F  + +
Sbjct  407  FIVLHIYAPEIYPTAVRATGVGFASSIARFGGILCPLVAVGLVHACHQTAAIAVFITVML  466

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
               ++V  FP ET G++LSD + A
Sbjct  467  ASAVAVSYFPLETSGRKLSDHIAA  490



>ref|XP_008674891.1| PREDICTED: synaptic vesicle 2-related protein isoform X1 [Zea 
mays]
 gb|ACF84617.1| unknown [Zea mays]
 gb|ACF88099.1| unknown [Zea mays]
 tpg|DAA46929.1| TPA: synaptic vesicle 2 protein [Zea mays]
Length=467

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGL+++A++VD +GRK +M  +      FL PL +HQ E++TT LL GAR C +G+ 
Sbjct  330  AEFPGLVISAIIVDWLGRKATMWILLFGCCGFLGPLAVHQKESVTTALLFGARACGMGSS  389

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPTS R+TG G+A ++G+I G++CP++AV  +  C  M A+++FE++  +
Sbjct  390  TVLCLYAPEVYPTSARSTGVGIATAIGKIGGIVCPLIAVGMLRSCHQMQAVLVFELVLGL  449

Query  108  LGLSVLLFPTETKGQQL  58
             G++ +LFP ETKG+++
Sbjct  450  AGVACILFPVETKGREM  466



>gb|EMT10389.1| Synaptic vesicle 2-related protein [Aegilops tauschii]
Length=534

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 98/138 (71%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLI +AVLV+  GRK +M  +      FL PLVL+Q E  TT LL GAR C +G++
Sbjct  397  AEIPGLIASAVLVEWFGRKATMWCLLFTCCGFLGPLVLYQSELWTTGLLFGARACAMGSY  456

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPTSVR+TG G+A ++GR+ G+ICP+VAV  +  C  M AII+FEV+  +
Sbjct  457  TVVCLYAPEVYPTSVRSTGVGIATAMGRVGGIICPLVAVGMLRSCHQMEAIIVFEVVLFL  516

Query  108  LGLSVLLFPTETKGQQLS  55
              ++ +LFP ETKG+ ++
Sbjct  517  AAIACMLFPFETKGRAMN  534



>gb|EMT01283.1| Synaptic vesicle 2-related protein [Aegilops tauschii]
Length=713

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            + EVPGLIL+A +VDK GRK SM  M  +  L + PL+  Q E+LTT+ L GAR+C   +
Sbjct  570  FGEVPGLILSAAIVDKFGRKLSMSSMLYISCLCIAPLMFSQTESLTTVFLFGARICISAS  629

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F +  I+ PEIYPT+VR TG G A+S+ R  G++CP+VAV  V  C   AAI +F  + +
Sbjct  630  FIVLHIYAPEIYPTAVRATGVGFASSIARFGGILCPLVAVGLVHACHQTAAIAVFITVML  689

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
            V  ++V  FP ET G++LSD + A
Sbjct  690  VSAVAVSYFPLETSGRKLSDHIAA  713



>dbj|BAJ90022.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85415.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 98/138 (71%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLI +AVLV+  GRK +M  +      FL PLVL+Q E  TT LL GAR C +G++
Sbjct  342  AEIPGLIASAVLVEWFGRKATMWCLLFTCCGFLGPLVLYQSELWTTGLLFGARACAMGSY  401

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPTSVR+TG G+A ++GR+ G+ICP+VAV  +  C  M AI++FEV+  +
Sbjct  402  TVVCLYAPEVYPTSVRSTGVGIATAMGRVGGIICPLVAVGMLRSCHQMEAILVFEVVLFL  461

Query  108  LGLSVLLFPTETKGQQLS  55
              ++ +LFP ETKG+ ++
Sbjct  462  AAIACMLFPFETKGRAMT  479



>gb|AGX85879.1| copper transporter [Triticum aestivum]
 gb|AGX85882.1| copper transporter [Triticum aestivum]
Length=479

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLI +A+LV+  GRK +M  +      FL PLV +Q E  TT LL GAR C +G++
Sbjct  342  AEIPGLIASALLVEWFGRKATMWCLLFTCCGFLGPLVFYQSELWTTGLLFGARACAMGSY  401

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPTSVR+TG G+A ++GR+ G+ICP+VAV  +  C  M AII+FEV+  +
Sbjct  402  TVVCLYAPEVYPTSVRSTGVGIATAMGRVGGIICPLVAVGMLRSCHQMEAIIVFEVVLFL  461

Query  108  LGLSVLLFPTETKGQQLS  55
              ++ +LFP ETKG+ ++
Sbjct  462  AAIACMLFPFETKGRAMN  479



>gb|EMS56043.1| Synaptic vesicle 2-related protein [Triticum urartu]
Length=771

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            + EVPGLIL+A +VDK GRK SM  M  +  L + PL+  Q E+LTT+ L GAR+C   +
Sbjct  628  FGEVPGLILSAAIVDKFGRKLSMSLMLYVSCLCIAPLMFAQTESLTTVFLFGARICISAS  687

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F +  I+ PEIYPT+VR TG G A+S+ R  G++CP+VAV  V  C   AAI +F  + +
Sbjct  688  FIVLHIYAPEIYPTAVRATGVGFASSIARFGGILCPLVAVGLVHACHQTAAIAVFITVML  747

Query  111  VLGLSVLLFPTETKGQQLSDAVVA  40
            V  ++V  FP ET G++LSD + A
Sbjct  748  VSAVAVSYFPLETSGRKLSDHIAA  771



>gb|AGX85880.1| copper transporter [Triticum aestivum]
 gb|AGX85881.1| copper transporter [Triticum aestivum]
 gb|AGX85883.1| copper transporter [Triticum aestivum]
 gb|AGX85884.1| copper transporter [Triticum aestivum]
Length=479

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLI +A+LV+  GRK +M  +      FL PLV +Q E  TT LL GAR C +G++
Sbjct  342  AEIPGLIASALLVEWFGRKATMWCLLFTCCGFLGPLVFYQSELWTTGLLFGARACAMGSY  401

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            T+  ++ PE+YPTSVR+TG G+A ++GR+ G+ICP+VAV  +  C  M AII+FEV+  +
Sbjct  402  TVVCLYAPEVYPTSVRSTGVGIATAMGRVGGIICPLVAVGMLRSCHQMEAIIVFEVVLFL  461

Query  108  LGLSVLLFPTETKGQQLS  55
              ++ +LFP ETKG+ ++
Sbjct  462  AAIACMLFPFETKGRAMN  479



>emb|CDP14260.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 97/141 (69%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AEVPGL+LAA +VD++GRK SM+ M+ LGF+ LLPLV+ Q+  LTT LL GARM    TF
Sbjct  342  AEVPGLVLAAFIVDRVGRKVSMVIMFTLGFILLLPLVVQQNGVLTTALLFGARMFVSATF  401

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  ++ PE+YPT +R +  G+  S+GRI GM+CP+VAV  VS C   AA+IL   +  +
Sbjct  402  EVACVYAPEVYPTDIRASAVGLTTSIGRIGGMLCPLVAVALVSDCHQTAAVILILAMIFL  461

