BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF041L12

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009781567.1|  PREDICTED: uncharacterized protein LOC104230446    239   2e-73   Nicotiana sylvestris
ref|XP_009625617.1|  PREDICTED: uncharacterized protein LOC104116463    237   9e-73   Nicotiana tomentosiformis
ref|XP_004228549.1|  PREDICTED: uncharacterized protein LOC101249752    229   2e-69   Solanum lycopersicum
ref|XP_006348523.1|  PREDICTED: uncharacterized protein LOC102597...    226   2e-68   Solanum tuberosum [potatoes]
ref|XP_006348525.1|  PREDICTED: uncharacterized protein LOC102597...    227   2e-68   Solanum tuberosum [potatoes]
ref|XP_008221831.1|  PREDICTED: uncharacterized protein LOC103321776    223   4e-67   Prunus mume [ume]
ref|XP_011086570.1|  PREDICTED: uncharacterized protein LOC105168...    221   2e-66   Sesamum indicum [beniseed]
ref|XP_011086569.1|  PREDICTED: uncharacterized protein LOC105168...    221   2e-66   Sesamum indicum [beniseed]
ref|XP_002315692.2|  hypothetical protein POPTR_0010s05140g             221   2e-66   Populus trichocarpa [western balsam poplar]
ref|XP_007222563.1|  hypothetical protein PRUPE_ppa008383mg             220   5e-66   Prunus persica
ref|XP_011011119.1|  PREDICTED: uncharacterized protein LOC105115...    214   2e-63   Populus euphratica
ref|XP_010100449.1|  hypothetical protein L484_027761                   213   2e-63   
ref|XP_011011117.1|  PREDICTED: uncharacterized protein LOC105115...    214   2e-63   Populus euphratica
ref|XP_002265077.1|  PREDICTED: uncharacterized protein LOC100244891    211   1e-62   Vitis vinifera
ref|XP_010023547.1|  PREDICTED: uncharacterized protein LOC104414205    209   1e-61   Eucalyptus grandis [rose gum]
ref|XP_008444321.1|  PREDICTED: uncharacterized protein LOC103487688    207   5e-61   Cucumis melo [Oriental melon]
ref|XP_004166540.1|  PREDICTED: uncharacterized protein LOC101230152    207   5e-61   
ref|XP_004143071.1|  PREDICTED: uncharacterized protein LOC101212235    207   6e-61   Cucumis sativus [cucumbers]
ref|XP_002525367.1|  conserved hypothetical protein                     205   3e-60   Ricinus communis
emb|CDP00160.1|  unnamed protein product                                204   4e-60   Coffea canephora [robusta coffee]
gb|KDO82400.1|  hypothetical protein CISIN_1g040266mg                   201   7e-60   Citrus sinensis [apfelsine]
gb|EPS62234.1|  hypothetical protein M569_12558                         201   1e-59   Genlisea aurea
ref|XP_007153742.1|  hypothetical protein PHAVU_003G061200g             202   3e-59   Phaseolus vulgaris [French bean]
ref|XP_006438371.1|  hypothetical protein CICLE_v10032036mg             200   4e-59   
ref|XP_006483871.1|  PREDICTED: uncharacterized protein LOC102618...    201   7e-59   
gb|KHG03137.1|  hypothetical protein F383_26743                         201   9e-59   Gossypium arboreum [tree cotton]
ref|XP_006438370.1|  hypothetical protein CICLE_v10032036mg             201   1e-58   Citrus clementina [clementine]
ref|XP_004509756.1|  PREDICTED: uncharacterized protein LOC101489238    200   3e-58   Cicer arietinum [garbanzo]
gb|KJB50220.1|  hypothetical protein B456_008G159400                    200   3e-58   Gossypium raimondii
gb|KDP26597.1|  hypothetical protein JCGZ_17755                         199   4e-58   Jatropha curcas
gb|KHN25530.1|  hypothetical protein glysoja_043966                     199   5e-58   Glycine soja [wild soybean]
gb|KHN26884.1|  hypothetical protein glysoja_035523                     197   2e-57   Glycine soja [wild soybean]
ref|XP_003532005.1|  PREDICTED: uncharacterized protein LOC100808...    197   2e-57   Glycine max [soybeans]
gb|KJB15572.1|  hypothetical protein B456_002G185100                    196   2e-57   Gossypium raimondii
ref|XP_010251230.1|  PREDICTED: uncharacterized protein LOC104593182    197   3e-57   Nelumbo nucifera [Indian lotus]
ref|XP_003552022.1|  PREDICTED: uncharacterized protein LOC100781...    197   4e-57   Glycine max [soybeans]
gb|KJB15570.1|  hypothetical protein B456_002G185100                    196   6e-57   Gossypium raimondii
gb|KJB15571.1|  hypothetical protein B456_002G185100                    196   7e-57   Gossypium raimondii
ref|XP_006300944.1|  hypothetical protein CARUB_v10021325mg             195   1e-56   Capsella rubella
gb|KEH20028.1|  OBP32pep, putative                                      195   3e-56   Medicago truncatula
gb|EYU31258.1|  hypothetical protein MIMGU_mgv1a009978mg                194   3e-56   Erythranthe guttata [common monkey flower]
gb|KEH20027.1|  OBP32pep, putative                                      195   6e-56   Medicago truncatula
gb|KEH20026.1|  OBP32pep, putative                                      195   7e-56   Medicago truncatula
emb|CDY11589.1|  BnaC06g31500D                                          192   2e-55   Brassica napus [oilseed rape]
emb|CDY47136.1|  BnaA08g05470D                                          192   2e-55   Brassica napus [oilseed rape]
ref|NP_564989.1|  uncharacterized protein                               191   4e-55   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64384.1|  unknown                                                 191   4e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415726.1|  PREDICTED: uncharacterized protein LOC104701686    191   6e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009105709.1|  PREDICTED: uncharacterized protein LOC103831...    191   6e-55   
ref|NP_001031261.1|  uncharacterized protein                            191   7e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427823.1|  PREDICTED: uncharacterized protein LOC104712594    189   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_002887303.1|  hypothetical protein ARALYDRAFT_894859             188   7e-54   Arabidopsis lyrata subsp. lyrata
ref|XP_009394240.1|  PREDICTED: uncharacterized protein LOC103979763    188   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011463200.1|  PREDICTED: uncharacterized protein LOC101307881    187   1e-53   Fragaria vesca subsp. vesca
ref|XP_010471039.1|  PREDICTED: uncharacterized protein LOC104750885    187   2e-53   Camelina sativa [gold-of-pleasure]
gb|AAA79703.1|  OBP32pep                                                184   5e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006661122.1|  PREDICTED: uncharacterized protein LOC102713573    183   7e-52   Oryza brachyantha
ref|XP_008353017.1|  PREDICTED: uncharacterized protein LOC103416...    182   1e-51   
ref|XP_008353020.1|  PREDICTED: uncharacterized protein LOC103416...    182   2e-51   Malus domestica [apple tree]
ref|XP_010925764.1|  PREDICTED: uncharacterized protein LOC105048...    179   1e-50   Elaeis guineensis
gb|EMT22456.1|  hypothetical protein F775_02661                         179   2e-50   
ref|XP_008812484.1|  PREDICTED: uncharacterized protein LOC103723...    179   4e-50   Phoenix dactylifera
ref|XP_008812483.1|  PREDICTED: uncharacterized protein LOC103723...    179   4e-50   Phoenix dactylifera
ref|XP_010925756.1|  PREDICTED: uncharacterized protein LOC105048...    178   5e-50   Elaeis guineensis
ref|XP_010552646.1|  PREDICTED: uncharacterized protein LOC104822970    177   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_004956598.1|  PREDICTED: uncharacterized protein LOC101756968    177   5e-49   Setaria italica
ref|XP_008389659.1|  PREDICTED: uncharacterized protein LOC103451978    170   7e-49   
ref|XP_002462231.1|  hypothetical protein SORBIDRAFT_02g022180          182   6e-48   
ref|XP_007044669.1|  Domain of Uncharacterized protein function i...    172   3e-47   
ref|XP_007044670.1|  Domain of Uncharacterized protein function i...    171   3e-47   
gb|KHG04031.1|  hypothetical protein F383_29543                         165   4e-47   Gossypium arboreum [tree cotton]
ref|XP_003577995.1|  PREDICTED: uncharacterized protein LOC100824540    170   7e-47   Brachypodium distachyon [annual false brome]
ref|XP_007044668.1|  Domain of Uncharacterized protein function i...    171   1e-46   
gb|KJB61050.1|  hypothetical protein B456_009G337600                    168   2e-46   Gossypium raimondii
gb|KJB61048.1|  hypothetical protein B456_009G337600                    168   5e-46   Gossypium raimondii
ref|XP_006585947.1|  PREDICTED: uncharacterized protein LOC100808...    165   2e-45   
ref|XP_006602384.1|  PREDICTED: uncharacterized protein LOC100781...    164   5e-45   Glycine max [soybeans]
ref|XP_006390884.1|  hypothetical protein EUTSA_v10019595mg             164   1e-44   
ref|XP_010682540.1|  PREDICTED: uncharacterized protein LOC104897377    161   1e-43   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG05657.1|  Trimethylamine-N-oxide reductase                        162   2e-43   Gossypium arboreum [tree cotton]
dbj|BAD23602.1|  hypothetical protein                                   161   5e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006840743.1|  hypothetical protein AMTR_s00096p00135790          159   1e-42   
emb|CDY57831.1|  BnaCnng32520D                                          151   9e-40   Brassica napus [oilseed rape]
gb|EMS64572.1|  hypothetical protein TRIUR3_17734                       150   1e-39   Triticum urartu
emb|CDY69075.1|  BnaCnng61760D                                          151   2e-39   Brassica napus [oilseed rape]
ref|XP_006305312.1|  hypothetical protein CARUB_v10009689mg             150   2e-39   Capsella rubella
gb|EEE69472.1|  hypothetical protein OsJ_28895                          155   2e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009110090.1|  PREDICTED: uncharacterized protein LOC103835...    149   3e-39   
emb|CDY25798.1|  BnaA07g09840D                                          150   3e-39   Brassica napus [oilseed rape]
emb|CDY41434.1|  BnaA08g20360D                                          150   6e-39   Brassica napus [oilseed rape]
ref|XP_010551589.1|  PREDICTED: uncharacterized protein LOC104822...    147   1e-38   
ref|XP_010551585.1|  PREDICTED: uncharacterized protein LOC104822...    147   3e-38   
ref|XP_010460141.1|  PREDICTED: uncharacterized protein LOC104741066    147   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_009103781.1|  PREDICTED: uncharacterized protein LOC103829839    150   5e-38   
ref|XP_006416072.1|  hypothetical protein EUTSA_v10008158mg             147   5e-38   Eutrema salsugineum [saltwater cress]
ref|XP_010477648.1|  PREDICTED: uncharacterized protein LOC104756719    146   7e-38   Camelina sativa [gold-of-pleasure]
ref|XP_002893289.1|  hypothetical protein ARALYDRAFT_472619             145   2e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_009109809.1|  PREDICTED: uncharacterized protein LOC103835402    144   3e-37   Brassica rapa
ref|NP_564197.1|  uncharacterized protein                               142   4e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63743.1|  unknown                                                 140   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44441.1|  hypothetical protein AALP_AA1G256900                    137   2e-34   Arabis alpina [alpine rockcress]
gb|AAF79591.1|AC007945_11  F28C11.19                                    141   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110088.1|  PREDICTED: uncharacterized protein LOC103835...    134   2e-33   
ref|XP_002964647.1|  hypothetical protein SELMODRAFT_82450              127   2e-31   
ref|XP_006483874.1|  PREDICTED: uncharacterized protein LOC102618...    122   4e-29   Citrus sinensis [apfelsine]
ref|XP_001771562.1|  predicted protein                                  113   1e-25   
ref|XP_006416064.1|  hypothetical protein EUTSA_v10009581mg             103   3e-23   
ref|XP_006416070.1|  hypothetical protein EUTSA_v10008632mg             104   5e-23   
ref|XP_006416069.1|  hypothetical protein EUTSA_v10009760mg             105   1e-22   
ref|XP_010477644.1|  PREDICTED: uncharacterized protein LOC104756716    103   1e-22   Camelina sativa [gold-of-pleasure]
gb|KFK40097.1|  hypothetical protein AALP_AA3G330000                    103   2e-22   Arabis alpina [alpine rockcress]
gb|AAC98020.1|  Similar to OBP32pep protein gb|U37698 from Arabid...    102   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893300.1|  hypothetical protein ARALYDRAFT_472628             102   3e-22   
ref|NP_564200.1|  uncharacterized protein                               101   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893299.1|  hypothetical protein ARALYDRAFT_313226             100   7e-22   
gb|AAM60976.1|  OBP32pep protein, putative                              100   8e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973899.1|  uncharacterized protein                               101   9e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44442.1|  hypothetical protein AALP_AA1G257000                    101   1e-21   Arabis alpina [alpine rockcress]
ref|XP_006396882.1|  hypothetical protein EUTSA_v10028680mg             101   3e-21   
gb|AAC73033.1|  hypothetical protein                                  99.0    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010480622.1|  PREDICTED: uncharacterized protein LOC104759384    100   4e-21   
ref|XP_006304583.1|  hypothetical protein CARUB_v10011627mg           99.4    4e-21   Capsella rubella
ref|XP_006303494.1|  hypothetical protein CARUB_v10010830mg           99.0    6e-21   
ref|NP_173766.1|  uncharacterized protein                             98.6    8e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180335.2|  uncharacterized protein                             98.6    1e-20   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ86261.1|  unknown                                               97.4    1e-20   Medicago truncatula
ref|XP_006304377.1|  hypothetical protein CARUB_v10010870mg           98.2    1e-20   
ref|NP_001077589.1|  uncharacterized protein                          96.7    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173773.1|  uncharacterized protein                             96.7    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416066.1|  hypothetical protein EUTSA_v10008137mg           96.7    6e-20   
ref|XP_006416065.1|  hypothetical protein EUTSA_v10008137mg           96.3    8e-20   
ref|XP_001766244.1|  predicted protein                                95.9    9e-20   
emb|CDY25791.1|  BnaA07g09910D                                        95.5    1e-19   Brassica napus [oilseed rape]
ref|XP_006304415.1|  hypothetical protein CARUB_v10010990mg           95.5    1e-19   
ref|XP_006304935.1|  hypothetical protein CARUB_v10011421mg           94.4    2e-19   
gb|KFK44435.1|  hypothetical protein AALP_AA1G256300                  94.0    2e-19   Arabis alpina [alpine rockcress]
ref|XP_010477658.1|  PREDICTED: uncharacterized protein LOC104756...  94.7    2e-19   
gb|KFK44436.1|  hypothetical protein AALP_AA1G256300                  94.0    2e-19   Arabis alpina [alpine rockcress]
ref|XP_010477661.1|  PREDICTED: uncharacterized protein LOC104756730  94.4    2e-19   Camelina sativa [gold-of-pleasure]
ref|NP_173781.1|  uncharacterized protein                             94.4    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498861.1|  PREDICTED: uncharacterized protein LOC104776...  93.2    3e-19   Camelina sativa [gold-of-pleasure]
ref|NP_001077590.1|  uncharacterized protein                          94.0    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103163.1|  PREDICTED: uncharacterized protein LOC103829265  94.0    4e-19   Brassica rapa
ref|XP_002893298.1|  hypothetical protein ARALYDRAFT_335602           94.0    4e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_006296266.1|  hypothetical protein CARUB_v10025431mg           94.4    4e-19   Capsella rubella
ref|XP_006306513.1|  hypothetical protein CARUB_v10012512mg           93.6    4e-19   
ref|XP_009110093.1|  PREDICTED: uncharacterized protein LOC103835656  94.0    5e-19   Brassica rapa
ref|XP_010477657.1|  PREDICTED: uncharacterized protein LOC104756...  94.0    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010477662.1|  PREDICTED: uncharacterized protein LOC104756731  93.6    6e-19   Camelina sativa [gold-of-pleasure]
emb|CDY41441.1|  BnaA08g20430D                                        96.3    6e-19   Brassica napus [oilseed rape]
ref|NP_001117340.1|  uncharacterized protein                          92.0    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110091.1|  PREDICTED: uncharacterized protein LOC103835654  93.6    7e-19   
ref|XP_010498860.1|  PREDICTED: uncharacterized protein LOC104776...  93.2    7e-19   
ref|XP_002893287.1|  hypothetical protein ARALYDRAFT_472615           93.2    8e-19   
ref|XP_006306553.1|  hypothetical protein CARUB_v10012640mg           92.4    1e-18   Capsella rubella
ref|XP_009103161.1|  PREDICTED: uncharacterized protein LOC103829263  92.8    1e-18   Brassica rapa
ref|XP_006416071.1|  hypothetical protein EUTSA_v10010034mg           92.4    2e-18   Eutrema salsugineum [saltwater cress]
ref|XP_009103162.1|  PREDICTED: uncharacterized protein LOC103829264  92.8    2e-18   Brassica rapa
gb|KFK44440.1|  hypothetical protein AALP_AA1G256800                  92.0    2e-18   Arabis alpina [alpine rockcress]
ref|XP_010510745.1|  PREDICTED: uncharacterized protein LOC104786963  92.0    3e-18   Camelina sativa [gold-of-pleasure]
ref|NP_001077587.1|  uncharacterized protein                          91.3    3e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDY54284.1|  BnaC07g48250D                                        92.0    3e-18   Brassica napus [oilseed rape]
ref|NP_564198.3|  uncharacterized protein                             91.3    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28412.1|  unknown                                               91.3    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893297.1|  hypothetical protein ARALYDRAFT_889905           90.9    4e-18   
ref|XP_001766483.1|  predicted protein                                90.9    5e-18   
ref|NP_173771.1|  uncharacterized protein                             90.9    5e-18   
gb|AAC98013.1|  Similar to OBP32pep protein gb|U37698 from Arabid...  90.9    6e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25795.1|  BnaA07g09870D                                        88.2    7e-18   Brassica napus [oilseed rape]
ref|XP_010477666.1|  PREDICTED: uncharacterized protein LOC104756...  89.4    8e-18   
ref|XP_010477663.1|  PREDICTED: uncharacterized protein LOC104756...  90.1    9e-18   Camelina sativa [gold-of-pleasure]
emb|CDY59740.1|  BnaCnng35460D                                        89.7    1e-17   Brassica napus [oilseed rape]
ref|XP_009112003.1|  PREDICTED: uncharacterized protein LOC103837396  89.4    2e-17   Brassica rapa
ref|XP_010477665.1|  PREDICTED: uncharacterized protein LOC104756...  89.0    2e-17   Camelina sativa [gold-of-pleasure]
emb|CDY16800.1|  BnaA09g05820D                                        89.4    2e-17   Brassica napus [oilseed rape]
ref|XP_002879144.1|  predicted protein                                89.4    2e-17   
gb|AAC98019.1|  Similar to OBP32pep protein gb|U37698 from Arabid...  89.0    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110095.1|  PREDICTED: uncharacterized protein LOC103835660  89.4    2e-17   
ref|NP_173778.1|  uncharacterized protein                             89.0    2e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDY57833.1|  BnaCnng32530D                                        89.4    2e-17   Brassica napus [oilseed rape]
emb|CDY25794.1|  BnaA07g09880D                                        90.1    2e-17   Brassica napus [oilseed rape]
ref|XP_006416077.1|  hypothetical protein EUTSA_v10008736mg           88.2    2e-17   
ref|XP_010460138.1|  PREDICTED: uncharacterized protein LOC104741...  88.2    3e-17   Camelina sativa [gold-of-pleasure]
emb|CDY25797.1|  BnaA07g09850D                                        88.6    3e-17   Brassica napus [oilseed rape]
ref|XP_010477659.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  90.5    3e-17   
ref|XP_010460137.1|  PREDICTED: uncharacterized protein LOC104741...  88.6    3e-17   Camelina sativa [gold-of-pleasure]
emb|CDX87227.1|  BnaC09g05420D                                        88.2    3e-17   
ref|XP_002893290.1|  hypothetical protein ARALYDRAFT_889898           88.2    4e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_010477655.1|  PREDICTED: uncharacterized protein LOC104756...  87.4    5e-17   
ref|XP_010477654.1|  PREDICTED: uncharacterized protein LOC104756...  87.4    6e-17   Camelina sativa [gold-of-pleasure]
emb|CDY41437.1|  BnaA08g20390D                                        87.4    6e-17   Brassica napus [oilseed rape]
ref|NP_173776.2|  uncharacterized protein                             89.0    7e-17   
ref|XP_010477653.1|  PREDICTED: uncharacterized protein LOC104756724  85.5    9e-17   
ref|XP_009110094.1|  PREDICTED: uncharacterized protein LOC103835657  86.3    2e-16   
ref|XP_002893295.1|  hypothetical protein ARALYDRAFT_889903           82.8    2e-16   
ref|XP_006416076.1|  hypothetical protein EUTSA_v10008486mg           85.9    2e-16   
emb|CDY57836.1|  BnaCnng32560D                                        86.7    3e-16   Brassica napus [oilseed rape]
emb|CDX91721.1|  BnaC08g06400D                                        87.4    4e-16   
ref|XP_001752924.1|  predicted protein                                84.3    5e-16   
emb|CDY41435.1|  BnaA08g20370D                                        85.1    5e-16   Brassica napus [oilseed rape]
ref|XP_009110750.1|  PREDICTED: uncharacterized protein LOC103836254  85.1    6e-16   
gb|AAC98021.1|  Similar to OBP32pep protein gb|U37698 from Arabid...  84.7    7e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306462.1|  hypothetical protein CARUB_v10012413mg           84.3    8e-16   Capsella rubella
emb|CDX91720.1|  BnaC08g06390D                                        84.3    1e-15   
ref|XP_010480623.1|  PREDICTED: uncharacterized protein LOC104759388  82.4    1e-15   Camelina sativa [gold-of-pleasure]
ref|NP_001185073.1|  uncharacterized protein                          83.2    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304618.1|  hypothetical protein CARUB_v10011702mg           84.0    1e-15   
emb|CDY54285.1|  BnaC07g48260D                                        83.6    2e-15   Brassica napus [oilseed rape]
ref|XP_010477660.1|  PREDICTED: uncharacterized protein LOC104756729  82.0    4e-15   Camelina sativa [gold-of-pleasure]
emb|CDY25792.1|  BnaA07g09900D                                        82.4    4e-15   Brassica napus [oilseed rape]
ref|XP_002893302.1|  hypothetical protein ARALYDRAFT_313228           82.0    5e-15   Arabidopsis lyrata subsp. lyrata
gb|AAF79594.1|AC007945_14  F28C11.14                                  81.3    8e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAC98007.1|  Similar to OBP32pep protein gb|U37698 from Arabid...  80.9    9e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305975.1|  hypothetical protein CARUB_v10011238mg           78.2    1e-14   
emb|CDY69838.1|  BnaCnng65610D                                        79.0    1e-14   Brassica napus [oilseed rape]
ref|XP_006303865.1|  hypothetical protein CARUB_v10012631mg           79.0    2e-14   
ref|XP_006303770.1|  hypothetical protein CARUB_v10011997mg           78.2    8e-14   Capsella rubella
gb|KFK44445.1|  hypothetical protein AALP_AA1G257400                  75.1    1e-13   Arabis alpina [alpine rockcress]
gb|AAC98017.1|  Similar to OBP32pep protein gb|U37698 from Arabid...  76.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893301.1|  hypothetical protein ARALYDRAFT_889909           77.0    2e-13   
gb|AAC98018.1|  Similar to OBP32pep protein gb|U37698 from Arabid...  75.9    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498871.1|  PREDICTED: uncharacterized protein LOC104776...  75.9    8e-13   
ref|XP_010460143.1|  PREDICTED: uncharacterized protein LOC104741068  75.1    9e-13   
ref|XP_006306474.1|  hypothetical protein CARUB_v10012439mg           74.7    1e-12   
ref|XP_002893291.1|  hypothetical protein ARALYDRAFT_313224           75.5    1e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_002893294.1|  hypothetical protein ARALYDRAFT_889902           75.9    1e-12   
ref|XP_002893286.1|  hypothetical protein ARALYDRAFT_472613           74.3    2e-12   
ref|XP_010498870.1|  PREDICTED: uncharacterized protein LOC104776...  74.7    2e-12   Camelina sativa [gold-of-pleasure]
emb|CDY20855.1|  BnaC05g26370D                                        73.9    3e-12   Brassica napus [oilseed rape]
emb|CDY54286.1|  BnaC07g48270D                                        73.9    3e-12   Brassica napus [oilseed rape]
ref|XP_010498902.1|  PREDICTED: uncharacterized protein LOC104776...  73.6    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_001781678.1|  predicted protein                                71.6    7e-12   
ref|XP_002893293.1|  hypothetical protein ARALYDRAFT_889901           69.3    8e-12   
ref|XP_002893292.1|  hypothetical protein ARALYDRAFT_889900           70.9    2e-11   
ref|XP_006416078.1|  hypothetical protein EUTSA_v10010008mg           70.5    4e-11   
ref|XP_010498869.1|  PREDICTED: uncharacterized protein LOC104776...  69.7    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010498901.1|  PREDICTED: uncharacterized protein LOC104776...  68.2    4e-10   
ref|XP_005645855.1|  hypothetical protein COCSUDRAFT_43073            67.4    5e-10   Coccomyxa subellipsoidea C-169
ref|XP_008800727.1|  PREDICTED: uncharacterized protein LOC103715006  65.1    5e-10   
emb|CDY52335.1|  BnaA09g38840D                                        66.2    2e-09   Brassica napus [oilseed rape]
ref|XP_009116772.1|  PREDICTED: uncharacterized protein LOC103841...  66.2    2e-09   Brassica rapa
ref|XP_010477651.1|  PREDICTED: uncharacterized protein LOC104756721  66.2    2e-09   Camelina sativa [gold-of-pleasure]
emb|CDY51642.1|  BnaC05g50890D                                        65.9    3e-09   Brassica napus [oilseed rape]
gb|AAM65908.1|  putative OBP32pep protein                             64.7    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115048.1|  PREDICTED: uncharacterized protein LOC103840304  65.1    5e-09   Brassica rapa
emb|CDY04704.1|  BnaC05g18850D                                        63.9    1e-08   
ref|NP_564199.1|  uncharacterized protein                             62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115518.1|  PREDICTED: uncharacterized protein LOC103840...  63.5    2e-08   Brassica rapa
ref|NP_001077588.1|  uncharacterized protein                          62.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDY72266.1|  BnaCnng76800D                                        62.8    2e-08   Brassica napus [oilseed rape]
ref|XP_009115516.1|  PREDICTED: uncharacterized protein LOC103840...  63.5    2e-08   Brassica rapa
ref|XP_009115510.1|  PREDICTED: uncharacterized protein LOC103840745  63.2    2e-08   Brassica rapa
emb|CDY70554.1|  BnaCnng68830D                                        62.4    4e-08   Brassica napus [oilseed rape]
gb|ABK28137.1|  unknown                                               54.7    1e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ABE65395.1|  hypothetical protein At1g23610                        54.3    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KIY98108.1|  hypothetical protein MNEG_9855                        57.8    2e-06   Monoraphidium neglectum
gb|AAC98015.1|  Similar to OBP32pep protein gb|U37698 from Arabid...  55.8    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001752626.1|  predicted protein                                54.3    3e-05   
emb|CDY25796.1|  BnaA07g09860D                                        53.1    1e-04   Brassica napus [oilseed rape]
ref|XP_001752935.1|  predicted protein                                50.4    6e-04   
ref|XP_001766738.1|  predicted protein                                50.4    7e-04   



>ref|XP_009781567.1| PREDICTED: uncharacterized protein LOC104230446 [Nicotiana sylvestris]
 ref|XP_009781568.1| PREDICTED: uncharacterized protein LOC104230446 [Nicotiana sylvestris]
 ref|XP_009781569.1| PREDICTED: uncharacterized protein LOC104230446 [Nicotiana sylvestris]
Length=334

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTI+VHVLVDQ RE+H+MNFKQVKTGFMKRFEG WRVEPLLVDE+LCHP+RPN LADY
Sbjct  164  WSGTIAVHVLVDQNRENHTMNFKQVKTGFMKRFEGSWRVEPLLVDEDLCHPFRPNRLADY  223

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            +SYTKGKGRIGS VSLEQLIQPA+VPPPPISWY+RGITTKTTEMII DL AE ARIR SS
Sbjct  224  ISYTKGKGRIGSTVSLEQLIQPAIVPPPPISWYLRGITTKTTEMIITDLLAEAARIRGSS  283

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
            + +  + L ++ ESS ESQ   + +IKERWAL
Sbjct  284  NNDGYQGLKVNEESSVESQVGDIRDIKERWAL  315



>ref|XP_009625617.1| PREDICTED: uncharacterized protein LOC104116463 [Nicotiana tomentosiformis]
 ref|XP_009625618.1| PREDICTED: uncharacterized protein LOC104116463 [Nicotiana tomentosiformis]
Length=337

 Score =   237 bits (605),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTI+VHVLVDQ RE+H+M FKQVKTGFMKRFEGCWRVEPLLVD++LCHP+RPN LADY
Sbjct  167  WSGTIAVHVLVDQNRENHTMTFKQVKTGFMKRFEGCWRVEPLLVDQDLCHPFRPNTLADY  226

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            +SYTKGKGRIGS VSLEQLIQPA+VPPPPISWY+RGITTKTTEMII DL AE ARIR SS
Sbjct  227  ISYTKGKGRIGSTVSLEQLIQPAIVPPPPISWYLRGITTKTTEMIITDLLAEAARIRGSS  286

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
            + +  + L ++ ESS ES+   + +IKERWAL
Sbjct  287  NNDGYQGLKVNEESSVESKVGDIRDIKERWAL  318



>ref|XP_004228549.1| PREDICTED: uncharacterized protein LOC101249752 [Solanum lycopersicum]
Length=331

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ RED++M FKQVKTGFM+RFEG W+VEPLLVDE LCHP++P  LADY
Sbjct  164  WSGTISVHVLVDQNREDYTMKFKQVKTGFMERFEGRWKVEPLLVDEHLCHPFKPKTLADY  223

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            +SYTKGKGRIGS VSLEQLIQPA+VPPPPISWY+RGIT KTTEMII DL AE ARIR SS
Sbjct  224  ISYTKGKGRIGSTVSLEQLIQPAIVPPPPISWYLRGITAKTTEMIIIDLVAEAARIRGSS  283

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
            S +  R L ++ ESS ESQ   + +IKERWAL
Sbjct  284  SNDGSRGLKVNEESSIESQVSDIRDIKERWAL  315



>ref|XP_006348523.1| PREDICTED: uncharacterized protein LOC102597312 isoform X1 [Solanum 
tuberosum]
 ref|XP_006348524.1| PREDICTED: uncharacterized protein LOC102597312 isoform X2 [Solanum 
tuberosum]
Length=331

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ RED++M F QVKTGFM+RFEG W+VEPLLVDE LCHP++P  LADY
Sbjct  164  WSGTISVHVLVDQNREDYTMKFNQVKTGFMERFEGRWKVEPLLVDEHLCHPFKPKTLADY  223

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            +SYTKGKGRIGS VSLEQLIQPA+VPPPPISWY+RGIT KTTEMII DL AE ARIR SS
Sbjct  224  ISYTKGKGRIGSTVSLEQLIQPAIVPPPPISWYLRGITAKTTEMIITDLVAEAARIRGSS  283

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
            S +  + L ++ ESS ESQ   + +IKERWAL
Sbjct  284  SNDGSQGLKVNEESSIESQVSDIRDIKERWAL  315



>ref|XP_006348525.1| PREDICTED: uncharacterized protein LOC102597312 isoform X3 [Solanum 
tuberosum]
Length=351

