BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF041K15

Length=750
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO98178.1|  unnamed protein product                                368   2e-121   Coffea canephora [robusta coffee]
ref|XP_011081977.1|  PREDICTED: glycerol kinase                         362   3e-119   Sesamum indicum [beniseed]
ref|XP_008461141.1|  PREDICTED: glycerol kinase                         360   3e-118   Cucumis melo [Oriental melon]
ref|XP_004135863.1|  PREDICTED: glycerol kinase-like                    358   9e-118   Cucumis sativus [cucumbers]
emb|CAN76048.1|  hypothetical protein VITISV_037711                     358   1e-117   Vitis vinifera
ref|XP_007023294.1|  Actin-like ATPase superfamily protein isoform 1    358   2e-117   
ref|XP_002273367.1|  PREDICTED: glycerol kinase                         357   3e-117   Vitis vinifera
gb|EYU21675.1|  hypothetical protein MIMGU_mgv1a019703mg                356   6e-117   Erythranthe guttata [common monkey flower]
ref|XP_004235901.1|  PREDICTED: glycerol kinase                         355   2e-116   Solanum lycopersicum
ref|XP_010033977.1|  PREDICTED: glycerol kinase-like                    354   4e-116   
ref|XP_011073388.1|  PREDICTED: glycerol kinase-like                    354   5e-116   Sesamum indicum [beniseed]
gb|AIT39761.1|  glycerol kinase                                         352   2e-115   Chrysanthemum boreale
ref|XP_004303284.1|  PREDICTED: glycerol kinase-like                    352   3e-115   Fragaria vesca subsp. vesca
ref|XP_009593517.1|  PREDICTED: glycerol kinase                         352   4e-115   Nicotiana tomentosiformis
ref|XP_009758692.1|  PREDICTED: glycerol kinase                         351   9e-115   Nicotiana sylvestris
ref|XP_006341400.1|  PREDICTED: glycerol kinase-like                    350   2e-114   Solanum tuberosum [potatoes]
ref|XP_010063499.1|  PREDICTED: glycerol kinase                         348   1e-113   Eucalyptus grandis [rose gum]
ref|XP_009334628.1|  PREDICTED: glycerol kinase-like                    347   3e-113   Pyrus x bretschneideri [bai li]
ref|XP_008372701.1|  PREDICTED: glycerol kinase                         347   4e-113   Malus domestica [apple tree]
ref|XP_009336317.1|  PREDICTED: glycerol kinase-like                    345   2e-112   Pyrus x bretschneideri [bai li]
gb|KJB66376.1|  hypothetical protein B456_010G138000                    338   5e-112   Gossypium raimondii
ref|XP_010472924.1|  PREDICTED: glycerol kinase-like isoform X1         340   1e-110   Camelina sativa [gold-of-pleasure]
gb|KHG30375.1|  Glycerol kinase                                         341   1e-110   Gossypium arboreum [tree cotton]
ref|XP_010691126.1|  PREDICTED: glycerol kinase                         340   1e-110   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX67948.1|  BnaA07g19880D                                          340   2e-110   
ref|XP_009104463.1|  PREDICTED: glycerol kinase                         339   3e-110   
emb|CDX79385.1|  BnaC06g19180D                                          339   3e-110   
ref|XP_006302137.1|  hypothetical protein CARUB_v10020141mg             339   5e-110   Capsella rubella
emb|CDY37598.1|  BnaA02g19720D                                          339   5e-110   Brassica napus [oilseed rape]
gb|KJB66375.1|  hypothetical protein B456_010G138000                    338   6e-110   Gossypium raimondii
ref|XP_010417705.1|  PREDICTED: glycerol kinase-like                    338   6e-110   Camelina sativa [gold-of-pleasure]
emb|CDY39977.1|  BnaC06g40550D                                          338   1e-109   Brassica napus [oilseed rape]
ref|XP_006389795.1|  hypothetical protein EUTSA_v10018399mg             338   1e-109   Eutrema salsugineum [saltwater cress]
ref|XP_009106746.1|  PREDICTED: glycerol kinase-like                    337   1e-109   Brassica rapa
ref|XP_010429953.1|  PREDICTED: glycerol kinase                         337   2e-109   Camelina sativa [gold-of-pleasure]
emb|CDX87311.1|  BnaA07g35620D                                          337   2e-109   
ref|XP_002887828.1|  At1g80460                                          337   3e-109   
ref|XP_007215813.1|  hypothetical protein PRUPE_ppa004097mg             337   3e-109   
gb|ABK32113.1|  At1g80460                                               336   7e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010250262.1|  PREDICTED: glycerol kinase-like                    336   8e-109   Nelumbo nucifera [Indian lotus]
ref|NP_178161.1|  glycerol kinase                                       334   3e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011044862.1|  PREDICTED: glycerol kinase                         334   3e-108   Populus euphratica
gb|KDO47427.1|  hypothetical protein CISIN_1g0098681mg                  332   4e-108   Citrus sinensis [apfelsine]
ref|XP_008228677.1|  PREDICTED: glycerol kinase                         334   4e-108   Prunus mume [ume]
ref|XP_006385291.1|  glycerol kinase family protein                     333   4e-108   
gb|EPS68115.1|  hypothetical protein M569_06657                         333   8e-108   Genlisea aurea
ref|XP_006427440.1|  hypothetical protein CICLE_v10025360mg             333   1e-107   Citrus clementina [clementine]
ref|XP_006492058.1|  PREDICTED: glycerol kinase-like                    332   3e-107   Citrus sinensis [apfelsine]
ref|XP_002517681.1|  glycerol kinase, putative                          331   4e-107   Ricinus communis
gb|AAR88660.1|  glycerol kinase                                         324   3e-104   Pandanus amaryllifolius [pandan rampeh]
ref|XP_006652916.1|  PREDICTED: glycerol kinase-like                    321   7e-103   Oryza brachyantha
ref|XP_010097187.1|  Glycerol kinase                                    320   7e-103   Morus notabilis
ref|XP_010537930.1|  PREDICTED: glycerol kinase                         318   5e-102   Tarenaya hassleriana [spider flower]
gb|KFK42437.1|  hypothetical protein AALP_AA2G256400                    318   8e-102   Arabis alpina [alpine rockcress]
gb|KHN01314.1|  Putative glycerol kinase                                317   9e-102   Glycine soja [wild soybean]
ref|NP_001237303.1|  glycerol kinase                                    317   1e-101   
ref|XP_008779159.1|  PREDICTED: glycerol kinase-like isoform X1         316   1e-101   Phoenix dactylifera
emb|CAJ86056.1|  H0821G03.7                                             317   1e-101   Oryza sativa [red rice]
gb|AGH08245.1|  glycerol kinase                                         317   1e-101   Triticum aestivum [Canadian hard winter wheat]
gb|KDP37048.1|  hypothetical protein JCGZ_06104                         317   2e-101   Jatropha curcas
ref|XP_008779160.1|  PREDICTED: glycerol kinase-like isoform X2         316   3e-101   Phoenix dactylifera
gb|EMT01355.1|  Putative glycerol kinase                                317   5e-101   
ref|XP_003580683.1|  PREDICTED: glycerol kinase                         315   7e-101   Brachypodium distachyon [annual false brome]
ref|NP_001132106.2|  uncharacterized protein LOC100193522               315   1e-100   Zea mays [maize]
ref|XP_009407371.1|  PREDICTED: glycerol kinase                         315   1e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001054071.1|  Os04g0647800                                       315   1e-100   
gb|EMS68114.1|  Glycerol kinase                                         313   1e-100   Triticum urartu
gb|AAR18687.1|  glycerol kinase-like protein                            315   1e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977029.1|  PREDICTED: glycerol kinase-like                    313   4e-100   Setaria italica
ref|XP_002448637.1|  hypothetical protein SORBIDRAFT_06g030600          310   4e-99    Sorghum bicolor [broomcorn]
ref|XP_007135771.1|  hypothetical protein PHAVU_010G157400g             309   2e-98    Phaseolus vulgaris [French bean]
ref|XP_010244913.1|  PREDICTED: glycerol kinase-like                    310   2e-98    Nelumbo nucifera [Indian lotus]
ref|XP_010907017.1|  PREDICTED: glycerol kinase                         304   2e-96    Elaeis guineensis
ref|XP_003604353.1|  Glycerol kinase                                    303   4e-96    Medicago truncatula
ref|XP_004506960.1|  PREDICTED: glycerol kinase-like                    301   2e-95    Cicer arietinum [garbanzo]
gb|ABK24550.1|  unknown                                                 290   5e-91    Picea sitchensis
gb|ABK25673.1|  unknown                                                 290   7e-91    Picea sitchensis
gb|KEH28675.1|  glycerol kinase-like protein                            286   5e-90    Medicago truncatula
gb|ABR26079.1|  glycerol kinase                                         276   6e-90    Oryza sativa Indica Group [Indian rice]
ref|XP_006442415.1|  hypothetical protein CICLE_v10024258mg             274   1e-86    
ref|XP_008795833.1|  PREDICTED: glycerol kinase-like                    276   1e-85    Phoenix dactylifera
gb|KDO41571.1|  hypothetical protein CISIN_1g046958mg                   272   3e-85    Citrus sinensis [apfelsine]
ref|XP_010913342.1|  PREDICTED: glycerol kinase-like                    273   2e-84    Elaeis guineensis
ref|XP_006427437.1|  hypothetical protein CICLE_v10025756mg             269   2e-84    
ref|XP_002985935.1|  hypothetical protein SELMODRAFT_123030             271   1e-83    Selaginella moellendorffii
ref|XP_002984877.1|  hypothetical protein SELMODRAFT_121015             270   1e-83    Selaginella moellendorffii
ref|XP_001763943.1|  predicted protein                                  270   2e-83    
ref|XP_006852853.1|  hypothetical protein AMTR_s00033p00197360          267   9e-83    
ref|NP_001031307.1|  glycerol kinase                                    263   4e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006442413.1|  hypothetical protein CICLE_v10020202mg             260   1e-80    
ref|XP_007023295.1|  Actin-like ATPase superfamily protein isoform 2    248   7e-76    
ref|XP_007023296.1|  Actin-like ATPase superfamily protein isoform 3    248   7e-76    
ref|XP_006302136.1|  hypothetical protein CARUB_v10020141mg             238   6e-72    
ref|XP_006389796.1|  hypothetical protein EUTSA_v10018399mg             236   4e-71    
ref|XP_006427439.1|  hypothetical protein CICLE_v10027554mg             230   5e-71    
emb|CDY03995.1|  BnaC02g37100D                                          223   3e-69    
emb|CDY72493.1|  BnaCnng77930D                                          216   3e-66    Brassica napus [oilseed rape]
dbj|BAH56977.1|  AT1G80460                                              218   2e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002500482.1|  predicted protein                                  212   4e-61    Micromonas commoda
ref|WP_040860438.1|  glycerol kinase                                    209   2e-60    Nocardia niigatensis
ref|XP_641267.1|  hypothetical protein DDB_G0280371                     210   3e-60    Dictyostelium discoideum AX4
ref|WP_033086797.1|  glycerol kinase                                    209   3e-60    Nocardia seriolae
ref|XP_010654824.1|  PREDICTED: glycerol kinase-like                    197   4e-60    
ref|XP_003288686.1|  hypothetical protein DICPUDRAFT_34436              209   4e-60    Dictyostelium purpureum
ref|WP_043669782.1|  glycerol kinase                                    208   6e-60    Clavibacter michiganensis
ref|WP_031459864.1|  glycerol kinase                                    208   8e-60    Chloroflexus sp. MS-G
ref|WP_028456954.1|  glycerol kinase                                    207   1e-59    Chloroflexus sp. Y-396-1
ref|WP_026419357.1|  glycerol kinase                                    207   1e-59    Actinoalloteichus
ref|WP_030104795.1|  glycerol kinase                                    207   1e-59    Actinoalloteichus cyanogriseus
ref|WP_026371016.1|  glycerol kinase                                    207   1e-59    bacterium JKG1
ref|WP_033441033.1|  glycerol kinase                                    207   2e-59    Saccharothrix sp. NRRL B-16314
ref|WP_015805093.1|  glycerol kinase                                    207   2e-59    Actinosynnema
ref|WP_015909396.1|  glycerol kinase                                    206   2e-59    Chloroflexus aurantiacus
ref|WP_040732517.1|  glycerol kinase                                    206   3e-59    Nocardia tenerifensis