Query  108  LGLSVLLFPTETKGQQLSDAV  46
              +SV   P ET G+ LS++V
Sbjct  462  SAVSVAFLPFETGGRDLSESV  482



>emb|CDP14261.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 98/139 (71%), Gaps = 0/139 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            A++ GL+++A ++D++GRK +M  + +LGF+ LLPLV+HQ+E LTT LL G+RM  + + 
Sbjct  340  ADLAGLVISAAILDRLGRKLTMKILCSLGFILLLPLVVHQNEILTTALLFGSRMFVMSSS  399

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
               VI+  E+YPTSVR TG G A S+GRI GMICP+VAV  V  C   AAI+LFE + ++
Sbjct  400  NAVVIYSREVYPTSVRATGVGSATSIGRIGGMICPLVAVGLVRDCHQTAAIVLFEAVILL  459

Query  108  LGLSVLLFPTETKGQQLSD  52
             G  +L  P ET G+ LSD
Sbjct  460  TGFCMLFLPIETGGKGLSD  478



>emb|CDP14262.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 115/183 (63%), Gaps = 5/183 (3%)
 Frame = -1

Query  594  HAICLLISSNLSRVSVAVNCKAVLATfsfffsclfFNEKFL--YAEVPGLILAAVLVDKI  421
            + I LLIS   S+ S   NC  +            + + F+  +A++ GL ++AV+VD++
Sbjct  299  YGIVLLISELSSKHS---NCGLIKNFLKSTEDSSLYRDVFITSFADLAGLAVSAVVVDRL  355

Query  420  GRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVR  241
            GRK ++    ALGF+ LLPLV+H +E +TT LL G+RM  +  +++ V++  E+YPTSVR
Sbjct  356  GRKLTVKIFLALGFILLLPLVVHHNEIVTTALLFGSRMSVMSGYSVIVVYSREVYPTSVR  415

Query  240  TTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQ  61
             TG G A ++GRI G+ICP+VAV  V  C   AAI+LFE + V+ G   L  P+ET G+ 
Sbjct  416  ATGVGSATAIGRIGGIICPLVAVGLVRDCHQTAAILLFEAVIVLTGFCTLFLPSETSGKA  475

Query  60   LSD  52
            L+D
Sbjct  476  LTD  478



>ref|XP_011093923.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Sesamum indicum]
Length=485

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 93/141 (66%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+LA VLV++ GRK  M  +  L  + +LPL+ HQ+  +TT LL   RM     F
Sbjct  341  AEIPGLLLAMVLVERFGRKLCMEILTMLTVIVILPLLAHQNGTVTTALLVSGRMFLSAAF  400

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
                ++  E+YPTSVR +G G+A +VGRI GMICP+VAV  V GC    A+I F ++ ++
Sbjct  401  NTLCVYTEEVYPTSVRASGYGLATAVGRIGGMICPLVAVGLVRGCHQTLAVIFFGIVILI  460

Query  108  LGLSVLLFPTETKGQQLSDAV  46
             G++VL FP ETKG+ L+D V
Sbjct  461  SGIAVLFFPFETKGRGLTDVV  481



>ref|XP_011093922.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Sesamum indicum]
Length=497

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 93/141 (66%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+LA VLV++ GRK  M  +  L  + +LPL+ HQ+  +TT LL   RM     F
Sbjct  353  AEIPGLLLAMVLVERFGRKLCMEILTMLTVIVILPLLAHQNGTVTTALLVSGRMFLSAAF  412

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
                ++  E+YPTSVR +G G+A +VGRI GMICP+VAV  V GC    A+I F ++ ++
Sbjct  413  NTLCVYTEEVYPTSVRASGYGLATAVGRIGGMICPLVAVGLVRGCHQTLAVIFFGIVILI  472

Query  108  LGLSVLLFPTETKGQQLSDAV  46
             G++VL FP ETKG+ L+D V
Sbjct  473  SGIAVLFFPFETKGRGLTDVV  493



>ref|XP_004243672.1| PREDICTED: organic cation/carnitine transporter 7-like [Solanum 
lycopersicum]
Length=476

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 96/139 (69%), Gaps = 0/139 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PG ILAA++VD IGRKFS+  M  L FLFLLPL+  Q  ALTT LL GAR    G+F
Sbjct  334  AEIPGTILAAIMVDTIGRKFSVALMCGLSFLFLLPLLAPQLPALTTGLLFGARTFISGSF  393

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             I  ++C E+YPTSVR+TG GVANSVGRI  MI PIV V  + GC   AAI  FE +  +
Sbjct  394  VIVGVYCREVYPTSVRSTGIGVANSVGRIGPMISPIVVVHLLRGCHQTAAIACFEAVLAL  453

Query  108  LGLSVLLFPTETKGQQLSD  52
              +SV+L   ETKG++L D
Sbjct  454  SAVSVMLLSVETKGRELID  472



>gb|EMT01595.1| Synaptic vesicle 2-related protein [Aegilops tauschii]
Length=257

 Score =   117 bits (292),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGLILAA+LVDK+GRK SM     L  + + PL    +E L T+LL  AR C  G++
Sbjct  120  AEFPGLILAALLVDKVGRKLSMGAFAFLCLVSIAPLAAPLEEGLATVLLFSARTCITGSY  179

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  I+ PEIYP+S R TG GVA S+GRI GMI P++AV  +  C    A+ +F+++   
Sbjct  180  AVLYIYGPEIYPSSCRNTGVGVATSLGRIGGMIAPLIAVGLLESCHQKEAVFVFDLVLFF  239

Query  108  LGLSVLLFPTETKGQQL  58
              ++  LFP ETKG Q+
Sbjct  240  AAVACALFPLETKGCQI  256



>emb|CDX82560.1| BnaA03g32610D [Brassica napus]
Length=663

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 94/152 (62%), Gaps = 12/152 (8%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+++A +VD++GRK SM  M     +FLLPL+ HQ   LTT LL G R+C    
Sbjct  348  FAEFPGLLISAAMVDRLGRKASMSSMLFTCCIFLLPLLTHQSPTLTTALLFGGRICISSA  407

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+  I+ PEIYPT+VRTTG GV +SVGRI G++CP+VAV  V GC    A++LFE + +
Sbjct  408  FTVVYIYAPEIYPTAVRTTGVGVGSSVGRIGGVLCPLVAVGLVHGCHQTIAVLLFEFVIL  467

Query  111  VLGLSVLLFPTETKGQQLSDAVVAS*TFVSDY  16
            V        P E +     D       FV+DY
Sbjct  468  VSDS-----PQEHEEPNNHD-------FVTDY  487



>gb|EPS64332.1| hypothetical protein M569_10450, partial [Genlisea aurea]
Length=478

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 91/139 (65%), Gaps = 0/139 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+LAA+LVD+ GRK  M  +  L  + +LPL+  Q    T+LLL  ARM     F
Sbjct  339  AELPGLVLAALLVDRFGRKICMETVSLLTVVAILPLLWPQTGTATSLLLITARMFNSAAF  398

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            +  V++  E+YPT VR TGAGV + VGR  G++CPIVAV  V GC + AA+ LF  + V+
Sbjct  399  STLVVYSEEVYPTCVRGTGAGVMSGVGRFGGILCPIVAVGLVRGCHLTAAVGLFGSLIVL  458