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ RED++M F QVKTGFM+RFEG W+VEPLLVDE LCHP++P  LADY
Sbjct  184  WSGTISVHVLVDQNREDYTMKFNQVKTGFMERFEGRWKVEPLLVDEHLCHPFKPKTLADY  243

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            +SYTKGKGRIGS VSLEQLIQPA+VPPPPISWY+RGIT KTTEMII DL AE ARIR SS
Sbjct  244  ISYTKGKGRIGSTVSLEQLIQPAIVPPPPISWYLRGITAKTTEMIITDLVAEAARIRGSS  303

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
            S +  + L ++ ESS ESQ   + +IKERWAL
Sbjct  304  SNDGSQGLKVNEESSIESQVSDIRDIKERWAL  335



>ref|XP_008221831.1| PREDICTED: uncharacterized protein LOC103321776 [Prunus mume]
Length=334

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTI+VHVLVDQ REDHSM FKQVKTGFMKRFEGCWRVEPL VDE+ C P++P    DY
Sbjct  166  WSGTIAVHVLVDQNREDHSMKFKQVKTGFMKRFEGCWRVEPLFVDEKTCFPFKPKTWTDY  225

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T GKGRIGSKVSLEQLIQPA+VPPPPISWY+RGIT+KTTEM+INDL AE ARIRR  
Sbjct  226  HSCTGGKGRIGSKVSLEQLIQPAIVPPPPISWYLRGITSKTTEMLINDLLAEAARIRREL  285

Query  405  STEDL-RslglsgessgeSQTDSLCNIKERWAL  310
            + E   + L +S E    SQ D++ NIKERWAL
Sbjct  286  NPEKSNKELEMSQEQEILSQVDNVSNIKERWAL  318



>ref|XP_011086570.1| PREDICTED: uncharacterized protein LOC105168260 isoform X2 [Sesamum 
indicum]
Length=335

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 129/152 (85%), Gaps = 3/152 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ REDH+M F+Q+K+GFM++FEGCW++EPL VDEELCHP +P +L +Y
Sbjct  168  WSGTISVHVLVDQNREDHTMKFRQIKSGFMEKFEGCWKMEPLFVDEELCHPLKPKSLLEY  227

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            V+YTKG+GRI SK+SLEQLIQPA+VPPPPISWY+RGITTKTTEM+I DL AE ARIR++S
Sbjct  228  VAYTKGRGRIASKLSLEQLIQPAIVPPPPISWYLRGITTKTTEMLITDLLAEAARIRQAS  287

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
               +     LS E SGESQ  + CNIK+RWAL
Sbjct  288  GNGN---SDLSDEKSGESQVGNACNIKDRWAL  316



>ref|XP_011086569.1| PREDICTED: uncharacterized protein LOC105168260 isoform X1 [Sesamum 
indicum]
Length=336

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 129/152 (85%), Gaps = 3/152 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ REDH+M F+Q+K+GFM++FEGCW++EPL VDEELCHP +P +L +Y
Sbjct  169  WSGTISVHVLVDQNREDHTMKFRQIKSGFMEKFEGCWKMEPLFVDEELCHPLKPKSLLEY  228

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            V+YTKG+GRI SK+SLEQLIQPA+VPPPPISWY+RGITTKTTEM+I DL AE ARIR++S
Sbjct  229  VAYTKGRGRIASKLSLEQLIQPAIVPPPPISWYLRGITTKTTEMLITDLLAEAARIRQAS  288

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
               +     LS E SGESQ  + CNIK+RWAL
Sbjct  289  GNGN---SDLSDEKSGESQVGNACNIKDRWAL  317



>ref|XP_002315692.2| hypothetical protein POPTR_0010s05140g [Populus trichocarpa]
 gb|EEF01863.2| hypothetical protein POPTR_0010s05140g [Populus trichocarpa]
Length=341

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 119/152 (78%), Gaps = 4/152 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R+DHSMNFKQVKTGFMKRFEGCW+VEP+ VDE +C+P++P  LADY
Sbjct  169  WSGTISVHVLVDQNRQDHSMNFKQVKTGFMKRFEGCWKVEPIFVDEAICYPFKPKTLADY  228

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T+GKGRIGSKVSLEQLIQPA+VPPPPISWY+RGITT+TTEMI+NDL AE  RIR   
Sbjct  229  CSCTRGKGRIGSKVSLEQLIQPAIVPPPPISWYLRGITTRTTEMIVNDLVAEAGRIRVGF  288

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
              E             E Q +   NIKERWAL
Sbjct  289  DAEKCE----DWSLYDEKQPNKSSNIKERWAL  316



>ref|XP_007222563.1| hypothetical protein PRUPE_ppa008383mg [Prunus persica]
 gb|EMJ23762.1| hypothetical protein PRUPE_ppa008383mg [Prunus persica]
Length=334

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTI+VHVLVDQ REDHSM FKQVKTGFMKRFEGCWRVEPL VDE+ C P++P    DY
Sbjct  166  WSGTIAVHVLVDQNREDHSMKFKQVKTGFMKRFEGCWRVEPLFVDEKTCFPFKPKTWTDY  225

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T GKGRIGSKVSLEQLIQPA+VPPPPISWY+RGIT+KTTEM+INDL AE ARIR   
Sbjct  226  HSCTGGKGRIGSKVSLEQLIQPAIVPPPPISWYLRGITSKTTEMLINDLLAEAARIRGEL  285

Query  405  STEDL-RslglsgessgeSQTDSLCNIKERWAL  310
            + E   + L +S +    SQ D++ NIKERWAL
Sbjct  286  NPEKSNKELEMSQDQEILSQVDNVSNIKERWAL  318



>ref|XP_011011119.1| PREDICTED: uncharacterized protein LOC105115796 isoform X2 [Populus 
euphratica]
 ref|XP_011011120.1| PREDICTED: uncharacterized protein LOC105115796 isoform X2 [Populus 
euphratica]
 ref|XP_011011121.1| PREDICTED: uncharacterized protein LOC105115796 isoform X2 [Populus 
euphratica]
 ref|XP_011011122.1| PREDICTED: uncharacterized protein LOC105115796 isoform X2 [Populus 
euphratica]
Length=341

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 116/152 (76%), Gaps = 4/152 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHV VDQ R+DHSMNFKQVKTGFMKRFEGCW+VEP+ VDE +C+P++P  LA+Y
Sbjct  169  WSGTISVHVSVDQNRQDHSMNFKQVKTGFMKRFEGCWKVEPIFVDEAICYPFKPRTLAEY  228

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T GKGRIGSKVSL+QLIQPA+VPPPPISWY+RGITT+TTEMI+NDL AE  RIR   
Sbjct  229  CSCTGGKGRIGSKVSLDQLIQPAIVPPPPISWYLRGITTRTTEMIVNDLVAEAGRIRVGF  288

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
              E             E Q     NIKERWAL
Sbjct  289  DAEKCE----DRSMYDEKQPHKSSNIKERWAL  316



>ref|XP_010100449.1| hypothetical protein L484_027761 [Morus notabilis]
 gb|EXB82583.1| hypothetical protein L484_027761 [Morus notabilis]
Length=340

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTI+VHVLVDQ REDHSM FKQVKTGFMK+FEGCWRVEPL VDE+LC P +P + ++Y
Sbjct  174  WSGTIAVHVLVDQNREDHSMKFKQVKTGFMKKFEGCWRVEPLFVDEKLCFPLKPKSWSEY  233

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T GKGR+GSKVSLEQLIQPA+VPPPPISWY+RGITT+TTEM+INDL+AE ARIR   
Sbjct  234  CSCTGGKGRLGSKVSLEQLIQPAIVPPPPISWYLRGITTRTTEMLINDLRAEAARIRGDL  293

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
              E   +          S+ D++ +IK+RWAL
Sbjct  294  GPEK-SNKEFELSEDLLSEIDNVSDIKKRWAL  324



>ref|XP_011011117.1| PREDICTED: uncharacterized protein LOC105115796 isoform X1 [Populus 
euphratica]
Length=355

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 116/152 (76%), Gaps = 4/152 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHV VDQ R+DHSMNFKQVKTGFMKRFEGCW+VEP+ VDE +C+P++P  LA+Y
Sbjct  183  WSGTISVHVSVDQNRQDHSMNFKQVKTGFMKRFEGCWKVEPIFVDEAICYPFKPRTLAEY  242

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T GKGRIGSKVSL+QLIQPA+VPPPPISWY+RGITT+TTEMI+NDL AE  RIR   
Sbjct  243  CSCTGGKGRIGSKVSLDQLIQPAIVPPPPISWYLRGITTRTTEMIVNDLVAEAGRIRVGF  302

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
              E             E Q     NIKERWAL
Sbjct  303  DAEKCE----DRSMYDEKQPHKSSNIKERWAL  330



>ref|XP_002265077.1| PREDICTED: uncharacterized protein LOC100244891 [Vitis vinifera]
 emb|CBI28544.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHV+VDQ REDHSM F QVKTGFMKRFEGCWRV+P+ VDE+ C P++P    +Y
Sbjct  160  WSGTISVHVIVDQNREDHSMKFTQVKTGFMKRFEGCWRVKPVFVDEKSCFPFKPKTWDEY  219

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T GKGRIGSKVSLEQLIQPA+VPPPPISWY+RGIT++TTEM+INDL AE ARIR  S
Sbjct  220  YSCTGGKGRIGSKVSLEQLIQPAIVPPPPISWYLRGITSRTTEMLINDLLAEAARIRGIS  279

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
              +       S ++S E Q D +C+IKERWAL
Sbjct  280  EPKK-SVGEPSEQTSYEHQVDEVCDIKERWAL  310



>ref|XP_010023547.1| PREDICTED: uncharacterized protein LOC104414205 [Eucalyptus grandis]
 gb|KCW59846.1| hypothetical protein EUGRSUZ_H02587 [Eucalyptus grandis]
 gb|KCW59847.1| hypothetical protein EUGRSUZ_H02587 [Eucalyptus grandis]
Length=338

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQVKTGFMKRFEGCWRVEP  VDE+LC+P +P    DY
Sbjct  171  WSGTISVHVLVDQNRADHSMKFKQVKTGFMKRFEGCWRVEPWFVDEKLCYPLKPKTWEDY  230

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T GKGRIGSKVSL+QLIQPALVPPPPISWY+RGITT+TTEM+I DL AETAR+R   
Sbjct  231  NSCTGGKGRIGSKVSLDQLIQPALVPPPPISWYLRGITTRTTEMLITDLLAETARVRGGL  290

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
            +     +     +++ + Q +   +IKERWAL
Sbjct  291  NPVKSGNNHELSDNTLDKQLEETGDIKERWAL  322



>ref|XP_008444321.1| PREDICTED: uncharacterized protein LOC103487688 [Cucumis melo]
Length=337

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R D+SM FKQ+K GFMKRFEGCWRVEPL VDE +C P +P NL DY
Sbjct  167  WSGTISVHVLVDQNRADNSMTFKQLKAGFMKRFEGCWRVEPLFVDERMCFPVKPKNLGDY  226

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             + TKGKGR+GS+VSLEQLIQPA+VPPPPISWY+RGITT+TTEM+I DL AE  RIR   
Sbjct  227  HACTKGKGRVGSRVSLEQLIQPAIVPPPPISWYLRGITTRTTEMLILDLLAEAERIRGDV  286

Query  405  STEDLRslglsgessgeSQ-TDSLCNIKERWAL  310
              E L +     +   +S   D++ +IKERWA+
Sbjct  287  KGEVLNNDVEISQGMSDSNLLDNVLDIKERWAM  319



>ref|XP_004166540.1| PREDICTED: uncharacterized protein LOC101230152 [Cucumis sativus]
Length=337

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQ+  GFMKRFEGCWRVEPL VDE +C P +P NL DY
Sbjct  167  WSGTISVHVLVDQNRADHSMMFKQLNAGFMKRFEGCWRVEPLFVDERMCFPVKPKNLGDY  226

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             + TKGKGR+GS+VSLEQLI+PA+VPPPPISWY+RGITT+TTEM+I DL AE  RIR   
Sbjct  227  HACTKGKGRVGSRVSLEQLIEPAIVPPPPISWYLRGITTRTTEMLILDLLAEAERIRGDV  286

Query  405  STEDLRslglsgessgeSQ-TDSLCNIKERWAL  310
              E L +         +S   DS+ +IKERWA+
Sbjct  287  KGEVLNNELEISHEMSDSNLLDSVLDIKERWAM  319



>ref|XP_004143071.1| PREDICTED: uncharacterized protein LOC101212235 [Cucumis sativus]
 gb|KGN62288.1| hypothetical protein Csa_2G348260 [Cucumis sativus]
Length=337

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQ+  GFMKRFEGCWRVEPL VDE +C P +P NL DY
Sbjct  167  WSGTISVHVLVDQNRADHSMMFKQLNAGFMKRFEGCWRVEPLFVDERMCFPVKPKNLGDY  226

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             + TKGKGR+GS+VSLEQLI+PA+VPPPPISWY+RGITT+TTEM+I DL AE  RIR   
Sbjct  227  HACTKGKGRVGSRVSLEQLIEPAIVPPPPISWYLRGITTRTTEMLILDLLAEAERIRGDV  286

Query  405  STEDLRslglsgessgeSQ-TDSLCNIKERWAL  310
              E L +         +S   DS+ +IKERWA+
Sbjct  287  KGEVLNNELEISHEMSDSNLLDSVLDIKERWAM  319



>ref|XP_002525367.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37005.1| conserved hypothetical protein [Ricinus communis]
Length=329

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 116/151 (77%), Gaps = 5/151 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R+D +M FKQVKTGFMK+FEGCWRVEP+ +D+++C+P++P   ADY
Sbjct  164  WSGTISVHVLVDQNRKDLTMKFKQVKTGFMKQFEGCWRVEPVFIDQDICYPFKPKTWADY  223

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T GKGRIGSKVSLEQLIQPALVPPPPISWY+RGITT+TTEMI NDL AE ARIR   
Sbjct  224  CWCTGGKGRIGSKVSLEQLIQPALVPPPPISWYLRGITTRTTEMIANDLLAEAARIR---  280

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWA  313
               D  +   S  S    + D   +IKERWA
Sbjct  281  --GDFNNNADSETSQNSYRIDKSSDIKERWA  309



>emb|CDP00160.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ REDHSM FKQ+KTGFMKRFEG W+VEP+LVDE+LCH   P  L +Y
Sbjct  147  WSGTISVHVLVDQNREDHSMKFKQIKTGFMKRFEGHWKVEPILVDEQLCHSVGPKTLEEY  206

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S TKGKGRI S+VSL+QLIQPA+VPPPP SWY+RGIT KTTEMIINDL AE ARI+  S
Sbjct  207  DSCTKGKGRIASEVSLDQLIQPAIVPPPPFSWYLRGITAKTTEMIINDLVAEAARIKGFS  266

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
            +TE  +    S E S +    S  +IKERWAL
Sbjct  267  TTEFSQVPLGSSEGSFDEGMLSY-DIKERWAL  297



>gb|KDO82400.1| hypothetical protein CISIN_1g040266mg, partial [Citrus sinensis]
Length=238

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 117/152 (77%), Gaps = 2/152 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSG + VHVLVDQ R DHSM FKQVKTGFMKRFEGCW +EPL VDE+LC P++P    DY
Sbjct  71   WSGVMLVHVLVDQDRRDHSMKFKQVKTGFMKRFEGCWVIEPLFVDEKLCFPFQPKTCEDY  130

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T+GKGRI S VSLEQLIQPA+VPPPPISWY+RGIT +TTEM+I+DL AE+ARIR   
Sbjct  131  HSCTRGKGRIASTVSLEQLIQPAIVPPPPISWYLRGITARTTEMLIHDLLAESARIR--G  188

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
            S +  +SL +  ES    Q D + +IKERWA 
Sbjct  189  SFDPGKSLEVHQESKDLHQIDQISDIKERWAF  220



>gb|EPS62234.1| hypothetical protein M569_12558, partial [Genlisea aurea]
Length=262

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 122/150 (81%), Gaps = 2/150 (1%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADYV  583
            SGT+S++VLVDQ RED++M FKQVK+GFM++FEGCW++EPL VD +LCHP++PN+L +YV
Sbjct  98   SGTLSINVLVDQNREDYTMKFKQVKSGFMEKFEGCWKMEPLFVDADLCHPFKPNSLTEYV  157

Query  582  SYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSSS  403
            S +KG+GRI +K+ LEQLIQP+ +PP PISWY+RGITTKTTEM+I+DL AE ARIR+ +S
Sbjct  158  SCSKGRGRIATKLHLEQLIQPSFLPPAPISWYLRGITTKTTEMLISDLLAEAARIRQHAS  217

Query  402  TEDLRslglsgessgeSQTDSLCNIKERWA  313
              +L    L  E S  SQT   C IKERWA
Sbjct  218  KSEL--SPLPDEQSSASQTTEACAIKERWA  245



>ref|XP_007153742.1| hypothetical protein PHAVU_003G061200g [Phaseolus vulgaris]
 gb|ESW25736.1| hypothetical protein PHAVU_003G061200g [Phaseolus vulgaris]
Length=335

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 116/157 (74%), Gaps = 9/157 (6%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTIS++VLVDQ R+DHSM F Q KTGFMK+FEGCWRVEPL VDE +CHP++P    DY
Sbjct  167  WSGTISINVLVDQNRKDHSMKFTQTKTGFMKKFEGCWRVEPLFVDEAICHPFKPMTKEDY  226

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIR---  415
               T+GKGRIGSKVSLEQ++QPA+VPPPPISWY+RGIT +TTEM+IND+ AETARIR   
Sbjct  227  NVCTRGKGRIGSKVSLEQILQPAIVPPPPISWYLRGITARTTEMLINDMLAETARIRGGY  286

Query  414  --RSSSTEDLRslglsgessgeSQTDSLCNIKERWAL  310
                S T++L+           +  D    IKERW L
Sbjct  287  EAEKSKTQELQGNPAENVDLVANSND----IKERWIL  319



>ref|XP_006438371.1| hypothetical protein CICLE_v10032036mg [Citrus clementina]
 gb|ESR51611.1| hypothetical protein CICLE_v10032036mg [Citrus clementina]
Length=278

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 116/152 (76%), Gaps = 2/152 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSG + VHVLVDQ R DHSM FKQVKTGFMKRFEGCW +EPL VDE+LC P++P    DY
Sbjct  111  WSGVMLVHVLVDQDRRDHSMKFKQVKTGFMKRFEGCWVIEPLFVDEKLCFPFQPKTCEDY  170

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T+GKGRI S VSLEQLIQPA+VPPPPISWY+RGIT +TTEM+I+DL AE ARIR   
Sbjct  171  HSCTRGKGRIASTVSLEQLIQPAIVPPPPISWYLRGITARTTEMLIHDLLAEAARIR--G  228

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
            S +  +SL +  ES    Q D + +IKERWA 
Sbjct  229  SFDPGKSLEVHQESKDLHQIDQISDIKERWAF  260



>ref|XP_006483871.1| PREDICTED: uncharacterized protein LOC102618931 isoform X1 [Citrus 
sinensis]
 ref|XP_006483872.1| PREDICTED: uncharacterized protein LOC102618931 isoform X2 [Citrus 
sinensis]
 ref|XP_006483873.1| PREDICTED: uncharacterized protein LOC102618931 isoform X3 [Citrus 
sinensis]
Length=338

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 117/152 (77%), Gaps = 2/152 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSG + VHVLVDQ R DHSM FKQVKTGFMKRFEGCW +EPL VDE+LC P++P    DY
Sbjct  171  WSGVMLVHVLVDQDRRDHSMKFKQVKTGFMKRFEGCWVIEPLFVDEKLCFPFQPKTCEDY  230

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T+GKGRI S VSLEQLIQPA+VPPPPISWY+RGIT +TTEM+I+DL AE+ARIR   
Sbjct  231  HSCTRGKGRIASTVSLEQLIQPAIVPPPPISWYLRGITARTTEMLIHDLLAESARIR--G  288

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
            S +  +SL +  ES    Q D + +IKERWA 
Sbjct  289  SFDPGKSLEVHQESKDLHQIDQISDIKERWAF  320



>gb|KHG03137.1| hypothetical protein F383_26743 [Gossypium arboreum]
Length=343

 Score =   201 bits (512),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 116/152 (76%), Gaps = 5/152 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ RED+SM FKQV  GFMK+FEG WRVEPL +DEE C P++P   A+Y
Sbjct  177  WSGTISVHVLVDQNREDYSMKFKQVDAGFMKKFEGHWRVEPLFIDEETCFPFKPKTWAEY  236

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T GKGRIGSKVSL+QLIQPA+VPPPPISWY+RGIT+KTTEM+INDL AE AR++   
Sbjct  237  CSCTGGKGRIGSKVSLDQLIQPAIVPPPPISWYLRGITSKTTEMLINDLLAEAARLKGGF  296

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
              E+        E + + Q + + +IKERW L
Sbjct  297  DAEN-----SVNEINEQHQVEQINDIKERWNL  323



>ref|XP_006438370.1| hypothetical protein CICLE_v10032036mg [Citrus clementina]
 gb|ESR51610.1| hypothetical protein CICLE_v10032036mg [Citrus clementina]
Length=338

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 116/152 (76%), Gaps = 2/152 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSG + VHVLVDQ R DHSM FKQVKTGFMKRFEGCW +EPL VDE+LC P++P    DY
Sbjct  171  WSGVMLVHVLVDQDRRDHSMKFKQVKTGFMKRFEGCWVIEPLFVDEKLCFPFQPKTCEDY  230

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T+GKGRI S VSLEQLIQPA+VPPPPISWY+RGIT +TTEM+I+DL AE ARIR   
Sbjct  231  HSCTRGKGRIASTVSLEQLIQPAIVPPPPISWYLRGITARTTEMLIHDLLAEAARIR--G  288

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
            S +  +SL +  ES    Q D + +IKERWA 
Sbjct  289  SFDPGKSLEVHQESKDLHQIDQISDIKERWAF  320



>ref|XP_004509756.1| PREDICTED: uncharacterized protein LOC101489238 [Cicer arietinum]
Length=335

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTIS++VLVDQ R D+SM FKQ KTGFMK+FEGCWRVEPL VDE  C+P++P    DY
Sbjct  171  WSGTISINVLVDQNRNDYSMKFKQTKTGFMKKFEGCWRVEPLFVDEATCYPFKPKTKEDY  230

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T+GKGRIG KV L+Q++QPA+VPPPPISWY+RGITT+TTEM+INDL AETARIR   
Sbjct  231  NKCTRGKGRIGPKVPLQQILQPAIVPPPPISWYLRGITTRTTEMLINDLLAETARIRGGY  290

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
              E  +               +  NIKERW L
Sbjct  291  EDEKSKEEIQGKHGKNLDMAANTNNIKERWIL  322



>gb|KJB50220.1| hypothetical protein B456_008G159400 [Gossypium raimondii]
 gb|KJB50221.1| hypothetical protein B456_008G159400 [Gossypium raimondii]
Length=343

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 116/152 (76%), Gaps = 5/152 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ  ED+SM FKQV  GFMK+FEG WRVEPL VDEE C P++P   A+Y
Sbjct  177  WSGTISVHVLVDQNGEDNSMKFKQVDAGFMKKFEGHWRVEPLFVDEETCFPFKPKTWAEY  236

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T GKGRIGSKVSL+QLIQPA+VPPPPISWY+RGIT+KTTEM+INDL AE AR++ S 
Sbjct  237  CSCTGGKGRIGSKVSLDQLIQPAIVPPPPISWYLRGITSKTTEMLINDLLAEAARLKGSF  296

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
              E+        E + + Q + + +IKERW L
Sbjct  297  DAEN-----SVNEINEQHQVEQINDIKERWNL  323



>gb|KDP26597.1| hypothetical protein JCGZ_17755 [Jatropha curcas]
Length=322

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 121/155 (78%), Gaps = 5/155 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R+D +M FKQVKTGFM++FEGCWRVEP+ VDE++C+P++P   A+Y
Sbjct  154  WSGTISVHVLVDQNRKDLTMKFKQVKTGFMEKFEGCWRVEPVFVDEDICYPFKPKTWAEY  213

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T+GKGRIGSKVSLEQLIQP +VPPPPISWY+RGIT++TTEMI+ DL AE ARIR   
Sbjct  214  HSCTRGKGRIGSKVSLEQLIQPTIVPPPPISWYLRGITSRTTEMIVYDLLAEAARIRGDL  273

Query  405  ST---EDLRslglsgessgeSQTDSLCNIKERWAL  310
            +T   E+L +   S +        S  +IKERWA+
Sbjct  274  NTVRSEELETSHNSNDECRSGAKSS--DIKERWAM  306



>gb|KHN25530.1| hypothetical protein glysoja_043966 [Glycine soja]
Length=330

 Score =   199 bits (506),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 116/157 (74%), Gaps = 9/157 (6%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTIS++VLVDQ R+DHSM FKQ K GFMK+FEGCWRVEPL VDE +CHP++P    DY
Sbjct  163  WSGTISINVLVDQNRKDHSMKFKQTKAGFMKKFEGCWRVEPLFVDEAMCHPFKPVTKEDY  222

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIR---  415
             + T+GKGRIGSKVSLEQ++QP++VPPPP+SWY+RGIT +TTEM+IND+ AETARIR   
Sbjct  223  NACTRGKGRIGSKVSLEQILQPSIVPPPPLSWYLRGITARTTEMLINDMLAETARIRGGY  282

Query  414  --RSSSTEDLRslglsgessgeSQTDSLCNIKERWAL  310
                S  E+L+           + +D    IKE W L
Sbjct  283  EAEKSKAEELQVKPGENVDLVSNTSD----IKESWKL  315



>gb|KHN26884.1| hypothetical protein glysoja_035523 [Glycine soja]
Length=334

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 115/157 (73%), Gaps = 9/157 (6%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTIS++VLVDQ R+DHSM FKQ K GFMK+FEGCWRVEPL VDE +CHP++P    DY
Sbjct  167  WSGTISINVLVDQNRKDHSMKFKQTKAGFMKKFEGCWRVEPLFVDEAMCHPFKPVTKEDY  226

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIR---  415
             +  +GKGRIGSKVSL+Q +QP++VPPPP+SWY+RGIT +TTEM+IND+ AETARIR   
Sbjct  227  YACARGKGRIGSKVSLKQTLQPSIVPPPPLSWYLRGITARTTEMLINDMLAETARIRGGY  286

Query  414  --RSSSTEDLRslglsgessgeSQTDSLCNIKERWAL  310
                S  E+L+           + +D    IKERW L
Sbjct  287  EAEKSKAEELQGKPGENVGLVSNTSD----IKERWKL  319



>ref|XP_003532005.1| PREDICTED: uncharacterized protein LOC100808684 isoform X1 [Glycine 
max]
Length=334

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 115/157 (73%), Gaps = 9/157 (6%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTIS++VLVDQ R+DHSM FKQ K GFMK+FEGCWRVEPL VDE +CHP++P    DY
Sbjct  167  WSGTISINVLVDQNRKDHSMKFKQTKAGFMKKFEGCWRVEPLFVDEAMCHPFKPVTKEDY  226

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIR---  415
             +  +GKGRIGSKVSL+Q +QP++VPPPP+SWY+RGIT +TTEM+IND+ AETARIR   
Sbjct  227  YACARGKGRIGSKVSLKQTLQPSIVPPPPLSWYLRGITARTTEMLINDMLAETARIRGGY  286

Query  414  --RSSSTEDLRslglsgessgeSQTDSLCNIKERWAL  310
                S  E+L+           + +D    IKERW L
Sbjct  287  EAEKSKAEELQGKPGENVDLVSNTSD----IKERWKL  319



>gb|KJB15572.1| hypothetical protein B456_002G185100 [Gossypium raimondii]
Length=285

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 117/155 (75%), Gaps = 3/155 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISV VLVDQ REDHSM F+QV TGFMK+FEG WR+EP+ VDEE C P++P  LA+Y
Sbjct  116  WSGTISVRVLVDQNREDHSMKFEQVNTGFMKKFEGQWRIEPVFVDEETCFPFKPKTLAEY  175

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARI---R  415
             S + GKGRIGSKVSL+QL+QPA+VPPPPISWY+RGIT KTTEM+I+DL AE  R+   R
Sbjct  176  CSCSGGKGRIGSKVSLDQLVQPAIVPPPPISWYLRGITAKTTEMLIHDLVAEADRLTGGR  235

Query  414  RSSSTEDLRslglsgessgeSQTDSLCNIKERWAL  310
            +S S    +   LS E +       + NIK+RW+L
Sbjct  236  QSDSKTSSKEFRLSKELNEYDPVKQIFNIKQRWSL  270



>ref|XP_010251230.1| PREDICTED: uncharacterized protein LOC104593182 [Nelumbo nucifera]
 ref|XP_010251234.1| PREDICTED: uncharacterized protein LOC104593182 [Nelumbo nucifera]
Length=341

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHV+VDQ R+DHS+ FKQ KTGFMKRFEGCW ++PLLVDE+ C P++P  LA+Y
Sbjct  171  WSGTISVHVIVDQNRKDHSVKFKQGKTGFMKRFEGCWTLQPLLVDEKSCFPFKPKTLAEY  230

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T GKGR+GS VSLEQL+QP+LVPPPPISWY+RGIT +TTEM+I DLQ E ARIR   
Sbjct  231  NSCTGGKGRVGSIVSLEQLVQPSLVPPPPISWYLRGITARTTEMLITDLQEEAARIRGDP  290

Query  405  STEDLRslglsgessgeSQT-DSLCNIKERWA  313
                         ++ +  T D+L ++KERWA
Sbjct  291  DKAKCSQQVDFSPAATDLHTVDALRDVKERWA  322



>ref|XP_003552022.1| PREDICTED: uncharacterized protein LOC100781672 isoform X1 [Glycine 
max]
Length=330

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 115/157 (73%), Gaps = 9/157 (6%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTIS++VLVDQ R+DHSM F Q K GFMK+FEGCWRVEPL VDE +CHP++P    DY
Sbjct  163  WSGTISINVLVDQNRKDHSMKFMQTKAGFMKKFEGCWRVEPLFVDEAMCHPFKPVTKEDY  222

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIR---  415
             + T+GKGRIGSKVSLEQ++QP++VPPPP+SWY+RGIT +TTEM+IND+ AETARIR   
Sbjct  223  NACTRGKGRIGSKVSLEQILQPSIVPPPPLSWYLRGITARTTEMLINDMLAETARIRGGY  282

Query  414  --RSSSTEDLRslglsgessgeSQTDSLCNIKERWAL  310
                S  E+L+           + +D    IKE W L
Sbjct  283  EAEKSKAEELQVKPGENVDLVSNTSD----IKESWKL  315



>gb|KJB15570.1| hypothetical protein B456_002G185100 [Gossypium raimondii]
Length=326

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 117/155 (75%), Gaps = 3/155 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISV VLVDQ REDHSM F+QV TGFMK+FEG WR+EP+ VDEE C P++P  LA+Y
Sbjct  157  WSGTISVRVLVDQNREDHSMKFEQVNTGFMKKFEGQWRIEPVFVDEETCFPFKPKTLAEY  216

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARI---R  415
             S + GKGRIGSKVSL+QL+QPA+VPPPPISWY+RGIT KTTEM+I+DL AE  R+   R
Sbjct  217  CSCSGGKGRIGSKVSLDQLVQPAIVPPPPISWYLRGITAKTTEMLIHDLVAEADRLTGGR  276

Query  414  RSSSTEDLRslglsgessgeSQTDSLCNIKERWAL  310
            +S S    +   LS E +       + NIK+RW+L
Sbjct  277  QSDSKTSSKEFRLSKELNEYDPVKQIFNIKQRWSL  311