ref|WP_013349045.1|  glycerol kinase                                    206   3e-59    Glutamicibacter arilaitensis
ref|WP_012038518.1|  glycerol kinase                                    206   4e-59    Clavibacter
ref|WP_020662584.1|  glycerol kinase                                    206   4e-59    Amycolatopsis benzoatilytica
ref|WP_012259133.1|  glycerol kinase                                    206   5e-59    Chloroflexus aurantiacus
ref|WP_030149055.1|  glycerol kinase                                    206   6e-59    Mycetocola
ref|WP_012615391.1|  glycerol kinase                                    206   6e-59    Chloroflexus aggregans
ref|WP_018189990.1|  MULTISPECIES: glycerol kinase                      206   6e-59    Microbacteriaceae
ref|WP_030528182.1|  glycerol kinase                                    206   7e-59    Intrasporangiaceae
ref|WP_043607522.1|  glycerol kinase                                    205   8e-59    Cellulomonas carbonis
ref|XP_005851284.1|  hypothetical protein CHLNCDRAFT_18995              206   8e-59    Chlorella variabilis
ref|WP_033429062.1|  glycerol kinase                                    205   8e-59    Saccharothrix syringae
ref|WP_016698736.1|  glycerol kinase                                    205   9e-59    Actinoalloteichus spitiensis
ref|WP_042264218.1|  glycerol kinase                                    205   9e-59    Nocardia brasiliensis
ref|WP_022888254.1|  glycerol kinase                                    205   9e-59    Agromyces italicus
ref|WP_012823872.1|  glycerol kinase                                    205   9e-59    Halothiobacillus neapolitanus
ref|XP_002951253.1|  hypothetical protein VOLCADRAFT_91722              205   9e-59    Volvox carteri f. nagariensis
ref|WP_040752000.1|  glycerol kinase                                    205   1e-58    Nocardia transvalensis
ref|WP_022895397.1|  glycerol kinase                                    205   1e-58    Corynebacterium-like bacterium B27
ref|WP_009072696.1|  glycerol kinase                                    205   1e-58    Actinobacteria
ref|WP_043663224.1|  glycerol kinase                                    205   1e-58    Nocardia vulneris
ref|WP_037816066.1|  glycerol kinase                                    205   1e-58    Streptomyces sp. NRRL F-3213
ref|WP_040161505.1|  glycerol kinase                                    205   1e-58    Nigerium massiliense
ref|WP_029901568.1|  glycerol kinase                                    205   1e-58    Nocardia brasiliensis
ref|WP_043831849.1|  glycerol kinase                                    205   1e-58    Amycolatopsis orientalis
ref|WP_007031951.1|  glycerol kinase                                    205   1e-58    Amycolatopsis decaplanina
ref|WP_037332341.1|  glycerol kinase                                    205   1e-58    Amycolatopsis
ref|WP_016331321.1|  glycerol kinase                                    204   1e-58    Amycolatopsis keratiniphila
ref|WP_027772783.1|  hypothetical protein                               196   2e-58    
ref|WP_022875171.1|  glycerol kinase                                    204   2e-58    Arthrobacter sp. PAO19
ref|WP_037366005.1|  glycerol kinase                                    204   2e-58    Amycolatopsis orientalis
ref|WP_022882980.1|  glycerol kinase                                    204   3e-58    Gryllotalpicola ginsengisoli
ref|WP_007272149.1|  glycerol kinase                                    204   3e-58    Paeniglutamicibacter gangotriensis
ref|WP_028680535.1|  hypothetical protein                               196   3e-58    
ref|WP_021755755.1|  glycerol kinase                                    204   3e-58    Leifsonia aquatica
ref|WP_025103335.1|  glycerol kinase                                    204   3e-58    Microbacterium
ref|WP_014982240.1|  glycerol kinase                                    204   3e-58    Nocardia brasiliensis
ref|WP_020633536.1|  glycerol kinase                                    204   3e-58    Amycolatopsis alba
ref|WP_038519322.1|  glycerol kinase                                    203   4e-58    Amycolatopsis japonica
ref|WP_020643440.1|  glycerol kinase                                    203   4e-58    Amycolatopsis balhimycina
ref|WP_034304739.1|  glycerol kinase                                    203   4e-58    Amycolatopsis lurida
ref|WP_033293216.1|  glycerol kinase                                    203   4e-58    Amycolatopsis jejuensis
ref|WP_025155617.1|  glycerol kinase                                    203   6e-58    Leifsonia aquatica
gb|EFA75245.1|  Glycerol kinase 2                                       203   6e-58    Heterostelium album PN500
ref|WP_019045228.1|  MULTISPECIES: glycerol kinase                      203   6e-58    Actinobacteria
ref|WP_034270380.1|  glycerol kinase                                    203   6e-58    Amycolatopsis halophila
ref|WP_026273704.1|  glycerol kinase                                    200   8e-58    
ref|WP_014453961.1|  glycerol kinase                                    202   8e-58    Caldisericum exile
ref|WP_006502359.1|  glycerol kinase                                    202   9e-58    Austwickia chelonae
dbj|BAL98869.1|  glycerol kinase                                        202   1e-57    Caldilinea aerophila DSM 14535 = NBRC 104270
ref|WP_030470708.1|  glycerol kinase                                    202   1e-57    Lechevalieria aerocolonigenes
ref|WP_018824072.1|  glycerol kinase                                    200   1e-57    
ref|WP_028936593.1|  glycerol kinase                                    202   1e-57    Pseudonocardia spinosispora
ref|WP_028852037.1|  glycerol kinase                                    202   1e-57    Thermocrispum municipale
ref|WP_026378244.1|  glycerol kinase                                    202   1e-57    
ref|WP_030478525.1|  glycerol kinase                                    202   1e-57    Lentzea albidocapillata
ref|WP_018267275.1|  glycerol kinase                                    202   1e-57    Methylosinus sp. LW4
ref|WP_009152547.1|  glycerol kinase                                    202   1e-57    Saccharomonospora marina
ref|WP_038991109.1|  glycerol kinase                                    202   1e-57    Arthrobacter sp. W1
ref|WP_005167726.1|  Glycerol kinase                                    202   2e-57    Amycolatopsis azurea
ref|WP_044276192.1|  glycerol kinase                                    202   2e-57    Caldilinea aerophila
ref|WP_027942070.1|  glycerol kinase                                    202   2e-57    Amycolatopsis taiwanensis
ref|WP_014692584.1|  glycerol kinase                                    202   2e-57    Actinoplanes
ref|WP_013561135.1|  glycerol kinase                                    201   2e-57    Anaerolinea thermophila
ref|WP_013772655.1|  glycerol kinase                                    202   2e-57    Cellulomonas fimi
ref|XP_785650.3|  PREDICTED: glycerol kinase-like                       202   2e-57    
ref|WP_026533037.1|  glycerol kinase                                    201   2e-57    Arthrobacter sp. H41
ref|WP_043445494.1|  glycerol kinase                                    201   2e-57    Arthrobacter sp. L77
ref|WP_043496580.1|  glycerol kinase                                    201   2e-57    
ref|WP_026818401.1|  glycerol kinase                                    201   3e-57    Arthrobacter castelli
ref|WP_017830735.1|  glycerol kinase                                    201   3e-57    Microbacterium
ref|WP_029263516.1|  MULTISPECIES: glycerol kinase                      201   3e-57    Microbacterium
ref|WP_030533893.1|  glycerol kinase                                    201   3e-57    Prauserella rugosa
ref|XP_004367171.1|  Glycerol kinase 2                                  203   3e-57    Cavenderia fasciculata
ref|WP_029259104.1|  glycerol kinase                                    201   3e-57    Microbacterium sp. Cr-K29
ref|WP_034224024.1|  glycerol kinase                                    201   3e-57    Actinotalea ferrariae
ref|WP_021200455.1|  MULTISPECIES: glycerol kinase                      201   3e-57    Microbacterium
ref|WP_028473143.1|  glycerol kinase                                    201   3e-57    Nocardioides alkalitolerans
ref|WP_026875140.1|  glycerol kinase                                    201   4e-57    Jiangella gansuensis
ref|WP_010315712.1|  glycerol kinase                                    201   4e-57    Saccharopolyspora spinosa
ref|WP_020668184.1|  glycerol kinase                                    201   4e-57    Amycolatopsis nigrescens
ref|WP_026549280.1|  glycerol kinase                                    201   4e-57    Arthrobacter sp. Br18
ref|WP_024877819.1|  glycerol kinase                                    201   4e-57    Saccharomonospora sp. CNQ490
ref|WP_018832895.1|  glycerol kinase                                    196   4e-57    
ref|WP_040826898.1|  glycerol kinase                                    201   5e-57    Nocardia jiangxiensis
ref|WP_025619269.1|  glycerol kinase                                    201   5e-57    Salinispora pacifica
ref|WP_030858775.1|  glycerol kinase                                    201   5e-57    Streptomyces sp. NRRL S-37
ref|WP_044854511.1|  glycerol kinase                                    201   5e-57    Amycolatopsis orientalis
ref|WP_028278664.1|  glycerol kinase                                    201   5e-57    Arthrobacter sp. H5
emb|CEA08195.1|  Glycerol kinase                                        201   5e-57    Arthrobacter saudimassiliensis
ref|WP_043786485.1|  glycerol kinase                                    201   5e-57    Amycolatopsis rifamycinica
ref|WP_005443559.1|  glycerol kinase                                    201   5e-57    Saccharomonospora azurea
ref|WP_040813279.1|  glycerol kinase                                    201   5e-57    Nocardia concava
ref|WP_024804016.1|  glycerol kinase                                    201   5e-57    Nocardia sp. BMG51109
ref|WP_005447261.1|  glycerol kinase                                    201   5e-57    Saccharomonospora azurea
ref|WP_040775205.1|  glycerol kinase                                    201   6e-57    Nocardia pneumoniae
ref|WP_003082344.1|  glycerol kinase                                    200   6e-57    Amycolatopsis vancoresmycina
ref|WP_015028738.1|  glycerol kinase                                    200   6e-57    Emticicia oligotrophica
ref|WP_030435889.1|  glycerol kinase                                    200   6e-57    Actinoplanes subtropicus
ref|WP_033776276.1|  glycerol kinase                                    197   6e-57    
ref|WP_043731252.1|  glycerol kinase                                    200   6e-57    Kutzneria sp. 744
ref|WP_006562876.1|  glycerol kinase                                    200   7e-57    Oscillochloris trichoides
ref|WP_030907160.1|  glycerol kinase                                    200   7e-57    Streptosporangium amethystogenes
ref|WP_026153798.1|  glycerol kinase                                    200   7e-57    Amycolatopsis methanolica
gb|KGA05763.1|  glpK                                                    200   7e-57    actinobacterium acMicro-4
ref|WP_038297944.1|  glycerol kinase                                    200   7e-57    
ref|WP_014445904.1|  glycerol kinase                                    200   7e-57    Actinoplanes missouriensis
ref|WP_026534792.1|  glycerol kinase                                    200   7e-57    Arthrobacter sp. H14
ref|WP_038254265.1|  glycerol kinase                                    200   8e-57    Williamsia sp. D3
ref|WP_027661174.1|  glycerol kinase                                    200   8e-57    Salinispora pacifica
gb|ETD30933.1|  glycerol kinase                                         200   8e-57    Williamsia sp. D3
ref|WP_018720195.1|  glycerol kinase                                    200   9e-57    Salinispora pacifica
ref|WP_013222837.1|  glycerol kinase                                    200   9e-57    Amycolatopsis mediterranei
ref|WP_012851581.1|  glycerol kinase                                    200   9e-57    Thermomonospora curvata
ref|WP_025361152.1|  glycerol kinase                                    200   1e-56    Kutzneria albida
ref|WP_006237808.1|  glycerol kinase                                    200   1e-56    Saccharomonospora xinjiangensis