Query  108  LGLSVLLFPTETKGQQLSD  52
             G  V+LFP ETKG+ L D
Sbjct  459  SGACVMLFPFETKGKDLFD  477



>gb|EMS60580.1| Synaptic vesicle 2-related protein [Triticum urartu]
Length=445

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 88/137 (64%), Gaps = 0/137 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGLILAA+LVDK+GRK SM     L  L + PL    +E L T+LL  AR C  G++
Sbjct  308  AEFPGLILAALLVDKVGRKLSMGAFAFLCLLSVAPLAAPLEEGLATVLLFSARTCITGSY  367

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  I+ PEIYP+S R TG GVA S+GRI GMI P++AV  +  C    A+ +F+++  +
Sbjct  368  AVLYIYGPEIYPSSCRNTGVGVATSLGRIGGMIAPLIAVGLLESCHQKEAVFVFDLVLFL  427

Query  108  LGLSVLLFPTETKGQQL  58
              ++  LFP ETKG Q+
Sbjct  428  AAVACALFPLETKGCQI  444



>ref|XP_011018199.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
Length=366

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 93/150 (62%), Gaps = 6/150 (4%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGLIL+AV+VD IGR+ S+ FM+A   +FL PL  HQ   LTT L+ GARM      
Sbjct  207  AEIPGLILSAVVVDTIGRRLSISFMFASACIFLSPLFYHQSATLTTTLMFGARMSSRVLS  266

Query  288  TITVIFCPEIYPTS------VRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILF  127
            T+  I+  E+ P         R TG GVA++V R+ GMI P+VAV  V+G     AIIL 
Sbjct  267  TLATIYAQEVSPGIHAFRCIRRATGFGVASAVRRVGGMITPLVAVGLVTGGHHTEAIILL  326

Query  126  EVIAVVLGLSVLLFPTETKGQQLSDAVVAS  37
            +++  + GL VLL P +TKG + SD+V  S
Sbjct  327  DIVMAMSGLCVLLIPVQTKGHEFSDSVDVS  356



>dbj|BAJ86078.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=404

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGLILAA+LVDK+GRK SM     L  + + PL    +E L T+LL  AR    G++
Sbjct  267  AEFPGLILAALLVDKVGRKLSMGAFAFLCLVSIAPLAAPLEEGLATVLLFSARTSITGSY  326

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  I+ PEIYP+S R TG GVA S+GRI GMI P++AV  +  C    A+ +F+++  +
Sbjct  327  AVLYIYGPEIYPSSCRNTGVGVATSLGRIGGMIAPLIAVGLLESCHQKEAVFVFDLVLFL  386

Query  108  LGLSVLLFPTETKGQQL  58
              ++  LFP ETKG Q+
Sbjct  387  AAIACALFPLETKGCQI  403



>dbj|BAJ96504.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 87/138 (63%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGLILAA+LVDK+GRK SM     L  + + PL    +E L T+LL  AR    G++
Sbjct  235  AEFPGLILAALLVDKVGRKLSMGAFAFLCLVSIAPLAAPLEEGLATVLLFSARTSITGSY  294

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  I+ PEIYP+S R TG GVA S+GRI GMI P++AV  +  C    A+ +F+++  +
Sbjct  295  AVLYIYGPEIYPSSCRNTGVGVATSLGRIGGMIAPLIAVGLLESCHQKEAVFVFDLVLFL  354

Query  108  LGLSVLLFPTETKGQQLS  55
              ++  LFP ETKG Q+ 
Sbjct  355  AAIACALFPLETKGCQIQ  372



>ref|XP_001774058.1| predicted protein [Physcomitrella patens]
 gb|EDQ61110.1| predicted protein [Physcomitrella patens]
Length=474

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 88/141 (62%), Gaps = 0/141 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL+LA + V++ GRK SM  +     LF+ PL     E  TT L+ GAR C +G F
Sbjct  319  AELPGLVLACLTVERYGRKASMGALLLGTGLFVAPLWKPLSEMATTTLMFGARSCIMGAF  378

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            +I   + PE+YPT +R+TG G +NS GRI G +CP VA++ +     + ++ LF  + ++
Sbjct  379  SILWAYAPELYPTKLRSTGLGFSNSAGRIGGFLCPFVAIEMMKNGHRILSVTLFSTVPLI  438

Query  108  LGLSVLLFPTETKGQQLSDAV  46
              ++ LLFP ETKG +L D +
Sbjct  439  ASIATLLFPVETKGLRLPDDI  459



>dbj|BAJ92143.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGLILAA+LVDK+GRK SM     L  + + PL    +E L T+LL  AR    G++
Sbjct  353  AEFPGLILAALLVDKVGRKLSMGAFAFLCLVSIAPLAAPLEEGLATVLLFSARTSITGSY  412

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  I+ PEIYP+S R TG GVA S+GRI GMI P++AV  +  C    A+ +F+++  +
Sbjct  413  AVLYIYGPEIYPSSCRNTGVGVATSLGRIGGMIAPLIAVGLLESCHQKEAVFVFDLVLFL  472

Query  108  LGLSVLLFPTETKGQQL  58
              ++  LFP ETKG Q+
Sbjct  473  AAIACALFPLETKGCQI  489



>ref|XP_006372273.1| hypothetical protein POPTR_0018s14860g [Populus trichocarpa]
 gb|ERP50070.1| hypothetical protein POPTR_0018s14860g [Populus trichocarpa]
Length=515

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 100/144 (69%), Gaps = 0/144 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PG++L+A +VD+IGRK ++ F + L  +FLLPLV HQ   LT   L GARM     +
Sbjct  363  AELPGILLSATIVDRIGRKLTVAFTFVLAGIFLLPLVYHQSATLTMSFLFGARMSTKAVY  422

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            ++  I+  E+YPTSVR TGAG AN+ G++ GMICP+VAV  V+ C+I  AIILFEV+  +
Sbjct  423  SVATIYGQELYPTSVRATGAGAANAAGKVGGMICPLVAVGLVTSCQITEAIILFEVLMAI  482

Query  108  LGLSVLLFPTETKGQQLSDAVVAS  37
              + V+  P +TKGQ+L D++  S
Sbjct  483  SAVCVMFIPVDTKGQKLCDSIDVS  506



>ref|XP_003562867.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Brachypodium distachyon]
Length=491

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 85/138 (62%), Gaps = 0/138 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PG ILAA+LVD++GRK SM     L F+F+ PL     E L T LL  AR C   ++
Sbjct  354  AEFPGQILAALLVDRVGRKLSMGGFVFLCFIFVAPLAAPLGEGLATTLLFSARTCITASY  413

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  I+ PEIYPTS R TG GVA SVGRI GM+ P+VAV  +  C    A+ +F+++  +
Sbjct  414  AVLYIYGPEIYPTSCRNTGVGVATSVGRIGGMVAPLVAVGLLENCHRKEAVFVFDLVLCL  473

Query  108  LGLSVLLFPTETKGQQLS  55
              ++  LFP ETK  Q+ 
Sbjct  474  AAVACALFPLETKNCQIQ  491



>gb|EEE67444.1| hypothetical protein OsJ_24811 [Oryza sativa Japonica Group]
Length=822

 Score =   108 bits (269),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 57/137 (42%), Positives = 81/137 (59%), Gaps = 0/137 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGL+LAA+LVD+IGRK S+  M  L   FL PL +H  +   T LL  AR C +G F
Sbjct  327  AEFPGLVLAALLVDRIGRKVSLGIMLLLSCAFLAPLAVHLGQGSVTTLLFCARTCIMGGF  386