>gb|KJB15571.1| hypothetical protein B456_002G185100 [Gossypium raimondii]
Length=332

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 117/155 (75%), Gaps = 3/155 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISV VLVDQ REDHSM F+QV TGFMK+FEG WR+EP+ VDEE C P++P  LA+Y
Sbjct  163  WSGTISVRVLVDQNREDHSMKFEQVNTGFMKKFEGQWRIEPVFVDEETCFPFKPKTLAEY  222

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARI---R  415
             S + GKGRIGSKVSL+QL+QPA+VPPPPISWY+RGIT KTTEM+I+DL AE  R+   R
Sbjct  223  CSCSGGKGRIGSKVSLDQLVQPAIVPPPPISWYLRGITAKTTEMLIHDLVAEADRLTGGR  282

Query  414  RSSSTEDLRslglsgessgeSQTDSLCNIKERWAL  310
            +S S    +   LS E +       + NIK+RW+L
Sbjct  283  QSDSKTSSKEFRLSKELNEYDPVKQIFNIKQRWSL  317



>ref|XP_006300944.1| hypothetical protein CARUB_v10021325mg [Capsella rubella]
 gb|EOA33842.1| hypothetical protein CARUB_v10021325mg [Capsella rubella]
Length=320

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 115/151 (76%), Gaps = 7/151 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQVK+GFMKRFEG W+V+PL VDE +C   +P  L +Y
Sbjct  163  WSGTISVHVLVDQNRADHSMKFKQVKSGFMKRFEGSWQVKPLFVDEHMCDRLKPKTLDEY  222

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T GKGRIGSKV+L+QLIQPA+VPPPPISWY+RGIT KTTEM+I DL AETARIR + 
Sbjct  223  NRCTGGKGRIGSKVTLDQLIQPAIVPPPPISWYLRGITAKTTEMLIYDLLAETARIRAAG  282

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWA  313
              ED       G SS E +T +  +IKERWA
Sbjct  283  EMED-------GHSSDEQRTGTSGDIKERWA  306



>gb|KEH20028.1| OBP32pep, putative [Medicago truncatula]
Length=337

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTIS++VLVDQ R D+SM FKQ KTGFMK+FEGCWRVEPL VDE  C+P++P    DY
Sbjct  171  WSGTISINVLVDQNRNDYSMKFKQTKTGFMKKFEGCWRVEPLFVDEATCYPFKPVTKEDY  230

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T+GKGRIGSKV L+Q++QPA+VPPPPISWY+RGIT+KTTEM+I DL AET RIR   
Sbjct  231  NMCTRGKGRIGSKVRLQQILQPAIVPPPPISWYLRGITSKTTEMLITDLLAETTRIRGGY  290

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
              E  +               +  NIKERW L
Sbjct  291  EAEKSKEEIQGKHGENLDLIANTNNIKERWIL  322



>gb|EYU31258.1| hypothetical protein MIMGU_mgv1a009978mg [Erythranthe guttata]
Length=325

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 116/152 (76%), Gaps = 4/152 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISV+VLVDQ R+D++M FKQ+K+GFM++FEG W++EPL VDEE+C   +P +L +Y
Sbjct  162  WSGTISVNVLVDQNRDDYTMKFKQIKSGFMEKFEGSWKMEPLFVDEEMCGAIKPKSLKEY  221

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            VS T GKGRIGSK+ LEQLIQPA+V PPPISWY+RGITTKTTEM+INDL AETARIR+ S
Sbjct  222  VSCTNGKGRIGSKLRLEQLIQPAIVVPPPISWYLRGITTKTTEMLINDLLAETARIRKYS  281

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
                         S  E +     NIKERWA+
Sbjct  282  GG----GGRTDVISGEEEEEGDAYNIKERWAV  309



>gb|KEH20027.1| OBP32pep, putative [Medicago truncatula]
Length=374

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTIS++VLVDQ R D+SM FKQ KTGFMK+FEGCWRVEPL VDE  C+P++P    DY
Sbjct  208  WSGTISINVLVDQNRNDYSMKFKQTKTGFMKKFEGCWRVEPLFVDEATCYPFKPVTKEDY  267

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T+GKGRIGSKV L+Q++QPA+VPPPPISWY+RGIT+KTTEM+I DL AET RIR   
Sbjct  268  NMCTRGKGRIGSKVRLQQILQPAIVPPPPISWYLRGITSKTTEMLITDLLAETTRIRGGY  327

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
              E  +               +  NIKERW L
Sbjct  328  EAEKSKEEIQGKHGENLDLIANTNNIKERWIL  359



>gb|KEH20026.1| OBP32pep, putative [Medicago truncatula]
Length=386

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTIS++VLVDQ R D+SM FKQ KTGFMK+FEGCWRVEPL VDE  C+P++P    DY
Sbjct  220  WSGTISINVLVDQNRNDYSMKFKQTKTGFMKKFEGCWRVEPLFVDEATCYPFKPVTKEDY  279

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T+GKGRIGSKV L+Q++QPA+VPPPPISWY+RGIT+KTTEM+I DL AET RIR   
Sbjct  280  NMCTRGKGRIGSKVRLQQILQPAIVPPPPISWYLRGITSKTTEMLITDLLAETTRIRGGY  339

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
              E  +               +  NIKERW L
Sbjct  340  EAEKSKEEIQGKHGENLDLIANTNNIKERWIL  371



>emb|CDY11589.1| BnaC06g31500D [Brassica napus]
Length=318

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 114/151 (75%), Gaps = 4/151 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQVK+GFMKRFEG W+V+PL VDE +C   +P  L +Y
Sbjct  158  WSGTISVHVLVDQNRADHSMKFKQVKSGFMKRFEGNWKVKPLFVDEHMCDRLKPKTLEEY  217

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T GKGR+GSKV+L+QLIQPA+VPPPPISWY+RGIT KTTEM+I+DL AETA+IR+  
Sbjct  218  EQCTGGKGRVGSKVTLDQLIQPAIVPPPPISWYLRGITAKTTEMLIHDLLAETAKIRKRL  277

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWA  313
            +T +         S  E Q  +  +IKERWA
Sbjct  278  ATGE----TDDSHSLDEQQIVNPGDIKERWA  304



>emb|CDY47136.1| BnaA08g05470D [Brassica napus]
Length=320

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 112/151 (74%), Gaps = 4/151 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQVK+GFMKRFEG W+V+PL VDE +C   +P  L +Y
Sbjct  160  WSGTISVHVLVDQNRADHSMKFKQVKSGFMKRFEGNWKVKPLFVDEHMCDRLKPKTLEEY  219

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T GKGR+GSKV+L+QLIQPA+VPPPPISWY+RGIT KTTEM+I+DL AETA+IR+  
Sbjct  220  EQCTGGKGRVGSKVTLDQLIQPAIVPPPPISWYLRGITAKTTEMLIHDLLAETAKIRKRL  279

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWA  313
            +T +        E    +  D    IKERWA
Sbjct  280  ATGETDDSQSLDEQMIVNPGD----IKERWA  306



>ref|NP_564989.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG52482.1|AC010796_21 unknown protein; 12217-13521 [Arabidopsis thaliana]
 gb|AAK96834.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10118.1| unknown protein [Arabidopsis thaliana]
 gb|AEE35066.1| uncharacterized protein AT1G70480 [Arabidopsis thaliana]
Length=320

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 114/151 (75%), Gaps = 7/151 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQVK+GFMKRFEG W+V+PL VDE +C   +P  L +Y
Sbjct  163  WSGTISVHVLVDQDRADHSMKFKQVKSGFMKRFEGSWQVKPLFVDEHMCDRLKPKTLEEY  222

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T GKGRIGSKV+L+QLIQPA+VPPPPISWY+RGIT KTTEM+I+DL AETARIR + 
Sbjct  223  NRCTGGKGRIGSKVTLDQLIQPAIVPPPPISWYLRGITAKTTEMLIHDLLAETARIRAAG  282

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWA  313
              ED       G S  E +  +  +IKERW+
Sbjct  283  VMED-------GHSPDEQRIGTPGDIKERWS  306



>gb|AAM64384.1| unknown [Arabidopsis thaliana]
Length=320

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 114/151 (75%), Gaps = 7/151 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQVK+GFMKRFEG W+V+PL VDE +C   +P  L +Y
Sbjct  163  WSGTISVHVLVDQDRADHSMKFKQVKSGFMKRFEGSWQVKPLFVDEHMCDRLKPKTLEEY  222

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T GKGRIGSKV+L+QLIQPA+VPPPPISWY+RGIT KTTEM+I+DL AETARIR + 
Sbjct  223  NRCTGGKGRIGSKVTLDQLIQPAIVPPPPISWYLRGITAKTTEMLIHDLLAETARIRAAG  282

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWA  313
              ED       G S  E +  +  +IKERW+
Sbjct  283  VMED-------GHSPDEQRIGTPGDIKERWS  306



>ref|XP_010415726.1| PREDICTED: uncharacterized protein LOC104701686 [Camelina sativa]
 ref|XP_010415727.1| PREDICTED: uncharacterized protein LOC104701686 [Camelina sativa]
Length=320

 Score =   191 bits (485),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 112/151 (74%), Gaps = 7/151 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQVK+GFMKRFEG W+V+PL VDE +C   +P  L +Y
Sbjct  163  WSGTISVHVLVDQNRADHSMKFKQVKSGFMKRFEGSWQVKPLFVDEHMCDRLKPKTLDEY  222

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T GKGRIGSKV+L+QLIQPA+VPPPPISWY+RGIT KTTEM+I DL AET RIR + 
Sbjct  223  NRCTGGKGRIGSKVTLDQLIQPAIVPPPPISWYLRGITAKTTEMLIYDLLAETTRIRAAG  282

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWA  313
              ED       G S  E +  +  +IKERWA
Sbjct  283  EMED-------GHSPDEQRIGTSGDIKERWA  306



>ref|XP_009105709.1| PREDICTED: uncharacterized protein LOC103831578 isoform X1 [Brassica 
rapa]
 ref|XP_009105710.1| PREDICTED: uncharacterized protein LOC103831578 isoform X2 [Brassica 
rapa]
Length=320

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 112/151 (74%), Gaps = 4/151 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQVK+GFMKRFEG W+V+PL VDE +C   +P  L +Y
Sbjct  160  WSGTISVHVLVDQNRADHSMRFKQVKSGFMKRFEGNWKVKPLFVDEHMCDRLKPKTLEEY  219

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T GKGR+GSKV+L+QLIQPA+VPPPPISWY+RGIT KTTEM+I+DL AETA+IR+  
Sbjct  220  EQCTGGKGRVGSKVTLDQLIQPAIVPPPPISWYLRGITAKTTEMLIHDLLAETAKIRKRL  279

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWA  313
            +T +        E    +  D    IKERWA
Sbjct  280  ATGETDDSPSLDEQRIVNPGD----IKERWA  306



>ref|NP_001031261.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE35067.1| uncharacterized protein AT1G70480 [Arabidopsis thaliana]
Length=338

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 114/151 (75%), Gaps = 7/151 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQVK+GFMKRFEG W+V+PL VDE +C   +P  L +Y
Sbjct  181  WSGTISVHVLVDQDRADHSMKFKQVKSGFMKRFEGSWQVKPLFVDEHMCDRLKPKTLEEY  240

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T GKGRIGSKV+L+QLIQPA+VPPPPISWY+RGIT KTTEM+I+DL AETARIR + 
Sbjct  241  NRCTGGKGRIGSKVTLDQLIQPAIVPPPPISWYLRGITAKTTEMLIHDLLAETARIRAAG  300

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWA  313
              ED       G S  E +  +  +IKERW+
Sbjct  301  VMED-------GHSPDEQRIGTPGDIKERWS  324



>ref|XP_010427823.1| PREDICTED: uncharacterized protein LOC104712594 [Camelina sativa]
 ref|XP_010427824.1| PREDICTED: uncharacterized protein LOC104712594 [Camelina sativa]
 ref|XP_010427825.1| PREDICTED: uncharacterized protein LOC104712594 [Camelina sativa]
Length=320

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQVK+GFMKRFEG W+V+PL VDE +C   +P  L +Y
Sbjct  163  WSGTISVHVLVDQNRADHSMKFKQVKSGFMKRFEGSWQVKPLFVDEHMCDRLKPKTLDEY  222

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T GKGRIGSKV+L+QLIQPA+VPPPPISWY+RGIT KTTEM+I DL AET RIR + 
Sbjct  223  NRCTGGKGRIGSKVTLDQLIQPAIVPPPPISWYLRGITAKTTEMLIYDLLAETTRIRAAG  282

Query  405  STED  394
              ED
Sbjct  283  EMED  286



>ref|XP_002887303.1| hypothetical protein ARALYDRAFT_894859 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63562.1| hypothetical protein ARALYDRAFT_894859 [Arabidopsis lyrata subsp. 
lyrata]
Length=320

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQVK+GFMKRFEG W+V+PL VDE +C   +   L +Y
Sbjct  163  WSGTISVHVLVDQNRADHSMKFKQVKSGFMKRFEGSWQVKPLFVDEHMCDRMKLKTLEEY  222

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T GKGRIGSKV+L+QLIQPA+VPPPPISWY+RGIT KTTEM+I+DL AETARIR + 
Sbjct  223  NRCTGGKGRIGSKVTLDQLIQPAIVPPPPISWYLRGITAKTTEMLIHDLLAETARIRAAG  282

Query  405  STED  394
              ED
Sbjct  283  EMED  286



>ref|XP_009394240.1| PREDICTED: uncharacterized protein LOC103979763 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394241.1| PREDICTED: uncharacterized protein LOC103979763 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394242.1| PREDICTED: uncharacterized protein LOC103979763 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394243.1| PREDICTED: uncharacterized protein LOC103979763 [Musa acuminata 
subsp. malaccensis]
Length=338

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHV+VDQ R+DH++ F+Q ++GFMKRFEGCW+VEPL VDE LC P++P    +Y
Sbjct  169  WSGTISVHVIVDQNRKDHTVKFQQGRSGFMKRFEGCWKVEPLFVDEHLCQPFKPRTWDNY  228

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             + T+GKGR+GS VSL+QLIQP+LVPPPPISWY+RGITT+TTEM+I+DL AE AR+R + 
Sbjct  229  NTCTQGKGRVGSIVSLDQLIQPSLVPPPPISWYLRGITTRTTEMLISDLIAEAARLRGAV  288

Query  405  STEDLR  388
            S  + R
Sbjct  289  SRAEAR  294



>ref|XP_011463200.1| PREDICTED: uncharacterized protein LOC101307881 [Fragaria vesca 
subsp. vesca]
Length=332

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTI+VHVLVDQ REDHSM FKQVKTGFM+RFEGCW VEPL VDE+ C P++P   ADY
Sbjct  166  WSGTIAVHVLVDQNREDHSMKFKQVKTGFMERFEGCWTVEPLFVDEKSCLPFKPTTWADY  225

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S+T GKGRIGSKVSL+QLIQP++VPPPPISWY+RGIT KTTEM+INDL AE ARIR   
Sbjct  226  NSHTGGKGRIGSKVSLDQLIQPSIVPPPPISWYLRGITAKTTEMLINDLLAEAARIRGEL  285

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
            + E      +        Q D   NIKERWA+
Sbjct  286  NPEK-SGEEVEMSEEVLGQVDKTFNIKERWAM  316



>ref|XP_010471039.1| PREDICTED: uncharacterized protein LOC104750885 [Camelina sativa]
 ref|XP_010471040.1| PREDICTED: uncharacterized protein LOC104750885 [Camelina sativa]
 ref|XP_010471041.1| PREDICTED: uncharacterized protein LOC104750885 [Camelina sativa]
 ref|XP_010471042.1| PREDICTED: uncharacterized protein LOC104750885 [Camelina sativa]
Length=320

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 110/151 (73%), Gaps = 7/151 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQVK+GFMKRFEG W+V+PL VDE +C   +P  L +Y
Sbjct  163  WSGTISVHVLVDQNRADHSMKFKQVKSGFMKRFEGSWQVKPLFVDEHMCDRLKPKTLDEY  222

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T  KGRIGSKV+L+QLIQPA+VPPPPISWY+RGIT KTTEM+I DL AET RIR + 
Sbjct  223  NRCTGCKGRIGSKVTLDQLIQPAIVPPPPISWYLRGITAKTTEMLIYDLLAETTRIRAAG  282

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWA  313
              ED       G S  E +  +   IKERWA
Sbjct  283  EMED-------GHSPDEQRIGTSGGIKERWA  306



>gb|AAA79703.1| OBP32pep, partial [Arabidopsis thaliana]
Length=255

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQVK+GFMKRFEG W+V+PL VDE +C   +P  L +Y
Sbjct  136  WSGTISVHVLVDQDRADHSMKFKQVKSGFMKRFEGSWQVKPLFVDEHMCDRLKPKTLEEY  195

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETAR  421
               T GKGRIGSKV+L+QLIQPA+VPPPPISWY+RGIT KTTEM+I+DL AETAR
Sbjct  196  NRCTGGKGRIGSKVTLDQLIQPAIVPPPPISWYLRGITAKTTEMLIHDLLAETAR  250



>ref|XP_006661122.1| PREDICTED: uncharacterized protein LOC102713573 [Oryza brachyantha]
Length=339

 Score =   183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 109/152 (72%), Gaps = 1/152 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSG +SVHV VDQ R +H++ FKQ + GFMK+FEGCW++EPL VD+E+CHP  P  L +Y
Sbjct  170  WSGVLSVHVFVDQNRRNHTVKFKQGRAGFMKKFEGCWKIEPLFVDKEVCHPLDPCTLEEY  229

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T G GR+GS ++L+QLI+P+++PPPPISWY+RGITT+TTEM++NDL AETAR+R  +
Sbjct  230  NSCTNGTGRVGSSITLDQLIEPSMLPPPPISWYLRGITTRTTEMLVNDLIAETARLRGLA  289

Query  405  STEDLRslglsgessgeSQTDSLCN-IKERWA  313
            ++ D                   CN +KERW 
Sbjct  290  NSADDEQDSEGKCDIDRDHLSEECNDVKERWC  321



>ref|XP_008353017.1| PREDICTED: uncharacterized protein LOC103416549 isoform X1 [Malus 
domestica]
 ref|XP_008353018.1| PREDICTED: uncharacterized protein LOC103416549 isoform X1 [Malus 
domestica]
 ref|XP_008353019.1| PREDICTED: uncharacterized protein LOC103416549 isoform X1 [Malus 
domestica]
Length=334

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGT +VHVLVDQ R+DHSM FKQ+KTGFM++FEGCWR+EPL VDE+ C P++P   ADY
Sbjct  166  WSGTFAVHVLVDQNRKDHSMKFKQIKTGFMEKFEGCWRMEPLFVDEKTCFPFKPKTWADY  225

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T GKGRIGSK+SLEQLIQP++VPPPPISWY+RGIT+KTTEM+IND+ AE AR+R   
Sbjct  226  NSCTGGKGRIGSKLSLEQLIQPSIVPPPPISWYLRGITSKTTEMLINDMLAEAARLRGEL  285

Query  405  STEDL-RslglsgessgeSQTDSLCNIKERWAL  310
            + E+  +   +S +    S+ D++ +IKERWAL
Sbjct  286  NPEESNKENEMSQDREVLSRVDNVSDIKERWAL  318



>ref|XP_008353020.1| PREDICTED: uncharacterized protein LOC103416549 isoform X2 [Malus 
domestica]
Length=332

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGT +VHVLVDQ R+DHSM FKQ+KTGFM++FEGCWR+EPL VDE+ C P++P   ADY
Sbjct  164  WSGTFAVHVLVDQNRKDHSMKFKQIKTGFMEKFEGCWRMEPLFVDEKTCFPFKPKTWADY  223

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T GKGRIGSK+SLEQLIQP++VPPPPISWY+RGIT+KTTEM+IND+ AE AR+R   
Sbjct  224  NSCTGGKGRIGSKLSLEQLIQPSIVPPPPISWYLRGITSKTTEMLINDMLAEAARLRGEL  283

Query  405  STEDL-RslglsgessgeSQTDSLCNIKERWAL  310
            + E+  +   +S +    S+ D++ +IKERWAL
Sbjct  284  NPEESNKENEMSQDREVLSRVDNVSDIKERWAL  316



>ref|XP_010925764.1| PREDICTED: uncharacterized protein LOC105048213 isoform X2 [Elaeis 
guineensis]
Length=292

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ REDH++ FKQ K+GFMK+FEGCW+V+P+ VDE++C   +    ADY
Sbjct  128  WSGTISVHVLVDQNREDHTVRFKQGKSGFMKKFEGCWKVDPMFVDEQICPASKSKTWADY  187

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T GKGR+GS V+L+QLIQPA+VPPPP SWY+RGITT+TTEM+I DL AE AR+R   
Sbjct  188  DLCTGGKGRVGSIVNLDQLIQPAIVPPPPFSWYLRGITTRTTEMLITDLLAEAARLRGDG  247

Query  405  STEDLRslglsgessgeSQTDSLCNIKERW  316
              E  +++  S ++S E    S   IKERW
Sbjct  248  YAESKQAIETSCDNSAECLAHS---IKERW  274



>gb|EMT22456.1| hypothetical protein F775_02661 [Aegilops tauschii]
Length=344

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 108/151 (72%), Gaps = 1/151 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSG +SVHV VDQ R +H++ FKQ ++GFMK+FEGCW++EPL VD+E C P  P+ L +Y
Sbjct  169  WSGILSVHVFVDQDRRNHTVKFKQGRSGFMKKFEGCWKIEPLFVDKEACLPLDPHTLEEY  228

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T G+GR+GS ++L+QLI+PAL+PP PI+WYVRGITT+TTEM++NDL AETAR+R  +
Sbjct  229  DSCTAGRGRVGSAITLDQLIEPALLPPQPIAWYVRGITTRTTEMLVNDLIAETARLRGLA  288

Query  405  STEDLRslglsgessgeSQTDSLCN-IKERW  316
            S  D                   CN +KERW
Sbjct  289  SNGDANLRTEENCDVNGGVLTEECNDVKERW  319



>ref|XP_008812484.1| PREDICTED: uncharacterized protein LOC103723369 isoform X2 [Phoenix 
dactylifera]
Length=333

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ REDH++ FKQ K+GFMK+FEGCW+VEPL VDE++C P +    ADY
Sbjct  169  WSGTISVHVLVDQNREDHTVRFKQGKSGFMKKFEGCWKVEPLFVDEQICLPTKSKTWADY  228

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T  KGR+GS VSL+QLIQPALVPPPP SWY+RGIT +TTE +I DL AE AR+R + 
Sbjct  229  DLCTGSKGRVGSFVSLDQLIQPALVPPPPFSWYLRGITARTTETLITDLLAEAARLRGAG  288

Query  405  STE  397
              E
Sbjct  289  YAE  291



>ref|XP_008812483.1| PREDICTED: uncharacterized protein LOC103723369 isoform X1 [Phoenix 
dactylifera]
Length=341

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ REDH++ FKQ K+GFMK+FEGCW+VEPL VDE++C P +    ADY
Sbjct  177  WSGTISVHVLVDQNREDHTVRFKQGKSGFMKKFEGCWKVEPLFVDEQICLPTKSKTWADY  236

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T  KGR+GS VSL+QLIQPALVPPPP SWY+RGIT +TTE +I DL AE AR+R + 
Sbjct  237  DLCTGSKGRVGSFVSLDQLIQPALVPPPPFSWYLRGITARTTETLITDLLAEAARLRGAG  296

Query  405  STE  397
              E
Sbjct  297  YAE  299



>ref|XP_010925756.1| PREDICTED: uncharacterized protein LOC105048213 isoform X1 [Elaeis 
guineensis]
Length=333

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ REDH++ FKQ K+GFMK+FEGCW+V+P+ VDE++C   +    ADY
Sbjct  169  WSGTISVHVLVDQNREDHTVRFKQGKSGFMKKFEGCWKVDPMFVDEQICPASKSKTWADY  228

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T GKGR+GS V+L+QLIQPA+VPPPP SWY+RGITT+TTEM+I DL AE AR+R   
Sbjct  229  DLCTGGKGRVGSIVNLDQLIQPAIVPPPPFSWYLRGITTRTTEMLITDLLAEAARLRGDG  288

Query  405  STEDLRslglsgessgeSQTDSLCNIKERW  316
              E  +++  S ++S E    S   IKERW
Sbjct  289  YAESKQAIETSCDNSAECLAHS---IKERW  315



>ref|XP_010552646.1| PREDICTED: uncharacterized protein LOC104822970 [Tarenaya hassleriana]
 ref|XP_010552647.1| PREDICTED: uncharacterized protein LOC104822970 [Tarenaya hassleriana]
Length=336

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 102/152 (67%), Gaps = 5/152 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCH-PYRPNNLAD  589
            WSGTISVHVLV+Q R DHSM FKQVKTGFMKRFEGCWRVEPL VDE +C    RP    +
Sbjct  171  WSGTISVHVLVEQNRADHSMKFKQVKTGFMKRFEGCWRVEPLFVDEHMCEGKERPRTEDE  230

Query  588  YVSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
            Y   + G+GRIGSK+ LEQLIQPA+VPPPPISWY+RGIT  TTEM+I DL AE+  IR  
Sbjct  231  YERCSGGRGRIGSKLKLEQLIQPAIVPPPPISWYLRGITANTTEMLILDLLAESYTIRAG  290

Query  408  SSTEDLRslglsgessgeSQTDSLCNIKERWA  313
             S                   D    +KERWA
Sbjct  291  DSGSSESKPDEPQRQVRMGSED----LKERWA  318



>ref|XP_004956598.1| PREDICTED: uncharacterized protein LOC101756968 [Setaria italica]
Length=387

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 113/151 (75%), Gaps = 1/151 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSG ++VHV V+Q R++H++ FKQ +TGFM++FEGCWR+EP+ VD+E+C P  P  L +Y
Sbjct  217  WSGILAVHVFVEQNRKNHTVKFKQGRTGFMRKFEGCWRIEPIFVDKEVCLPLHPCTLEEY  276

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T G+GR+ S ++L+QLI+PAL+PPPPISWY+RGIT++TTEM++NDL AETAR+R  S
Sbjct  277  ESCTGGRGRVASAITLDQLIEPALLPPPPISWYLRGITSRTTEMLVNDLIAETARLRGIS  336

Query  405  STEDLRslglsgessgeSQTDSLC-NIKERW  316
            +  D +        + +S     C +IKERW
Sbjct  337  NNADGKQDVEEICDASKSHPVIECGDIKERW  367



>ref|XP_008389659.1| PREDICTED: uncharacterized protein LOC103451978 [Malus domestica]
Length=150

 Score =   170 bits (430),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  708  MNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADYVSYTKGKGRIGSKVSLEQL  529
            M FKQVKTGFM++FEG WRVEPL VDE+ C P++P   ADY S T GKGRIGS+VSLEQL
Sbjct  1    MKFKQVKTGFMEKFEGYWRVEPLFVDEKTCFPFKPRTWADYNSCTGGKGRIGSRVSLEQL  60

Query  528  IQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS-SSTEDLRslglsgessgeS  352
            IQP +VPPPPISWY+RGIT+KTTEM+IND+ AE AR+R   +  E  + + +S +    S
Sbjct  61   IQPTIVPPPPISWYLRGITSKTTEMLINDMLAEAARLRGELNPGESNKEIEMSQDGQVLS  120

Query  351  QTDSLCNIKERWAL  310
              D++ NIKERWAL
Sbjct  121  HVDNVSNIKERWAL  134



>ref|XP_002462231.1| hypothetical protein SORBIDRAFT_02g022180 [Sorghum bicolor]
 gb|EER98752.1| hypothetical protein SORBIDRAFT_02g022180 [Sorghum bicolor]
Length=1479

 Score =   182 bits (462),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 115/151 (76%), Gaps = 1/151 (1%)
 Frame = -1

Query  765   WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
             WSG +SVHV VDQ R++H++ F+Q +TGFM++FEGCW++EPL VD+ELC P  P+ L +Y
Sbjct  998   WSGILSVHVFVDQNRKNHTVKFRQGRTGFMRKFEGCWKIEPLFVDKELCLPLDPHTLEEY  1057

Query  585   VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR-S  409
              S T G+GR+G  ++L+QLI+PAL+PPPPISWYVRGITT+TTEM++NDL AETAR+R  S
Sbjct  1058  ESCTGGRGRVGCAITLDQLIEPALLPPPPISWYVRGITTRTTEMLVNDLIAETARLRGIS  1117

Query  408   SSTEDLRslglsgessgeSQTDSLCNIKERW  316
             ++T   +     G +S    T    +IKERW
Sbjct  1118  NNTVTKQDTEEMGGASPSDPTRESGDIKERW  1148



>ref|XP_007044669.1| Domain of Uncharacterized protein function isoform 2 [Theobroma 
cacao]
 gb|EOY00501.1| Domain of Uncharacterized protein function isoform 2 [Theobroma 
cacao]
Length=347

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 120/154 (78%), Gaps = 7/154 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R+D+SM FKQVKTGFMK+FEG WRVEP+ VDEE C P++P   A+Y
Sbjct  175  WSGTISVHVLVDQNRDDYSMKFKQVKTGFMKKFEGHWRVEPVFVDEETCFPFKPKTWAEY  234

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR--  412
             S T GKGR+GSKVSL+QLIQPA++PPPPISWY+RGIT KTTEM+++DL AE  R++   
Sbjct  235  CSCTAGKGRVGSKVSLDQLIQPAIIPPPPISWYLRGITAKTTEMLVHDLLAEADRLKGGF  294

Query  411  --SSSTEDLRslglsgessgeSQTDSLCNIKERW  316
               +S + LR   LS + +   Q + +C+IKERW
Sbjct  295  DFGNSDKGLR---LSKKINEHQQVEQICDIKERW  325



>ref|XP_007044670.1| Domain of Uncharacterized protein function isoform 3 [Theobroma 
cacao]
 gb|EOY00502.1| Domain of Uncharacterized protein function isoform 3 [Theobroma 
cacao]
Length=338

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 120/154 (78%), Gaps = 7/154 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R+D+SM FKQVKTGFMK+FEG WRVEP+ VDEE C P++P   A+Y
Sbjct  166  WSGTISVHVLVDQNRDDYSMKFKQVKTGFMKKFEGHWRVEPVFVDEETCFPFKPKTWAEY  225

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR--  412
             S T GKGR+GSKVSL+QLIQPA++PPPPISWY+RGIT KTTEM+++DL AE  R++   
Sbjct  226  CSCTAGKGRVGSKVSLDQLIQPAIIPPPPISWYLRGITAKTTEMLVHDLLAEADRLKGGF  285

Query  411  --SSSTEDLRslglsgessgeSQTDSLCNIKERW  316
               +S + LR   LS + +   Q + +C+IKERW
Sbjct  286  DFGNSDKGLR---LSKKINEHQQVEQICDIKERW  316



>gb|KHG04031.1| hypothetical protein F383_29543 [Gossypium arboreum]
 gb|KHG06243.1| hypothetical protein F383_32813 [Gossypium arboreum]
Length=157

 Score =   165 bits (418),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 102/136 (75%), Gaps = 3/136 (2%)
 Frame = -1

Query  708  MNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADYVSYTKGKGRIGSKVSLEQL  529
            M F+QV TGFMK+FEG WR+EP+ VDEE C P++P  LA+Y S + GKGRIGSKVSL+QL
Sbjct  7    MKFEQVNTGFMKKFEGQWRIEPIFVDEETCFPFKPKTLAEYCSCSGGKGRIGSKVSLDQL  66