ref|WP_022884044.1|  glycerol kinase                                    200   1e-56    Glaciibacter superstes
ref|XP_001416856.1|  predicted protein                                  200   1e-56    Ostreococcus lucimarinus CCE9901
ref|WP_036533578.1|  glycerol kinase                                    199   1e-56    Nocardia cyriacigeorgica
ref|WP_037561466.1|  glycerol kinase                                    199   1e-56    Alkalispirochaeta odontotermitis
ref|WP_037315944.1|  glycerol kinase                                    199   1e-56    Amycolatopsis orientalis
ref|WP_028478492.1|  glycerol kinase                                    199   1e-56    Nocardia sp. CNY236
ref|WP_026552192.1|  glycerol kinase                                    199   1e-56    Arthrobacter sp. H20
ref|WP_042166131.1|  glycerol kinase                                    199   1e-56    Streptomyces
ref|WP_026935893.1|  glycerol kinase                                    199   1e-56    Gulosibacter molinativorax
ref|WP_004932569.1|  glycerol kinase                                    199   1e-56    Streptomyces
ref|WP_022905305.1|  glycerol kinase                                    197   2e-56    Curtobacterium sp. B18
ref|WP_012245351.1|  glycerol kinase                                    199   2e-56    Renibacterium salmoninarum
ref|WP_039799920.1|  glycerol kinase                                    199   2e-56    Nocardia araoensis
ref|WP_027652531.1|  glycerol kinase                                    199   2e-56    Salinispora pacifica
ref|WP_012920815.1|  glycerol kinase                                    199   2e-56    Kribbella flavida
ref|WP_043778835.1|  glycerol kinase                                    199   2e-56    Amycolatopsis rifamycinica
ref|WP_014044407.1|  MULTISPECIES: glycerol kinase                      199   2e-56    Streptomyces
ref|WP_019810702.1|  glycerol kinase                                    199   2e-56    Saccharomonospora halophila
ref|WP_015490495.1|  hypothetical protein                               199   2e-56    Clavibacter michiganensis
ref|WP_037266528.1|  glycerol kinase                                    199   2e-56    Kibdelosporangium aridum
ref|WP_020384896.1|  glycerol kinase                                    199   2e-56    Kribbella catacumbae
ref|WP_015413943.1|  Glycerol kinase                                    199   2e-56    Pseudodesulfovibrio piezophilus
ref|WP_022884871.1|  glycerol kinase                                    199   2e-56    Glaciibacter superstes
ref|WP_036413611.1|  glycerol kinase                                    193   2e-56    
ref|WP_030624251.1|  glycerol kinase                                    199   2e-56    
ref|WP_020001533.1|  MULTISPECIES: glycerol kinase                      199   3e-56    Desulfovibrionaceae
ref|WP_025781076.1|  glycerol kinase                                    199   3e-56    
ref|WP_040794681.1|  glycerol kinase                                    198   3e-56    Nocardia higoensis
ref|WP_040160669.1|  glycerol kinase                                    199   3e-56    Mobilicoccus massiliensis
ref|WP_018219541.1|  glycerol kinase                                    199   3e-56    Salinispora pacifica
ref|WP_033342646.1|  glycerol kinase                                    199   3e-56    Catenuloplanes japonicus
ref|WP_015623342.1|  glycerol kinase                                    199   3e-56    Actinoplanes sp. N902-109
ref|WP_028654043.1|  glycerol kinase                                    199   3e-56    Nocardioides sp. J54
ref|WP_043688472.1|  glycerol kinase                                    198   3e-56    Nocardia abscessus
ref|WP_026455160.1|  glycerol kinase                                    199   3e-56    [Actinopolyspora] iraqiensis
ref|WP_024878177.1|  glycerol kinase                                    198   3e-56    Methylosinus
ref|WP_030820797.1|  glycerol kinase                                    198   3e-56    Streptomyces
ref|WP_043594942.1|  glycerol kinase                                    198   3e-56    Frigoribacterium
ref|WP_027932484.1|  glycerol kinase                                    198   4e-56    Amycolatopsis thermoflava
ref|WP_028847390.1|  glycerol kinase                                    198   4e-56    Thermocrispum agreste
ref|WP_039504563.1|  glycerol kinase                                    198   4e-56    
ref|WP_017832284.1|  glycerol kinase                                    198   4e-56    Kocuria sp. UCD-OTCP
ref|WP_005453596.1|  glycerol kinase                                    198   4e-56    Saccharomonospora cyanea
ref|WP_007024268.1|  glycerol kinase                                    198   4e-56    Saccharomonospora paurometabolica
emb|CEL13600.1|  Glycerol kinase                                        198   4e-56    Kibdelosporangium sp. MJ126-NF4
ref|WP_042181713.1|  glycerol kinase                                    198   4e-56    Kibdelosporangium sp. MJ126-NF4
ref|WP_027645715.1|  glycerol kinase                                    198   4e-56    Salinispora pacifica
ref|WP_006423821.1|  glycerol kinase                                    198   4e-56    delta proteobacterium NaphS2
ref|WP_029128061.1|  glycerol kinase                                    198   4e-56    Salinispora pacifica
ref|WP_020423170.1|  glycerol kinase                                    198   4e-56    Amycolatopsis sp. ATCC 39116
ref|WP_018810625.1|  glycerol kinase                                    198   4e-56    
ref|WP_014349312.1|  glycerol kinase                                    198   5e-56    
gb|KBV03083.1|  glycerol kinase GlpK                                    191   5e-56    
ref|WP_043718666.1|  glycerol kinase                                    198   5e-56    
ref|WP_012893895.1|  glycerol kinase                                    198   5e-56    
ref|WP_013824342.1|  glycerol kinase                                    197   6e-56    
ref|WP_026531176.1|  glycerol kinase                                    197   6e-56    
ref|WP_030529577.1|  glycerol kinase                                    197   6e-56    
ref|WP_016464115.1|  glycerol kinase                                    197   6e-56    
ref|WP_017204512.1|  glycerol kinase                                    197   6e-56    
ref|WP_005047841.1|  glycerol kinase                                    197   6e-56    
ref|WP_037342574.1|  glycerol kinase                                    197   7e-56    
ref|WP_004807519.1|  glycerol kinase                                    197   7e-56    
ref|WP_042541676.1|  glycerol kinase                                    197   7e-56    
ref|WP_042542604.1|  glycerol kinase                                    197   7e-56    
ref|WP_024286825.1|  glycerol kinase                                    197   7e-56    
ref|WP_020647395.1|  glycerol kinase                                    197   7e-56    
gb|AHJ48706.1|  glycerol kinase                                         191   7e-56    
ref|WP_015773622.1|  glycerol kinase                                    197   7e-56    
ref|WP_024936374.1|  glycerol kinase                                    197   8e-56    
ref|WP_042756353.1|  glycerol kinase                                    191   8e-56    
ref|WP_024476806.1|  glycerol kinase                                    197   8e-56    
ref|WP_015105019.1|  Glycerol kinase                                    197   8e-56    
ref|WP_018682408.1|  glycerol kinase                                    197   8e-56    
ref|WP_009945105.1|  glycerol kinase                                    197   8e-56    
ref|WP_003057219.1|  glycerol kinase                                    197   8e-56    
gb|AHE14689.1|  FAD dependent oxidoreductase family protein             197   9e-56    
ref|WP_035928520.1|  glycerol kinase                                    197   9e-56    
ref|WP_016663431.1|  glycerol kinase                                    197   9e-56    
ref|WP_028501984.1|  glycerol kinase                                    197   9e-56    
ref|WP_027769937.1|  glycerol kinase                                    197   9e-56    
ref|WP_026599807.1|  glycerol kinase                                    197   9e-56    
ref|WP_034232906.1|  glycerol kinase                                    197   1e-55    
ref|WP_003873346.1|  glycerol kinase                                    197   1e-55    
ref|WP_019146442.1|  glycerol kinase                                    197   1e-55    
ref|WP_013115804.1|  glycerol kinase                                    197   1e-55    
ref|WP_003877027.1|  glycerol kinase                                    197   1e-55    
ref|WP_038847727.1|  glycerol kinase                                    197   1e-55    
ref|WP_017887334.1|  MULTISPECIES: glycerol kinase                      197   1e-55    
ref|WP_020672234.1|  glycerol kinase                                    197   1e-55    
ref|WP_010851484.1|  glycerol kinase                                    197   1e-55    
ref|WP_040865247.1|  glycerol kinase                                    197   1e-55    
ref|WP_040284713.1|  glycerol kinase                                    197   1e-55    
gb|ETB09546.1|  glycerol kinase                                         197   1e-55    
ref|WP_003800801.1|  glycerol kinase                                    197   1e-55    
ref|WP_040201436.1|  glycerol kinase                                    197   1e-55    
ref|WP_018215645.1|  glycerol kinase                                    197   1e-55    
gb|AAS02670.1|  GlpK                                                    197   1e-55    
ref|WP_019135877.1|  glycerol kinase                                    197   1e-55    
ref|WP_013226257.1|  glycerol kinase                                    197   1e-55    
ref|WP_031507577.1|  glycerol kinase                                    197   1e-55    
ref|WP_028924103.1|  glycerol kinase                                    197   1e-55    
ref|WP_005178846.1|  glycerol kinase                                    197   1e-55    
ref|WP_018255733.1|  glycerol kinase                                    197   1e-55    
ref|WP_043575623.1|  glycerol kinase                                    197   1e-55    
ref|WP_034271867.1|  glycerol kinase                                    197   1e-55    
ref|WP_035284750.1|  glycerol kinase                                    197   1e-55    
ref|WP_034371115.1|  glycerol kinase                                    197   1e-55    
ref|WP_030511834.1|  glycerol kinase                                    197   1e-55    
ref|WP_036474429.1|  glycerol kinase                                    197   1e-55    
ref|WP_027657906.1|  glycerol kinase                                    197   1e-55    
ref|WP_019872340.1|  glycerol kinase                                    197   2e-55    
ref|WP_036285653.1|  glycerol kinase                                    197   2e-55    
ref|WP_037339524.1|  glycerol kinase                                    197   2e-55    
ref|WP_036545874.1|  glycerol kinase                                    197   2e-55    
ref|WP_019732609.1|  MULTISPECIES: glycerol kinase                      197   2e-55    
ref|WP_038511941.1|  glycerol kinase                                    196   2e-55    
ref|WP_033729155.1|  glycerol kinase                                    197   2e-55    
ref|WP_031354280.1|  glycerol kinase                                    197   2e-55    
ref|WP_027656696.1|  glycerol kinase                                    196   2e-55    
ref|WP_005206214.1|  glycerol kinase                                    196   2e-55    
ref|WP_013809138.1|  glycerol kinase                                    196   2e-55    
ref|WP_009940284.1|  glycerol kinase                                    191   2e-55    
ref|WP_033720199.1|  glycerol kinase                                    196   2e-55    
ref|WP_042726458.1|  glycerol kinase                                    196   2e-55    
ref|WP_035791790.1|  glycerol kinase                                    196   2e-55    
ref|WP_011344733.1|  glycerol kinase                                    196   2e-55    
gb|ETA94472.1|  glycerol kinase                                         197   2e-55    
ref|WP_034316660.1|  glycerol kinase                                    196   2e-55    
ref|WP_042908475.1|  glycerol kinase                                    196   2e-55    