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  ++ PEIYP S R TG G+ +S GRI  ++ P+V V     C    A+   +++  +
Sbjct  387  AVLYVYTPEIYPASSRNTGVGITSSFGRIGSIVSPVVTVSLSENCRQKEAVFFMDLMLFL  446

Query  108  LGLSVLLFPTETKGQQL  58
              ++  L P ETKG+Q+
Sbjct  447  AAVACALIPLETKGRQI  463



>ref|XP_002463060.1| hypothetical protein SORBIDRAFT_02g036920 [Sorghum bicolor]
 gb|EER99581.1| hypothetical protein SORBIDRAFT_02g036920 [Sorghum bicolor]
Length=466

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 85/137 (62%), Gaps = 0/137 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGL+LAA+LVD+IGRK SM  M  +   FL PL +   E L T LL  AR C +G+F
Sbjct  329  AEFPGLLLAALLVDRIGRKRSMGGMLLMCGAFLAPLSVQLGEGLVTTLLFCARTCIMGSF  388

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  ++ PE+YP S R TG G+ +S+GRI  ++ P+V V  +  C    A+ + +++  +
Sbjct  389  AVLYVYTPELYPASSRNTGVGITSSLGRIGSIVSPLVIVGLLESCRQKEAVFMIDLVLFL  448

Query  108  LGLSVLLFPTETKGQQL  58
             G++   FP ETKG Q+
Sbjct  449  AGVTCAFFPRETKGCQI  465



>gb|EEC82301.1| hypothetical protein OsI_26552 [Oryza sativa Indica Group]
Length=490

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 81/137 (59%), Gaps = 0/137 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGL+LAA+LVD+IGRK S+  M  L   FL PL +H  +   T LL  AR C +G F
Sbjct  353  AEFPGLVLAALLVDRIGRKVSLGIMLLLSCAFLAPLAVHLGQGSVTTLLFCARTCIMGGF  412

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  ++ PEIYP S R TG G+ +S GRI  ++ P+V V     C    A+   +++  +
Sbjct  413  AVLYVYTPEIYPASSRNTGVGITSSFGRIGSIVSPVVTVSLSENCRQKEAVFFMDLMLFL  472

Query  108  LGLSVLLFPTETKGQQL  58
              ++  L P ETKG+Q+
Sbjct  473  AAVACALIPLETKGRQI  489



>ref|NP_001060053.1| Os07g0571700 [Oryza sativa Japonica Group]
 dbj|BAC84668.1| putative organic cation transporter [Oryza sativa Japonica Group]
 dbj|BAF21967.1| Os07g0571700 [Oryza sativa Japonica Group]
Length=491

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 81/137 (59%), Gaps = 0/137 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGL+LAA+LVD+IGRK S+  M  L   FL PL +H  +   T LL  AR C +G F
Sbjct  354  AEFPGLVLAALLVDRIGRKVSLGIMLLLSCAFLAPLAVHLGQGSVTTLLFCARTCIMGGF  413

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  ++ PEIYP S R TG G+ +S GRI  ++ P+V V     C    A+   +++  +
Sbjct  414  AVLYVYTPEIYPASSRNTGVGITSSFGRIGSIVSPVVTVSLSENCRQKEAVFFMDLMLFL  473

Query  108  LGLSVLLFPTETKGQQL  58
              ++  L P ETKG+Q+
Sbjct  474  AAVACALIPLETKGRQI  490



>ref|XP_001753056.1| predicted protein [Physcomitrella patens]
 gb|EDQ82097.1| predicted protein, partial [Physcomitrella patens]
Length=465

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 85/133 (64%), Gaps = 0/133 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE+PGL++A ++V++ GRK S+  +     LF+ PL     E  TT L+ GAR C +G F
Sbjct  317  AELPGLLVACLIVERYGRKASLGALLLGTSLFVAPLWKPLSEMATTSLMFGARSCIMGAF  376

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
            +I   + PE+YPT +R++G G +NS GRI G +CP VA++ +     + +++LF  + ++
Sbjct  377  SILWAYAPELYPTKLRSSGLGFSNSAGRIGGFLCPFVAIEMMKNGHRVLSVLLFVAVPLI  436

Query  108  LGLSVLLFPTETK  70
              ++ LLFP ETK
Sbjct  437  ASMATLLFPIETK  449



>ref|NP_001168223.1| hypothetical protein [Zea mays]
 gb|ACN27493.1| unknown [Zea mays]
 tpg|DAA41164.1| TPA: hypothetical protein ZEAMMB73_754098 [Zea mays]
Length=484

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 85/137 (62%), Gaps = 0/137 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGL+LAA+LVD+IGRK SM  M  L  +FL PL L   E L T LL  AR C +G+F
Sbjct  347  AEFPGLLLAALLVDRIGRKRSMGGMLLLCGVFLAPLSLQLGEGLVTTLLFCARTCIMGSF  406

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  ++ PE+YP   R TG G+ +S+GRI  ++ P+V V  +  C    A+ + +++  +
Sbjct  407  AVLYVYTPELYPAPSRNTGVGITSSLGRIGSIVSPLVIVGLLESCRRKEAVFVVDLVLFL  466

Query  108  LGLSVLLFPTETKGQQL  58
             G++  L P ETKG Q+
Sbjct  467  AGVACALLPRETKGCQI  483



>ref|XP_008668303.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=491

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 85/137 (62%), Gaps = 0/137 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGL+LAA+LVD+IGRK SM  M  L  +FL PL L   E L T LL  AR C +G+F
Sbjct  354  AEFPGLLLAALLVDRIGRKRSMGGMLLLCGVFLAPLSLQLGEGLVTTLLFCARTCIMGSF  413

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  ++ PE+YP   R TG G+ +S+GRI  ++ P+V V  +  C    A+ + +++  +
Sbjct  414  AVLYVYTPELYPAPSRNTGVGITSSLGRIGSIVSPLVIVGLLESCRRKEAVFVVDLVLFL  473

Query  108  LGLSVLLFPTETKGQQL  58
             G++  L P ETKG Q+
Sbjct  474  AGVACALLPRETKGCQI  490



>ref|XP_004958088.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Setaria italica]
Length=484

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 83/137 (61%), Gaps = 0/137 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            AE PGL+LAA+LVD+IGRK SM  M  +   FL PL +   E L T LL  AR C +G+F
Sbjct  347  AEFPGLLLAALLVDRIGRKTSMGGMLFMCGAFLAPLSVQLGEGLVTTLLFCARTCIMGSF  406

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  ++ PE+Y  S R TG G+ +S+GRI  ++ P+V +  +  C    A+ + +++  +
Sbjct  407  AVLYVYTPELYSASTRNTGVGITSSLGRIGSIVSPLVTLGLLESCHQKEAVFVMDLVLFL  466

Query  108  LGLSVLLFPTETKGQQL  58
             G +   FP ETKG Q+
Sbjct  467  AGATCAFFPRETKGCQI  483



>ref|XP_011093915.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum 
indicum]
Length=486

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 81/129 (63%), Gaps = 0/129 (0%)
 Frame = -1

Query  432  VDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYP  253
            V+++GRK  M  +  L  +F+LPL+ H    +TT LL  +RM     FT   ++  E+YP
Sbjct  352  VERLGRKCCMEILTMLALVFILPLLSHHKATVTTALLVSSRMFLSAAFTTLSLYAKEVYP  411