Query  528  IQPALVPPPPISWYVRGITTKTTEMIINDLQAETARI---RRSSSTEDLRslglsgessg  358
            +QPA+VPPPPISWY+RGITTKTTEM+I+DL AE  R+   RRS S    +   LS E + 
Sbjct  67   VQPAIVPPPPISWYLRGITTKTTEMLIHDLVAEADRLTGGRRSDSETSSKKFRLSKELNE  126

Query  357  eSQTDSLCNIKERWAL  310
                + + NIK+RW+L
Sbjct  127  YDPIEQIFNIKQRWSL  142



>ref|XP_003577995.1| PREDICTED: uncharacterized protein LOC100824540 [Brachypodium 
distachyon]
Length=335

 Score =   170 bits (431),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSG +SVHV VDQ R+DH++ FKQ ++GFMK+FEG W++EPL VD+E C P  P  L +Y
Sbjct  167  WSGILSVHVFVDQNRKDHTVKFKQGRSGFMKKFEGSWKIEPLFVDKEACLPLDPPTLEEY  226

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T G+GR+GS ++L+QLI+PAL+PP PI+WYVRGIT +TTEM++NDL AET R+R  +
Sbjct  227  DSCTVGRGRVGSVITLDQLIEPALLPPQPIAWYVRGITARTTEMLVNDLIAETGRLRGLA  286

Query  405  STEDLRslglsgessgeSQTDSLC-NIKERW  316
               D +       +  +      C ++KERW
Sbjct  287  KNADEKQHIEENSNVNKCLLTGGCGDVKERW  317



>ref|XP_007044668.1| Domain of Uncharacterized protein function isoform 1 [Theobroma 
cacao]
 gb|EOY00500.1| Domain of Uncharacterized protein function isoform 1 [Theobroma 
cacao]
Length=387

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 120/154 (78%), Gaps = 7/154 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R+D+SM FKQVKTGFMK+FEG WRVEP+ VDEE C P++P   A+Y
Sbjct  215  WSGTISVHVLVDQNRDDYSMKFKQVKTGFMKKFEGHWRVEPVFVDEETCFPFKPKTWAEY  274

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR--  412
             S T GKGR+GSKVSL+QLIQPA++PPPPISWY+RGIT KTTEM+++DL AE  R++   
Sbjct  275  CSCTAGKGRVGSKVSLDQLIQPAIIPPPPISWYLRGITAKTTEMLVHDLLAEADRLKGGF  334

Query  411  --SSSTEDLRslglsgessgeSQTDSLCNIKERW  316
               +S + LR   LS + +   Q + +C+IKERW
Sbjct  335  DFGNSDKGLR---LSKKINEHQQVEQICDIKERW  365



>gb|KJB61050.1| hypothetical protein B456_009G337600 [Gossypium raimondii]
Length=298

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 111/153 (73%), Gaps = 5/153 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ RED+SM FKQ+ TGFMK+FEG WRVEP  VDE+ C P++P   A+Y
Sbjct  124  WSGTISVHVLVDQNREDYSMRFKQMSTGFMKKFEGYWRVEPFFVDEKTCFPFKPKTWAEY  183

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARI---R  415
             S T GKGRIGSKVSL+QLIQPA+ PPPPISWY+ GI  KTTEM+INDL AE  R+   R
Sbjct  184  CSCTGGKGRIGSKVSLDQLIQPAIAPPPPISWYLSGIPAKTTEMLINDLLAEADRLKGGR  243

Query  414  RSSSTEDLRslglsgessgeSQTDSLCNIKERW  316
             S  +E+LR            Q + + +IKERW
Sbjct  244  DSEISEELR--LSKEIGGYHHQLEQVSDIKERW  274



>gb|KJB61048.1| hypothetical protein B456_009G337600 [Gossypium raimondii]
 gb|KJB61049.1| hypothetical protein B456_009G337600 [Gossypium raimondii]
Length=339

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 111/153 (73%), Gaps = 5/153 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ RED+SM FKQ+ TGFMK+FEG WRVEP  VDE+ C P++P   A+Y
Sbjct  165  WSGTISVHVLVDQNREDYSMRFKQMSTGFMKKFEGYWRVEPFFVDEKTCFPFKPKTWAEY  224

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARI---R  415
             S T GKGRIGSKVSL+QLIQPA+ PPPPISWY+ GI  KTTEM+INDL AE  R+   R
Sbjct  225  CSCTGGKGRIGSKVSLDQLIQPAIAPPPPISWYLSGIPAKTTEMLINDLLAEADRLKGGR  284

Query  414  RSSSTEDLRslglsgessgeSQTDSLCNIKERW  316
             S  +E+LR            Q + + +IKERW
Sbjct  285  DSEISEELR--LSKEIGGYHHQLEQVSDIKERW  315



>ref|XP_006585947.1| PREDICTED: uncharacterized protein LOC100808684 isoform X2 [Glycine 
max]
Length=286

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 97/138 (70%), Gaps = 9/138 (7%)
 Frame = -1

Query  708  MNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADYVSYTKGKGRIGSKVSLEQL  529
            M FKQ K GFMK+FEGCWRVEPL VDE +CHP++P    DY +  +GKGRIGSKVSL+Q 
Sbjct  138  MKFKQTKAGFMKKFEGCWRVEPLFVDEAMCHPFKPVTKEDYYACARGKGRIGSKVSLKQT  197

Query  528  IQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIR-----RSSSTEDLRslglsges  364
            +QP++VPPPP+SWY+RGIT +TTEM+IND+ AETARIR       S  E+L+        
Sbjct  198  LQPSIVPPPPLSWYLRGITARTTEMLINDMLAETARIRGGYEAEKSKAEELQGKPGENVD  257

Query  363  sgeSQTDSLCNIKERWAL  310
               + +D    IKERW L
Sbjct  258  LVSNTSD----IKERWKL  271



>ref|XP_006602384.1| PREDICTED: uncharacterized protein LOC100781672 isoform X2 [Glycine 
max]
Length=282

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 97/138 (70%), Gaps = 9/138 (7%)
 Frame = -1

Query  708  MNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADYVSYTKGKGRIGSKVSLEQL  529
            M F Q K GFMK+FEGCWRVEPL VDE +CHP++P    DY + T+GKGRIGSKVSLEQ+
Sbjct  134  MKFMQTKAGFMKKFEGCWRVEPLFVDEAMCHPFKPVTKEDYNACTRGKGRIGSKVSLEQI  193

Query  528  IQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIR-----RSSSTEDLRslglsges  364
            +QP++VPPPP+SWY+RGIT +TTEM+IND+ AETARIR       S  E+L+        
Sbjct  194  LQPSIVPPPPLSWYLRGITARTTEMLINDMLAETARIRGGYEAEKSKAEELQVKPGENVD  253

Query  363  sgeSQTDSLCNIKERWAL  310
               + +D    IKE W L
Sbjct  254  LVSNTSD----IKESWKL  267



>ref|XP_006390884.1| hypothetical protein EUTSA_v10019595mg, partial [Eutrema salsugineum]
 gb|ESQ28170.1| hypothetical protein EUTSA_v10019595mg, partial [Eutrema salsugineum]
Length=310

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 113/151 (75%), Gaps = 7/151 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ R DHSM FKQVK+GFMKRFEG W+V+PL VDE +C   +P  L +Y
Sbjct  153  WSGTISVHVLVDQNRADHSMRFKQVKSGFMKRFEGSWKVKPLFVDEHMCDRLKPKTLEEY  212

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
               T GKGRIGSKV+L+QLIQPA++PPPPISWY+RGIT KTTEM+I+DL AETARIR   
Sbjct  213  NHCTGGKGRIGSKVTLDQLIQPAIIPPPPISWYLRGITAKTTEMLIHDLLAETARIRNGF  272

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWA  313
            +T +        E S E +     +IKERWA
Sbjct  273  ATGE-------TEDSDEQRIGKPGDIKERWA  296



>ref|XP_010682540.1| PREDICTED: uncharacterized protein LOC104897377 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682541.1| PREDICTED: uncharacterized protein LOC104897377 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682542.1| PREDICTED: uncharacterized protein LOC104897377 [Beta vulgaris 
subsp. vulgaris]
Length=333

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 114/151 (75%), Gaps = 1/151 (1%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADYV  583
            SGTI+VHVLVDQ REDHSM FKQ+ TGFMK+FEGCWRV+P+ VDE++C P++P  ++DY 
Sbjct  171  SGTIAVHVLVDQNREDHSMKFKQINTGFMKKFEGCWRVDPVFVDEKMCSPFKPKTMSDYR  230

Query  582  SYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR-SS  406
            S T GKGRIGS+V LEQL+QPA+VPPPPI+WY+RGIT+KT+E ++N L  E ARI+    
Sbjct  231  SCTGGKGRIGSRVVLEQLLQPAIVPPPPIAWYLRGITSKTSEALMNYLLEEVARIKGIPQ  290

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWA  313
            +T          +   E + D + +IK+RWA
Sbjct  291  ATGSGGDEKSVQKIPHELKVDEVRDIKKRWA  321



>gb|KHG05657.1| Trimethylamine-N-oxide reductase [Gossypium arboreum]
Length=360

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGTISVHVLVDQ RED+SM F+Q+ TGFMK+FEG WRVEP  VDE+ C P++P   A+Y
Sbjct  186  WSGTISVHVLVDQNREDYSMRFRQMSTGFMKKFEGYWRVEPFFVDEKTCFPFKPKTWAEY  245

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T GKGRIGSKVSL+QLIQPA+ PPPPISWY+ GI  KTTEM+INDL AE  R++   
Sbjct  246  CSCTGGKGRIGSKVSLDQLIQPAIAPPPPISWYLSGIPAKTTEMLINDLLAEADRLKGGR  305

Query  405  STE-DLRslglsgessgeSQTDSLCNIKERW  316
              E       L        Q + + +IKERW
Sbjct  306  DLEISEELQLLKDIGGHHHQLEQVPDIKERW  336



>dbj|BAD23602.1| hypothetical protein [Oryza sativa Japonica Group]
Length=378

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 106/151 (70%), Gaps = 12/151 (8%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSG +SVHV            FKQ +TGFMK+FEGCW++EPL VD+E CHP  P  L  Y
Sbjct  220  WSGVLSVHV-----------KFKQGRTGFMKKFEGCWKIEPLFVDKEACHPLDPCTLEKY  268

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR-S  409
             S T G GR+GS ++L+QLI+PA+VPPPP SWY+RGITT+TTEM++NDL AETAR+R  +
Sbjct  269  DSCTNGTGRVGSSITLDQLIEPAMVPPPPFSWYLRGITTRTTEMLVNDLIAETARLRGLA  328

Query  408  SSTEDLRslglsgessgeSQTDSLCNIKERW  316
            ++  D + +    ++S +  T+   +IKERW
Sbjct  329  NNAIDKQYVEGKCDTSRDHLTEECNDIKERW  359



>ref|XP_006840743.1| hypothetical protein AMTR_s00096p00135790 [Amborella trichopoda]
 gb|ERN02418.1| hypothetical protein AMTR_s00096p00135790 [Amborella trichopoda]
Length=334

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSG + VHV VDQ R+DH++ FKQ K GFMKRFEG W+++   VD++   P+ P  + DY
Sbjct  167  WSGVMLVHVFVDQNRKDHTVKFKQGKAGFMKRFEGAWKIDSNFVDKDHSFPFEPKTITDY  226

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
               + GKGRIGS V L+QL++PAL+PPPPISWY+RGITT+T EM+I DL++E ARIR
Sbjct  227  ELCSNGKGRIGSVVHLQQLVEPALLPPPPISWYLRGITTRTVEMLITDLRSEAARIR  283



>emb|CDY57831.1| BnaCnng32520D [Brassica napus]
Length=316

 Score =   151 bits (381),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 99/151 (66%), Gaps = 3/151 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W+GT  VH++V + R++ +  +KQ KT FMK FEGCWRVEPL +DE LC   +P  L DY
Sbjct  151  WAGTFPVHLIVQENRKNLTSKYKQEKTMFMKVFEGCWRVEPLFIDEHLCDRMKPKTLQDY  210

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
             S + G+GRIGSKV+++Q+ QP A++ PPP+SWY+RGIT KTTE +I+DL AE AR+R  
Sbjct  211  DSCSNGRGRIGSKVTMDQMFQPSAILTPPPLSWYIRGITIKTTESMIDDLLAEAARLRGG  270

Query  408  SSTEDLRslglsgessgeSQTDSLCNIKERW  316
                          +  E   D   +IKERW
Sbjct  271  GGGGHDDDGQGENGAVLEKSKDE--HIKERW  299



>gb|EMS64572.1| hypothetical protein TRIUR3_17734 [Triticum urartu]
Length=302

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = -1

Query  708  MNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADYVSYTKGKGRIGSKVSLEQL  529
            + FKQ ++GFMK+FEGCW++EPL VD+E C P  P+ L +Y S + G+GR+GS ++L+QL
Sbjct  146  VKFKQGRSGFMKKFEGCWKIEPLFVDKEACLPLDPHTLEEYDSCSAGRGRVGSAITLDQL  205

Query  528  IQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSSSTEDLRslglsgessgeSQ  349
            I+PAL+PP PI+WYVRGITT+TTEM++NDL AETAR+R  +S  D               
Sbjct  206  IEPALLPPQPIAWYVRGITTRTTEMLVNDLIAETARLRGLASNGDANEHTEENRDVNGDV  265

Query  348  TDSLCN-IKERW  316
                CN +KERW
Sbjct  266  LTEDCNDVKERW  277



>emb|CDY69075.1| BnaCnng61760D, partial [Brassica napus]
Length=369

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W+GT  +H++V + R+    N+KQ KT FMK FEGCWRVEPL +DE LC   +P    DY
Sbjct  194  WAGTFPIHLIVQENRKHLMSNYKQEKTMFMKVFEGCWRVEPLFIDEHLCESLKPKTQEDY  253

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
               T G+GRIGSKV+++Q+ QP A++ PPP+SWY+RGITTKTTE +I DL AE ARIR  
Sbjct  254  DRCTNGRGRIGSKVTMDQMFQPSAILTPPPLSWYIRGITTKTTESMIEDLLAEAARIRGG  313

Query  408  SSTED  394
               +D
Sbjct  314  GRDDD  318



>ref|XP_006305312.1| hypothetical protein CARUB_v10009689mg [Capsella rubella]
 gb|EOA38210.1| hypothetical protein CARUB_v10009689mg [Capsella rubella]
Length=333

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 99/151 (66%), Gaps = 4/151 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W GT  +H++V + RE+ + N+KQ KT FMK FEGCW+VEPL +DE LC   +P  L DY
Sbjct  169  WDGTFPIHLIVKENRENLTSNYKQEKTMFMKVFEGCWKVEPLFIDEHLCDRSKPKTLEDY  228

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
             + + G+GRIGSKV+++Q+ QP A++ PPP+SWY+RGIT KTTE +I DL AE  R+R  
Sbjct  229  HNCSNGRGRIGSKVTMDQMFQPSAILTPPPLSWYIRGITIKTTESMIEDLLAEATRLRGG  288

Query  408  SSTEDLRslglsgessgeSQTDSLCNIKERW  316
                 +   G        ++T    +IKERW
Sbjct  289  GGGGHMDDQGEHSAVMENTKT---VDIKERW  316



>gb|EEE69472.1| hypothetical protein OsJ_28895 [Oryza sativa Japonica Group]
Length=754

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = -1

Query  708  MNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADYVSYTKGKGRIGSKVSLEQL  529
            + FKQ +TGFMK+FEGCW++EPL VD+E CHP  P  L  Y S T G GR+GS ++L+QL
Sbjct  604  VKFKQGRTGFMKKFEGCWKIEPLFVDKEACHPLDPCTLEKYDSCTNGTGRVGSSITLDQL  663

Query  528  IQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR-SSSTEDLRslglsgessgeS  352
            I+PA+VPPPP SWY+RGITT+TTEM++NDL AETAR+R  +++  D + +    ++S + 
Sbjct  664  IEPAMVPPPPFSWYLRGITTRTTEMLVNDLIAETARLRGLANNAIDKQYVEGKCDTSRDH  723

Query  351  QTDSLCNIKERW  316
             T+   +IKERW
Sbjct  724  LTEECNDIKERW  735



>ref|XP_009110090.1| PREDICTED: uncharacterized protein LOC103835653 isoform X2 [Brassica 
rapa]
Length=317

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 97/151 (64%), Gaps = 3/151 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W+GT  VH++V + R++ +  +KQ KT FMK FEGCWRVEPL +DE LC   +P  L DY
Sbjct  152  WAGTFPVHLIVQENRKNLTSKYKQEKTMFMKVFEGCWRVEPLFIDEHLCDRMKPKTLQDY  211

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
             S + G+GR+GSKV+++Q+ QP A++ PPP+SWY+RGIT KTTE +I DL AE AR+R  
Sbjct  212  DSCSNGRGRVGSKVTMDQMFQPSAILTPPPLSWYIRGITIKTTESMIEDLLAEAARLRGG  271

Query  408  SSTEDLRslglsgessgeSQTDSLCNIKERW  316
                             E   D   +IKERW
Sbjct  272  GGGGHDDDGQGENGVVLEKSKDE--HIKERW  300



>emb|CDY25798.1| BnaA07g09840D [Brassica napus]
Length=365

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W+GT  +H++V + R+    N+KQ KT FMK FEGCWRVEPL +DE LC   +P    DY
Sbjct  204  WAGTFPIHLIVQENRKHLMSNYKQEKTMFMKVFEGCWRVEPLFIDEHLCERLKPKTQEDY  263

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
               T G+GRIGSKV+++Q+ QP A++ PPP+SWY+RGITTKTTE +I DL AE ARIR  
Sbjct  264  DRCTNGRGRIGSKVTMDQMFQPSAILTPPPLSWYIRGITTKTTESMIEDLLAEAARIRGG  323

Query  408  SSTED  394
               +D
Sbjct  324  GRDDD  328



>emb|CDY41434.1| BnaA08g20360D [Brassica napus]
Length=382

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 97/151 (64%), Gaps = 3/151 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W+GT  VH++V + R++ +  +KQ KT FMK FEGCWRVEPL +DE LC   +P  L DY
Sbjct  217  WAGTFPVHLIVQENRKNLTSKYKQEKTMFMKVFEGCWRVEPLFIDEHLCDRMKPKTLQDY  276

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
             S + G+GR+GSKV+++Q+ QP A++ PPP+SWY+RGIT KTTE +I DL AE AR+R  
Sbjct  277  DSCSNGRGRVGSKVTMDQMFQPSAILTPPPLSWYIRGITIKTTESMIEDLLAEAARLRGG  336

Query  408  SSTEDLRslglsgessgeSQTDSLCNIKERW  316
                             E   D   +IKERW
Sbjct  337  GGGGHDDDGQGENGVVLEKSKDE--HIKERW  365



>ref|XP_010551589.1| PREDICTED: uncharacterized protein LOC104822153 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010551590.1| PREDICTED: uncharacterized protein LOC104822153 isoform X2 [Tarenaya 
hassleriana]
Length=290

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGT  VH+LVD+ R+D S  +KQ KT FMK FEGCWRVEPL VDE LC   +P    +Y
Sbjct  118  WSGTFPVHLLVDENRKDFSSKYKQGKTMFMKVFEGCWRVEPLYVDEHLCGKEKPKTREEY  177

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
               + G+GRIGSKV ++Q+ QP AL+ PPP+SWY+RGIT KTTE +I DL + +AR+R  
Sbjct  178  RRCSGGRGRIGSKVIMDQIFQPSALLTPPPLSWYLRGITVKTTESMIEDLMSVSARVRSG  237

Query  408  SS  403
             S
Sbjct  238  GS  239



>ref|XP_010551585.1| PREDICTED: uncharacterized protein LOC104822153 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010551586.1| PREDICTED: uncharacterized protein LOC104822153 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010551588.1| PREDICTED: uncharacterized protein LOC104822153 isoform X1 [Tarenaya 
hassleriana]
Length=337

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSGT  VH+LVD+ R+D S  +KQ KT FMK FEGCWRVEPL VDE LC   +P    +Y
Sbjct  165  WSGTFPVHLLVDENRKDFSSKYKQGKTMFMKVFEGCWRVEPLYVDEHLCGKEKPKTREEY  224

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
               + G+GRIGSKV ++Q+ QP AL+ PPP+SWY+RGIT KTTE +I DL + +AR+R  
Sbjct  225  RRCSGGRGRIGSKVIMDQIFQPSALLTPPPLSWYLRGITVKTTESMIEDLMSVSARVRSG  284

Query  408  SS  403
             S
Sbjct  285  GS  286



>ref|XP_010460141.1| PREDICTED: uncharacterized protein LOC104741066 [Camelina sativa]
 ref|XP_010460142.1| PREDICTED: uncharacterized protein LOC104741066 [Camelina sativa]
Length=335

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 100/153 (65%), Gaps = 2/153 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W GT  +H++V++ RE+ + ++KQ KT FMK FEGCW+VEPL +DE LC   +P  L DY
Sbjct  169  WDGTYPIHLIVEEDRENLTSSYKQEKTMFMKVFEGCWKVEPLFIDEHLCDRSKPKTLEDY  228

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
             S + G+GR+GSKV ++Q+ QP AL+ PPP+SWY+RGIT KTTE ++ DL AE  R+R  
Sbjct  229  HSCSNGRGRVGSKVRMDQMFQPSALLTPPPLSWYIRGITIKTTESMMEDLFAEATRLRGG  288

Query  408  SSTEDLRslglsgessgeSQTDSLCNIKERWAL  310
                          S    +T ++ +IKERW L
Sbjct  289  GGGVGHIDDQKGENSVVLEKTKTV-DIKERWRL  320



>ref|XP_009103781.1| PREDICTED: uncharacterized protein LOC103829839 [Brassica rapa]
Length=625

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W+GT  +H++V + R+    N+KQ KT FMK FEGCWRVEPL +DE LC   +P    DY
Sbjct  159  WAGTFPIHLIVQENRKHLMSNYKQEKTMFMKVFEGCWRVEPLFIDEHLCERLKPKTQEDY  218

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
               T G+GRIGSKV+++Q+ QP A++ PPP+SWY+RGITTKTTE +I DL AE ARIR  
Sbjct  219  DRCTNGRGRIGSKVTMDQMFQPSAILTPPPLSWYIRGITTKTTESMIEDLLAEAARIRGG  278

Query  408  SSTED  394
               +D
Sbjct  279  GRDDD  283


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 79/124 (64%), Gaps = 2/124 (2%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   ++G I +HV++D+  +  +  +K+VK  +MK FEG W++EPL VD+E LC      
Sbjct  495  KILGYNGAIPIHVIIDENHQKVTATYKKVKVKYMKVFEGSWKMEPLYVDQERLCKSRSRI  554

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +   Y   + GKGRIGSKV++E + QP +L+  PP+SW++RGI  K T+ ++ DL+    
Sbjct  555  SEEKYKKCSGGKGRIGSKVTMEHIFQPSSLLNVPPVSWFIRGIAVKVTKALLQDLREYVI  614

Query  423  RIRR  412
            R+ +
Sbjct  615  RMNK  618



>ref|XP_006416072.1| hypothetical protein EUTSA_v10008158mg [Eutrema salsugineum]
 gb|ESQ34425.1| hypothetical protein EUTSA_v10008158mg [Eutrema salsugineum]
Length=332

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W+GT  +H++V + R++ + N++Q KT FMK FEGCW+VEPL +DE LC   +P    DY
Sbjct  172  WAGTFPIHLIVQENRKNLTSNYRQEKTMFMKVFEGCWKVEPLFIDEHLCETRKPRTREDY  231

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR  412
             S + G+GRIGSKV+++Q+ QP A++ PPP+SWY+ GIT KTTE +I DL AE A+IRR
Sbjct  232  ESCSNGRGRIGSKVTMDQMFQPSAILTPPPLSWYIHGITIKTTESMIEDLLAEAAKIRR  290



>ref|XP_010477648.1| PREDICTED: uncharacterized protein LOC104756719 [Camelina sativa]
 ref|XP_010477649.1| PREDICTED: uncharacterized protein LOC104756719 [Camelina sativa]
Length=337

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W GT  +H++V++ RE+ + ++KQ KT FMK FEGCW+VEPL +DE LC   +P  L DY
Sbjct  169  WDGTFPIHLIVEEDRENLTSSYKQEKTMFMKVFEGCWKVEPLFIDEHLCDRSKPKTLEDY  228

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
             S + G+GR+GSKV ++Q+ QP AL+ PPP+SWY+RGIT KTTE ++ DL AE  R+R
Sbjct  229  HSCSNGRGRVGSKVKMDQMFQPSALLTPPPLSWYIRGITIKTTESMMEDLFAEATRLR  286



>ref|XP_002893289.1| hypothetical protein ARALYDRAFT_472619 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69548.1| hypothetical protein ARALYDRAFT_472619 [Arabidopsis lyrata subsp. 
lyrata]
Length=333

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 101/151 (67%), Gaps = 4/151 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W+GT  +H++V++ R++ +  +KQ  T FMK FEGCW+VEPL +DE LC   +P +  DY
Sbjct  169  WAGTCPIHLIVEENRKNLTSKYKQETTMFMKVFEGCWKVEPLFIDEHLCERSKPKSQEDY  228

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
             S + G+GRIGSKV+++Q+ QP AL+ PPP+SWY+RGIT KTTE +I DL AE +R+R  
Sbjct  229  HSCSNGRGRIGSKVTMDQMFQPSALLTPPPLSWYIRGITIKTTESMIEDLFAEASRLRGG  288

Query  408  SSTEDLRslglsgessgeSQTDSLCNIKERW  316
                 +     +     +S+ D   +IKERW
Sbjct  289  KGGGYIADQEENNVVFEKSKAD---DIKERW  316



>ref|XP_009109809.1| PREDICTED: uncharacterized protein LOC103835402 [Brassica rapa]
 ref|XP_009109810.1| PREDICTED: uncharacterized protein LOC103835402 [Brassica rapa]
Length=317

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W+GT  VH++V + R++ +  +KQ KT FMK FEGCWRVEPL +DE LC   +P  L DY
Sbjct  152  WAGTFPVHLIVQENRKNLTSKYKQEKTMFMKVFEGCWRVEPLFIDEHLCDRMKPKTLQDY  211

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETA  424
             S + G+GR+GSKV+++Q+ QP A++ PPP+SWY+RGIT KTTE +I DL AE A
Sbjct  212  DSCSNGRGRVGSKVTMDQMFQPSAILTPPPLSWYIRGITIKTTESMIEDLLAEAA  266



>ref|NP_564197.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC98012.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
 gb|AEE30403.1| uncharacterized protein AT1G23560 [Arabidopsis thaliana]
Length=332

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W GT  +H++V++ R++ +  +KQ  T FMK FEGCW+VEPL +DE LC   +P +  DY
Sbjct  168  WDGTCPIHLIVEENRKNLTSKYKQETTMFMKVFEGCWKVEPLFIDEHLCDRSKPKSQKDY  227

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
             S + G+GRIGSKV+++Q+ QP AL+ PPP+SWY+RGIT KTTE +I DL AE  R+R
Sbjct  228  HSCSNGRGRIGSKVTMDQMFQPSALLTPPPLSWYIRGITIKTTESMIEDLFAEATRLR  285



>gb|AAM63743.1| unknown [Arabidopsis thaliana]
Length=332

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W GT  +H++V++ R++ +  +KQ  T FMK FEGCW+VEPL +DE LC   +P +  DY
Sbjct  168  WDGTCPIHLIVEENRKNLTSKYKQETTMFMKVFEGCWKVEPLFIDEHLCDRSKPKSQKDY  227

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
             S + G+GRIGSKV+++Q+ QP AL+ PPP+SWY+RG T KTTE +I DL AE  R+R
Sbjct  228  HSCSNGRGRIGSKVTMDQMFQPSALLTPPPLSWYIRGXTIKTTESMIEDLFAEATRLR  285



>gb|KFK44441.1| hypothetical protein AALP_AA1G256900 [Arabis alpina]
Length=334

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 85/125 (68%), Gaps = 1/125 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            W+GT  +H++V + R+  +  +KQ KT FMK FEG W+VEPL +DE LC   +P    DY
Sbjct  172  WAGTFPIHLIVQENRKHLTSKYKQEKTMFMKVFEGSWKVEPLFIDEHLCETMKPKTREDY  231

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
             S + G+GRIGSKV+++Q+ QP A++ PPP+SWY+ GIT KTTE +I DL A  ARIR  
Sbjct  232  HSCSNGRGRIGSKVTMDQMFQPNAILTPPPLSWYICGITVKTTESMIEDLLAVAARIRGE  291

Query  408  SSTED  394
                D
Sbjct  292  GGGHD  296



>gb|AAF79591.1|AC007945_11 F28C11.19 [Arabidopsis thaliana]
Length=3134

 Score =   141 bits (356),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -1

Query  765   WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
             W GT  +H++V++ R++ +  +KQ  T FMK FEGCW+VEPL +DE LC   +P +  DY
Sbjct  2970  WDGTCPIHLIVEENRKNLTSKYKQETTMFMKVFEGCWKVEPLFIDEHLCDRSKPKSQKDY  3029

Query  585   VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
              S + G+GRIGSKV+++Q+ QP AL+ PPP+SWY+RGIT KTTE +I DL AE  R+R
Sbjct  3030  HSCSNGRGRIGSKVTMDQMFQPSALLTPPPLSWYIRGITIKTTESMIEDLFAEATRLR  3087


 Score =   103 bits (257),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 78/124 (63%), Gaps = 6/124 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDE-ELCHPYRPNNLAD  589
            WSG   ++++VD  ++D +  +K+ K  FMK FEG W++EPL VD   LC    P +L +
Sbjct  825  WSGEFPINLIVDVNKKDLTAKYKKEKMMFMKVFEGNWKIEPLYVDSVRLCKQREPKSLQE  884

Query  588  YVSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARI  418
            Y   + G+GR+GSKV+++Q  QP   PP   PPISW++R IT +TT+ ++  LQ  +  +
Sbjct  885  YKKCSGGQGRVGSKVTMDQYFQP--YPPFNLPPISWFIRDITIRTTKTLLKMLQHASVVL  942

Query  417  RRSS  406
            R  S
Sbjct  943  RDGS  946


 Score =   101 bits (251),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 74/121 (61%), Gaps = 4/121 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTG--FMKRFEGCWRVEPLLVDE-ELCHPYRPNNL  595
            WSG+I VH+  +++R+D S  +   K    FMK F G W++EP  VD    C P  P N 
Sbjct  234  WSGSIPVHLTFNESRKDFSTLYMIPKKNVMFMKTFYGKWQIEPWYVDNMRFCKPRLPKNR  293

Query  594  ADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARI  418
             +Y   T GKG IGS+V+L+Q  QP+  +  PP+SWY+R  T KTT+ +I DLQ + A I
Sbjct  294  EEYRQCTGGKGLIGSRVTLDQYFQPSSYLNLPPLSWYIRRATVKTTKALIEDLQIQAAVI  353

Query  417  R  415
            R
Sbjct  354  R  354


 Score = 90.9 bits (224),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 74/120 (62%), Gaps = 6/120 (5%)
 Frame = -1

Query  762   SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDE-ELCHPYRPNNLADY  586
             S  I + ++VD+ R D +  +K+ K  FMK FEG ++VEP+ VD   LC   +P ++ +Y
Sbjct  2306  SIAIPISLIVDENRRDLTAKYKKEKMMFMKVFEGSYKVEPVYVDSVRLCKNKKPKSVDEY  2365