ref|WP_033384401.1|  glycerol kinase                                    196   2e-55    
ref|WP_042904409.1|  hypothetical protein                               191   2e-55    
ref|WP_022878082.1|  glycerol kinase                                    196   2e-55    
ref|XP_003056322.1|  predicted protein                                  197   2e-55    
ref|WP_020624849.1|  glycerol kinase                                    196   2e-55    
ref|WP_007033226.1|  glycerol kinase                                    196   2e-55    
ref|WP_018830846.1|  glycerol kinase                                    196   2e-55    
ref|WP_012013690.1|  glycerol kinase                                    196   2e-55    
ref|WP_033228932.1|  glycerol kinase                                    196   2e-55    
ref|WP_028052024.1|  glycerol kinase                                    196   2e-55    
ref|WP_030250580.1|  glycerol kinase                                    196   2e-55    
ref|WP_033388311.1|  glycerol kinase                                    196   2e-55    
ref|WP_031064041.1|  glycerol kinase                                    196   2e-55    
ref|WP_025347461.1|  glycerol kinase                                    196   2e-55    
ref|WP_013583492.1|  glycerol kinase                                    196   2e-55    
ref|WP_042195709.1|  glycerol kinase                                    196   2e-55    
ref|WP_011904413.1|  glycerol kinase                                    196   2e-55    
ref|WP_028050532.1|  glycerol kinase                                    196   2e-55    
ref|WP_014210517.1|  glycerol kinase                                    196   2e-55    
ref|WP_041309928.1|  MULTISPECIES: glycerol kinase                      196   2e-55    
ref|WP_018724791.1|  glycerol kinase                                    196   2e-55    
ref|WP_016335195.1|  glycerol kinase                                    196   2e-55    
ref|WP_031344618.1|  glycerol kinase                                    196   2e-55    
ref|WP_037251689.1|  glycerol kinase                                    196   2e-55    
gb|ABG10977.1|  glycerol kinase                                         196   2e-55    
ref|WP_044799048.1|  hypothetical protein                               190   2e-55    
ref|WP_028187940.1|  glycerol kinase                                    196   2e-55    
ref|WP_019988789.1|  glycerol kinase                                    196   2e-55    
ref|WP_029931756.1|  glycerol kinase                                    196   2e-55    
ref|WP_037746777.1|  glycerol kinase                                    195   2e-55    
gb|ETB21410.1|  glycerol kinase                                         196   2e-55    
ref|WP_040254938.1|  glycerol kinase                                    196   3e-55    
ref|WP_040688123.1|  glycerol kinase                                    196   3e-55    
ref|WP_018837529.1|  glycerol kinase                                    196   3e-55    
gb|EGV14165.1|  glycerol kinase                                         194   3e-55    
ref|WP_009974637.1|  glycerol kinase                                    196   3e-55    
ref|WP_010549215.1|  glycerol kinase                                    196   3e-55    
ref|WP_036293668.1|  glycerol kinase                                    196   3e-55    
ref|WP_030171291.1|  MULTISPECIES: glycerol kinase                      196   3e-55    
gb|ETB13213.1|  glycerol kinase                                         196   3e-55    
ref|WP_014059525.1|  glycerol kinase                                    196   3e-55    
ref|WP_017884908.1|  glycerol kinase                                    196   3e-55    
ref|WP_027757088.1|  glycerol kinase                                    196   3e-55    
ref|WP_030168428.1|  glycerol kinase                                    196   3e-55    
ref|WP_026544016.1|  glycerol kinase                                    196   3e-55    
ref|WP_028423131.1|  glycerol kinase                                    196   4e-55    
ref|WP_015776956.1|  glycerol kinase                                    196   4e-55    
ref|WP_037730098.1|  glycerol kinase                                    196   4e-55    
ref|WP_037309812.1|  glycerol kinase                                    196   4e-55    
ref|WP_018351123.1|  hypothetical protein                               195   4e-55    
ref|WP_043729602.1|  glycerol kinase                                    196   4e-55    
ref|WP_015793712.1|  glycerol kinase                                    196   4e-55    
ref|WP_035836941.1|  glycerol kinase                                    196   4e-55    
ref|WP_035750642.1|  glycerol kinase                                    195   4e-55    
ref|WP_023885850.1|  glycerol kinase                                    196   4e-55    
ref|WP_013882334.1|  glycerol kinase [                                  196   4e-55    
gb|KAL21218.1|  glycerol kinase GlpK                                    191   4e-55    
ref|WP_028703221.1|  glycerol kinase                                    196   4e-55    
ref|WP_027762751.1|  glycerol kinase                                    196   4e-55    
ref|WP_031703440.1|  hypothetical protein                               190   4e-55    
ref|WP_015334176.1|  glycerol kinase                                    195   5e-55    
ref|WP_030475900.1|  glycerol kinase                                    195   5e-55    
ref|WP_041694822.1|  glycerol kinase                                    195   5e-55    
ref|WP_023420204.1|  MULTISPECIES: glycerol kinase                      196   5e-55    
ref|WP_037730009.1|  hypothetical protein                               195   5e-55    
ref|WP_030542151.1|  glycerol kinase                                    196   5e-55    
ref|WP_031099411.1|  MULTISPECIES: glycerol kinase                      195   5e-55    
ref|WP_017793875.1|  glycerol kinase                                    195   5e-55    
ref|WP_018469199.1|  MULTISPECIES: glycerol kinase                      196   5e-55    
ref|WP_003947218.1|  MULTISPECIES: glycerol kinase                      196   5e-55    
ref|WP_037859877.1|  glycerol kinase                                    195   5e-55    
ref|WP_030696520.1|  glycerol kinase                                    196   5e-55    
ref|WP_031702232.1|  hypothetical protein                               190   5e-55    
gb|ETA08808.1|  glycerol kinase                                         195   5e-55    
ref|WP_020730936.1|  Glycerol kinase                                    195   5e-55    
ref|WP_037730025.1|  hypothetical protein                               195   5e-55    
ref|WP_036332995.1|  glycerol kinase                                    195   5e-55    
ref|WP_003419781.1|  MULTISPECIES: glycerol kinase                      190   5e-55    
gb|AEJ42051.1|  glycerol kinase                                         196   5e-55    
gb|ACY21056.1|  glycerol kinase                                         195   5e-55    
ref|WP_009289239.1|  MULTISPECIES: glycerol kinase                      195   5e-55    
ref|WP_043403961.1|  glycerol kinase                                    195   5e-55    
ref|WP_024356445.1|  glycerol kinase                                    195   6e-55    
ref|WP_028565102.1|  glycerol kinase                                    195   6e-55    
ref|WP_020785266.1|  Glycerol kinase                                    195   6e-55    
ref|WP_012396720.1|  MULTISPECIES: glycerol kinase                      195   6e-55    
ref|WP_005167273.1|  Glycerol kinase                                    195   6e-55    
ref|WP_011741904.1|  glycerol kinase                                    195   6e-55    
ref|WP_018830042.1|  glycerol kinase                                    195   6e-55    
ref|XP_009055569.1|  hypothetical protein LOTGIDRAFT_209470             196   6e-55    
ref|WP_020634636.1|  glycerol kinase                                    195   6e-55    
ref|WP_010614478.1|  glycerol kinase                                    195   6e-55    
ref|WP_037739010.1|  hypothetical protein                               195   6e-55    
ref|WP_041925177.1|  glycerol kinase                                    195   6e-55    
ref|WP_024368601.1|  glycerol kinase                                    195   6e-55    
gb|ABO01005.1|  glycerol kinase                                         195   6e-55    
gb|KEP74468.1|  glycerol kinase                                         195   6e-55    
ref|WP_028707479.1|  glycerol kinase                                    195   6e-55    
ref|WP_028567714.1|  glycerol kinase                                    195   6e-55    
ref|WP_026554959.1|  glycerol kinase                                    195   6e-55    
ref|WP_037628462.1|  glycerol kinase                                    195   7e-55    
ref|WP_030380786.1|  MULTISPECIES: glycerol kinase                      195   7e-55    
ref|WP_007240295.1|  glycerol kinase                                    195   7e-55    
ref|WP_041919816.1|  glycerol kinase                                    195   7e-55    
ref|WP_037738533.1|  hypothetical protein                               195   7e-55    
ref|WP_043463377.1|  glycerol kinase                                    195   7e-55    
ref|WP_006594500.1|  glycerol kinase                                    195   7e-55    
ref|WP_006567424.1|  glycerol kinase                                    195   7e-55    
ref|WP_029722263.1|  glycerol kinase                                    195   7e-55    
dbj|GAM27131.1|  hypothetical protein SAMD00019534_103060               196   7e-55    
ref|WP_019708870.1|  glycerol kinase                                    195   7e-55    
emb|CEF97002.1|  Carbohydrate kinase, FGGY, C-terminal                  195   7e-55    
ref|WP_006243920.1|  glycerol kinase                                    195   7e-55    
ref|WP_028046101.1|  glycerol kinase                                    195   7e-55    
ref|WP_002857756.1|  glycerol kinase                                    195   7e-55    
ref|WP_027942578.1|  glycerol kinase                                    195   7e-55    
ref|WP_024936622.1|  glycerol kinase                                    195   8e-55    
ref|WP_011207501.1|  glycerol kinase                                    194   8e-55    
ref|WP_005271764.1|  glycerol kinase                                    195   8e-55    
ref|WP_009233209.1|  glycerol kinase                                    195   8e-55    
ref|WP_028577748.1|  glycerol kinase                                    195   8e-55    
ref|WP_037621032.1|  glycerol kinase                                    195   8e-55    
ref|WP_024455537.1|  MULTISPECIES: glycerol kinase                      195   8e-55    
gb|AGZ51127.1|  glycerol kinase                                         195   8e-55    
ref|WP_021608510.1|  glycerol kinase                                    195   8e-55    
ref|WP_036394523.1|  glycerol kinase                                    195   8e-55    
ref|WP_036319933.1|  glycerol kinase                                    195   8e-55    
ref|WP_015309760.1|  glycerol kinase                                    195   8e-55    
ref|WP_003888638.1|  glycerol kinase                                    195   8e-55    
ref|WP_008712346.1|  Glycerol kinase 2                                  195   8e-55    
ref|WP_027747707.1|  glycerol kinase                                    194   9e-55    
ref|WP_028443498.1|  MULTISPECIES: glycerol kinase                      194   9e-55    
ref|WP_005461643.1|  glycerol kinase                                    194   9e-55    
ref|WP_023552204.1|  glycerol kinase                                    194   9e-55    
ref|WP_016948833.1|  hypothetical protein                               194   9e-55    
ref|WP_040315722.1|  glycerol kinase                                    195   9e-55    
ref|WP_028801631.1|  glycerol kinase                                    195   9e-55    
ref|WP_034087989.1|  glycerol kinase                                    194   9e-55    
ref|WP_021754090.1|  glycerol kinase                                    194   9e-55    
ref|WP_009198563.1|  glycerol kinase                                    194   9e-55    
ref|WP_009394447.1|  glycerol kinase                                    194   1e-54    