Query  252  TSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTET  73
            T VR +G G+A+ +GRI GMICP+V V  V GC    A++LF ++ ++ G+ VL +P ET
Sbjct  412  TCVRGSGFGLASGMGRIGGMICPLVGVALVRGCHQTLAVVLFGIVILISGIGVLFYPLET  471

Query  72   KGQQLSDAV  46
            KG+ L D V
Sbjct  472  KGRGLKDVV  480



>ref|XP_011094025.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum 
indicum]
Length=492

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 86/144 (60%), Gaps = 15/144 (10%)
 Frame = -1

Query  432  VDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTFTITVIFCPEIYP  253
            V+++GRK  M  +  L  +F+LPL+ HQ+  +TT LL   RM     FT   ++  E+YP
Sbjct  347  VERLGRKRCMEILTLLTVVFILPLLSHQNATVTTALLVSGRMFLSAAFTTLSLYAKEVYP  406

Query  252  TSVRTTG---------------AGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVI  118
            TSVR++G                G+A +VGRI GMICP+VAV  V GC    A+++F +I
Sbjct  407  TSVRSSGFGLALVYPTSVRASGYGLATAVGRIGGMICPLVAVGLVRGCHQTLAVVVFGII  466

Query  117  AVVLGLSVLLFPTETKGQQLSDAV  46
             ++ G+ V+ FP ETKG+ L+D V
Sbjct  467  ILISGICVVFFPFETKGRGLTDVV  490



>ref|XP_004981616.1| PREDICTED: organic cation/carnitine transporter 7-like [Setaria 
italica]
Length=472

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 83/138 (60%), Gaps = 0/138 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+LAA+LVD+IGRK +M  M  L   FL PL     E L+ +LL  AR C +G 
Sbjct  334  FAEFPGLLLAALLVDRIGRKVTMGGMILLCCAFLAPLATQLREDLSIILLFCARSCVMGC  393

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F +  ++ PEIYPTS R TG G A+ +GRI  ++ P+     +        +++ ++   
Sbjct  394  FAVLHVYSPEIYPTSCRNTGVGFASIIGRIGSIVAPLTTTALLENHHQKEVVLVMDLALF  453

Query  111  VLGLSVLLFPTETKGQQL  58
            + G++  LFP ETKG+++
Sbjct  454  LAGVACTLFPLETKGREI  471



>ref|XP_006374731.1| hypothetical protein POPTR_0014s00300g [Populus trichocarpa]
 gb|ERP52528.1| hypothetical protein POPTR_0014s00300g [Populus trichocarpa]
Length=101

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -1

Query  261  IYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFP  82
            IYPTSVR+TG GVA+S+GRI GMICP+VAV  V GC   AA+ILF  I  V G  V+LFP
Sbjct  11   IYPTSVRSTGIGVASSMGRIGGMICPLVAVSLVQGCHQTAALILFVCIIFVAGCCVMLFP  70

Query  81   TETKGQQLSDAVVAS  37
             ETKG +L+D++ ++
Sbjct  71   FETKGLELTDSISST  85



>tpg|DAA50363.1| TPA: hypothetical protein ZEAMMB73_018003 [Zea mays]
Length=494

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 68/100 (68%), Gaps = 3/100 (3%)
 Frame = -1

Query  354  HQDEALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVA  175
            ++D  +T+L    AR C  G  T   ++ PE+YPT VR+TG G+A ++G+I G+ICP+VA
Sbjct  398  YKDTFITSL---AARACGTGATTTLCLYAPEVYPTYVRSTGVGIATAIGKIGGVICPLVA  454

Query  174  VQFVSGCEIMAAIILFEVIAVVLGLSVLLFPTETKGQQLS  55
            V  +  C  M A+++FE++  + G+S +LFP ETKG+++ 
Sbjct  455  VGMLRSCHQMEAVLVFELVLFLAGVSCILFPVETKGREMD  494



>ref|XP_004958086.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Setaria italica]
Length=472

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 81/138 (59%), Gaps = 0/138 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            +AE PGL+LAA+LVD+IGRK  +  M  L   FL PL     E L+ +LL  AR C +G 
Sbjct  334  FAEFPGLLLAALLVDRIGRKVMLGGMILLCCAFLAPLATQLREDLSIILLFCARSCVMGC  393

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            F +  ++  EIYPTS R TG G A+ +GRI  ++ P+     +        +++ ++   
Sbjct  394  FAVLHVYSSEIYPTSCRNTGVGFASFIGRIGSIVAPLTTTALLENHHQKEVVLVMDLALF  453

Query  111  VLGLSVLLFPTETKGQQL  58
            + G++  LFP ETKG+++
Sbjct  454  LAGVACTLFPLETKGREI  471



>ref|XP_007510245.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18590.1| predicted protein [Bathycoccus prasinos]
Length=639

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 76/139 (55%), Gaps = 0/139 (0%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGT  292
            ++E+PG+I A V +D +GRK SM+  + +  +  +P++      + T  L+ AR   +  
Sbjct  470  FSELPGMISAMVCIDTLGRKKSMILGFVVAAVCFIPIMQSAKRDVITAFLAIARSSSMAA  529

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FT+   +C E+YPT +R TG GV+N+  R AGMI P+ AV  V        + LF  IA+
Sbjct  530  FTVLFAYCSEVYPTQIRGTGVGVSNTFSRFAGMIVPLFAVDLVRNGAEEFVLFLFGFIAI  589

Query  111  VLGLSVLLFPTETKGQQLS  55
            V    V     ETKGQ L 
Sbjct  590  VSAFVVSRLERETKGQHLD  608



>gb|KHF36311.1| putative niacin/nicotinamide transporter NaiP [Paenibacillus 
sp. P1XP2]
Length=203

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 78/145 (54%), Gaps = 11/145 (8%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            A++PG   AA  ++K GRKF M+  Y +          + D A  +L+ +G    CL  F
Sbjct  64   AQLPGYFTAAYFIEKFGRKFVMI-TYLVLTAVSAAWFGNADSA-GSLIAAG---ICLSFF  118

Query  288  TITVI-----FCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVS-GCEIMAAIILF  127
             +        + PE+YPTSVR+TG G+A SVGRI G+I P +    V    EI A  I+F
Sbjct  119  NLGAWGGLYAYTPELYPTSVRSTGVGIATSVGRIGGVIAPFLVGYLVQRHVEINAIFIMF  178

Query  126  EVIAVVLGLSVLLFPTETKGQQLSD  52
             VI ++  L VL    ETKG+ L+D
Sbjct  179  FVIILIGALGVLFLGKETKGKALAD  203



>ref|XP_004958087.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Setaria italica]
Length=440

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 0/137 (0%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            ++ PGL+LAA+LVD+IGRK  +  M  L   FL PL     E L+ +LL  AR C +G F
Sbjct  303  SKFPGLLLAALLVDRIGRKVMLGGMILLCCAFLAPLATQLREDLSIILLFCARSCVMGCF  362

Query  288  TITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVV  109
             +  ++  EIYPTS R TG G A+ +GRI  ++ P+     +        +++ ++   +
Sbjct  363  AVLHVYSSEIYPTSCRNTGVGFASFIGRIGSIVAPLTTTALLENHHQKEVVLVMDLALFL  422