Query  585   VSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIR  415
                + G+G+I SKV+++Q  QP   PP   PP SW++R IT K T+ ++  LQ+ +  IR
Sbjct  2366  KKCSGGQGKIASKVTMDQYFQP--YPPFNLPPFSWFIRDITIKNTKSVLERLQSWSFSIR  2423


 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 73/111 (66%), Gaps = 2/111 (2%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  I +H+++D+  ++ +  ++     F+K  EG W+V P  VD+E LC    P +  +Y
Sbjct  541  SRAIPIHLVIDENHKNLTAKYRTKNMMFLKVLEGSWKVVPDFVDQERLCKSRLPKSREEY  600

Query  585  VSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQ  436
               + G+G++GSKV++EQ+ +P+ L+  PP+SW +RGIT KTT++++ D++
Sbjct  601  KRCSGGQGKVGSKVTMEQIFKPSPLLNLPPVSWIIRGITIKTTKILLEDIR  651


 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 79/124 (64%), Gaps = 3/124 (2%)
 Frame = -1

Query  753   ISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSY  577
             I +H+++ +  ++ +  +   K   MK F+G W+VEP  VD+E LC    P +  +Y   
Sbjct  1084  IPIHLIIHENHKNLTAKYTTKKMMLMKVFKGSWKVEPDYVDQERLCKSRSPKSREEYKIC  1143

Query  576   TKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSSST  400
             + G+G++GSKV++EQ+ +P+ L+  PP+SW +RGIT +TT++++ DL+ + A +  ++ T
Sbjct  1144  SGGQGKVGSKVTMEQIFEPSSLLNRPPVSWIIRGITIRTTKILLEDLR-KAANMANTTQT  1202

Query  399   EDLR  388
                R
Sbjct  1203  STHR  1206


 Score = 81.6 bits (200),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = -1

Query  762   SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
             S  + + ++VD+ R+D +  +K+ K   MK FEG +RVEPL VD E LC+   P + A+Y
Sbjct  2658  SFAVPISLIVDENRKDLTAKYKKKKMILMKVFEGSYRVEPLYVDSERLCNNMEPKSPAEY  2717

Query  585   VSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVR  481
                + G+GRI SKV++ Q  +P   PP   PP+SWY+R
Sbjct  2718  KRCSGGQGRIASKVTMNQYFKP--YPPFNLPPLSWYIR  2753


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = -1

Query  765   WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNNLAD  589
             +SG++ ++++V++ ++D  + +K+ K  FMK FEG W++EPL VD + LC   +P +  +
Sbjct  1771  FSGSLPINLIVNENKKDLEVKYKKEKMMFMKVFEGSWKIEPLYVDADRLCKNMKPKSREE  1830

Query  588   YVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWY  487
             Y   + G+G+I  KV+++Q  QP  L+  PP S +
Sbjct  1831  YKKCSGGQGKIAPKVTMDQYFQPYPLLNLPPFSCF  1865


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -1

Query  765   WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDE-ELCHPYRPNNLAD  589
             WSG I + ++VD+ +++ +  +K+ K  FMK FEG ++VEPL VD   LC+   P +  +
Sbjct  1410  WSGAIPIELIVDENQKEFTAKYKKEKMMFMKVFEGNYKVEPLYVDSVRLCNNKEPKSFQE  1469

Query  588   YVSYTKGKGRIGSK  547
             Y + + G+GRI SK
Sbjct  1470  YKTCSGGQGRIASK  1483



>ref|XP_009110088.1| PREDICTED: uncharacterized protein LOC103835653 isoform X1 [Brassica 
rapa]
 ref|XP_009110089.1| PREDICTED: uncharacterized protein LOC103835653 isoform X1 [Brassica 
rapa]
Length=348

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 98/182 (54%), Gaps = 34/182 (19%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSM-------------------------------NFKQVKTGF  679
            W+GT  VH++V + R++ ++                                +KQ KT F
Sbjct  152  WAGTFPVHLIVQENRKNLTVRYNYGLHKNHYFSSVFTTSNLFFSLYFQAQSKYKQEKTMF  211

Query  678  MKRFEGCWRVEPLLVDEELCHPYRPNNLADYVSYTKGKGRIGSKVSLEQLIQP-ALVPPP  502
            MK FEGCWRVEPL +DE LC   +P  L DY S + G+GR+GSKV+++Q+ QP A++ PP
Sbjct  212  MKVFEGCWRVEPLFIDEHLCDRMKPKTLQDYDSCSNGRGRVGSKVTMDQMFQPSAILTPP  271

Query  501  PISWYVRGITTKTTEMIINDLQAETARIRRSSSTEDLRslglsgessgeSQTDSLCNIKE  322
            P+SWY+RGIT KTTE +I DL AE AR+R                   E   D   +IKE
Sbjct  272  PLSWYIRGITIKTTESMIEDLLAEAARLRGGGGGGHDDDGQGENGVVLEKSKDE--HIKE  329

Query  321  RW  316
            RW
Sbjct  330  RW  331



>ref|XP_002964647.1| hypothetical protein SELMODRAFT_82450, partial [Selaginella moellendorffii]
 gb|EFJ34980.1| hypothetical protein SELMODRAFT_82450, partial [Selaginella moellendorffii]
Length=239

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 78/123 (63%), Gaps = 16/123 (13%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADYV  583
            SGTI V VLVD+ +  H++++K  K GFMKRFEG W ++P  VD E              
Sbjct  91   SGTIDVRVLVDEDQSSHTVSYKLAKEGFMKRFEGTWEIKPFYVDGEPGE-----------  139

Query  582  SYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSSS  403
                  GR+ S V+L Q +QP L+PPPP+SWYVRGITTKTTEM+I DLQAE  RIR  + 
Sbjct  140  -----AGRVASLVNLHQEVQPVLIPPPPVSWYVRGITTKTTEMMIGDLQAEGKRIREGNE  194

Query  402  TED  394
             +D
Sbjct  195  DDD  197



>ref|XP_006483874.1| PREDICTED: uncharacterized protein LOC102618931 isoform X4 [Citrus 
sinensis]
Length=304

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 87/152 (57%), Gaps = 36/152 (24%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            WSG + VHVLVDQ R DHS                                  P    DY
Sbjct  171  WSGVMLVHVLVDQDRRDHS----------------------------------PKTCEDY  196

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
             S T+GKGRI S VSLEQLIQPA+VPPPPISWY+RGIT +TTEM+I+DL AE+ARIR   
Sbjct  197  HSCTRGKGRIASTVSLEQLIQPAIVPPPPISWYLRGITARTTEMLIHDLLAESARIR--G  254

Query  405  STEDLRslglsgessgeSQTDSLCNIKERWAL  310
            S +  +SL +  ES    Q D + +IKERWA 
Sbjct  255  SFDPGKSLEVHQESKDLHQIDQISDIKERWAF  286



>ref|XP_001771562.1| predicted protein [Physcomitrella patens]
 gb|EDQ63592.1| predicted protein [Physcomitrella patens]
Length=330

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 77/123 (63%), Gaps = 9/123 (7%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADYV  583
            SGT+S  VLVDQ R  H + +K  KTGFMKRFEG W++EPL +D         ++ A   
Sbjct  173  SGTLSACVLVDQDRSTHMVKYKLAKTGFMKRFEGTWKIEPLFLD---------DSGAPVQ  223

Query  582  SYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSSS  403
             + +G  R+ S V+L+Q+ QP ++PPPP   YVR I+TKTT  +I +LQAE  R+R  + 
Sbjct  224  VHERGTERVASMVTLQQIWQPMIIPPPPFGGYVRNISTKTTTDMIQELQAEAKRLREGTP  283

Query  402  TED  394
              D
Sbjct  284  EPD  286



>ref|XP_006416064.1| hypothetical protein EUTSA_v10009581mg, partial [Eutrema salsugineum]
 gb|ESQ34417.1| hypothetical protein EUTSA_v10009581mg, partial [Eutrema salsugineum]
Length=203

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 79/124 (64%), Gaps = 2/124 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            WSG   + ++V++ ++D +  +K+ K  FMK FEG W+VEPL VD+E LC    P    +
Sbjct  74   WSGAFPITLIVEENKKDLTAKYKKEKMMFMKVFEGNWKVEPLYVDQERLCKHMLPKTREE  133

Query  588  YVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR  412
            Y   + G+G++ SKV+++Q  QP +L+  PP+SWY+RGIT KTT+ ++  LQ ++   R 
Sbjct  134  YKKCSGGQGKVASKVTVDQYFQPYSLLNIPPVSWYIRGITIKTTKTLLQILQIKSVIFRE  193

Query  411  SSST  400
               T
Sbjct  194  VPPT  197



>ref|XP_006416070.1| hypothetical protein EUTSA_v10008632mg [Eutrema salsugineum]
 gb|ESQ34423.1| hypothetical protein EUTSA_v10008632mg [Eutrema salsugineum]
Length=241

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 83/128 (65%), Gaps = 2/128 (2%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   WSG I +H+++D+  ++ +  +K+ +  +MK FEG W+VEPL  D+E LC      
Sbjct  113  KLLRWSGAIPIHLIIDENHQNLTAKYKKEEMMYMKVFEGSWKVEPLYADQERLCKSRSRT  172

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +  +Y   + G+GRIGSKV++EQ+ QP +L+  PP+SW++R IT +TT+ ++ DL+    
Sbjct  173  SEEEYRKCSGGQGRIGSKVTVEQIFQPSSLLNMPPVSWFMRLITIRTTKALLEDLRQYVI  232

Query  423  RIRRSSST  400
             I +SS +
Sbjct  233  DIHKSSDS  240



>ref|XP_006416069.1| hypothetical protein EUTSA_v10009760mg [Eutrema salsugineum]
 gb|ESQ34422.1| hypothetical protein EUTSA_v10009760mg [Eutrema salsugineum]
Length=420

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            WSG I +H+++D+  +  +  +K      MK  EG W+VEP  VD+E LC    P +  +
Sbjct  296  WSGAIPIHLIIDENHKTLTAKYKTKNLMLMKTLEGSWKVEPDFVDQERLCKSKLPESREE  355

Query  588  YVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + GKG++GSKV++EQ+ QP +L+  PP+SW++RGIT KTT+ ++ DL+   A  R
Sbjct  356  YKRCSGGKGKVGSKVTMEQIFQPSSLLNLPPVSWFIRGITIKTTKALLEDLRKAGATFR  414


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            WSG+I + ++VD+ ++D +  +K+ K  FMK FEG ++VEPL VD E LC   +P +  +
Sbjct  105  WSGSIPITLIVDENKKDLTAKYKKEKMMFMKVFEGSYKVEPLYVDSERLCMHMKPKSKEE  164

Query  588  YVSYTKGKGRIGSKV  544
            Y   + G+G+I SK 
Sbjct  165  YRKCSGGQGKIASKA  179



>ref|XP_010477644.1| PREDICTED: uncharacterized protein LOC104756716 [Camelina sativa]
Length=266

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 77/123 (63%), Gaps = 2/123 (2%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   WSGTI + +   + R++ S  + + K  FMK FEG W+VEP+ VD E LC   +P 
Sbjct  142  KFRSWSGTIPITLDFVENRKNLSAVYMKNKMKFMKTFEGSWKVEPVYVDSERLCKNMKPK  201

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +  +Y   + G+GRI SKV++EQ  QP+ L+  PP+SWY+R IT K T+ ++ DLQ   A
Sbjct  202  SREEYQKCSGGQGRIASKVTMEQTFQPSTLLNLPPLSWYIRKITIKITKDLVQDLQDRGA  261

Query  423  RIR  415
             IR
Sbjct  262  IIR  264



>gb|KFK40097.1| hypothetical protein AALP_AA3G330000 [Arabis alpina]
Length=276

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 79/124 (64%), Gaps = 2/124 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            WSGT+ ++++V + R+D +  +K+ K  FMK FEG ++VEP+ VD+E LC   RP    +
Sbjct  141  WSGTLPIYLIVYENRKDLTAKYKKEKMIFMKVFEGSFKVEPIYVDQERLCKHMRPKTRKE  200

Query  588  YVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR  412
            Y   + G+G++ SKV ++Q  QP  L+  PPISWY+R  T KTT+ +I  LQ   + +R 
Sbjct  201  YKKCSGGQGKVASKVVMDQYFQPYTLLNLPPISWYIREKTIKTTKTLIETLQKMCSELRS  260

Query  411  SSST  400
            S  T
Sbjct  261  SDPT  264



>gb|AAC98020.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
Length=225

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 77/121 (64%), Gaps = 6/121 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDE-ELCHPYRPNNLAD  589
            WSG   ++++VD  ++D +  +K+ K  FMK FEG W++EPL VD   LC    P +L +
Sbjct  106  WSGEFPINLIVDVNKKDLTAKYKKEKMMFMKVFEGNWKIEPLYVDSVRLCKQREPKSLQE  165

Query  588  YVSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARI  418
            Y   + G+GR+GSKV+++Q  QP   PP   PPISW++R IT +TT+ ++  LQ  +  +
Sbjct  166  YKKCSGGQGRVGSKVTMDQYFQP--YPPFNLPPISWFIRDITIRTTKTLLKMLQHASVVL  223

Query  417  R  415
            R
Sbjct  224  R  224



>ref|XP_002893300.1| hypothetical protein ARALYDRAFT_472628 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69559.1| hypothetical protein ARALYDRAFT_472628 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 75/121 (62%), Gaps = 4/121 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTG--FMKRFEGCWRVEPLLVDE-ELCHPYRPNNL  595
            WSG+I VH+  +++R+D S  +   K    FMKRF G W++EP  VD    C P  P N 
Sbjct  142  WSGSIPVHLTFNESRKDFSPLYMIPKKNVMFMKRFYGKWQIEPWYVDNMRFCKPRLPKNR  201

Query  594  ADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARI  418
             +Y   T GKG IGS+V+L+Q  QP+  +  PPISWY+R  T KTT+ ++ DLQ + A I
Sbjct  202  EEYRQCTGGKGLIGSRVTLDQSFQPSSYLNLPPISWYIRRATVKTTKALVEDLQIQAAVI  261

Query  417  R  415
            R
Sbjct  262  R  262



>ref|NP_564200.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30417.1| uncharacterized protein AT1G23670 [Arabidopsis thaliana]
Length=219

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 74/121 (61%), Gaps = 4/121 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTG--FMKRFEGCWRVEPLLVDE-ELCHPYRPNNL  595
            WSG+I VH+  +++R+D S  +   K    FMK F G W++EP  VD    C P  P N 
Sbjct  97   WSGSIPVHLTFNESRKDFSTLYMIPKKNVMFMKTFYGKWQIEPWYVDNMRFCKPRLPKNR  156

Query  594  ADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARI  418
             +Y   T GKG IGS+V+L+Q  QP+  +  PP+SWY+R  T KTT+ +I DLQ + A I
Sbjct  157  EEYRQCTGGKGLIGSRVTLDQYFQPSSYLNLPPLSWYIRRATVKTTKALIEDLQIQAAVI  216

Query  417  R  415
            R
Sbjct  217  R  217



>ref|XP_002893299.1| hypothetical protein ARALYDRAFT_313226 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69558.1| hypothetical protein ARALYDRAFT_313226 [Arabidopsis lyrata subsp. 
lyrata]
Length=225

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDE-ELCHPYRPNNLAD  589
            WSG   +H++VD  ++D +  +K+ K  FMK FEG W++EPL VD   LC    P +L +
Sbjct  106  WSGDFPIHLIVDVNKKDLTAKYKKEKMMFMKVFEGNWKIEPLYVDSVRLCKHKEPKSLQE  165

Query  588  YVSYTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y + + G+GR+ SKV+++Q  QP      PPISW++R IT +TT+ ++  LQ  +  +R
Sbjct  166  YKTCSGGQGRVASKVTMDQYFQPYTPFNLPPISWFIRDITIRTTKTLLKMLQHASVVLR  224



>gb|AAM60976.1| OBP32pep protein, putative [Arabidopsis thaliana]
Length=219

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 74/121 (61%), Gaps = 4/121 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTG--FMKRFEGCWRVEPLLVDE-ELCHPYRPNNL  595
            WSG+I VH+  +++R+D S  +   K    FMK F G W++EP  VD    C P  P N 
Sbjct  97   WSGSIPVHLTFNESRKDFSTLYMIPKKNVMFMKTFYGKWQIEPWYVDNMRFCKPRLPKNR  156

Query  594  ADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARI  418
             +Y   T GKG IGS+V+L+Q  QP+  +  PP+SWY+R  T KTT+ ++ DLQ + A I
Sbjct  157  EEYRQCTGGKGLIGSRVTLDQYFQPSSYLNLPPLSWYIRRATVKTTKALVEDLQIQAAVI  216

Query  417  R  415
            R
Sbjct  217  R  217



>ref|NP_973899.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC98022.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
 gb|AEE30416.1| uncharacterized protein AT1G23670 [Arabidopsis thaliana]
Length=264

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 74/121 (61%), Gaps = 4/121 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTG--FMKRFEGCWRVEPLLVDE-ELCHPYRPNNL  595
            WSG+I VH+  +++R+D S  +   K    FMK F G W++EP  VD    C P  P N 
Sbjct  142  WSGSIPVHLTFNESRKDFSTLYMIPKKNVMFMKTFYGKWQIEPWYVDNMRFCKPRLPKNR  201

Query  594  ADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARI  418
             +Y   T GKG IGS+V+L+Q  QP+  +  PP+SWY+R  T KTT+ +I DLQ + A I
Sbjct  202  EEYRQCTGGKGLIGSRVTLDQYFQPSSYLNLPPLSWYIRRATVKTTKALIEDLQIQAAVI  261

Query  417  R  415
            R
Sbjct  262  R  262



>gb|KFK44442.1| hypothetical protein AALP_AA1G257000 [Arabis alpina]
Length=260

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            SG I +H+ +D+  ++ S  +   K   MK F+G W+VEPL VD+E LC    P +  +Y
Sbjct  140  SGAIPIHLTIDENHKNLSATYTTKKMALMKVFKGSWKVEPLFVDQERLCKKKLPESRKEY  199

Query  585  VSYTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
               ++GKG++GSKV++EQ+ QP+      P SW++RGIT KTT+ ++ DL+  + + RR+
Sbjct  200  KRCSRGKGKVGSKVTMEQVFQPSWPFSMLPFSWFIRGITIKTTKTLLEDLRKTSIQHRRA  259



>ref|XP_006396882.1| hypothetical protein EUTSA_v10028680mg [Eutrema salsugineum]
 gb|ESQ38335.1| hypothetical protein EUTSA_v10028680mg [Eutrema salsugineum]
Length=426

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNNLAD  589
            WSGTI +H+++D+  ++ +  +K+ K  +MK  EG W+VEPL +D + LC    P N  +
Sbjct  305  WSGTIPIHLIIDENHQNLTAKYKKEKMMYMKVLEGSWKVEPLYIDADRLCKHIDPKNQQE  364

Query  588  YVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQ  436
            Y   + G+GRI SKV++E++ +P+ L+  PP+SW +R I  KTT++++ DL+
Sbjct  365  YKKCSGGQGRIASKVTMEEIFEPSPLLNLPPVSWIMRAIVIKTTKILLEDLR  416



>gb|AAC73033.1| hypothetical protein [Arabidopsis thaliana]
Length=221

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 79/124 (64%), Gaps = 2/124 (2%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  I +H+++D+  ++ +  +K+ K  +MK FEG W+VEPL  D+E LC      N  +Y
Sbjct  98   SIAIPIHLIIDENHKNLTAKYKKEKMMYMKVFEGRWKVEPLYADQERLCKSRSRINEEEY  157

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
               + GKGRIGSKV++EQ+ QP +L+  PPISW++R IT KT + ++ DL+     + ++
Sbjct  158  KKCSDGKGRIGSKVTMEQIFQPCSLLNVPPISWFIREITIKTIKNLLEDLRQFVIDMHKN  217

Query  408  SSTE  397
            S  E
Sbjct  218  SDPE  221



>ref|XP_010480622.1| PREDICTED: uncharacterized protein LOC104759384 [Camelina sativa]
Length=302

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 77/118 (65%), Gaps = 4/118 (3%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNF--KQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYR  607
            K   WSGTI +H+++D+  +  +  +  K+ K  +MK FEG W++EPL  D + LC   +
Sbjct  172  KFLLWSGTIPIHLIIDENHQKLTAKYTKKKNKMTYMKVFEGSWKIEPLYADSKRLCKHLK  231

Query  606  PNNLADYVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQ  436
            P N  +Y   + G+GRI SKV++EQ+ QP +L+  PP+SW +R IT K T++++ D++
Sbjct  232  PTNAEEYKKCSHGQGRIASKVTMEQIFQPSSLLNVPPVSWIIRWITIKVTKILLEDIR  289



>ref|XP_006304583.1| hypothetical protein CARUB_v10011627mg [Capsella rubella]
 gb|EOA37481.1| hypothetical protein CARUB_v10011627mg [Capsella rubella]
Length=266

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 77/123 (63%), Gaps = 2/123 (2%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPL-LVDEELCHPYRPN  601
            K   WSGTI + +   + R++ S  + + K  FMK FEG W+VEP+ +V E LC   +P 
Sbjct  142  KFRSWSGTIPITLDFVENRKNLSAVYVKNKMMFMKTFEGSWKVEPIYVVSERLCKNVKPR  201

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +  +Y   + G+G+I SKV++ Q  QP +L+  PP+SWY+R IT K T+ ++ DLQ   A
Sbjct  202  SREEYKKCSGGQGKIASKVTMNQTFQPSSLLNLPPLSWYIRKITVKITKTLVEDLQDMGA  261

Query  423  RIR  415
            +IR
Sbjct  262  KIR  264



>ref|XP_006303494.1| hypothetical protein CARUB_v10010830mg, partial [Capsella rubella]
 gb|EOA36392.1| hypothetical protein CARUB_v10010830mg, partial [Capsella rubella]
Length=251

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 76/121 (63%), Gaps = 6/121 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDE-ELCHPYRPNNLAD  589
            WSG+I + ++VD+ ++D +  +K+ K  FMK F+G ++VEPL  D   LC    P +L +
Sbjct  132  WSGSIPIELIVDENKKDFTAKYKKQKMMFMKVFQGSYKVEPLYADSVRLCKHMDPKSLQE  191

Query  588  YVSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARI  418
            Y + + G+GRI SKV+++Q  QP   PP   PP SW++R IT  TT+ ++  LQ  +  +
Sbjct  192  YKTCSGGQGRIASKVTMDQYFQP--YPPFNMPPFSWFIRNITINTTKTLLKMLQHGSVVL  249

Query  417  R  415
            R
Sbjct  250  R  250



>ref|NP_173766.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF79593.1|AC007945_13 F28C11.15 [Arabidopsis thaliana]
 gb|AAC98008.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
 gb|AEE30398.1| uncharacterized protein AT1G23520 [Arabidopsis thaliana]
Length=263

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 74/123 (60%), Gaps = 2/123 (2%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   WSGTI + +   + R++ S  + + K  FMK FEG W+VEP+ VD + LC   +P 
Sbjct  139  KFLSWSGTIPISLDFVENRKNLSAVYMKRKMMFMKSFEGSWKVEPIYVDSKRLCKQMKPK  198

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +  +Y   + G+G+I SKV + Q  QP+     PP+SWY+R IT K T+ +I DLQ   A
Sbjct  199  SREEYHKCSGGQGKIASKVKMNQTFQPSFPFNLPPLSWYIRDITIKITKALIQDLQDMGA  258

Query  423  RIR  415
            ++R
Sbjct  259  KLR  261



>ref|NP_180335.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC08024.1| uncharacterized protein AT2G27670 [Arabidopsis thaliana]
Length=293

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 79/124 (64%), Gaps = 2/124 (2%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  I +H+++D+  ++ +  +K+ K  +MK FEG W+VEPL  D+E LC      N  +Y
Sbjct  170  SIAIPIHLIIDENHKNLTAKYKKEKMMYMKVFEGRWKVEPLYADQERLCKSRSRINEEEY  229

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
               + GKGRIGSKV++EQ+ QP +L+  PPISW++R IT KT + ++ DL+     + ++
Sbjct  230  KKCSDGKGRIGSKVTMEQIFQPCSLLNVPPISWFIREITIKTIKNLLEDLRQFVIDMHKN  289

Query  408  SSTE  397
            S  E
Sbjct  290  SDPE  293



>gb|ACJ86261.1| unknown [Medicago truncatula]
Length=224

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRP  604
            WSGTIS++VLVDQ R D+SM FKQ KTGFMK+FEGCWRVEPL VDE  C+P+ P
Sbjct  171  WSGTISINVLVDQNRNDYSMKFKQTKTGFMKKFEGCWRVEPLFVDEATCYPFNP  224



>ref|XP_006304377.1| hypothetical protein CARUB_v10010870mg, partial [Capsella rubella]
 gb|EOA37275.1| hypothetical protein CARUB_v10010870mg, partial [Capsella rubella]
Length=259

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            SG I +H+++ +  ++ +  +   K   MK FEG W+VEP  VD+E LC P  P    +Y
Sbjct  140  SGDIPIHLIIHENHKNLTAKYTTKKMMLMKVFEGSWKVEPDFVDQERLCKPRLPKTREEY  199

Query  585  VSYTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQAETARIRR  412
               + GKG++GSKV++EQ+ QP+  +  PP+SW +RGIT KTT+ ++ DL+     +R+
Sbjct  200  KRCSGGKGKVGSKVTMEQIFQPSSPLNLPPVSWIIRGITIKTTKNLLEDLRKAGTSLRQ  258



>ref|NP_001077589.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAZ52693.1| expressed protein [Arabidopsis thaliana]
 gb|AEE30411.1| uncharacterized protein AT1G23600 [Arabidopsis thaliana]
Length=224

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 77/119 (65%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNNLAD  589
            +SG++ ++++V++ ++D  + +K+ K  FMK FEG W++EPL VD + LC   +P +  +
Sbjct  101  FSGSLPINLIVNENKKDLEVKYKKEKMMFMKVFEGSWKIEPLYVDADRLCKNMKPKSREE  160

Query  588  YVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+G+I  KV+++Q  QP  L+  PP SWY+R IT KTT+ ++  LQ     +R
Sbjct  161  YKKCSGGQGKIAPKVTMDQYFQPYPLLNLPPFSWYIRNITIKTTKTLLKMLQDRATILR  219



>ref|NP_173773.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC98016.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
 gb|AAY78617.1| unknown [Arabidopsis thaliana]
 gb|AAZ52691.1| expressed protein [Arabidopsis thaliana]
 gb|AEE30410.1| uncharacterized protein AT1G23600 [Arabidopsis thaliana]
Length=270

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 77/119 (65%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNNLAD  589
            +SG++ ++++V++ ++D  + +K+ K  FMK FEG W++EPL VD + LC   +P +  +
Sbjct  147  FSGSLPINLIVNENKKDLEVKYKKEKMMFMKVFEGSWKIEPLYVDADRLCKNMKPKSREE  206

Query  588  YVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+G+I  KV+++Q  QP  L+  PP SWY+R IT KTT+ ++  LQ     +R
Sbjct  207  YKKCSGGQGKIAPKVTMDQYFQPYPLLNLPPFSWYIRNITIKTTKTLLKMLQDRATILR  265



>ref|XP_006416066.1| hypothetical protein EUTSA_v10008137mg [Eutrema salsugineum]
 gb|ESQ34419.1| hypothetical protein EUTSA_v10008137mg [Eutrema salsugineum]
Length=336

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 78/127 (61%), Gaps = 2/127 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            +S  I + ++VD+ R+D +  +K+ K  FMK FEG ++VEP+ VD E LC    P +  +
Sbjct  202  FSIPIPIILIVDENRKDLTTKYKKEKIMFMKVFEGNYKVEPIYVDSERLCGQRLPKSREE  261

Query  588  YVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR  412
            Y   + G+G+I SKV+L Q  QP  L   PP+SWY+RGIT KTT+ ++  +Q     IRR
Sbjct  262  YKRCSGGQGKIASKVTLNQYFQPYPLFNLPPVSWYIRGITIKTTKNLLLSVQKVATSIRR  321

Query  411  SSSTEDL  391
            +    +L
Sbjct  322  AKRLNEL  328



>ref|XP_006416065.1| hypothetical protein EUTSA_v10008137mg [Eutrema salsugineum]
 gb|ESQ34418.1| hypothetical protein EUTSA_v10008137mg [Eutrema salsugineum]
Length=308

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 78/127 (61%), Gaps = 2/127 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            +S  I + ++VD+ R+D +  +K+ K  FMK FEG ++VEP+ VD E LC    P +  +
Sbjct  174  FSIPIPIILIVDENRKDLTTKYKKEKIMFMKVFEGNYKVEPIYVDSERLCGQRLPKSREE  233

Query  588  YVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR  412
            Y   + G+G+I SKV+L Q  QP  L   PP+SWY+RGIT KTT+ ++  +Q     IRR
Sbjct  234  YKRCSGGQGKIASKVTLNQYFQPYPLFNLPPVSWYIRGITIKTTKNLLLSVQKVATSIRR  293

Query  411  SSSTEDL  391
            +    +L
Sbjct  294  AKRLNEL  300



>ref|XP_001766244.1| predicted protein [Physcomitrella patens]
 gb|EDQ68876.1| predicted protein [Physcomitrella patens]
Length=266

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 81/120 (68%), Gaps = 11/120 (9%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            +SGT+SV VLVDQ R  H M ++  + GFMK+FEG W+V+PL VD +   P   N  AD 
Sbjct  107  FSGTLSVCVLVDQDRRSHLMKYRLARQGFMKQFEGSWKVDPLYVDAQ-GSPSSENE-AD-  163

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
                    R+ S VSLEQ+++PA+VPPPP   YVRGITT+TTEM++ DLQAE  R+R  S
Sbjct  164  --------RVASIVSLEQVVRPAVVPPPPFKSYVRGITTRTTEMLLQDLQAEGKRLRELS  215



>emb|CDY25791.1| BnaA07g09910D [Brassica napus]
Length=269

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 73/124 (59%), Gaps = 6/124 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            WSG   + ++VD+  +D +  +K+ K  FMK FEG ++VEP+ VD E LC    P    +
Sbjct  148  WSGAFPIKLIVDENIKDLTAKYKKEKMMFMKVFEGSYKVEPIFVDSERLCKHRLPKTREE  207

Query  588  YVSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARI  418
            Y   ++G+G+I SKV + Q  QP+  PP   PP SWY+ GIT +TT+ ++  ++  T   
Sbjct  208  YKKCSRGQGKIASKVIMNQYFQPS--PPFNLPPFSWYINGITIRTTKTLLQMIELSTVTF  265

Query  417  RRSS  406
            R  S
Sbjct  266  RELS  269



>ref|XP_006304415.1| hypothetical protein CARUB_v10010990mg, partial [Capsella rubella]
 gb|EOA37313.1| hypothetical protein CARUB_v10010990mg, partial [Capsella rubella]
Length=299

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDE-ELCHPYRPNNLAD  589
            WSG +   ++V++ ++D    +K+ +  FMK F+G W++EPL VD   LC   +P N  +
Sbjct  177  WSGALPFSLVVEENKKDLEAKYKKEEMMFMKVFKGSWKIEPLYVDSARLCKQMKPKNREE  236

Query  588  YVSYTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+G+I SKV+++Q  QP      PP+SWY+R IT KTT+ ++  LQ     +R
Sbjct  237  YKKCSGGQGKIASKVTMDQYFQPCFPFNLPPLSWYIRKITIKTTKTLLKMLQERATILR  295



>ref|XP_006304935.1| hypothetical protein CARUB_v10011421mg [Capsella rubella]
 gb|EOA37833.1| hypothetical protein CARUB_v10011421mg [Capsella rubella]
Length=229