>emb|CDO98178.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE+LASKV+STGGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIISSASEIEELASKVDSTGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSMHKDAGD GE KN++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMHKDAGDTGETKNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLG+PVVRPADIETTALGAAYAAGLAVGIWTEDEIFS+GEKMKK T
Sbjct  430  GATVNNLLMQIQADLLGNPVVRPADIETTALGAAYAAGLAVGIWTEDEIFSAGEKMKKAT  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F+PV+EE +RKKKV+SWCKAVSRTFDLAD
Sbjct  490  NFQPVLEEGLRKKKVESWCKAVSRTFDLAD  519



>ref|XP_011081977.1| PREDICTED: glycerol kinase [Sesamum indicum]
Length=522

 Score =   362 bits (930),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I +ASEIE+LA +V+S+GGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKTASEIEKLALEVDSSGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSMHKDAG+KGEVKND+GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNDKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQAD+LGSPVVRPADIETTALGAAYAAGLAVG+WTED+IFSSGEK +KDT
Sbjct  430  GATVNNLLMQIQADILGSPVVRPADIETTALGAAYAAGLAVGVWTEDQIFSSGEKTEKDT  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P I+E++RK+KV+SWCKAV+RTFDLAD
Sbjct  490  VFRPAIDEQLRKQKVESWCKAVTRTFDLAD  519