Query  108  LGLSVLLFPTETKGQQL  58
             G++  LFP ETKG+++
Sbjct  423  AGVACTLFPLETKGREI  439



>ref|WP_009672674.1| MULTISPECIES: major facilitator transporter [Paenibacillus]
 gb|EGL18679.1| transporter, major facilitator family protein [Paenibacillus 
sp. HGF7]
 gb|EPD92675.1| hypothetical protein HMPREF1207_00446 [Paenibacillus sp. HGH0039]
Length=404

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 79/144 (55%), Gaps = 9/144 (6%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCC----  301
            A++PG   AA  ++K GRKF ++       +      +    A T  +L  A MC     
Sbjct  265  AQLPGYFTAAYFIEKFGRKFVLV----TYLVLTAFSAVWFGGASTEGMLIAAGMCLSFFN  320

Query  300  LGTFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICP-IVAVQFVSGCEIMAAIILFE  124
            LG +     + PE+YPT++R+TGAG+A S GRI G+I P +V V    G  I A  ILF 
Sbjct  321  LGAWGGLYAYTPELYPTAIRSTGAGLAASFGRIGGIIAPLLVGVLVGWGIGIQAIFILFF  380

Query  123  VIAVVLGLSVLLFPTETKGQQLSD  52
            V+ ++  L+VL +  ETKG++LS 
Sbjct  381  VMILIGALAVLFWGDETKGKELSS  404



>ref|XP_001420126.1| MFS family transporter: sugar [Ostreococcus lucimarinus CCE9901]
 gb|ABO98419.1| MFS family transporter: sugar [Ostreococcus lucimarinus CCE9901]
Length=576

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 78/140 (56%), Gaps = 1/140 (1%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMF-MYAlgflfllplvLHQDEALTTLLLSGARMCCLG  295
            + E+PGLI+A ++VDKIGR+ SM F + A     L        +A+  ++L G R     
Sbjct  424  FGEIPGLIVAIMIVDKIGRRRSMAFTVIATAVFLLPVASSSISKAVRDIMLFGGRSAAFA  483

Query  294  TFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIA  115
             FT+  IF  E+YPTS+R+TG G+ N   RI G+ CPI AV  +    +  ++++F  +A
Sbjct  484  AFTVLYIFAGEVYPTSIRSTGVGLGNGFARIGGITCPIFAVTLIESGHLTLSVVVFIAVA  543

Query  114  VVLGLSVLLFPTETKGQQLS  55
             V   + L    ET G++L 
Sbjct  544  AVACAAALSLAVETAGRELD  563



>ref|WP_042227166.1| major facilitator transporter [Paenibacillus chitinolyticus]
Length=404

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 79/144 (55%), Gaps = 9/144 (6%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCC----  301
            A++PG   AA  ++K GRKF ++       +      +    A T  +L  A MC     
Sbjct  265  AQLPGYFTAAYFIEKFGRKFVLV----TYLVLTAFSAIWFGGASTEGMLIAAGMCLSFFN  320

Query  300  LGTFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICP-IVAVQFVSGCEIMAAIILFE  124
            LG +     + PE+YPT++R+TGAG+A S GRI G++ P +V V    G  I A  ILF 
Sbjct  321  LGAWGGLYAYTPELYPTAIRSTGAGLAASFGRIGGIVAPLLVGVLVGWGIGIQAIFILFF  380

Query  123  VIAVVLGLSVLLFPTETKGQQLSD  52
            V+ ++  L+VL +  ETKG++LS 
Sbjct  381  VMILIGALAVLFWGDETKGKELSS  404



>ref|XP_002499721.1| major facilitator superfamily [Micromonas sp. RCC299]
 gb|ACO60979.1| major facilitator superfamily [Micromonas sp. RCC299]
Length=537

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 77/140 (55%), Gaps = 2/140 (1%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEA--LTTLLLSGARMCCLG  295
            AE+PGL+LAA+ VD IGR+ S+    AL  + LL L+ +      L TL L  +R   + 
Sbjct  372  AELPGLVLAALSVDLIGRRNSLSSSMALNVVPLLALLGYATFPIWLETLALFLSRAASMW  431

Query  294  TFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIA  115
             FT+  I+ PE   TSVR T  G+ N+V R+ GM+CP+ AV+ V    +  AI  F  +A
Sbjct  432  AFTVLYIYAPETVNTSVRATAMGMGNAVARLGGMLCPLFAVEMVESGRMTGAIAFFAALA  491

Query  114  VVLGLSVLLFPTETKGQQLS  55
             V        P ET G++L 
Sbjct  492  CVTSTVAFFLPIETAGKRLD  511



>gb|ADE77746.1| unknown [Picea sitchensis]
Length=206

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  261  IYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFP  82
            +YPTS+R+TG G A+S  RI G++CP++AV  V  C    AI LFEV+ ++ G++VL  P
Sbjct  132  VYPTSIRSTGFGAASSFARIGGILCPLIAVGLVKSCRRALAISLFEVVILLAGIAVLFLP  191

Query  81   TETKGQQLSDAV  46
             ETKG+ LSD V
Sbjct  192  IETKGRALSDIV  203



>gb|EMS63401.1| Synaptic vesicle 2-related protein [Triticum urartu]
Length=695

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -1

Query  345  EALTTLLLSGARMCCLGTFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAV  172
            E LT + L GAR+C   +FTI  I+ PEIYPTSVRTTG GVA+SVGRI G++CP+VAV
Sbjct  357  EILTRISLFGARLCISASFTIVYIYAPEIYPTSVRTTGIGVASSVGRIGGILCPLVAV  414



>gb|EYU25778.1| hypothetical protein MIMGU_mgv1a0062852mg, partial [Erythranthe 
guttata]
Length=72

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -1

Query  261  IYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAVVLGLSVLLFP  82
            +YPT +RT+  G+A+++G+I GM+CP+VAV  V  C+   A+I+F+VI +V  LSV   P
Sbjct  1    VYPTEIRTSAVGIASAIGKIGGMVCPLVAVGLVDACQQTYALIMFQVIILVSALSVWFSP  60

Query  81   TETKGQQLSD  52
             ET G  LS+
Sbjct  61   FETNGMNLSE  70



>ref|WP_027084688.1| major facilitator transporter [Cohnella panacarvi]
Length=413

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 78/141 (55%), Gaps = 9/141 (6%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCC----  301
            A++PG   AA L++K+GRKF +    A   L      +    A T  +L  A +C     
Sbjct  266  AQLPGYFTAAYLIEKLGRKFVL----ATYLLLTGASAIWFGVATTEGMLIAAGICLSFFN  321

Query  300  LGTFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEV  121
            LG +     + PE+YPTSVR+TG G+A S+GRI G+I P +    +SG   + A+ +   
Sbjct  322  LGAWGAMYAYTPELYPTSVRSTGVGLAASIGRIGGVIGPYLVGMLISGGTAVTAVFIVFF  381

Query  120  IAVVLG-LSVLLFPTETKGQQ  61
            +A+V+G ++V+L   ETKG  
Sbjct  382  VAIVIGSMAVMLLGKETKGSD  402



>ref|XP_003081589.1| Synaptic vesicle transporter SVOP and related transporters (major 
facilitator superfamily) (ISS) [Ostreococcus tauri]
Length=825