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 75/125 (60%), Gaps = 2/125 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            WSG     ++ D+ ++  +  + + K  FMK F+G W++EPL VD E LC    P +  +
Sbjct  104  WSGAFPFTLIADENQKIFTAKYNKEKMMFMKVFKGSWKIEPLYVDSERLCKEREPKSREE  163

Query  588  YVSYTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQAETARIRR  412
            Y   ++G+G++ SKV+++Q  QP   +  PPISW++R IT KTT+ ++  +Q  +   R 
Sbjct  164  YKRCSRGQGKVASKVTMDQYFQPYFPLNLPPISWFIRWITIKTTKKLLKLIQDASIMYRD  223

Query  411  SSSTE  397
            +S TE
Sbjct  224  TSPTE  228



>gb|KFK44435.1| hypothetical protein AALP_AA1G256300 [Arabis alpina]
Length=218

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            WS  I + +L+++  +D S+ + + K  FMK F+G ++VEP+ VD E LC    P +  +
Sbjct  98   WSRPIPITLLIEENYKDLSVVYMKKKMLFMKVFDGRYKVEPVYVDSERLCKHKLPKSREE  157

Query  588  YVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+G+I SKV+++Q  QP+     PP+SWY+RGIT KTT+ ++ D Q  +  IR
Sbjct  158  YRKCSSGQGKIASKVTMDQYFQPSSFFNLPPLSWYIRGITIKTTKDLVQDFQITSLAIR  216



>ref|XP_010477658.1| PREDICTED: uncharacterized protein LOC104756727 isoform X2 [Camelina 
sativa]
Length=255

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 4/118 (3%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTG--FMKRFEGCWRVEPLLVDEE-LCHPYR  607
            K   +SGTI +H+++D+  +     + + K    +MK FEG W++EPL VD E LC+   
Sbjct  129  KFLLFSGTIPIHLIIDENHQTLRAKYTKKKNTMTYMKVFEGRWKIEPLYVDSERLCNQRE  188

Query  606  PNNLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQ  436
            P +  +Y   + GKGRI S V +E + QPA L+  PP+SW +RGIT K T+ +I DL+
Sbjct  189  PKSREEYRRCSGGKGRIASTVRMELIFQPASLLNVPPVSWIIRGITIKATKTLIEDLR  246



>gb|KFK44436.1| hypothetical protein AALP_AA1G256300 [Arabis alpina]
Length=220

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            WS  I + +L+++  +D S+ + + K  FMK F+G ++VEP+ VD E LC    P +  +
Sbjct  100  WSRPIPITLLIEENYKDLSVVYMKKKMLFMKVFDGRYKVEPVYVDSERLCKHKLPKSREE  159

Query  588  YVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+G+I SKV+++Q  QP+     PP+SWY+RGIT KTT+ ++ D Q  +  IR
Sbjct  160  YRKCSSGQGKIASKVTMDQYFQPSSFFNLPPLSWYIRGITIKTTKDLVQDFQITSLAIR  218



>ref|XP_010477661.1| PREDICTED: uncharacterized protein LOC104756730 [Camelina sativa]
Length=264

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 75/118 (64%), Gaps = 2/118 (2%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  I +H+++D+  ++ +  +      F+K  EG W+V P  VD+E LC P  P +  +Y
Sbjct  145  SKAIPIHLIIDENHKNLTAKYTTKNMMFLKVLEGSWKVVPDFVDQERLCKPRLPKSREEY  204

Query  585  VSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
               + GKG++GSKV++EQ+ QP+ L+  PP+SW +RGIT KTT++++ D++     +R
Sbjct  205  KRCSGGKGKVGSKVTMEQVFQPSPLLNLPPVSWIIRGITIKTTKILLEDIRKAGTTLR  262



>ref|NP_173781.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC98023.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
 gb|AAZ52694.1| expressed protein [Arabidopsis thaliana]
 gb|AEE30419.1| uncharacterized protein AT1G23690 [Arabidopsis thaliana]
Length=273

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNNLAD  589
            W G     ++VD+ +++    + + K  FMK FEG W++EPL VD E LC   +P +  +
Sbjct  153  WCGAFPFTLIVDENQKNFRGRYMKEKMKFMKYFEGKWKIEPLYVDSERLCKDRKPKSREE  212

Query  588  YVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+G++ SKV+++Q  QP  L+  PP+SWY+RGIT KTT+ ++  +Q  +   R
Sbjct  213  YKRCSGGEGKVASKVTMDQYFQPYFLLNLPPLSWYIRGITIKTTKNLLILIQNASIMFR  271



>ref|XP_010498861.1| PREDICTED: uncharacterized protein LOC104776477 isoform X2 [Camelina 
sativa]
 ref|XP_010498862.1| PREDICTED: uncharacterized protein LOC104776477 isoform X2 [Camelina 
sativa]
Length=217

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 73/123 (59%), Gaps = 6/123 (5%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   WSGTI + +   + R++ S  + + K  FMK FEG W+VEP+ VD E LC   +P 
Sbjct  97   KFLSWSGTIPITLDFVENRKNLSAVYMKNKMKFMKTFEGSWKVEPVYVDSERLCKNMKPK  156

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +  +Y   + G+GRI SKV++ Q  QP+ L+  PP+SWY+R IT      ++ DLQ   A
Sbjct  157  SREEYQKCSGGQGRIASKVTMNQTFQPSTLLNLPPLSWYIRKITKD----LVQDLQDRGA  212

Query  423  RIR  415
             IR
Sbjct  213  IIR  215



>ref|NP_001077590.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABE65650.1| unknown [Arabidopsis thaliana]
 gb|AEE30420.1| uncharacterized protein AT1G23690 [Arabidopsis thaliana]
Length=268

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNNLAD  589
            W G     ++VD+ +++    + + K  FMK FEG W++EPL VD E LC   +P +  +
Sbjct  148  WCGAFPFTLIVDENQKNFRGRYMKEKMKFMKYFEGKWKIEPLYVDSERLCKDRKPKSREE  207

Query  588  YVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+G++ SKV+++Q  QP  L+  PP+SWY+RGIT KTT+ ++  +Q  +   R
Sbjct  208  YKRCSGGEGKVASKVTMDQYFQPYFLLNLPPLSWYIRGITIKTTKNLLILIQNASIMFR  266



>ref|XP_009103163.1| PREDICTED: uncharacterized protein LOC103829265 [Brassica rapa]
Length=269

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 72/124 (58%), Gaps = 6/124 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            WSG   + ++VD+  +D +  +K+ K  FMK FEG ++VEP+ VD E LC    P    +
Sbjct  148  WSGAFPIKLIVDENIKDLTAKYKKEKMMFMKVFEGNYKVEPIFVDSERLCKHRLPKTREE  207

Query  588  YVSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARI  418
            Y   + G+G+I SKV + Q  QP+  PP   PP SWY+ GIT +TT+ ++  ++  T   
Sbjct  208  YKKCSDGQGKIASKVIMNQYFQPS--PPFNLPPFSWYINGITIRTTKTLLQMIELSTVTF  265

Query  417  RRSS  406
            R  S
Sbjct  266  RELS  269



>ref|XP_002893298.1| hypothetical protein ARALYDRAFT_335602 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69557.1| hypothetical protein ARALYDRAFT_335602 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            SG I +H+++ +  ++ +  +   K   MK FEG W+VEP  VD+E LC P  P +  +Y
Sbjct  145  SGDIPIHLIIHENHKNLTAKYTTKKMILMKVFEGSWKVEPDYVDQERLCKPRLPKSRKEY  204

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR  412
               + G+G++GSKV +EQ+ QP +L+  PP+SW + GIT +TT++++ DL+     +R+
Sbjct  205  KICSGGQGKVGSKVIMEQIFQPSSLLNLPPVSWIICGITIRTTKILLEDLRKAGTSLRK  263



>ref|XP_006296266.1| hypothetical protein CARUB_v10025431mg [Capsella rubella]
 gb|EOA29164.1| hypothetical protein CARUB_v10025431mg [Capsella rubella]
Length=312

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = -1

Query  756  TISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVS  580
             I +H+++D+  ++ + N+K+ K   MK FEG W+V+PL  D+E LC      N  +Y  
Sbjct  191  AIPIHLIIDENHKNLTANYKKEKMKCMKVFEGSWKVKPLYADQERLCKSKSRINDEEYKR  250

Query  579  YTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSSS  403
             + GKGRIGSKV++E + QP +L+  PPISW++R IT +T + ++ DL+     + +S S
Sbjct  251  CSNGKGRIGSKVTMEHIFQPCSLLNVPPISWFIRKITIRTVKDLLEDLRQYIIDMHKSYS  310



>ref|XP_006306513.1| hypothetical protein CARUB_v10012512mg, partial [Capsella rubella]
 gb|EOA39411.1| hypothetical protein CARUB_v10012512mg, partial [Capsella rubella]
Length=249

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 71/121 (59%), Gaps = 4/121 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTG--FMKRFEGCWRVEPLLVDEE-LCHPYRPNNL  595
            WSG+I VH+  +++R+D S  +   K    FMK   G W++EP  +D    C P  P N 
Sbjct  127  WSGSIPVHLTFNESRQDFSAIYMIPKENAMFMKTLYGKWKIEPWYIDNSRYCKPRLPKNR  186

Query  594  ADYVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARI  418
             +Y   T GKG IGSKV+L Q  QP + +  PP+SWY+R +T KTT+ ++ + Q   A I
Sbjct  187  QEYRQCTGGKGLIGSKVTLMQSFQPSSYLNFPPLSWYIRRVTIKTTKALVEEFQVRAAII  246

Query  417  R  415
            +
Sbjct  247  K  247



>ref|XP_009110093.1| PREDICTED: uncharacterized protein LOC103835656 [Brassica rapa]
 emb|CDY41440.1| BnaA08g20420D [Brassica napus]
Length=281

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 77/121 (64%), Gaps = 6/121 (5%)
 Frame = -1

Query  756  TISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVS  580
            +I +H+ +++ R+D +  +K+ K  FMK F G ++VEP+ VD+E LC    P +  +Y  
Sbjct  159  SIPIHLTMEENRKDLTTKYKKEKVLFMKEFHGNYKVEPIYVDQERLCKKRLPKSPEEYKK  218

Query  579  YTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIRRS  409
             + G+GRIGSK+++    QP   PP   PP+SW++RGIT KT++ ++N LQ     +R++
Sbjct  219  CSGGQGRIGSKLTINHYFQP--YPPFSLPPLSWFIRGITIKTSKKLLNLLQDMAFSLRQA  276

Query  408  S  406
             
Sbjct  277  G  277



>ref|XP_010477657.1| PREDICTED: uncharacterized protein LOC104756727 isoform X1 [Camelina 
sativa]
Length=304

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 4/118 (3%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTG--FMKRFEGCWRVEPLLVDEE-LCHPYR  607
            K   +SGTI +H+++D+  +     + + K    +MK FEG W++EPL VD E LC+   
Sbjct  178  KFLLFSGTIPIHLIIDENHQTLRAKYTKKKNTMTYMKVFEGRWKIEPLYVDSERLCNQRE  237

Query  606  PNNLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQ  436
            P +  +Y   + GKGRI S V +E + QPA L+  PP+SW +RGIT K T+ +I DL+
Sbjct  238  PKSREEYRRCSGGKGRIASTVRMELIFQPASLLNVPPVSWIIRGITIKATKTLIEDLR  295



>ref|XP_010477662.1| PREDICTED: uncharacterized protein LOC104756731 [Camelina sativa]
Length=265

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFM-KRFEGCWRVEPLLVDEE-LCHPYRPNNLA  592
            WSG I VH+ ++++R+D S  +   K   M K F G W++EP  +D    C P  P N  
Sbjct  144  WSGAIPVHLNLNESRKDFSALYLIPKKNMMFKEFNGKWKIEPWYIDNSRYCKPRLPKNRE  203

Query  591  DYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            +Y   T GKG IGS+V+++Q  +P+  +  PP+SWY+R +T KTT+ ++ DLQ   A I+
Sbjct  204  EYRQCTGGKGLIGSRVTVDQSFKPSSYLNFPPLSWYIRRVTIKTTKALVEDLQVRAAIIK  263



>emb|CDY41441.1| BnaA08g20430D [Brassica napus]
Length=622

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 81/128 (63%), Gaps = 8/128 (6%)
 Frame = -1

Query  756  TISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVS  580
            +I +H+ +++ R+D + N+K+ K   MK F G ++VEP+ VD+E LC    P +  +Y  
Sbjct  162  SIPIHLTMEENRKDLTTNYKKGKVILMKEFHGNYKVEPIYVDQERLCKKRLPKSPEEYKK  221

Query  579  YTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIRRS  409
             + G+GRIGSK+++    QP   PP   PP+SW++RG T KT++ ++N +Q  T+  RR+
Sbjct  222  CSGGQGRIGSKLTINHYFQP--YPPFNIPPLSWFIRGNTIKTSKKLLNGIQELTSSFRRA  279

Query  408  S--STEDL  391
               S ED+
Sbjct  280  GPPSEEDM  287


 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 75/122 (61%), Gaps = 7/122 (6%)
 Frame = -1

Query  756  TISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVS  580
            +I +H+ +++ R+D +  +K+ K   MK F G ++VEP+ VD++ LC    P    +Y  
Sbjct  484  SIPLHLTMEENRKDLTTKYKKGKVMLMKEFHGDYKVEPIYVDQKRLCKKRLPKTPEEYKK  543

Query  579  YTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIRRS  409
             + G+GRIGSK+++    QP   PP   PP+SW++ GIT KT++ ++N LQ E A I R 
Sbjct  544  CSGGQGRIGSKLTINHYFQP--YPPFNIPPLSWFIHGITIKTSKNLLNALQ-EMALIVRE  600

Query  408  SS  403
            + 
Sbjct  601  AG  602



>ref|NP_001117340.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30406.1| uncharacterized protein AT1G23570 [Arabidopsis thaliana]
Length=186

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 70/113 (62%), Gaps = 6/113 (5%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  + + ++VD+ R+D +  +K+ K   MK FEG +RVEPL VD E LC+   P + A+Y
Sbjct  33   SFAVPISLIVDENRKDLTAKYKKKKMILMKVFEGSYRVEPLYVDSERLCNNMEPKSPAEY  92

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQ  436
               + G+GRI SKV++ Q  +P   PP   PP+SWY+R +T K T+  +  LQ
Sbjct  93   KRCSGGQGRIASKVTMNQYFKP--YPPFNLPPLSWYIRKVTIKNTKTALKTLQ  143



>ref|XP_009110091.1| PREDICTED: uncharacterized protein LOC103835654 [Brassica rapa]
 ref|XP_009110092.1| PREDICTED: uncharacterized protein LOC103835654 [Brassica rapa]
Length=303

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  756  TISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVS  580
            +I +H+ +++ R+D + N+K+ K   MK F G ++VEP+ VD+E LC    P +  +Y  
Sbjct  162  SIPIHLNMEENRKDLTTNYKKGKVILMKEFHGNYKVEPIYVDQERLCKKRLPKSPEEYKK  221

Query  579  YTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS-  406
             + G+GRIGSK+++    QP      PP+SW++RG T KT++ ++N +Q  T+  RR+  
Sbjct  222  CSGGQGRIGSKLTINHYFQPYRPFNIPPLSWFIRGNTIKTSKKLLNGIQELTSSFRRAGP  281

Query  405  -STEDLR  388
             S ED++
Sbjct  282  PSEEDMK  288



>ref|XP_010498860.1| PREDICTED: uncharacterized protein LOC104776477 isoform X1 [Camelina 
sativa]
Length=259

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 73/123 (59%), Gaps = 6/123 (5%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   WSGTI + +   + R++ S  + + K  FMK FEG W+VEP+ VD E LC   +P 
Sbjct  139  KFLSWSGTIPITLDFVENRKNLSAVYMKNKMKFMKTFEGSWKVEPVYVDSERLCKNMKPK  198

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +  +Y   + G+GRI SKV++ Q  QP+ L+  PP+SWY+R IT      ++ DLQ   A
Sbjct  199  SREEYQKCSGGQGRIASKVTMNQTFQPSTLLNLPPLSWYIRKITKD----LVQDLQDRGA  254

Query  423  RIR  415
             IR
Sbjct  255  IIR  257



>ref|XP_002893287.1| hypothetical protein ARALYDRAFT_472615 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69546.1| hypothetical protein ARALYDRAFT_472615 [Arabidopsis lyrata subsp. 
lyrata]
Length=271

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 73/128 (57%), Gaps = 7/128 (5%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEEL------CH  616
            K   WSGTI + +   + R++    + + K  FMK FEG W++EP+ VD E       C 
Sbjct  142  KFLSWSGTIPISLDFVENRKNLYAVYMKRKMMFMKTFEGSWKLEPIYVDSERLCKGIDCS  201

Query  615  PYRPNNLADYVSYTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDL  439
              +P +  +Y   + G+G+I SKV++ Q  QP+     PP+SWY+R IT K T+ +I DL
Sbjct  202  SMKPKSREEYRKCSGGQGKIASKVTMNQTFQPSFPFNLPPLSWYIREITIKVTKALIEDL  261

Query  438  QAETARIR  415
            Q   A++R
Sbjct  262  QDMDAKLR  269



>ref|XP_006306553.1| hypothetical protein CARUB_v10012640mg [Capsella rubella]
 gb|EOA39451.1| hypothetical protein CARUB_v10012640mg [Capsella rubella]
Length=264

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  I +H+++D+  ++ +  +      F+K  EG W+V P  VD+E LC P  P    +Y
Sbjct  145  SKIIPIHLIIDENHKNLTGKYTTKNMMFLKVLEGSWKVVPDFVDQERLCKPRLPKTREEY  204

Query  585  VSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
               + GKG++GSKV++EQ+ QP+ L+  PP+SW +RGIT KTT+ ++ D++     +R
Sbjct  205  KRCSGGKGKVGSKVTMEQIFQPSPLLNLPPVSWIIRGITIKTTKTLLEDIRKAGTTLR  262



>ref|XP_009103161.1| PREDICTED: uncharacterized protein LOC103829263 [Brassica rapa]
Length=312

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 81/126 (64%), Gaps = 2/126 (2%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   ++GTI +HV++D+  +  +  +K+VK   MK FEG W++EPL VD+E LC      
Sbjct  183  KILGYNGTIPIHVIIDENHQKVTATYKKVKVKHMKVFEGSWKMEPLYVDQERLCKSRSRI  242

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +  +Y   + GKGRIGSKV++E + QP +L+  PP+SW++RG+  K T+ ++ DL+    
Sbjct  243  SEEEYKKCSSGKGRIGSKVTMEHIFQPSSLLNIPPVSWFIRGVAIKFTKALLQDLREYVI  302

Query  423  RIRRSS  406
             I +S+
Sbjct  303  MINKST  308



>ref|XP_006416071.1| hypothetical protein EUTSA_v10010034mg [Eutrema salsugineum]
 gb|ESQ34424.1| hypothetical protein EUTSA_v10010034mg [Eutrema salsugineum]
Length=280

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 75/121 (62%), Gaps = 2/121 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            WS  I +++++D+ R++ +  +K+ K   MK FEG ++VEP+  D+E LC    P +L +
Sbjct  156  WSIPIPINLILDENRKELTTKYKKEKVMLMKVFEGNYKVEPIYADQERLCKHRLPKSLEE  215

Query  588  YVSYTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQAETARIRR  412
            Y   + GKG++ +KV++ Q  QP      PP+SWY+RGIT KT++ ++   Q  T   R+
Sbjct  216  YKICSGGKGKLAAKVTMNQYFQPYFPFNLPPLSWYIRGITIKTSKNLLKAFQNMTTEFRK  275

Query  411  S  409
            +
Sbjct  276  A  276



>ref|XP_009103162.1| PREDICTED: uncharacterized protein LOC103829264 [Brassica rapa]
Length=341

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 82/129 (64%), Gaps = 2/129 (2%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   ++GTI +H+++D+  +  +  +K+VK   MK FEG W+++PL VD+E LC      
Sbjct  183  KILGYNGTIPIHLIIDENHQKVTATYKKVKVKHMKVFEGSWKIQPLYVDQERLCKSKSRI  242

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +   Y   + GKGRIGSKV++E + QP+ L+  PP+SW++RGI  K T++++ DL+    
Sbjct  243  SEEKYKKCSGGKGRIGSKVTMEHIFQPSPLLNVPPVSWFIRGIAVKVTKVLLQDLREHVI  302

Query  423  RIRRSSSTE  397
            R+ +  + +
Sbjct  303  RMNKMKTVD  311



>gb|KFK44440.1| hypothetical protein AALP_AA1G256800 [Arabis alpina]
Length=317

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 80/122 (66%), Gaps = 2/122 (2%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   W G+I +H+++D+  ++ + N+K+ K  +MK FEG W++EPL VD+E LC      
Sbjct  182  KLFSWFGSIPIHIIIDENHQNLTANYKKEKMKYMKVFEGSWKIEPLYVDQERLCKSRSQI  241

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +  +Y   + G+GRIGSKV++E + QP+ L+  PP+SW VR IT KTT++++ DL+    
Sbjct  242  SEKEYKKCSHGQGRIGSKVTMELIFQPSCLLNLPPVSWLVREITIKTTKVLLEDLRKHVN  301

Query  423  RI  418
             I
Sbjct  302  DI  303



>ref|XP_010510745.1| PREDICTED: uncharacterized protein LOC104786963 [Camelina sativa]
Length=314

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = -1

Query  756  TISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVS  580
             I +H+++D+  ++ +  +K+     MK FEG W+++PL  D+E LC      N  +Y  
Sbjct  188  AIPIHLVIDENHQNLTAKYKKKNMSCMKVFEGSWKIKPLYADQERLCKSRSRINDEEYKK  247

Query  579  YTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSSS  403
             + GKGRIGSKV++EQ+ QP  L+  PP+SW++R IT +T + ++ DL+     I +S +
Sbjct  248  CSGGKGRIGSKVTMEQIFQPCTLLNVPPVSWFIRKITIRTIKNLLEDLRQYIINIHKSRA  307



>ref|NP_001077587.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABE65648.1| unknown [Arabidopsis thaliana]
 gb|AEE30405.1| uncharacterized protein AT1G23570 [Arabidopsis thaliana]
Length=263

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 70/113 (62%), Gaps = 6/113 (5%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  + + ++VD+ R+D +  +K+ K   MK FEG +RVEPL VD E LC+   P + A+Y
Sbjct  110  SFAVPISLIVDENRKDLTAKYKKKKMILMKVFEGSYRVEPLYVDSERLCNNMEPKSPAEY  169

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQ  436
               + G+GRI SKV++ Q  +P   PP   PP+SWY+R +T K T+  +  LQ
Sbjct  170  KRCSGGQGRIASKVTMNQYFKP--YPPFNLPPLSWYIRKVTIKNTKTALKTLQ  220



>emb|CDY54284.1| BnaC07g48250D [Brassica napus]
Length=335

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 83/129 (64%), Gaps = 2/129 (2%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   ++GTI +H+++D+ ++  +  +K+VK   MK FEG W+++PL VD+E LC      
Sbjct  183  KILGYNGTIPIHLIIDENQQKVTATYKKVKVKHMKVFEGSWKIQPLYVDQERLCKSKSRI  242

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +   Y   + G+GRIGSKV++E + QP+ L+  PP+SW++RGI  K T++++ DL+    
Sbjct  243  SEEKYKKCSGGQGRIGSKVTMEHIFQPSPLLNVPPVSWFIRGIAVKVTKVLLQDLRKHVI  302

Query  423  RIRRSSSTE  397
            R+ +  + +
Sbjct  303  RMNKMKTVD  311



>ref|NP_564198.3| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30404.1| uncharacterized protein AT1G23570 [Arabidopsis thaliana]
Length=261

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 70/113 (62%), Gaps = 6/113 (5%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  + + ++VD+ R+D +  +K+ K   MK FEG +RVEPL VD E LC+   P + A+Y
Sbjct  108  SFAVPISLIVDENRKDLTAKYKKKKMILMKVFEGSYRVEPLYVDSERLCNNMEPKSPAEY  167

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQ  436
               + G+GRI SKV++ Q  +P   PP   PP+SWY+R +T K T+  +  LQ
Sbjct  168  KRCSGGQGRIASKVTMNQYFKP--YPPFNLPPLSWYIRKVTIKNTKTALKTLQ  218



>gb|ABK28412.1| unknown [Arabidopsis thaliana]
Length=264

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 70/113 (62%), Gaps = 6/113 (5%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  + + ++VD+ R+D +  +K+ K   MK FEG +RVEPL VD E LC+   P + A+Y
Sbjct  110  SFAVPISLIVDENRKDLTAKYKKKKMILMKVFEGSYRVEPLYVDSERLCNNMEPKSPAEY  169

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQ  436
               + G+GRI SKV++ Q  +P   PP   PP+SWY+R +T K T+  +  LQ
Sbjct  170  KRCSGGQGRIASKVTMNQYFKP--YPPFNLPPLSWYIRKVTIKNTKTALKTLQ  220



>ref|XP_002893297.1| hypothetical protein ARALYDRAFT_889905 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69556.1| hypothetical protein ARALYDRAFT_889905 [Arabidopsis lyrata subsp. 
lyrata]
Length=256

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 73/121 (60%), Gaps = 6/121 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDE-ELCHPYRPNNLAD  589
            WSG I + ++V++ + D +  +K+ K  FMK F+G ++VEPL VD   LC    P +  +
Sbjct  137  WSGAIPIELIVEENQTDLTAKYKKEKMMFMKVFDGSYKVEPLYVDSVRLCRHNEPKSPQE  196

Query  588  YVSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARI  418
            Y   + G+GRI SKV+++Q  QP   PP   PP SW++R IT +TT  ++  LQ  +  +
Sbjct  197  YKICSGGQGRIASKVTMDQYFQP--YPPFNLPPFSWFIRDITIRTTITLLKMLQHASVVV  254

Query  417  R  415
            R
Sbjct  255  R  255



>ref|XP_001766483.1| predicted protein [Physcomitrella patens]
 gb|EDQ68811.1| predicted protein [Physcomitrella patens]
Length=279

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 81/120 (68%), Gaps = 11/120 (9%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            +SGT+SV VLVDQ R  H MN+K  K GFMK+F+G W+V+PL VD +      P + AD 
Sbjct  121  FSGTLSVCVLVDQDRRLHMMNYKLAKHGFMKQFDGTWKVDPLYVDAQGIPA--PEHAAD-  177

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
                    R+ S ++L+Q++QPA+VPPPP   YVR ITT+TTEM++ DLQAE  R+R  S
Sbjct  178  --------RVASIITLQQVVQPAVVPPPPFKNYVRKITTRTTEMLLQDLQAEGKRLREGS  229



>ref|NP_173771.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC98014.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
 gb|AAS65951.1| At1g23580 [Arabidopsis thaliana]
 gb|AAS92320.1| At1g23580 [Arabidopsis thaliana]
 gb|AEE30407.1| uncharacterized protein AT1G23580 [Arabidopsis thaliana]
Length=285

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 73/118 (62%), Gaps = 6/118 (5%)
 Frame = -1

Query  756  TISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDE-ELCHPYRPNNLADYVS  580
             I + ++VD+ R D +  +K+ K  FMK FEG ++VEP+ VD   LC   +P ++ +Y  
Sbjct  150  AIPISLIVDENRRDLTAKYKKEKMMFMKVFEGSYKVEPVYVDSVRLCKNKKPKSVDEYKK  209

Query  579  YTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIR  415
             + G+G+I SKV+++Q  QP   PP   PP SW++R IT K T+ ++  LQ+ +  IR
Sbjct  210  CSGGQGKIASKVTMDQYFQP--YPPFNLPPFSWFIRDITIKNTKSVLERLQSWSFSIR  265



>gb|AAC98013.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
Length=315

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 6/120 (5%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  + + ++VD+ R+D +  +K+ K   MK FEG +RVEPL VD E LC+   P + A+Y
Sbjct  162  SFAVPISLIVDENRKDLTAKYKKKKMILMKVFEGSYRVEPLYVDSERLCNNMEPKSPAEY  221

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIR  415
               + G+GRI SKV++ Q  +P   PP   PP+SWY+R +T K T+  +  LQ     +R
Sbjct  222  KRCSGGQGRIASKVTMNQYFKP--YPPFNLPPLSWYIRKVTIKNTKTALKTLQTWGINLR  279



>emb|CDY25795.1| BnaA07g09870D [Brassica napus]
Length=151

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 80/124 (65%), Gaps = 2/124 (2%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   ++GTI +HV++D+  +  +  +K+VK  +MK FEG W++E L VD++ LC      
Sbjct  21   KILGYNGTIPIHVIIDEKHQKVTAAYKKVKVKYMKVFEGSWKMESLYVDQQRLCKSRSRI  80

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +  +Y   + GKGRIGSKV++E + QP +L+  PP+SW++RGI  K T+ ++ DL+    
Sbjct  81   SEEEYKKCSGGKGRIGSKVTMEHIFQPSSLLNVPPVSWFIRGIAVKVTKALLQDLREYVI  140

Query  423  RIRR  412
            R+ +
Sbjct  141  RMNK  144



>ref|XP_010477666.1| PREDICTED: uncharacterized protein LOC104756732 isoform X3 [Camelina 
sativa]
Length=223

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 70/119 (59%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNNLAD  589
            W       ++ D+ +++ +  +K+ K  FMK FEG W++EPL VD E LC    P +  +
Sbjct  103  WYRAFPFTLIADENQKEFTAKYKKEKMMFMKVFEGSWKIEPLYVDSERLCKEREPKSREE  162

Query  588  YVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+G++ SKV+++Q  QP + +  PP SWY+R IT KTT+ ++  +Q  +   R
Sbjct  163  YKRCSGGQGKVASKVTMDQYFQPYSFLNLPPSSWYIRRITIKTTKRLLKQIQDASIMFR  221



>ref|XP_010477663.1| PREDICTED: uncharacterized protein LOC104756732 isoform X1 [Camelina 
sativa]
 ref|XP_010477664.1| PREDICTED: uncharacterized protein LOC104756732 isoform X1 [Camelina 
sativa]
Length=273

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 70/119 (59%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            W       ++ D+ +++ +  +K+ K  FMK FEG W++EPL VD E LC    P +  +
Sbjct  153  WYRAFPFTLIADENQKEFTAKYKKEKMMFMKVFEGSWKIEPLYVDSERLCKEREPKSREE  212

Query  588  YVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+G++ SKV+++Q  QP + +  PP SWY+R IT KTT+ ++  +Q  +   R
Sbjct  213  YKRCSGGQGKVASKVTMDQYFQPYSFLNLPPSSWYIRRITIKTTKRLLKQIQDASIMFR  271



>emb|CDY59740.1| BnaCnng35460D [Brassica napus]
Length=288

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 76/124 (61%), Gaps = 6/124 (5%)
 Frame = -1

Query  753  ISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSY  577
            I +H++V++ R+D +  +K+ K   MK FEG ++VEP+ VD+E LC    P +  +Y   
Sbjct  163  IPLHLIVEENRKDLTGKYKKEKVMLMKVFEGNYKVEPVYVDQERLCKKRLPKSPEEYRKC  222

Query  576  TKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            + G+G+IGSK+++ Q  +P   PP   PP SWY+RG T KT++ ++  LQ     +R + 
Sbjct  223  SGGQGKIGSKLTINQYFEP--YPPFNLPPFSWYIRGNTVKTSKNLLYALQNTAKSVRMAG  280

Query  405  STED  394
              E+
Sbjct  281  PLEE  284



>ref|XP_009112003.1| PREDICTED: uncharacterized protein LOC103837396 [Brassica rapa]
Length=283