>ref|XP_008461141.1| PREDICTED: glycerol kinase [Cucumis melo]
Length=523

 Score =   360 bits (923),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSA EIE+LA +V+STGGVYFVPAFNGLFAPWWRD
Sbjct  311  NYALEGSIAIAGAAVQWLRDSLGIISSAQEIEELALQVQSTGGVYFVPAFNGLFAPWWRD  370

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDG
Sbjct  371  DARGVCIGITRFTSKAHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDG  430

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGIW++DEIF SGE++K  T
Sbjct  431  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGIWSKDEIFDSGERVKSAT  490

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F PV+EEE+RKKKV+SWCKAVSRTFDLAD
Sbjct  491  TFYPVLEEELRKKKVESWCKAVSRTFDLAD  520



>ref|XP_004135863.1| PREDICTED: glycerol kinase-like [Cucumis sativus]
 ref|XP_004163547.1| PREDICTED: glycerol kinase-like [Cucumis sativus]
 gb|KGN45247.1| hypothetical protein Csa_7G432280 [Cucumis sativus]
Length=523

 Score =   358 bits (920),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSA EIE+LAS+V+STGGVYFVPAFNGLFAPWWRD
Sbjct  311  NYALEGSIAIAGAAVQWLRDSLGIISSAQEIEKLASQVQSTGGVYFVPAFNGLFAPWWRD  370

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSMHKDA +KGEVKN++GEF+LRVDG
Sbjct  371  DARGVCIGITRFTSKAHIARAVLESMCFQVKDVLDSMHKDAVEKGEVKNEKGEFLLRVDG  430

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGIW++DEIF SGE++K  T
Sbjct  431  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGIWSKDEIFDSGERVKSAT  490

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F PV+EEE+RKKKV+SWCKAVSRTFDLAD
Sbjct  491  TFYPVLEEELRKKKVESWCKAVSRTFDLAD  520



>emb|CAN76048.1| hypothetical protein VITISV_037711 [Vitis vinifera]
Length=522

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE+LA+KV+S+GGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIISSASEIEELAAKVDSSGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT+NNLLMQIQADLLG+PVVRPADIETTALGAAYAAGLAVGIWTEDEIF SGEK+K  T
Sbjct  430  GATINNLLMQIQADLLGNPVVRPADIETTALGAAYAAGLAVGIWTEDEIFDSGEKVKLAT  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F P ++EE R KKV+SWCKAVSRTFDLAD
Sbjct  490  TFYPALDEERRNKKVESWCKAVSRTFDLAD  519



>ref|XP_007023294.1| Actin-like ATPase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY25916.1| Actin-like ATPase superfamily protein isoform 1 [Theobroma cacao]
Length=522

 Score =   358 bits (918),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +IS+ASEIE LA +V+STGGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIISTASEIESLALQVDSTGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTSKAHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVG+W EDEIF+S EK+K  T
Sbjct  430  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWKEDEIFASREKIKTAT  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF+PV+ EE+RKKKVDSWCKAV RTFDLAD
Sbjct  490  IFRPVLSEELRKKKVDSWCKAVERTFDLAD  519



>ref|XP_002273367.1| PREDICTED: glycerol kinase [Vitis vinifera]
 emb|CBI36391.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   357 bits (916),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +IS+ASEIE+LA+KV+S+GGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIISTASEIEELAAKVDSSGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT+NNLLMQIQADLLG+PVVRPADIETTALGAAYAAGLAVGIWTEDEIF SGEK+K  T
Sbjct  430  GATINNLLMQIQADLLGNPVVRPADIETTALGAAYAAGLAVGIWTEDEIFDSGEKVKLAT  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F P ++EE R KKV+SWCKAVSRTFDLAD
Sbjct  490  TFYPALDEERRNKKVESWCKAVSRTFDLAD  519



>gb|EYU21675.1| hypothetical protein MIMGU_mgv1a019703mg [Erythranthe guttata]
Length=510

 Score =   356 bits (914),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I +A EIE+LA +V+S+GGVYFVPAFNGLFAPWWRD
Sbjct  298  NYALEGSIAIAGAAVQWLRDSLGIIKTAGEIEELALQVDSSGGVYFVPAFNGLFAPWWRD  357

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KGE KND+GEFVLRVDG
Sbjct  358  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGEAKNDKGEFVLRVDG  417

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVG+WTE+EIFSS EK +K T
Sbjct  418  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWTENEIFSSVEKQEKPT  477

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+PV+ EEVRKKKV+SWCKAVSRTFDLAD
Sbjct  478  VFRPVLGEEVRKKKVESWCKAVSRTFDLAD  507



>ref|XP_004235901.1| PREDICTED: glycerol kinase [Solanum lycopersicum]
Length=522

 Score =   355 bits (911),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE+LASKV STGGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIISSASEIEELASKVSSTGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSMHKDAG K E K+D+ EF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMHKDAGTKDEAKSDKTEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT+NNLLMQIQADLLGS VVRPADIETTALGAAYAAGLAVG++TE++IF+SGEK+K+ T
Sbjct  430  GATINNLLMQIQADLLGSSVVRPADIETTALGAAYAAGLAVGVYTENDIFASGEKLKQAT  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IFKPV+EEE+RKKK DSWC+AVSR+FDLAD
Sbjct  490  IFKPVLEEELRKKKADSWCRAVSRSFDLAD  519



>ref|XP_010033977.1| PREDICTED: glycerol kinase-like [Eucalyptus grandis]
 ref|XP_010033978.1| PREDICTED: glycerol kinase-like [Eucalyptus grandis]
 gb|KCW53847.1| hypothetical protein EUGRSUZ_J03080 [Eucalyptus grandis]
 gb|KCW53848.1| hypothetical protein EUGRSUZ_J03080 [Eucalyptus grandis]
Length=522

 Score =   354 bits (909),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE+LAS+V+STGGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLEIISSASEIEKLASQVDSTGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESM FQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKAHIARAVLESMAFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLG+PVVRPADIETTALGAAYAAGLAVG+WTED+IF SG +    T
Sbjct  430  GATVNNLLMQIQADLLGNPVVRPADIETTALGAAYAAGLAVGVWTEDDIFHSGARSSDPT  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F+P ++EE+RKKKVDSWCKAVSRTFDLAD
Sbjct  490  TFRPKLDEELRKKKVDSWCKAVSRTFDLAD  519



>ref|XP_011073388.1| PREDICTED: glycerol kinase-like [Sesamum indicum]
Length=522

 Score =   354 bits (909),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE+LA +V++ GGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEELALQVDTCGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGV IGITRFTNK HIARAVLESMCFQV+DVLDSMHKD GDKGE KND+GEF+LRVDG
Sbjct  370  DARGVLIGITRFTNKSHIARAVLESMCFQVKDVLDSMHKDVGDKGEAKNDKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADL+G PV RPADIETTA GAAYAAGLA+GIWTE +IFSSGE+M K T
Sbjct  430  GATVNNLLMQIQADLIGKPVARPADIETTARGAAYAAGLAIGIWTEKDIFSSGEEMDKPT  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF+P++++EVRKKKVDSWCKAVSRTFDLAD
Sbjct  490  IFRPIVDQEVRKKKVDSWCKAVSRTFDLAD  519



>gb|AIT39761.1| glycerol kinase, partial [Chrysanthemum boreale]
Length=514

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE+LA+KV+STGGVYFVPAFNGLFAPWWRD
Sbjct  302  NYALEGSIAIAGAAVQWLRDSLGIISSASEIEELAAKVDSTGGVYFVPAFNGLFAPWWRD  361

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGV IGITRFTNK HIARAVLESMCFQV+DVLDSMHKDAG+KGE KN +G+F+LRVDG
Sbjct  362  DARGVLIGITRFTNKSHIARAVLESMCFQVKDVLDSMHKDAGEKGETKNAKGQFLLRVDG  421

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNN LMQIQADLLG+PVVRPADIETTALGAAYAAGLAVG+WTE+EIFS+GE+MKKDT
Sbjct  422  GATVNNTLMQIQADLLGNPVVRPADIETTALGAAYAAGLAVGVWTEEEIFSNGERMKKDT  481

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F PV+ +E+R+KKV SWCKAV ++FDLAD
Sbjct  482  TFNPVLNDELREKKVASWCKAVGKSFDLAD  511



>ref|XP_004303284.1| PREDICTED: glycerol kinase-like [Fragaria vesca subsp. vesca]
Length=522