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 51/138 (37%), Positives = 76/138 (55%), Gaps = 1/138 (1%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQ-DEALTTLLLSGARMCCLGT  292
            AEVPG+++A  ++D+IGR+ SM    A   +F  P+        +  + L  +R     +
Sbjct  335  AEVPGVLIAVAVIDRIGRRGSMALTLAATAVFTFPVAFKSIGVGIRDVALFCSRSAAFAS  394

Query  291  FTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVIAV  112
            FTI  +F  EIYPT +R++G GV NS  RI G+ CP+ AV  V     + A+  F V+AV
Sbjct  395  FTILYVFTGEIYPTRIRSSGLGVGNSFARIGGIACPLFAVTLVETGHRVLAVTFFLVVAV  454

Query  111  VLGLSVLLFPTETKGQQL  58
            V   + L    ET G++L
Sbjct  455  VAVAATLSLDIETTGRKL  472



>ref|WP_020961827.1| hypothetical protein [Thermofilum sp. 1910b]
 ref|YP_008431533.1| hypothetical protein N186_00655 [Thermofilum sp. 1910b]
 gb|AGT34529.1| hypothetical protein N186_00655 [Thermofilum sp. 1910b]
Length=414

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 77/143 (54%), Gaps = 7/143 (5%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSM-MFMYAlgflfllplvLHQDEALTTLLLSGARMCC--L  298
            A+VPG   AA LV+K+GRK ++  +M   G       +   D+A+   LL G  +    L
Sbjct  273  AQVPGYFSAAYLVEKVGRKRTLATYMLVSGLSSFGLWMATSDQAV---LLWGIVLSAFNL  329

Query  297  GTFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICP-IVAVQFVSGCEIMAAIILFEV  121
            G + +T  + PE+YPT +R TG+G ANSVGRI G++ P  V        E   + + F V
Sbjct  330  GAWGVTYAYTPELYPTKLRGTGSGWANSVGRIGGILGPYFVGFMLSQFKEPFTSFLAFAV  389

Query  120  IAVVLGLSVLLFPTETKGQQLSD  52
              +V  L+V +   ETKG+ L +
Sbjct  390  AQLVSSLTVSVLGIETKGKTLEE  412



>gb|AJB42259.1| Niacin transporter NiaP [Thermofilum carboxyditrophus 1505]
Length=414

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 77/143 (54%), Gaps = 7/143 (5%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSM-MFMYAlgflfllplvLHQDEALTTLLLSGARMCC--L  298
            A+VPG   AA LV+K+GRK ++  +M   G       +   D+A+   LL G  +    L
Sbjct  273  AQVPGYFSAAYLVEKVGRKRTLATYMLVSGLSSFGLWMATSDQAV---LLWGIVLSAFNL  329

Query  297  GTFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICP-IVAVQFVSGCEIMAAIILFEV  121
            G + +T  + PE+YPT +R TG+G ANSVGRI G++ P  V        E   + + F V
Sbjct  330  GAWGVTYAYTPELYPTKLRGTGSGWANSVGRIGGILGPYFVGFMLSQFKEPFTSFLAFAV  389

Query  120  IAVVLGLSVLLFPTETKGQQLSD  52
              +V  L+V +   ETKG+ L +
Sbjct  390  AQLVSSLTVSVLGIETKGKTLEE  412



>ref|WP_023965369.1| niacin transporter NiaP [Paenibacillus sp. JCM 10914]
 dbj|GAE09057.1| niacin transporter NiaP [Paenibacillus sp. JCM 10914]
Length=405

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 77/142 (54%), Gaps = 5/142 (4%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCC--LG  295
            A++PG   AA  ++K GRKF ++    L  +  +       EA  +LL +G  +    LG
Sbjct  266  AQLPGYFTAAYFIEKFGRKFVLVTYLVLTAVSAIWFGYANTEA--SLLAAGISLSFFNLG  323

Query  294  TFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICP-IVAVQFVSGCEIMAAIILFEVI  118
             +     + PE+YPT VR+TG G+A S GRI G+I P +V V   +G  I    ++F + 
Sbjct  324  AWGGLYAYSPELYPTKVRSTGVGLATSFGRIGGVIAPLLVGVLKQNGTSIEIIFVMFFIT  383

Query  117  AVVLGLSVLLFPTETKGQQLSD  52
             ++  L VLL   ETKG +L+D
Sbjct  384  ILIGALGVLLLGRETKGLELAD  405



>ref|WP_043097935.1| sugar transporter, partial [bacterium JKG1]
Length=448

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 80/142 (56%), Gaps = 7/142 (5%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSM-MFMYAlgflfllplvLHQDEAL--TTLLLSGARMCCL  298
            A+VPG +LAA LVD+IGR++++ ++++       L +      A+  T+ LLS      L
Sbjct  311  AQVPGYLLAAYLVDRIGRRWTLALYLFGSAAASFLFMTARSSGAVLATSSLLS---FALL  367

Query  297  GTFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEVI  118
            G +    +F PE+Y T  RTTG G A+++ R+A +  P V    + G  + AA+ ++   
Sbjct  368  GAWGALYVFTPELYSTDARTTGMGWASAMARLASIFAPSVGGALM-GYSLAAALSVYAAF  426

Query  117  AVVLGLSVLLFPTETKGQQLSD  52
             V+ G++ LL   ET+ + LSD
Sbjct  427  FVLGGVAALLITVETRNRPLSD  448



>gb|KFN08985.1| sugar (and other) transporter family protein [Paenibacillus macerans]
Length=413

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 74/144 (51%), Gaps = 9/144 (6%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCC----  301
            A++PG   AA  ++K GRKF ++    L             E +    L  A +C     
Sbjct  274  AQLPGYFTAAYFIEKFGRKFVLVLYLLLTAASAAWFGAATSEGM----LMAAGICLSFFN  329

Query  300  LGTFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEV  121
            LG +     + PE+YPTSVR+TG G+A S GRI G+I P +    V+    + +I     
Sbjct  330  LGAWGGMYAYTPELYPTSVRSTGVGLAASFGRIGGIIAPYLVGMLVARHVAVGSIFWLFF  389

Query  120  IAVVLG-LSVLLFPTETKGQQLSD  52
            + +V+G L+V    TETKG++L+D
Sbjct  390  VTIVIGALAVWWLGTETKGKELAD  413



>ref|WP_036628046.1| major facilitator transporter [Paenibacillus macerans]
Length=405

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 74/144 (51%), Gaps = 9/144 (6%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCC----  301
            A++PG   AA  ++K GRKF ++    L             E +    L  A +C     
Sbjct  266  AQLPGYFTAAYFIEKFGRKFVLVLYLLLTAASAAWFGAATSEGM----LMAAGICLSFFN  321

Query  300  LGTFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEV  121
            LG +     + PE+YPTSVR+TG G+A S GRI G+I P +    V+    + +I     
Sbjct  322  LGAWGGMYAYTPELYPTSVRSTGVGLAASFGRIGGIIAPYLVGMLVARHVAVGSIFWLFF  381

Query  120  IAVVLG-LSVLLFPTETKGQQLSD  52
            + +V+G L+V    TETKG++L+D
Sbjct  382  VTIVIGALAVWWLGTETKGKELAD  405



>ref|WP_007131744.1| major facilitator transporter [Paenibacillus lactis]
 gb|EHB59613.1| major facilitator superfamily MFS_1 [Paenibacillus lactis 154]
Length=408