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 78/120 (65%), Gaps = 6/120 (5%)
 Frame = -1

Query  753  ISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSY  577
            IS++++VD+ R+D    +K+ K  FMK FEG ++VEP+ VD+E LC    P    +Y   
Sbjct  152  ISMNLIVDENRKDLMTQYKKEKVRFMKAFEGNYKVEPIFVDKERLCKKRIPMTQEEYKKC  211

Query  576  TKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            + G+G++ SK++++Q  QP   PP   PP+SW++RG+T KT++ ++  +Q  +  +R ++
Sbjct  212  SGGQGKLASKLTIDQYYQP--YPPFNLPPLSWFIRGMTIKTSKSLLAQVQDTSIAMRTAT  269



>ref|XP_010477665.1| PREDICTED: uncharacterized protein LOC104756732 isoform X2 [Camelina 
sativa]
Length=256

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 70/119 (59%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNNLAD  589
            W       ++ D+ +++ +  +K+ K  FMK FEG W++EPL VD E LC    P +  +
Sbjct  136  WYRAFPFTLIADENQKEFTAKYKKEKMMFMKVFEGSWKIEPLYVDSERLCKEREPKSREE  195

Query  588  YVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+G++ SKV+++Q  QP + +  PP SWY+R IT KTT+ ++  +Q  +   R
Sbjct  196  YKRCSGGQGKVASKVTMDQYFQPYSFLNLPPSSWYIRRITIKTTKRLLKQIQDASIMFR  254



>emb|CDY16800.1| BnaA09g05820D [Brassica napus]
Length=283

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 78/120 (65%), Gaps = 6/120 (5%)
 Frame = -1

Query  753  ISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSY  577
            IS++++VD+ R+D    +K+ K  FMK FEG ++VEP+ VD+E LC    P    +Y   
Sbjct  152  ISMNLIVDENRKDLMTQYKKEKVRFMKAFEGNYKVEPIFVDKERLCKKRIPMTQEEYKKC  211

Query  576  TKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            + G+G++ SK++++Q  QP   PP   PP+SW++RG+T KT++ ++  +Q  +  +R ++
Sbjct  212  SGGQGKLASKLTIDQYYQP--YPPFNLPPLSWFIRGMTIKTSKSLLAQVQDTSIAMRTAT  269



>ref|XP_002879144.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55403.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=292

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 80/124 (65%), Gaps = 2/124 (2%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  I +H+++D+  ++ +  FK+ K  +MK FEG W+VEPL  D+E LC      N  +Y
Sbjct  169  SIAIPIHLIIDENHQNLTAKFKKKKMMYMKVFEGSWKVEPLYADQERLCKSRSRINGEEY  228

Query  585  VSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRS  409
               + GKGRIGSKV++EQ+ QP +L+  PPISW++R IT KT + ++ DL+     + +S
Sbjct  229  KKCSGGKGRIGSKVTMEQIFQPCSLLNVPPISWFIREITIKTFKNLLEDLRQFVIDMHKS  288

Query  408  SSTE  397
            S +E
Sbjct  289  SDSE  292



>gb|AAC98019.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
 gb|AAY78618.1| unknown [Arabidopsis thaliana]
Length=264

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 74/115 (64%), Gaps = 2/115 (2%)
 Frame = -1

Query  753  ISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSY  577
            I +H+++ +  ++ +  +   K   MK F+G W+VEP  VD+E LC    P +  +Y   
Sbjct  148  IPIHLIIHENHKNLTAKYTTKKMMLMKVFKGSWKVEPDYVDQERLCKSRSPKSREEYKIC  207

Query  576  TKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            + G+G++GSKV++EQ+ +P+ L+  PP+SW +RGIT +TT++++ DL+     +R
Sbjct  208  SGGQGKVGSKVTMEQIFEPSSLLNRPPVSWIIRGITIRTTKILLEDLRKAGTTLR  262



>ref|XP_009110095.1| PREDICTED: uncharacterized protein LOC103835660 [Brassica rapa]
Length=301

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 76/122 (62%), Gaps = 7/122 (6%)
 Frame = -1

Query  756  TISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVS  580
            +I +H+ +++ R+D +  +K+ K   MK F G ++VEP+ VD++ LC   RP    +Y  
Sbjct  163  SIPLHLTMEENRKDLTTKYKKGKVMLMKEFHGDYKVEPIYVDQKRLCKKRRPKTPEEYKK  222

Query  579  YTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIRRS  409
             + G+GRIGSK+++    QP   PP   PP+SW++ GIT KT++ ++N LQ E A I R 
Sbjct  223  CSGGQGRIGSKLTINHYFQP--YPPFNIPPLSWFIHGITIKTSKNLLNALQ-EMALIVRE  279

Query  408  SS  403
            + 
Sbjct  280  AG  281



>ref|NP_173778.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30415.1| uncharacterized protein AT1G23660 [Arabidopsis thaliana]
Length=264

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 75/118 (64%), Gaps = 2/118 (2%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  I +H+++D+  ++ +  ++     F+K  EG W+V P  VD+E LC    P +  +Y
Sbjct  145  SRAIPIHLVIDENHKNLTAKYRTKNMMFLKVLEGSWKVVPDFVDQERLCKSRLPKSREEY  204

Query  585  VSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
               + G+G++GSKV++EQ+ +P+ L+  PP+SW +RGIT KTT++++ D++     +R
Sbjct  205  KRCSGGQGKVGSKVTMEQIFKPSPLLNLPPVSWIIRGITIKTTKILLEDIRKAGTTLR  262



>emb|CDY57833.1| BnaCnng32530D [Brassica napus]
Length=303

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 76/124 (61%), Gaps = 6/124 (5%)
 Frame = -1

Query  753  ISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSY  577
            I +H++V++  +D +  +K+ K  FMK FEG ++VEP+ VD+E LC    P N  +Y   
Sbjct  163  IPLHLIVEENEKDLTGKYKKEKVMFMKVFEGNFKVEPVYVDQERLCKKKLPKNQEEYKKC  222

Query  576  TKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            + G+G+  SK+++ Q  +P   PP   PP+SWY+RG T KT++ ++  LQ  +  IR + 
Sbjct  223  SGGQGKTASKLTINQYFEP--YPPFNLPPLSWYIRGSTIKTSKNLLIALQNTSKIIRTAK  280

Query  405  STED  394
              ED
Sbjct  281  LPED  284



>emb|CDY25794.1| BnaA07g09880D [Brassica napus]
Length=379

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   ++GTI +H+++D+  +  +  +K+VK   MK FEG W+++PL VD+E LC      
Sbjct  247  KILGYNGTIPIHLIIDENHQKVTATYKKVKVKHMKVFEGSWKIQPLYVDQERLCKSKSRI  306

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQ  436
            +   Y   + GKGRIGSKV++E + QP+ L+  PP+SW++RGI  K T++++ DL+
Sbjct  307  SEEKYKKCSGGKGRIGSKVTMEHIFQPSPLLNVPPVSWFIRGIAVKVTKVLLQDLR  362



>ref|XP_006416077.1| hypothetical protein EUTSA_v10008736mg [Eutrema salsugineum]
 gb|ESQ34430.1| hypothetical protein EUTSA_v10008736mg [Eutrema salsugineum]
Length=219

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 72/120 (60%), Gaps = 8/120 (7%)
 Frame = -1

Query  765  WSGTISVHV-LVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLA  592
            WSGTI + +  +++ RE       + +  +M  FEG + VEP+ VD E  C   +P +  
Sbjct  103  WSGTIPIRLYFIEKPRE-----LAKNEMRYMAMFEGSYEVEPMYVDSERFCKHMKPKSRE  157

Query  591  DYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            +Y   + G+GRI SKV L+Q+ +P+ L   PPISW++R +T KTT+ +  DLQ  +A IR
Sbjct  158  EYRKCSGGQGRIASKVKLDQIFKPSPLFNVPPISWFIRKVTVKTTKTLAEDLQTASAVIR  217



>ref|XP_010460138.1| PREDICTED: uncharacterized protein LOC104741062 isoform X2 [Camelina 
sativa]
Length=264

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 71/123 (58%), Gaps = 4/123 (3%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   WSGTI + +   + R+  S  + + K  FMK FEG W+VEP+ VD E LC   +P 
Sbjct  142  KFLSWSGTIPITLDFVENRKKISAVYMKNKMKFMKTFEGSWKVEPVYVDSERLCKNMKPK  201

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +  +Y   +   G I SKV++ Q  QP+ L+  PP+SWY+R IT   T+ ++ DLQ   A
Sbjct  202  SREEYQKCS--GGHIASKVTMNQTFQPSTLLNLPPLSWYIRKITITITKNLVQDLQDRGA  259

Query  423  RIR  415
             IR
Sbjct  260  IIR  262



>emb|CDY25797.1| BnaA07g09850D [Brassica napus]
Length=306

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   ++GTI +HV++D+  +  +  +K+VK  +MK FEG W++EPL VD++ LC      
Sbjct  176  KILGYNGTIPIHVIIDENHQKVTATYKKVKVKYMKVFEGSWKMEPLYVDQQRLCKSRSRI  235

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQ  436
            +  +Y   + GKGRIGSKV++E + QP +L+  PP+SW++RGI  K T+ ++ DL+
Sbjct  236  SEEEYKKCSGGKGRIGSKVTMEHIFQPSSLLNVPPVSWFIRGIAVKVTKALLQDLR  291



>ref|XP_010477659.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104756728 
[Camelina sativa]
Length=465

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            +SG I +H+++ +  ++ +  +   K   MK FEG W+VEP  VD+E LC    P +  +
Sbjct  345  FSGDIPIHLIIHENHKNLTAKYTTKKMMLMKVFEGSWKVEPDYVDQERLCKTRLPKSREE  404

Query  588  YVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR  412
            Y   + G+G++GSKV +EQ+ QP +L+  PPIS  +RGIT KTT+ ++ DL+     +R+
Sbjct  405  YKICSGGQGKVGSKVIMEQIFQPSSLLNTPPISGIIRGITIKTTKNLLEDLRKAGITLRK  464



>ref|XP_010460137.1| PREDICTED: uncharacterized protein LOC104741062 isoform X1 [Camelina 
sativa]
Length=325

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 71/123 (58%), Gaps = 4/123 (3%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   WSGTI + +   + R+  S  + + K  FMK FEG W+VEP+ VD E LC   +P 
Sbjct  203  KFLSWSGTIPITLDFVENRKKISAVYMKNKMKFMKTFEGSWKVEPVYVDSERLCKNMKPK  262

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +  +Y   +   G I SKV++ Q  QP+ L+  PP+SWY+R IT   T+ ++ DLQ   A
Sbjct  263  SREEYQKCS--GGHIASKVTMNQTFQPSTLLNLPPLSWYIRKITITITKNLVQDLQDRGA  320

Query  423  RIR  415
             IR
Sbjct  321  IIR  323



>emb|CDX87227.1| BnaC09g05420D [Brassica napus]
Length=283

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = -1

Query  753  ISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSY  577
            IS++++VD+ R+D    +K+ K  FMK FEG ++VEP+ VD+E LC    P    +Y   
Sbjct  152  ISMNLIVDENRKDLMTQYKKEKVRFMKAFEGNYKVEPIFVDKERLCKKRIPMTREEYKKC  211

Query  576  TKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            + G+G++ SK++++Q  QP +    PP+SW++RG+T KT++ ++  +Q  +  +R ++
Sbjct  212  SGGQGKVASKLTIDQYYQPYSPFNLPPLSWFIRGMTVKTSKSLLAQVQDTSIAVRTAT  269



>ref|XP_002893290.1| hypothetical protein ARALYDRAFT_889898 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69549.1| hypothetical protein ARALYDRAFT_889898 [Arabidopsis lyrata subsp. 
lyrata]
Length=293

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 68/114 (60%), Gaps = 6/114 (5%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  + + V+VD+ R+D +  +K+ K   MK FEG ++VEP+ VD E LC    P +  DY
Sbjct  150  SFAVPISVIVDENRKDLTAKYKKKKMILMKVFEGSYKVEPVYVDSERLCKNMEPKSPEDY  209

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQA  433
               + G+GRI SKV++ Q  +P   PP   PP+SWY+R +T K T+  +  LQ 
Sbjct  210  KRCSGGQGRIASKVTMNQYFKP--YPPFNLPPLSWYIREVTIKNTKTALKTLQT  261



>ref|XP_010477655.1| PREDICTED: uncharacterized protein LOC104756725 isoform X2 [Camelina 
sativa]
Length=231

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNNLAD  589
            WSG + + ++VD+ ++D    +K+ K  FMK FEG W++EPL VD   LC   +P N  +
Sbjct  108  WSGALPISLIVDENKKDRKAKYKKQKMMFMKVFEGSWKIEPLYVDAARLCKQMKPKNQEE  167

Query  588  YVSYTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+G+I SKV+++Q  QP      PP+S Y+R IT KTT+ ++  LQ     +R
Sbjct  168  YKKCSGGQGKIASKVTMDQYFQPYFPFNIPPLSSYIREITIKTTKTLLKMLQERATILR  226



>ref|XP_010477654.1| PREDICTED: uncharacterized protein LOC104756725 isoform X1 [Camelina 
sativa]
Length=267

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNNLAD  589
            WSG + + ++VD+ ++D    +K+ K  FMK FEG W++EPL VD   LC   +P N  +
Sbjct  144  WSGALPISLIVDENKKDRKAKYKKQKMMFMKVFEGSWKIEPLYVDAARLCKQMKPKNQEE  203

Query  588  YVSYTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+G+I SKV+++Q  QP      PP+S Y+R IT KTT+ ++  LQ     +R
Sbjct  204  YKKCSGGQGKIASKVTMDQYFQPYFPFNIPPLSSYIREITIKTTKTLLKMLQERATILR  262



>emb|CDY41437.1| BnaA08g20390D [Brassica napus]
Length=276

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 78/120 (65%), Gaps = 7/120 (6%)
 Frame = -1

Query  753  ISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSY  577
            I +H++V++  +D +  +K+ K   MK FEG +++EP+ VD+E LC    P +  +Y   
Sbjct  158  IPLHLIVEENEQDLTGKYKKEKVMLMKVFEGNYKLEPVYVDQERLCKKRLPKSQEEYKKC  217

Query  576  TKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            + G+G+I +K+ + Q  +P   PP   PP+SWY+RG T KT++ ++N LQ +TA+I RS+
Sbjct  218  SGGQGKIATKLIINQYFEP--YPPFNLPPLSWYIRGNTIKTSKNLLNALQ-DTAKIIRST  274



>ref|NP_173776.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30413.1| uncharacterized protein AT1G23640 [Arabidopsis thaliana]
Length=424

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 74/115 (64%), Gaps = 2/115 (2%)
 Frame = -1

Query  753  ISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSY  577
            I +H+++ +  ++ +  +   K   MK F+G W+VEP  VD+E LC    P +  +Y   
Sbjct  308  IPIHLIIHENHKNLTAKYTTKKMMLMKVFKGSWKVEPDYVDQERLCKSRSPKSREEYKIC  367

Query  576  TKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            + G+G++GSKV++EQ+ +P+ L+  PP+SW +RGIT +TT++++ DL+     +R
Sbjct  368  SGGQGKVGSKVTMEQIFEPSSLLNRPPVSWIIRGITIRTTKILLEDLRKAGTTLR  422


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD  631
            WSG   ++++VD  ++D +  +K+ K  FMK FEG W++EPL VD
Sbjct  106  WSGEFPINLIVDVNKKDLTAKYKKEKMMFMKVFEGNWKIEPLYVD  150



>ref|XP_010477653.1| PREDICTED: uncharacterized protein LOC104756724 [Camelina sativa]
Length=170

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 69/120 (58%), Gaps = 6/120 (5%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  + + + VD+ R+D +  +K+ K   MK F+G ++VEPL VD E LC    P +  +Y
Sbjct  33   SFAVPISLTVDENRKDFTAKYKKEKMMLMKVFKGSYKVEPLYVDSERLCKHMEPKSKEEY  92

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIR  415
               + G+G+I SKV ++Q  QP   PP   PP SW++R IT K T+ ++  LQ     IR
Sbjct  93   NKCSGGQGKIASKVIMDQYFQP--YPPFNLPPFSWFIRDITIKNTKNVLKTLQRWGFSIR  150



>ref|XP_009110094.1| PREDICTED: uncharacterized protein LOC103835657 [Brassica rapa]
Length=282

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 77/120 (64%), Gaps = 7/120 (6%)
 Frame = -1

Query  753  ISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSY  577
            I +H++V++  +D +  +K+ K   MK FEG +++EP+ VD+E LC    P +  +Y   
Sbjct  164  IPLHLIVEENEQDLTGKYKKEKVMLMKVFEGNYKLEPVYVDQERLCKKRLPKSQEEYKKC  223

Query  576  TKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            + G+G I +K+ + Q  +P   PP   PP+SWY+RG T KT++ ++N LQ +TA+I RS+
Sbjct  224  SGGQGNIATKLIINQYFEP--YPPFNLPPLSWYIRGNTIKTSKNLLNALQ-DTAKIIRST  280



>ref|XP_002893295.1| hypothetical protein ARALYDRAFT_889903 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69554.1| hypothetical protein ARALYDRAFT_889903 [Arabidopsis lyrata subsp. 
lyrata]
Length=94

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 2/83 (2%)
 Frame = -1

Query  678  MKRFEGCWRVEPLLVD-EELCHPYRPNNLADYVSYTKGKGRIGSKVSLEQLIQP-ALVPP  505
            MK FEG W+VEPL VD E LC+   P     Y   ++GKGRI SKV++E + QP +L+  
Sbjct  4    MKVFEGSWKVEPLYVDSERLCNQREPKCREKYKRCSRGKGRIASKVTMEHIFQPSSLLNL  63

Query  504  PPISWYVRGITTKTTEMIINDLQ  436
            PP SW +RG T KTT++++ DL+
Sbjct  64   PPFSWIIRGYTIKTTKILLEDLR  86



>ref|XP_006416076.1| hypothetical protein EUTSA_v10008486mg [Eutrema salsugineum]
 gb|ESQ34429.1| hypothetical protein EUTSA_v10008486mg [Eutrema salsugineum]
Length=265

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 70/119 (59%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            WS  I +  +  + ++D S  + + K  FMK FEG W+VEP+ VD + LC    P +  D
Sbjct  145  WSRAIPITFVFAENQKDLSAVYMKKKMMFMKDFEGSWQVEPIFVDSQRLCKHRLPKSQED  204

Query  588  YVSYTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+G+I SKV +     P+     PP+SWY+RGI  KTT+ ++ DLQA  ARIR
Sbjct  205  YRQCSGGQGKIASKVKMNLTFMPSSPFNLPPVSWYIRGIVIKTTKTLLQDLQATCARIR  263



>emb|CDY57836.1| BnaCnng32560D [Brassica napus]
Length=377

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 78/120 (65%), Gaps = 7/120 (6%)
 Frame = -1

Query  753  ISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSY  577
            I +H++V++  +D +  +K+ K   MK FEG +++EP+ VD+E LC    P +  +Y   
Sbjct  259  IPLHLIVEENEKDLTGKYKKEKVMLMKVFEGNYKLEPVYVDQERLCKKRLPKSQEEYKKC  318

Query  576  TKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            + G+G+I +K+ + Q  +P   PP   PP+SWY+RG T KT++ ++N LQ +TA+I RS+
Sbjct  319  SGGQGKIATKLIINQYFEP--YPPFNLPPLSWYIRGNTIKTSKNLLNALQ-DTAKIIRST  375



>emb|CDX91721.1| BnaC08g06400D [Brassica napus]
Length=491

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 77/126 (61%), Gaps = 4/126 (3%)
 Frame = -1

Query  756  TISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVS  580
            +I +H+ +++ R+D + N+K+ K   MK F G ++VEP+ VD++ LC    P +  +Y  
Sbjct  162  SIPIHLTMEENRKDLTTNYKKGKVILMKEFHGNYKVEPIYVDQKRLCKKRLPKSPEEYKK  221

Query  579  YTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQ--AETARIRRS  409
             + G+GRIGSK+++    QP      PP+SW++RG T KT++ ++N +Q  A + R    
Sbjct  222  CSGGQGRIGSKLTINHYFQPYRPFNIPPLSWFIRGNTIKTSKKLLNGIQDLASSFRGAEP  281

Query  408  SSTEDL  391
             S ED+
Sbjct  282  PSEEDM  287



>ref|XP_001752924.1| predicted protein [Physcomitrella patens]
 gb|EDQ82428.1| predicted protein [Physcomitrella patens]
Length=222

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 70/121 (58%), Gaps = 12/121 (10%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADYV  583
            SGT S  V+V+Q RE+  M F   + G MK+F G W++EP+L   EL    R NN     
Sbjct  114  SGTFSSRVIVEQNREEKLMLFDLSRQGMMKKFSGSWKIEPMLAS-ELSIGSRENNATP--  170

Query  582  SYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSSS  403
                     GS V+ +Q+++PA+VPP P++ YVRG+T +    ++ DLQ E  R+ + ++
Sbjct  171  ---------GSWVNFQQVLEPAIVPPWPLNGYVRGVTERIIREMLADLQLECLRLSQVNN  221

Query  402  T  400
            +
Sbjct  222  S  222



>emb|CDY41435.1| BnaA08g20370D [Brassica napus]
Length=303

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 75/124 (60%), Gaps = 6/124 (5%)
 Frame = -1

Query  753  ISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSY  577
            I +H++V++  +D +  +K+ K  FMK FEG ++VEP+ VD+E LC    P +  +Y   
Sbjct  163  IPLHLIVEENEKDLTGKYKKEKVMFMKVFEGNFKVEPVYVDQERLCKKKLPKDQEEYKKC  222

Query  576  TKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            + G+G+  SK+++ Q  +P   PP   PP+SWY+RG T K ++ ++  LQ  +  IR + 
Sbjct  223  SGGEGKTASKLTINQYFEP--YPPFNLPPLSWYIRGSTIKASKNLLIALQNTSKIIRIAK  280

Query  405  STED  394
              ED
Sbjct  281  LPED  284



>ref|XP_009110750.1| PREDICTED: uncharacterized protein LOC103836254 [Brassica rapa]
Length=314

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 75/124 (60%), Gaps = 6/124 (5%)
 Frame = -1

Query  753  ISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSY  577
            I +H++V++  +D +  +K+ K  FMK FEG ++VEP+ VD+E LC    P +  +Y   
Sbjct  174  IPLHLIVEENEKDLTGKYKKEKVMFMKVFEGNFKVEPVYVDQERLCKKKLPKDQEEYKKC  233

Query  576  TKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            + G+G+  SK+++ Q  +P   PP   PP+SWY+RG T K ++ ++  LQ  +  IR + 
Sbjct  234  SGGEGKTASKLTINQYFEP--YPPFNLPPLSWYIRGSTIKASKNLLIALQNTSKIIRIAK  291

Query  405  STED  394
              ED
Sbjct  292  LPED  295



>gb|AAC98021.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
Length=287

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMN--FKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLA  592
            S  I +H+++D+  ++ ++   ++     F+K  EG W+V P  VD+E LC    P +  
Sbjct  166  SRAIPIHLVIDENHKNLTVKAKYRTKNMMFLKVLEGSWKVVPDFVDQERLCKSRLPKSRE  225

Query  591  DYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            +Y   + G+G++GSKV++EQ+ +P+ L+  PP+SW +RGIT KTT++++ D++     +R
Sbjct  226  EYKRCSGGQGKVGSKVTMEQIFKPSPLLNLPPVSWIIRGITIKTTKILLEDIRKAGTTLR  285



>ref|XP_006306462.1| hypothetical protein CARUB_v10012413mg [Capsella rubella]
 gb|EOA39360.1| hypothetical protein CARUB_v10012413mg [Capsella rubella]
Length=299

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKT--GFMKRFEGCWRVEPLLVDEE-LCHPYR  607
            K   +SGT  +H+++D+  ++ +  F + K    +MK FEGCW++EPL VD E LC+   
Sbjct  173  KFLLFSGTTPIHLIIDENHQNLTAKFTKKKNTMKYMKIFEGCWKLEPLFVDSERLCNQRE  232

Query  606  PNNLADYVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISW  490
            P +  +Y   ++GKGRIGS V++E + QP +L+  PP+SW
Sbjct  233  PKSQEEYKRCSRGKGRIGSTVTMELIFQPSSLLNLPPVSW  272



>emb|CDX91720.1| BnaC08g06390D [Brassica napus]
Length=318

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 74/120 (62%), Gaps = 3/120 (3%)
 Frame = -1

Query  756  TISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVS  580
            +I +H+ +++ R+D +  +K+ K   MK F G ++VEP+ VD++ LC    P +  +Y  
Sbjct  180  SIPLHLTMEENRKDLTTKYKKGKVMLMKEFHGDYKVEPIYVDQKRLCKKRLPKSPEEYKK  239

Query  579  YTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQAETARIRRSSS  403
             + G+GRIGSK+++    QP      PP+SW++ GIT KT++ ++N LQ E A I R + 
Sbjct  240  CSGGQGRIGSKLTINHYFQPYRPFNIPPLSWFIHGITIKTSKNLLNALQ-EMALIVREAG  298



>ref|XP_010480623.1| PREDICTED: uncharacterized protein LOC104759388 [Camelina sativa]
Length=175

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 74/111 (67%), Gaps = 2/111 (2%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S ++ + ++V+  ++D + N+K+ K  FMK FEG W+VEPL +D E LC   +P    +Y
Sbjct  65   SRSLPIKLIVEDNQKDLTGNYKKKKVKFMKVFEGSWKVEPLFIDSERLCKQIKPKGREEY  124

Query  585  VSYTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQ  436
               + G+GRI SKV+++Q  +P+  +  PP SW++RGIT KTT+ +IN L+
Sbjct  125  KKCSGGRGRIASKVTIDQYFEPSSPLNLPPFSWFIRGITIKTTKNLINMLE  175



>ref|NP_001185073.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30421.1| uncharacterized protein AT1G23690 [Arabidopsis thaliana]
Length=225

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = -1

Query  690  KTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSYTKGKGRIGSKVSLEQLIQPA-  517
            K  FMK FEG W++EPL VD E LC   +P +  +Y   + G+G++ SKV+++Q  QP  
Sbjct  130  KMKFMKYFEGKWKIEPLYVDSERLCKDRKPKSREEYKRCSGGEGKVASKVTMDQYFQPYF  189

Query  516  LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            L+  PP+SWY+RGIT KTT+ ++  +Q  +   R
Sbjct  190  LLNLPPLSWYIRGITIKTTKNLLILIQNASIMFR  223



>ref|XP_006304618.1| hypothetical protein CARUB_v10011702mg [Capsella rubella]
 gb|EOA37516.1| hypothetical protein CARUB_v10011702mg [Capsella rubella]
Length=296

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 70/125 (56%), Gaps = 6/125 (5%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  I + V+VD+ R++ +  +K+ +   MK F+G ++VEPL VD E LC    P +  +Y
Sbjct  153  SFAIPISVIVDENRKELTAKYKKKRMVLMKVFKGSYKVEPLYVDSERLCKNIEPKSPEEY  212

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARIR  415
               + GKGRI SKV++ Q  QP   PP   PP+SWY+  +T K T+  +  LQ     IR
Sbjct  213  KRCSCGKGRIASKVTINQYFQP--YPPFNLPPLSWYICSVTIKNTKTALKTLQTWGISIR  270

Query  414  RSSST  400
                T
Sbjct  271  NPGVT  275



>emb|CDY54285.1| BnaC07g48260D [Brassica napus]
Length=297

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 74/126 (59%), Gaps = 17/126 (13%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   ++GTI +HV++D   E+H            ++  G W++EPL VD+E LC      
Sbjct  183  KILGYNGTIPIHVIID---ENH------------QKVTGSWKMEPLYVDQERLCKSRSRI  227

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +  +Y   + GKGRIGSKV++E + QP+ L+  PP+SW++RGI  K T+ ++ DL+    
Sbjct  228  SEEEYKKCSSGKGRIGSKVTMEHIFQPSSLLNIPPVSWFIRGIAIKFTKALLQDLREHVI  287

Query  423  RIRRSS  406
             I +S+
Sbjct  288  MINKST  293



>ref|XP_010477660.1| PREDICTED: uncharacterized protein LOC104756729 [Camelina sativa]
Length=270

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 6/121 (5%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDE-ELCHPYRPNNLAD  589
            WSG+I + ++VD+ ++  +  +K+ K  FMK FEG ++VEPL  D   LC    P +L +
Sbjct  151  WSGSIPIELIVDENQKKFTAKYKKEKMIFMKVFEGSYKVEPLYADSVRLCKQKEPKSLQE  210

Query  588  YVSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETARI  418
            Y + +  +GRI SKV+++Q  QP   PP   PP SW++R IT KTT  ++  LQ  +  +
Sbjct  211  YKTCSGERGRIASKVTMDQYFQP--YPPFNLPPFSWFIRDITIKTTTTLLKMLQHASVVL  268

Query  417  R  415
            R
Sbjct  269  R  269



>emb|CDY25792.1| BnaA07g09900D [Brassica napus]
Length=296

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 74/126 (59%), Gaps = 17/126 (13%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   ++GTI +HV++D   E+H            ++  G W++EPL VD+E LC      
Sbjct  183  KILGYNGTIPIHVIID---ENH------------QKVTGSWKMEPLYVDQERLCKSRSRI  227

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETA  424
            +  +Y   + GKGRIGSKV++E + QP+ L+  PP+SW++RG+  K T+ ++ DL+    
Sbjct  228  SEEEYKKCSSGKGRIGSKVTMEHIFQPSSLLNIPPVSWFIRGVAIKFTKALLQDLREYVI  287

Query  423  RIRRSS  406
             I +S+
Sbjct  288  MINKST  293



>ref|XP_002893302.1| hypothetical protein ARALYDRAFT_313228 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69561.1| hypothetical protein ARALYDRAFT_313228 [Arabidopsis lyrata subsp. 
lyrata]
Length=273

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            W G     ++VD+ ++D    +K+ K  FMK FEG W++E L VD E LC    P +  +
Sbjct  153  WCGAFPFTLIVDENQKDFRAKYKKKKMMFMKVFEGKWKIESLYVDSERLCKDREPKSREE  212

Query  588  YVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+G++ SKV+++Q  QP  L+  PP+SWY+RGIT KTT+ ++  +Q  +   R
Sbjct  213  YKRCSGGQGKVASKVTMDQYFQPYFLLNIPPLSWYIRGITIKTTKKLLKLIQNASIMFR  271



>gb|AAF79594.1|AC007945_14 F28C11.14 [Arabidopsis thaliana]
Length=254

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = -1

Query  660  CWRVEPLLVDEE-LCHPYRPNNLADYVSYTKGKGRIGSKVSLEQLIQPALV-PPPPISWY  487
             ++VEPL VD E LC   +P +  +Y   ++G+GRIGSKV+L+Q+ +P+ +   PPISWY
Sbjct  169  TYKVEPLYVDSERLCKQKKPKSTEEYERCSRGQGRIGSKVTLDQMFKPSFIFNLPPISWY  228

Query  486  VRGITTKTTEMIINDLQAETARIR  415
            VR IT KT + +I DLQ  +A IR
Sbjct  229  VRRITIKTMKTLIEDLQITSAMIR  252



>gb|AAC98007.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
Length=251

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 58/83 (70%), Gaps = 2/83 (2%)
 Frame = -1

Query  657  WRVEPLLVDEE-LCHPYRPNNLADYVSYTKGKGRIGSKVSLEQLIQPALV-PPPPISWYV  484
            ++VEPL VD E LC   +P +  +Y   ++G+GRIGSKV+L+Q+ +P+ +   PPISWYV
Sbjct  167  YKVEPLYVDSERLCKQKKPKSTEEYERCSRGQGRIGSKVTLDQMFKPSFIFNLPPISWYV  226