 Score =   352 bits (904),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LAS+VESTGG+YFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIETLASEVESTGGIYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIG+TRFTNK HIARAVLESMCFQV+DVLDSMHKDAG++GEVKN++GEF+LRVDG
Sbjct  370  DARGVCIGMTRFTNKAHIARAVLESMCFQVKDVLDSMHKDAGEQGEVKNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQAD++GSPVVRPAD ETTALGAAYAAGLAVG+WTE+EIF+S EK K  T
Sbjct  430  GATVNNLLMQIQADVMGSPVVRPADTETTALGAAYAAGLAVGVWTEEEIFASEEKTKTAT  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F+P I EE+RKKK++SWCKAVSRTFDLAD
Sbjct  490  TFRPKIGEELRKKKLESWCKAVSRTFDLAD  519



>ref|XP_009593517.1| PREDICTED: glycerol kinase [Nicotiana tomentosiformis]
Length=522

 Score =   352 bits (902),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSA+EIE+LASKV STGGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIISSANEIEELASKVTSTGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+C+GITRFTNK HIARAVLESMCFQV+DVLDSMHKDA  K + K +  EF+LRVDG
Sbjct  370  DARGICVGITRFTNKSHIARAVLESMCFQVKDVLDSMHKDAAQKSDDKTEGTEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVG++T+DEIFSSGEKMKK T
Sbjct  430  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVYTQDEIFSSGEKMKKAT  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             FKPV+EEE+RKKKVDSWC AVSR+FDLAD
Sbjct  490  TFKPVLEEELRKKKVDSWCLAVSRSFDLAD  519



>ref|XP_009758692.1| PREDICTED: glycerol kinase [Nicotiana sylvestris]
Length=522

 Score =   351 bits (900),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSA+EIE LASKV STGGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIISSANEIEDLASKVTSTGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+C+GITRFTNK HIARAVLESMCFQV+DVLDSMHKDA  K + K +  EF+LRVDG
Sbjct  370  DARGICVGITRFTNKSHIARAVLESMCFQVKDVLDSMHKDAAQKSDGKTEGTEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVG++T+DEIFSSGEKMKK T
Sbjct  430  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVYTQDEIFSSGEKMKKAT  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             FKPV+EEE+RKKKVDSWC AVSR+FDLAD
Sbjct  490  TFKPVLEEELRKKKVDSWCLAVSRSFDLAD  519



>ref|XP_006341400.1| PREDICTED: glycerol kinase-like [Solanum tuberosum]
Length=518

 Score =   350 bits (897),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 197/210 (94%), Gaps = 4/210 (2%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE+LASKV STGGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIISSASEIEELASKVSSTGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFTNK HIARAVLESMCFQV+DVLDSMHKDA    E K+D+ EF+LRVDG
Sbjct  370  DARGICIGITRFTNKSHIARAVLESMCFQVKDVLDSMHKDA----EAKSDKTEFLLRVDG  425

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGS VVRPADIETTALGAAYAAGLAVG++TEDEIF+SGEK+K+ T
Sbjct  426  GATVNNLLMQIQADLLGSSVVRPADIETTALGAAYAAGLAVGVYTEDEIFASGEKLKQAT  485

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IFKPV+EEE+RKKK DSWC+AVSR+FDLAD
Sbjct  486  IFKPVLEEELRKKKADSWCRAVSRSFDLAD  515



>ref|XP_010063499.1| PREDICTED: glycerol kinase [Eucalyptus grandis]
 gb|KCW70740.1| hypothetical protein EUGRSUZ_F03908 [Eucalyptus grandis]
Length=524

 Score =   348 bits (892),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE LA  V+STGGVYFVPAFNGLFAPWWR+
Sbjct  311  NYALEGSIAIAGAAVQWLRDSLGVISSASEIEDLAMSVDSTGGVYFVPAFNGLFAPWWRE  370

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSMHKDAG+KGE KN++GEF+LRVDG
Sbjct  371  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMHKDAGEKGEAKNEKGEFLLRVDG  430

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLG+PVVRPADIETTALGAAYAAGLAVGIWTE++IFSSGE+ +  T
Sbjct  431  GATVNNLLMQIQADLLGNPVVRPADIETTALGAAYAAGLAVGIWTENDIFSSGERAENVT  490

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F P ++E VRK K+DSWCKAVSRTFDLAD
Sbjct  491  TFHPRLDEGVRKSKLDSWCKAVSRTFDLAD  520



>ref|XP_009334628.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
Length=530

 Score =   347 bits (890),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA +VESTGGVYFVPAFNGLFAPWWRD
Sbjct  318  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLALQVESTGGVYFVPAFNGLFAPWWRD  377

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HI RAVLESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDG
Sbjct  378  DARGVCIGITRFTNKAHICRAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDG  437

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVN LLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVG+W+E EIF+S E+ K  T
Sbjct  438  GATVNTLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWSEKEIFASEERTKTST  497

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF+P ++EE+RKKK++SW KA+SRTFDLAD
Sbjct  498  IFRPKLDEELRKKKLESWFKAISRTFDLAD  527



>ref|XP_008372701.1| PREDICTED: glycerol kinase [Malus domestica]
 ref|XP_008372702.1| PREDICTED: glycerol kinase [Malus domestica]
Length=530

 Score =   347 bits (889),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA +VESTGGVYFVPAFNGLFAPWWRD
Sbjct  318  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLALQVESTGGVYFVPAFNGLFAPWWRD  377

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HI RAVLESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDG
Sbjct  378  DARGVCIGITRFTNKAHICRAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDG  437

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVN LLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVG+W+E EIF+  E+ K  T
Sbjct  438  GATVNTLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWSEKEIFACEERTKSST  497

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF+P ++EE+RKKK+DSW KA+SRTFDLAD
Sbjct  498  IFRPKLDEELRKKKLDSWFKAISRTFDLAD  527



>ref|XP_009336317.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
 ref|XP_009338517.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
 ref|XP_009338518.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
Length=524

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA +VESTGGVYFVPAFNGLFAPWWRD
Sbjct  312  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLALQVESTGGVYFVPAFNGLFAPWWRD  371

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HI RAVLESMCFQV+DVLDSMHKDAG+KGE KN++GEF+LRVDG
Sbjct  372  DARGVCIGITRFTNKAHICRAVLESMCFQVKDVLDSMHKDAGEKGEAKNEKGEFLLRVDG  431

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVN LLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVG+W+E EIF+  E+ K  T
Sbjct  432  GATVNTLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWSEKEIFACEERTKNST  491

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF+P ++EE+RKKK+DSW KA+SRTFDLAD
Sbjct  492  IFRPKLDEELRKKKLDSWFKAISRTFDLAD  521



>gb|KJB66376.1| hypothetical protein B456_010G138000 [Gossypium raimondii]
Length=370

 Score =   338 bits (868),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE LASKV+ TGGVYFVPAFNGLFAPWWRD
Sbjct  158  NYALEGSIAIAGAAVQWLRDSLGIISSASEIESLASKVDCTGGVYFVPAFNGLFAPWWRD  217

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFT+K HIARAVLESMCFQV+DVLDSMHKDAG+KGEVKN++ EF+LRVDG
Sbjct  218  DARGICIGITRFTSKSHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKEEFLLRVDG  277

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGS VVRPADIETTALGAAYAAG+AVG+W E+E+F+SG+ +K  +
Sbjct  278  GATVNNLLMQIQADLLGSSVVRPADIETTALGAAYAAGIAVGVWKEEELFASGQIIKTAS  337

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF P    E RKKKVDSWCKAV RTF LAD
Sbjct  338  IFSPKSSVEWRKKKVDSWCKAVERTFGLAD  367



>ref|XP_010472924.1| PREDICTED: glycerol kinase-like isoform X1 [Camelina sativa]
 ref|XP_010472925.1| PREDICTED: glycerol kinase-like isoform X2 [Camelina sativa]
Length=522

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA+KV+STGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAKVDSTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + ND+GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNDKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   
Sbjct  430  GATANNLLMQIQADLMGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKAKNSK  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EE  RKKKV+SWCKAV+RTFDLAD
Sbjct  490  VFRPAMEEGTRKKKVESWCKAVTRTFDLAD  519



>gb|KHG30375.1| Glycerol kinase [Gossypium arboreum]
Length=550

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE LASKV+ TGGVYFVPAFNGLFAPWWRD
Sbjct  338  NYALEGSIAIAGAAVQWLRDSLGIISSASEIESLASKVDCTGGVYFVPAFNGLFAPWWRD  397

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFT+K HIARAVLESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDG
Sbjct  398  DARGICIGITRFTSKSHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDG  457

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGS VVRPADIETTALGAAYAAG+AVG+W E+E+F+ G+ +K  +
Sbjct  458  GATVNNLLMQIQADLLGSSVVRPADIETTALGAAYAAGMAVGVWKEEELFALGQNIKTAS  517

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF P    E RKKKVDSWCKAV RTF LAD
Sbjct  518  IFSPKSSVEWRKKKVDSWCKAVERTFGLAD  547



>ref|XP_010691126.1| PREDICTED: glycerol kinase [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L +I S+ EIE+LASKV+STGGVYFVPAFNGLFAPWWRD
Sbjct  311  NYALEGSIAIAGAAVQWLRDGLGIIKSSGEIEELASKVDSTGGVYFVPAFNGLFAPWWRD  370

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVC+G+TRFTNK HI RAVLESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDG
Sbjct  371  DARGVCVGMTRFTNKSHICRAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDG  430

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPV+RP +IETTALGAAYAAGLAVG+W +D+IFS+ E+ K   
Sbjct  431  GATVNNLLMQIQADLLGSPVLRPENIETTALGAAYAAGLAVGVWKQDQIFSTEERAKTAR  490

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF+P +EEE RKKKV SWCKAV R+FDLAD
Sbjct  491  IFRPTLEEESRKKKVGSWCKAVERSFDLAD  520