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 75/145 (52%), Gaps = 11/145 (8%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            A++PG   AA  +++ GRKF ++       +  +       EA  +LL +G    CL  F
Sbjct  268  AQLPGYFTAAYFIERFGRKFVLVTYLVFTAISAIWFGYANTEA--SLLAAG---ICLSFF  322

Query  288  TITVI-----FCPEIYPTSVRTTGAGVANSVGRIAGMICP-IVAVQFVSGCEIMAAIILF  127
             +        + PE+YPT VR+TG G+A S GRI G+I P +V V    G  I    ++F
Sbjct  323  NLGAWGGLYAYSPELYPTKVRSTGVGLATSFGRIGGVIAPLLVGVLKQQGTRIELIFVMF  382

Query  126  EVIAVVLGLSVLLFPTETKGQQLSD  52
             V  ++  L VLL   ETKG +L+D
Sbjct  383  FVTILIGALGVLLLGKETKGLELAD  407



>ref|WP_028405052.1| major facilitator transporter [Bacillus sp. J13]
Length=408

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 75/145 (52%), Gaps = 11/145 (8%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCCLGTF  289
            A++PG   AA  +++ GRKF ++       +  +       EA  +LL +G    CL  F
Sbjct  268  AQLPGYFTAAYFIERFGRKFVLVTYLVFTAISAIWFGYANTEA--SLLAAG---ICLSFF  322

Query  288  TITVI-----FCPEIYPTSVRTTGAGVANSVGRIAGMICP-IVAVQFVSGCEIMAAIILF  127
             +        + PE+YPT VR+TG G+A S GRI G+I P +V V    G  I    ++F
Sbjct  323  NLGAWGGLYAYSPELYPTKVRSTGVGLATSFGRIGGVIAPLLVGVLKQQGTRIELIFVMF  382

Query  126  EVIAVVLGLSVLLFPTETKGQQLSD  52
             V  ++  L VLL   ETKG +L+D
Sbjct  383  FVTILIGALGVLLLGKETKGLELAD  407



>ref|WP_027889084.1| major facilitator transporter [Megamonas hypermegale]
Length=437

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = -1

Query  471  YAEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCC--L  298
            +A++PG   AA LVDKIGRK+++     L    +      Q +    ++  G  M    L
Sbjct  296  FAQLPGYFCAAWLVDKIGRKYTLSIF--LCMSGVASYFFGQSDTAQMIIFWGCVMSFFNL  353

Query  297  GTFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICP-IVAVQFVSGCEIMAAIILFEV  121
            G + +   + PE+YPTS+R  G+G A  +GRI GM  P +V +   +G ++     +F  
Sbjct  354  GAWGVVYTYTPELYPTSIRAMGSGWAAGIGRIGGMAAPFVVGIMLEAGSDMHTVFYMFAA  413

Query  120  IAVVLGLSVLLFPTETKGQQLSD  52
            + V++ ++V     ETK + L +
Sbjct  414  VFVIIAIAVFSLGIETKQKNLEN  436



>ref|WP_027092773.1| major facilitator transporter [Cohnella thermotolerans]
Length=409

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 9/139 (6%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCC----  301
            A++PG   AA L++K+GRKF ++       L      +    A+T   L  A +C     
Sbjct  266  AQLPGYFTAAYLIEKLGRKFVLV----AYLLLTAASAVWFGNAVTEGSLLAAGICLSFFN  321

Query  300  LGTFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICPIVAVQFVSGCEIMAAIILFEV  121
            LG +     + PE+YPTSVR TG G+A S GRI G+I P +    V+G   ++AI     
Sbjct  322  LGAWGAMYAYTPELYPTSVRATGVGLAASFGRIGGVIGPYLVGLLVAGNTSISAIFAIFF  381

Query  120  IAVVLG-LSVLLFPTETKG  67
            +A+V+G L+VLL   ETKG
Sbjct  382  VAIVIGALTVLLVGRETKG  400



>ref|WP_042161716.1| major facilitator transporter [Paenibacillus sp. G1]
Length=409

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 74/137 (54%), Gaps = 5/137 (4%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCC--LG  295
            A++PG   AA  ++K GRKF ++   A+  L  +       EA+  L+ +G  +    LG
Sbjct  268  AQLPGYFTAAYFIEKYGRKFVLVSYLAMTALSAIWFGTASSEAM--LVTAGISLSFFNLG  325

Query  294  TFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICP-IVAVQFVSGCEIMAAIILFEVI  118
             +     + PE+YPTSVR TG G A S GR+ G+I P +V V    G  + A  I+F + 
Sbjct  326  AWGAMYAYTPELYPTSVRATGVGFAASFGRVGGVIGPYLVGVLVAGGVSLTAVFIVFFIA  385

Query  117  AVVLGLSVLLFPTETKG  67
             ++   +VLLF  ETKG
Sbjct  386  ILIGAATVLLFAPETKG  402



>ref|WP_009590119.1| major facilitator transporter [Paenibacillus sp. HGF5]
 gb|EGG37821.1| transporter, major facilitator family protein [Paenibacillus 
sp. HGF5]
Length=407

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 76/142 (54%), Gaps = 5/142 (4%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCC--LG  295
            A++PG   AA  ++K GRKF ++    L  L  +       E   +LL +G  +    LG
Sbjct  268  AQLPGYFTAAYFIEKFGRKFVLVTYLVLTALSAIWFGYANTEG--SLLAAGISLSFFNLG  325

Query  294  TFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICP-IVAVQFVSGCEIMAAIILFEVI  118
             +     + PE+YPT VR+TG G+A S GRI G+I P +V V   +G  I    ++F V 
Sbjct  326  AWGGLYAYSPELYPTKVRSTGVGLATSFGRIGGVIAPLLVGVLKQNGTRIEIIFVMFFVT  385

Query  117  AVVLGLSVLLFPTETKGQQLSD  52
             ++  L VL+   ETKG +L+D
Sbjct  386  ILIGALGVLVLGKETKGLELAD  407



>gb|ETT61401.1| major facilitator superfamily protein [Paenibacillus sp. FSL 
H8-457]
Length=404

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 76/142 (54%), Gaps = 5/142 (4%)
 Frame = -1

Query  468  AEVPGLILAAVLVDKIGRKFSMMFMYAlgflfllplvLHQDEALTTLLLSGARMCC--LG  295
            A++PG   AA  ++K GRKF ++    L  L  +       E   +LL +G  +    LG
Sbjct  265  AQLPGYFTAAYFIEKFGRKFVLVTYLVLTALSAIWFGYANTEG--SLLAAGISLSFFNLG  322

Query  294  TFTITVIFCPEIYPTSVRTTGAGVANSVGRIAGMICP-IVAVQFVSGCEIMAAIILFEVI  118
             +     + PE+YPT VR+TG G+A S GRI G+I P +V V   +G  I    ++F V 
Sbjct  323  AWGGLYAYSPELYPTKVRSTGVGLATSFGRIGGVIAPLLVGVLKQNGTRIEIIFVMFFVT  382

Query  117  AVVLGLSVLLFPTETKGQQLSD  52
             ++  L VL+   ETKG +L+D
Sbjct  383  ILIGALGVLVLGKETKGLELAD  404



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520