Query  483  RGITTKTTEMIINDLQAETARIR  415
            R IT KT + +I DLQ  +A IR
Sbjct  227  RRITIKTMKTLIEDLQITSAMIR  249



>ref|XP_006305975.1| hypothetical protein CARUB_v10011238mg [Capsella rubella]
 gb|EOA38873.1| hypothetical protein CARUB_v10011238mg [Capsella rubella]
Length=113

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = -1

Query  681  FMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSYTKGKGRIGSKVSLEQLIQPALVPP  505
             MK F+G ++VEPL VD E LC    P +  +Y   ++G+G+I SKV ++Q  QP   PP
Sbjct  3    LMKVFKGSYKVEPLYVDSERLCKRMEPESAEEYQKCSRGQGKIASKVIMDQYFQP--YPP  60

Query  504  ---PPISWYVRGITTKTTEMIINDLQAETARIR  415
               PP SW++RGIT KTT+ ++N LQ     IR
Sbjct  61   LNLPPCSWFIRGITIKTTKNVLNKLQRWGFSIR  93



>emb|CDY69838.1| BnaCnng65610D, partial [Brassica napus]
Length=152

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 72/110 (65%), Gaps = 2/110 (2%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   ++G I +HV++D+  +  +  +K+VK  +MK FEG W++EPL VD+E LC      
Sbjct  35   KILGYNGAIPIHVIIDENHQKVTATYKKVKVKYMKVFEGSWKMEPLYVDQERLCKSRSRI  94

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEM  454
            +  ++   +  KGRIGSKV+ E + QP +L+  PP+SW++RGI+ K T++
Sbjct  95   SEEEHKKCSGSKGRIGSKVTKEHIFQPSSLLNVPPVSWFIRGISVKVTKV  144



>ref|XP_006303865.1| hypothetical protein CARUB_v10012631mg [Capsella rubella]
 gb|EOA36763.1| hypothetical protein CARUB_v10012631mg [Capsella rubella]
Length=176

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = -1

Query  681  FMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSYTKGKGRIGSKVSLEQLIQP-ALVP  508
            FMK F+G W++EP+ VD E LC   +P +L +Y + + G+GRI SKV ++Q  QP +   
Sbjct  85   FMKVFKGNWKIEPIYVDSERLCKQKKPKSLQEYKTCSGGQGRIASKVIMDQYFQPYSPFN  144

Query  507  PPPISWYVRGITTKTTEMIINDLQAETARIR  415
             PPISW++R  T +TT+ ++  LQ  +  +R
Sbjct  145  LPPISWFIRDFTIRTTKTLLKMLQYASVTLR  175



>ref|XP_006303770.1| hypothetical protein CARUB_v10011997mg [Capsella rubella]
 gb|EOA36668.1| hypothetical protein CARUB_v10011997mg [Capsella rubella]
Length=272

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 65/119 (55%), Gaps = 2/119 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            WSG I +     + R+  ++++      F+   EG +++EPL VD E  C   +P    +
Sbjct  152  WSGAIPITASFLEQRKLLTVDYSIENEMFINMLEGQYKLEPLFVDSERFCKHMKPKCREE  211

Query  588  YVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGITTKTTEMIINDLQAETARIR  415
            Y   + G+GRI +KV +EQ+ +P  L   PP+SW VR IT K  + II DLQ   A IR
Sbjct  212  YEKCSCGQGRIATKVKVEQVFKPTFLFNLPPLSWLVRRITIKVMKTIIQDLQINGAVIR  270



>gb|KFK44445.1| hypothetical protein AALP_AA1G257400 [Arabis alpina]
Length=109

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = -1

Query  681  FMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSYTKGKGRIGSKVSLEQLIQP-ALVP  508
            FMK FEG ++VEP+ VD++ LC    P    +Y   + G+G+I SKV ++Q  QP  L+ 
Sbjct  3    FMKVFEGSFKVEPIYVDQKRLCKHMVPKTQKEYKKCSGGQGKIASKVVMDQYFQPYPLLN  62

Query  507  PPPISWYVRGITTKTTEMIINDLQAETARIRRSSST  400
             PP SWY+R  T KTT+ ++  LQ     +R S  T
Sbjct  63   LPPFSWYIREKTIKTTKNLLESLQKLCGLMRNSDPT  98



>gb|AAC98017.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
Length=178

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 58/103 (56%), Gaps = 8/103 (8%)
 Frame = -1

Query  705  NFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSYTKGKGRIGSKVSLEQL  529
            +F + K  FMK FEG W+VEPL VD+E  C     N+  +Y   + G+GRI S  S    
Sbjct  82   DFMKEKMKFMKVFEGSWKVEPLYVDQERFCRSRSVNSQEEYKKCSGGRGRIASMPS----  137

Query  528  IQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSSST  400
                L+  PP+SW +RGIT K T+M++ DL+     I +S  T
Sbjct  138  ---TLLNLPPVSWIIRGITIKITKMLLEDLRKYVIMIHKSDVT  177



>ref|XP_002893301.1| hypothetical protein ARALYDRAFT_889909 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69560.1| hypothetical protein ARALYDRAFT_889909 [Arabidopsis lyrata subsp. 
lyrata]
Length=255

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 58/87 (67%), Gaps = 4/87 (5%)
 Frame = -1

Query  699  KQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSYTKGKGRIGSKVSLEQLIQ  523
            +Q K  ++  FEG W+VEPL +D E LC   +P +  +Y   + G+GRI SKV++EQ+ Q
Sbjct  168  RQPKISYL--FEGSWKVEPLFIDSERLCKQIKPKSREEYKKCSGGRGRIASKVTMEQIFQ  225

Query  522  PAL-VPPPPISWYVRGITTKTTEMIIN  445
            P+  +  PP SW +RGIT KTT+ +++
Sbjct  226  PSFPLNLPPFSWIIRGITIKTTKNLLD  252



>gb|AAC98018.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
Length=276

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 57/88 (65%), Gaps = 3/88 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDE-ELCHPYRPNNLAD  589
            WSG I + ++VD+ +++ +  +K+ K  FMK FEG ++VEPL VD   LC+   P +  +
Sbjct  180  WSGAIPIELIVDENQKEFTAKYKKEKMMFMKVFEGNYKVEPLYVDSVRLCNNKEPKSFQE  239

Query  588  YVSYTKGKGRIGSKVSLEQLIQPALVPP  505
            Y + + G+GRI SKV+++Q  QP   PP
Sbjct  240  YKTCSGGQGRIASKVTMDQYFQP--YPP  265



>ref|XP_010498871.1| PREDICTED: uncharacterized protein LOC104776482 isoform X3 [Camelina 
sativa]
Length=308

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 15/123 (12%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMN---------FKQVKTGFMKRFEGCWRVEPLLVDEE-LCHP  613
            S  I + V+VD+ R+D +++         +K+ +   MK F+G ++VEPL VD E LC  
Sbjct  151  SFAIPISVIVDENRKDLTVSRGDDCELAKYKKKRVMLMKVFKGSYKVEPLYVDSERLCKH  210

Query  612  YRPNNLADYVSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIIND  442
              P +  +Y   ++G+GRI SKV L Q  QP   PP   PP+S Y+R +T K T   +  
Sbjct  211  MEPKSPEEYKRCSRGQGRIASKVLLNQYFQP--YPPFNLPPLSRYIRDVTVKNTVTALKT  268

Query  441  LQA  433
            LQ+
Sbjct  269  LQS  271



>ref|XP_010460143.1| PREDICTED: uncharacterized protein LOC104741068 [Camelina sativa]
Length=253

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 64/112 (57%), Gaps = 6/112 (5%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  I + ++V + R+D +  +K+ +   MK F+G ++VEPL VD E LC    P +  +Y
Sbjct  102  SFAIPISLIVHENRKDLTTKYKKKRMMLMKVFKGSYKVEPLYVDSERLCKHMEPKSPEEY  161

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDL  439
               ++G+GRI SKV + Q  QP   PP   PP+S Y+R +T K T   +  L
Sbjct  162  KRCSRGQGRIASKVIVNQYFQP--YPPFSLPPLSKYIRDVTVKNTVTALKTL  211



>ref|XP_006306474.1| hypothetical protein CARUB_v10012439mg, partial [Capsella rubella]
 gb|EOA39372.1| hypothetical protein CARUB_v10012439mg, partial [Capsella rubella]
Length=244

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 74/112 (66%), Gaps = 2/112 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            +S T+ ++++V+  ++D + ++K+ K  FMK FEG W+VEPL +D E LC    P +  +
Sbjct  133  FSRTLPINLIVEDNQKDLTGSYKKKKVKFMKVFEGRWKVEPLFIDSERLCKQIEPKSREE  192

Query  588  YVSYTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQ  436
            Y   + G+GRI SKV+++Q  +P+  +  PP SW++R IT KT + +IN L+
Sbjct  193  YRKCSGGRGRIASKVTIDQYFEPSSPLNLPPFSWFIRRITIKTNKNLINMLK  244



>ref|XP_002893291.1| hypothetical protein ARALYDRAFT_313224 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69550.1| hypothetical protein ARALYDRAFT_313224 [Arabidopsis lyrata subsp. 
lyrata]
Length=293

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 70/130 (54%), Gaps = 16/130 (12%)
 Frame = -1

Query  762  SGTISVHVLVDQTRED----------HSMNFKQVKTGFMKRFEGCWRVEPLLVDE-ELCH  616
            S ++ + + VD+ R+D          H+  +       MK FEG ++VEPL VD   LC 
Sbjct  146  SFSVPISLTVDENRKDLTVRSFSIPAHNNQYLSFVLMMMKVFEGSYKVEPLYVDSVRLCK  205

Query  615  PYRPNNLADYVSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIIN  445
               P ++  Y   + G+G+I SKV+++Q  QP   PP   PP+SW++R IT K T+ +++
Sbjct  206  NKEPKSVEVYRKCSGGQGKIASKVTMDQYFQP--YPPFNLPPLSWFIRDITIKNTKNVLD  263

Query  444  DLQAETARIR  415
             LQ     IR
Sbjct  264  RLQLWGFSIR  273



>ref|XP_002893294.1| hypothetical protein ARALYDRAFT_889902 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69553.1| hypothetical protein ARALYDRAFT_889902 [Arabidopsis lyrata subsp. 
lyrata]
Length=335

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 66/116 (57%), Gaps = 17/116 (15%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPN  601
            K   WSGTI +H+++D+  ++                 G W+++PL VD E LC    P 
Sbjct  115  KFLLWSGTIPIHLIIDENHQN---------------LTGSWKIDPLYVDSERLCKHIEPK  159

Query  600  NLADYVSYTKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQ  436
            N  +Y   + G+GRI SKV++E + QP +L+  PP+S+  R IT K T++++ D++
Sbjct  160  NPEEYKRCSGGQGRIASKVAMEIIFQPSSLLNVPPVSFVTRWITIKATKILLEDIR  215



>ref|XP_002893286.1| hypothetical protein ARALYDRAFT_472613 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69545.1| hypothetical protein ARALYDRAFT_472613 [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 2/79 (3%)
 Frame = -1

Query  645  PLLVDEEL-CHPYRPNNLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPISWYVRGIT  472
            PL VD EL C   +P +  +Y   ++G+GRIGSKV+L+Q+ +P+ L   PPISWYVR IT
Sbjct  171  PLYVDSELFCKHEKPRSTEEYEKCSRGQGRIGSKVTLDQMFKPSFLFNLPPISWYVRRIT  230

Query  471  TKTTEMIINDLQAETARIR  415
             KT + +I DLQ  +A +R
Sbjct  231  IKTMKTLIEDLQITSAVMR  249



>ref|XP_010498870.1| PREDICTED: uncharacterized protein LOC104776482 isoform X2 [Camelina 
sativa]
Length=295

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 64/114 (56%), Gaps = 10/114 (9%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  I + V+VD+ R+D      + +   MK F+G ++VEPL VD E LC    P +  +Y
Sbjct  151  SFAIPISVIVDENRKD----LTKKRVMLMKVFKGSYKVEPLYVDSERLCKHMEPKSPEEY  206

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQA  433
               ++G+GRI SKV L Q  QP   PP   PP+S Y+R +T K T   +  LQ+
Sbjct  207  KRCSRGQGRIASKVLLNQYFQP--YPPFNLPPLSRYIRDVTVKNTVTALKTLQS  258



>emb|CDY20855.1| BnaC05g26370D [Brassica napus]
Length=277

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 72/118 (61%), Gaps = 2/118 (2%)
 Frame = -1

Query  753  ISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSY  577
            IS++++VD+ R+D  +    +       FEG ++VEP+ VD+E LC    P    +Y   
Sbjct  146  ISMNLIVDENRKDLMVKRASLTRNNHFSFEGNYKVEPIFVDKERLCKKRIPMTREEYKKC  205

Query  576  TKGKGRIGSKVSLEQLIQP-ALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
            + G+G++ SK++++Q  QP +    PP+SW++RG+T KT++ ++  +Q  +  +R ++
Sbjct  206  SGGQGKVASKLTIDQYYQPYSPFNLPPLSWFIRGMTVKTSKSLLAQVQDTSIAVRTAT  263



>emb|CDY54286.1| BnaC07g48270D [Brassica napus]
Length=269

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 2/122 (2%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            WS    + ++VD+  +D +  +K+ K  FMK FEG ++VEP+ VD E LC    P    +
Sbjct  148  WSRAFPIKLIVDENIKDLTAKYKKEKMMFMKVFEGSYKVEPIFVDSERLCKHRLPKTREE  207

Query  588  YVSYTKGKGRIGSKVSLEQL-IQPALVPPPPISWYVRGITTKTTEMIINDLQAETARIRR  412
            Y   + G+G++ SKV + Q          PP SWY+  IT +TT+ ++  +Q  TA  R 
Sbjct  208  YKKCSGGQGKVASKVIMNQYFQPFPPFNLPPFSWYINRITIRTTKTLLQMIQLSTATFRE  267

Query  411  SS  406
             S
Sbjct  268  LS  269



>ref|XP_010498902.1| PREDICTED: uncharacterized protein LOC104776513 isoform X2 [Camelina 
sativa]
Length=292

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 64/114 (56%), Gaps = 10/114 (9%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  I + V+VD+ R+D      + +   MK F+G ++VEPL VD E LC    P +  +Y
Sbjct  148  SFAIPISVIVDENRKD----LTKKRVMLMKVFKGSYKVEPLYVDSERLCKHMEPKSPEEY  203

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQA  433
               ++G+GRI SKV + Q  QP   PP   PP+S Y+R +T K T   +  LQ+
Sbjct  204  KRCSRGQGRIASKVIVNQYFQP--YPPFNLPPLSKYIRDVTIKNTVTALKTLQS  255



>ref|XP_001781678.1| predicted protein [Physcomitrella patens]
 gb|EDQ53491.1| predicted protein, partial [Physcomitrella patens]
Length=192

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 66/119 (55%), Gaps = 9/119 (8%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTG-FMKRFEGCWRVEPLLVDEELCHPYRPNNLADY  586
            SGT    V+++Q R++ ++ F   K G  MK+F G W++EP+   E         N++  
Sbjct  76   SGTFPTRVMIEQKRQEKTIVFDLAKQGGIMKKFTGSWKIEPMRASEAASQ-----NVSTS  130

Query  585  VSYTKGKGR---IGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEMIINDLQAETARI  418
            V      G    +GS ++ +Q+++P++ PP P+S Y+RG++ K    ++ DLQ E  R+
Sbjct  131  VGVETEPGSDPILGSWITFQQVVEPSIKPPWPLSNYIRGVSDKIVREMLADLQQECQRL  189



>ref|XP_002893293.1| hypothetical protein ARALYDRAFT_889901 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69552.1| hypothetical protein ARALYDRAFT_889901 [Arabidopsis lyrata subsp. 
lyrata]
Length=86

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -1

Query  678  MKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVSYTKGKGRIGSKVSLEQLIQP-ALVPP  505
            MK FEG W+VEPL VD+E  C     N+  +Y   + G+GRI SKV++E + QP +L+  
Sbjct  4    MKVFEGSWKVEPLYVDQERFCKSRSVNSQEEYKKCSGGRGRIASKVTMELIFQPSSLLNL  63

Query  504  PPISWYVRGI  475
            PP+SW +RGI
Sbjct  64   PPVSWIIRGI  73



>ref|XP_002893292.1| hypothetical protein ARALYDRAFT_889900 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69551.1| hypothetical protein ARALYDRAFT_889900 [Arabidopsis lyrata subsp. 
lyrata]
Length=224

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNNLAD  589
            WSG + ++++ D+  +D +  +K+ K  FMK FEG ++VEP+ VD E LC    P +  +
Sbjct  109  WSGGMPINLIADENEKDLTGKYKKQKMKFMKVFEGSYKVEPIYVDSESLCKNKEPKSPEE  168

Query  588  YVSYTKGKGRIGSKVSLEQLIQP  520
            Y   + G+G+I SKV+++Q  QP
Sbjct  169  YKKCSGGQGKIASKVTMDQYFQP  191



>ref|XP_006416078.1| hypothetical protein EUTSA_v10010008mg [Eutrema salsugineum]
 gb|ESQ34431.1| hypothetical protein EUTSA_v10010008mg [Eutrema salsugineum]
Length=252

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = -1

Query  666  EGCWRVEPLLVDE-ELCHPYRPNNLADYVSYTKGKGRIGSKVSLEQLIQPA-LVPPPPIS  493
            E  W+VEP+ VD   LC   +P    DY   + G+G+I SKV++  + QP+ +   PP S
Sbjct  165  EEKWKVEPVYVDSVRLCKHMKPKTREDYRKCSGGRGKIASKVTVSGVFQPSSIFLLPPFS  224

Query  492  WYVRGITTKTTEMIINDLQAETARIR  415
            WY+RG T +TT+ ++ D Q  +A IR
Sbjct  225  WYIRGFTVETTKTLLQDFQNLSAAIR  250



>ref|XP_010498869.1| PREDICTED: uncharacterized protein LOC104776482 isoform X1 [Camelina 
sativa]
Length=297

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 62/112 (55%), Gaps = 6/112 (5%)
 Frame = -1

Query  756  TISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVS  580
            + ++ + V +  +     +K+ +   MK F+G ++VEPL VD E LC    P +  +Y  
Sbjct  151  SFAIPISVSRGDDCELAKYKKKRVMLMKVFKGSYKVEPLYVDSERLCKHMEPKSPEEYKR  210

Query  579  YTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQA  433
             ++G+GRI SKV L Q  QP   PP   PP+S Y+R +T K T   +  LQ+
Sbjct  211  CSRGQGRIASKVLLNQYFQP--YPPFNLPPLSRYIRDVTVKNTVTALKTLQS  260



>ref|XP_010498901.1| PREDICTED: uncharacterized protein LOC104776513 isoform X1 [Camelina 
sativa]
Length=294

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 6/112 (5%)
 Frame = -1

Query  756  TISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADYVS  580
            + ++ + V +  +     +K+ +   MK F+G ++VEPL VD E LC    P +  +Y  
Sbjct  148  SFAIPISVSRGDDCELAKYKKKRVMLMKVFKGSYKVEPLYVDSERLCKHMEPKSPEEYKR  207

Query  579  YTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQA  433
             ++G+GRI SKV + Q  QP   PP   PP+S Y+R +T K T   +  LQ+
Sbjct  208  CSRGQGRIASKVIVNQYFQP--YPPFNLPPLSKYIRDVTIKNTVTALKTLQS  257



>ref|XP_005645855.1| hypothetical protein COCSUDRAFT_43073 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21311.1| hypothetical protein COCSUDRAFT_43073 [Coccomyxa subellipsoidea 
C-169]
Length=246

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 66/139 (47%), Gaps = 15/139 (11%)
 Frame = -1

Query  777  KXXXWSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDE----------  628
            K   +SG+ +  + V Q +  H + F+  + G MK F G WRV+P   D           
Sbjct  80   KFLMFSGSFATRLYVFQDKRRHIVEFRLARPGLMKDFAGTWRVQPFTQDAVGALFKADQP  139

Query  627  ELCHPYRP--NNLADYVSYTKGKGRIGSKVSLEQLIQPALVPPPPISWYVRGITTKTTEM  454
            +  +P+    N L  Y+   K K  +   VSLEQ ++PA+ PP  +   V+GI     + 
Sbjct  140  QAQNPWHSLTNTLNSYLGDRKVKATL---VSLEQSLEPAVRPPKALEGLVKGIAVSQLQG  196

Query  453  IINDLQAETARIRRSSSTE  397
            ++ DL+ E  RI+  S  +
Sbjct  197  LLKDLREEVPRIKAGSKKQ  215



>ref|XP_008800727.1| PREDICTED: uncharacterized protein LOC103715006 [Phoenix dactylifera]
Length=128

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (54%), Gaps = 16/99 (16%)
 Frame = -1

Query  702  FKQVKTGFMKRFEGCWRVEPLLVDEELCHPYRPNNLADYVSYTKGKGRIGSKVSLEQLIQ  523
            FKQ ++GFMK+ EGCW+VEPL V+E++  P +P    +          + ++ S   L  
Sbjct  41   FKQGRSGFMKKIEGCWKVEPLFVEEQILLPSKPKTWVN--------NDLCTRASTCSLAI  92

Query  522  PALVPPPPISWYVRGITTKTTEMIINDLQAETARIRRSS  406
              +V          GITT TTEM+I DL  E AR+R + 
Sbjct  93   NLVV--------FEGITTGTTEMLITDLLTEAARLRGAG  123



>emb|CDY52335.1| BnaA09g38840D [Brassica napus]
Length=267

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 67/123 (54%), Gaps = 8/123 (7%)
 Frame = -1

Query  765  WSGTISVHVLV-DQTREDHSMNFKQVK-TGFMKRFEGCWRVEPLLVD-EELCHPYRPNNL  595
            +SGTI + + V +  +E  + N+K+ K   +M+ FE  +RVEP+ VD E LC   +P + 
Sbjct  145  FSGTIPIRLYVLENPKELSTYNWKRRKGMDYMETFEVNYRVEPMYVDAERLCKHKKPKSR  204

Query  594  ADYVSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETA  424
             +Y   + GKG I SKV + Q  +P+   P   P +S Y R  T +TT+ +  D Q    
Sbjct  205  EEYRKCSGGKGLIASKVKVNQAFRPSF--PWNLPLLSSYFRRFTVETTKKVAEDFQTRAG  262

Query  423  RIR  415
             IR
Sbjct  263  DIR  265



>ref|XP_009116772.1| PREDICTED: uncharacterized protein LOC103841936 isoform X1 [Brassica 
rapa]
 ref|XP_009116773.1| PREDICTED: uncharacterized protein LOC103841936 isoform X1 [Brassica 
rapa]
Length=267

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 67/123 (54%), Gaps = 8/123 (7%)
 Frame = -1

Query  765  WSGTISVHVLV-DQTREDHSMNFKQVK-TGFMKRFEGCWRVEPLLVD-EELCHPYRPNNL  595
            +SGTI + + V +  +E  + N+K+ K   +M+ FE  +RVEP+ VD E LC   +P + 
Sbjct  145  FSGTIPIRLYVLENPKELSTYNWKRRKGMDYMETFEVNYRVEPMYVDAERLCKHKKPKSR  204

Query  594  ADYVSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETA  424
             +Y   + GKG I SKV + Q  +P+   P   P +S Y R  T +TT+ +  D Q    
Sbjct  205  EEYRKCSGGKGLIASKVKVNQAFRPSF--PWNLPLLSSYFRRFTVETTKKVAEDFQTRAG  262

Query  423  RIR  415
             IR
Sbjct  263  DIR  265



>ref|XP_010477651.1| PREDICTED: uncharacterized protein LOC104756721 [Camelina sativa]
Length=296

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 66/114 (58%), Gaps = 6/114 (5%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLADY  586
            S  I + ++VD+ R+D    +K+ +   MK F+G ++VEPL VD E LC    P +  +Y
Sbjct  148  SFDIPISLIVDENRKDLITKYKKKRMMMMKVFKGSYKVEPLYVDSERLCKQMEPKSPEEY  207

Query  585  VSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQA  433
               ++G+GRI SKV L Q  QP   PP   PP+S Y+R +T K T   +  LQ+
Sbjct  208  KRCSRGQGRIASKVILNQYFQP--YPPFNLPPLSKYIRDVTIKNTVTALKTLQS  259



>emb|CDY51642.1| BnaC05g50890D [Brassica napus]
Length=272

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 67/121 (55%), Gaps = 4/121 (3%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFM--KRFEGCWRVEPLLVD-EELCHPYRPNNL  595
            W G + + ++ ++ R+D    F+  +   M  +R  G  +++P  +D ++ C    P + 
Sbjct  150  WDGKMPIELIFNENRKDLLTLFRIPREDVMNMERLLGQLQIKPWYIDSDKYCTAREPKSA  209

Query  594  ADYVSYTKGKGRIGSKVSLEQLIQPAL-VPPPPISWYVRGITTKTTEMIINDLQAETARI  418
             +Y   + GKG +GSK+ L+ +  P   +  PP SWY+R +TTK+T+ ++ DLQ   A +
Sbjct  210  EEYRKCSGGKGLLGSKLKLDMVYIPMQPLDMPPFSWYIRRVTTKSTKSLMEDLQIRGAVL  269

Query  417  R  415
            R
Sbjct  270  R  270



>gb|AAM65908.1| putative OBP32pep protein [Arabidopsis thaliana]
Length=217

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVDEE-LCHPYRPNNLAD  589
            WSG + ++++ D+  +D    +K+ K  FMK FEG + VEP+ VD E  C    P +  +
Sbjct  131  WSGGMPINLIADENEKDLRGKYKKQKMKFMKVFEGSYNVEPIYVDSERFCKHKEPKSPEE  190

Query  588  YVSYTKGKGRIGSKVSLEQLI  526
            Y   + G+G+I SKV+++Q+ 
Sbjct  191  YKKCSGGQGKIASKVTMDQIF  211



>ref|XP_009115048.1| PREDICTED: uncharacterized protein LOC103840304 [Brassica rapa]
 emb|CDY02327.1| BnaA09g25750D [Brassica napus]
Length=270

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 64/123 (52%), Gaps = 10/123 (8%)
 Frame = -1

Query  762  SGTISV--HVLVD-QTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNNL  595
            SGTI +  HVL D +T   H M  +Q     M+ FEG + VEP+ VD E LC   +P + 
Sbjct  149  SGTIPIRLHVLEDPKTLYVHYMK-QQNGIRLMENFEGRFTVEPVYVDAERLCKHRKPKSQ  207

Query  594  ADYVSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETA  424
             +Y   + GKG I SK+ + Q  +PA   P   P +S YVR  T  TT+ +  D Q    
Sbjct  208  EEYRKCSGGKGLIASKIKMNQTFRPA--SPWDLPLVSSYVRRFTVNTTKKVAEDFQMRAG  265

Query  423  RIR  415
             IR
Sbjct  266  DIR  268



>emb|CDY04704.1| BnaC05g18850D [Brassica napus]
Length=297

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 68/122 (56%), Gaps = 8/122 (7%)
 Frame = -1

Query  762  SGTISVHVLVDQTREDHSMNFKQVKTGF--MKRFEGCWRVEPLLVD-EELCHPYRPNNLA  592
            SGT+ + ++V +  +   +++ +   G   M+ FEG + VEP+ VD E LC   +P +  
Sbjct  147  SGTLPIRLIVLEEPKKLYVDYLKDGKGIRTMETFEGRYTVEPVYVDAERLCKHMKPKSPE  206

Query  591  DYVSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAETAR  421
            +Y   + GKG I SKV ++Q  +PA   P   P +S Y+R  T +TT+ +  DLQ   A 
Sbjct  207  EYRRCSGGKGLIASKVKVDQTFRPA--SPWDLPLLSSYMRRFTIETTKKVAEDLQIRAAD  264

Query  420  IR  415
            IR
Sbjct  265  IR  266



>ref|NP_564199.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABE65649.1| unknown [Arabidopsis thaliana]
 gb|AEE30408.1| uncharacterized protein AT1G23590 [Arabidopsis thaliana]
Length=217

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNNLAD  589
            WSG + +++   +  +D    +K+ K  FMK FEG ++VEP+ VD E LC+   P +  +
Sbjct  131  WSGGMPININAVENEKDLRGKYKKQKMKFMKVFEGSYKVEPIYVDFERLCNQKEPKSPEE  190

Query  588  YVSYTKGKGRIGSKVSLEQLI  526
            Y   + G+G+I SKV+++Q+ 
Sbjct  191  YKKCSGGQGKIASKVTMDQIF  211



>ref|XP_009115518.1| PREDICTED: uncharacterized protein LOC103840750 isoform X2 [Brassica 
rapa]
 emb|CDY44154.1| BnaA09g30980D [Brassica napus]
Length=275

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 70/124 (56%), Gaps = 12/124 (10%)
 Frame = -1

Query  762  SGTISVHVLV----DQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNN  598
            SGT+ + ++V    ++   D+  + K ++T  M+ FEG + VEP+ VD E LC   +P +
Sbjct  147  SGTLPIRLIVLEEPNKLYVDYLKDGKGIRT--METFEGRYTVEPIYVDAERLCKHMKPKS  204

Query  597  LADYVSYTKGKGRIGSKVSLEQLIQPALVPP---PPISWYVRGITTKTTEMIINDLQAET  427
              +Y   + GKG I SKV ++Q  +PA   P   P +S Y+R  T +TT+ +  DLQ   
Sbjct  205  PEEYRKCSGGKGLIASKVKVDQTFRPA--SPWDLPLLSSYMRLFTIETTKKVAEDLQIRA  262

Query  426  ARIR  415
            + IR
Sbjct  263  SNIR  266



>ref|NP_001077588.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30409.1| uncharacterized protein AT1G23590 [Arabidopsis thaliana]
Length=195

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = -1

Query  765  WSGTISVHVLVDQTREDHSMNFKQVKTGFMKRFEGCWRVEPLLVD-EELCHPYRPNNLAD  589
            WSG + +++   +  +D    +K+ K  FMK FEG ++VEP+ VD E LC+   P +  +
Sbjct  109  WSGGMPININAVENEKDLRGKYKKQKMKFMKVFEGSYKVEPIYVDFERLCNQKEPKSPEE  168

Query  588  YVSYTKGKGRIGSKVSLEQLI  526
            Y   + G+G+I SKV+++Q+ 
Sbjct  169  YKKCSGGQGKIASKVTMDQIF  189



>emb|CDY72266.1| BnaCnng76800D, partial [Brassica napus]
Length=238

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 67/121 (55%), Gaps = 4/121 (3%)
 Frame = -1

Query  765  WSGTISVHV-LVDQTREDHSMNFKQVK-TGFMKRFEGCWRVEPLLVD-EELCHPYRPNNL  595
            +SGTI + + +++  +E  + N+K+ K   +M+ FE  + VEP+ VD E LC   +P + 
Sbjct  115  FSGTIPIRLNVLENPKELSTYNWKRRKGMDYMETFEVNYTVEPMYVDAERLCKHKKPKSR  174

Query  594  ADYVSYTKGKGRIGSKVSLEQLIQPALV-PPPPISWYVRGITTKTTEMIINDLQAETARI  418
             +Y   + GKG I SKV ++Q  +P+     P +S Y R  T +TT+ +  D Q     I
Sbjct  175  EEYRKCSGGKGLIASKVKVDQNFRPSFPWNLPLLSSYFRRFTVETTKKVAEDFQTRAGDI  234

Query  417  R  415
            R
Sbjct  235  R  235



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730