>emb|CDX67948.1| BnaA07g19880D [Brassica napus]
Length=522

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE+LA+ VESTGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEELAAMVESTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N +GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNGKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   
Sbjct  430  GATANNLLMQIQADLMGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKSKNSK  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EEE RKKKV+SWCKAV RTFDLAD
Sbjct  490  VFRPAMEEETRKKKVESWCKAVERTFDLAD  519



>ref|XP_009104463.1| PREDICTED: glycerol kinase [Brassica rapa]
 ref|XP_009104464.1| PREDICTED: glycerol kinase [Brassica rapa]
Length=522

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE+LA+ VESTGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEELAAMVESTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N +GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNGKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+G+PVVRP DIETTALGAAYAAGLAVG W E+ IF SGEK K   
Sbjct  430  GATANNLLMQIQADLMGTPVVRPVDIETTALGAAYAAGLAVGFWKEENIFESGEKSKNSK  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EEE RKKKV+SWCKAV RTFDLAD
Sbjct  490  VFRPAMEEETRKKKVESWCKAVERTFDLAD  519



>emb|CDX79385.1| BnaC06g19180D [Brassica napus]
Length=522

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE+LA+ VESTGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEELAAMVESTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N +GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNGQGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   
Sbjct  430  GATANNLLMQIQADLMGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKSKNSK  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EEE RKKKV+SWCKAV RTFDLAD
Sbjct  490  VFRPTMEEETRKKKVESWCKAVERTFDLAD  519



>ref|XP_006302137.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
 gb|EOA35035.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
Length=522

 Score =   339 bits (869),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA  V+STGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAKMVDSTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+GSPVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   
Sbjct  430  GATANNLLMQIQADLMGSPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKAKNSQ  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EEE RKKKV+SWCKAV RTFDLAD
Sbjct  490  VFRPAMEEETRKKKVESWCKAVERTFDLAD  519



>emb|CDY37598.1| BnaA02g19720D [Brassica napus]
Length=522

 Score =   339 bits (869),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA+ VESTGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAMVESTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   
Sbjct  430  GATANNLLMQIQADLMGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKSKNSK  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+PV+EE  RKKKV+SWCKAV RTFDLAD
Sbjct  490  VFRPVMEEATRKKKVESWCKAVERTFDLAD  519



>gb|KJB66375.1| hypothetical protein B456_010G138000 [Gossypium raimondii]
Length=522

 Score =   338 bits (868),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE LASKV+ TGGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIISSASEIESLASKVDCTGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFT+K HIARAVLESMCFQV+DVLDSMHKDAG+KGEVKN++ EF+LRVDG
Sbjct  370  DARGICIGITRFTSKSHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKEEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGS VVRPADIETTALGAAYAAG+AVG+W E+E+F+SG+ +K  +
Sbjct  430  GATVNNLLMQIQADLLGSSVVRPADIETTALGAAYAAGIAVGVWKEEELFASGQIIKTAS  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF P    E RKKKVDSWCKAV RTF LAD
Sbjct  490  IFSPKSSVEWRKKKVDSWCKAVERTFGLAD  519



>ref|XP_010417705.1| PREDICTED: glycerol kinase-like [Camelina sativa]
Length=522

 Score =   338 bits (868),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA+KV+STGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAKVDSTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   
Sbjct  430  GATANNLLMQIQADLMGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKAKNSK  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EE +RKKKV+SWCKAV RTFDLAD
Sbjct  490  VFRPAMEEGIRKKKVESWCKAVERTFDLAD  519



>emb|CDY39977.1| BnaC06g40550D [Brassica napus]
Length=522

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA+ VESTGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAMVESTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   
Sbjct  430  GATANNLLMQIQADLMGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKSKNSK  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EE  RKKKV+SWCKAV RTFDLAD
Sbjct  490  VFRPAMEEATRKKKVESWCKAVERTFDLAD  519



>ref|XP_006389795.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
 gb|ESQ27081.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
Length=522

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I  ASEIE LA+ VESTGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKKASEIEDLAAMVESTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GA+ NNLLMQIQADL+GSPVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   
Sbjct  430  GASANNLLMQIQADLMGSPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKAKNSR  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EEE+RKKKV SWCKAV RTFDLAD
Sbjct  490  VFRPAMEEEIRKKKVQSWCKAVERTFDLAD  519



>ref|XP_009106746.1| PREDICTED: glycerol kinase-like [Brassica rapa]
Length=522

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA+ VESTGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAMVESTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   
Sbjct  430  GATANNLLMQIQADLMGTPVVRPVDIETTALGAAYAAGLAVGFWREEDIFESGEKSKNSK  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EE  RKKKV+SWCKAV RTFDLAD
Sbjct  490  VFRPAMEEATRKKKVESWCKAVERTFDLAD  519



>ref|XP_010429953.1| PREDICTED: glycerol kinase [Camelina sativa]
Length=522

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I +ASEIE LA+KV+STGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKTASEIEDLAAKVDSTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   
Sbjct  430  GATANNLLMQIQADLMGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKAKNSK  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EE +RKKKV+SWCKAV RTFDLAD
Sbjct  490  VFRPAMEEGIRKKKVESWCKAVERTFDLAD  519



>emb|CDX87311.1| BnaA07g35620D [Brassica napus]
Length=522

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA+ VESTGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAMVESTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   
Sbjct  430  GATANNLLMQIQADLMGTPVVRPVDIETTALGAAYAAGLAVGFWREEDIFESGEKSKNSK  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EE  RKKKV+SWCKAV RTFDLAD
Sbjct  490  VFRPAMEEATRKKKVESWCKAVERTFDLAD  519



>ref|XP_002887828.1| At1g80460 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64087.1| At1g80460 [Arabidopsis lyrata subsp. lyrata]
Length=522

 Score =   337 bits (863),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA+ V+STGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAMVDSTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+GSPVVRP DIETTALGAAYAAGLAVG W E +IF SGEK K   
Sbjct  430  GATANNLLMQIQADLMGSPVVRPVDIETTALGAAYAAGLAVGFWKEADIFESGEKAKNSK  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EEE RKKKV SWCKAV RTFDLAD
Sbjct  490  VFRPAMEEETRKKKVASWCKAVERTFDLAD  519



>ref|XP_007215813.1| hypothetical protein PRUPE_ppa004097mg [Prunus persica]
 gb|EMJ17012.1| hypothetical protein PRUPE_ppa004097mg [Prunus persica]
Length=530

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYA+EGS AIAGAAVQWLRDSL +I SA EIE LA +VESTGGVYFVPAFNGLFAPWWRD
Sbjct  318  NYAIEGSIAIAGAAVQWLRDSLGIIKSAKEIEDLALQVESTGGVYFVPAFNGLFAPWWRD  377

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HI RAVLESM FQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDG
Sbjct  378  DARGVCIGITRFTNKAHICRAVLESMAFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDG  437

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVN LLMQIQADLLGSPV+RPADIETTALGAAYAAGLAVGIWTE EIF+  E+ K  T
Sbjct  438  GATVNTLLMQIQADLLGSPVLRPADIETTALGAAYAAGLAVGIWTEKEIFAGEERAKVAT  497

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F P ++EE+RKKK+DSW KA+SRTFDLAD
Sbjct  498  TFHPKLDEELRKKKLDSWFKAISRTFDLAD  527



>gb|ABK32113.1| At1g80460 [Arabidopsis thaliana]
Length=522

 Score =   336 bits (861),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA+ V+STGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAMVDSTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N +GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNGKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+GSPVVRP DIETTALGAAYAA LAVG W E +IF SGEK K   
Sbjct  430  GATANNLLMQIQADLMGSPVVRPVDIETTALGAAYAARLAVGFWKEADIFESGEKAKNSK  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EE +RKKKV SWCKAV RTFDLAD
Sbjct  490  VFRPAMEEGIRKKKVASWCKAVERTFDLAD  519



>ref|XP_010250262.1| PREDICTED: glycerol kinase-like [Nelumbo nucifera]
Length=529

 Score =   336 bits (861),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 196/210 (93%), Gaps = 2/210 (1%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L +I SA+EIE+LA++V+++GGVYFVPAFNGLFAPWWRD
Sbjct  319  NYALEGSIAIAGAAVQWLRDGLGIIKSAAEIEELAAQVDNSGGVYFVPAFNGLFAPWWRD  378

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSMHKDAG+KGE KND+GEF+LRVDG
Sbjct  379  DARGVCIGITRFTSKAHIARAVLESMCFQVKDVLDSMHKDAGEKGEAKNDKGEFLLRVDG  438

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVN LLMQIQAD+LGSPVVRPADIETTALGAAYAAGLAVG+WTED+IF+  E+ +K T
Sbjct  439  GATVNKLLMQIQADILGSPVVRPADIETTALGAAYAAGLAVGLWTEDDIFA--ERAEKAT  496

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF P ++ E+RKK+++SWCKA+SRTFDLAD
Sbjct  497  IFSPKLDGELRKKRLESWCKAISRTFDLAD  526



>ref|NP_178161.1| glycerol kinase [Arabidopsis thaliana]
 sp|Q9M8L4.1|GLPK_ARATH RecName: Full=Glycerol kinase; Short=Glycerokinase; AltName: 
Full=ATP:glycerol 3-phosphotransferase; AltName: Full=Protein 
GLYCEROL INSENSITIVE 1; AltName: Full=Protein NONHOST RESISTANCE 
TO P. S. PHASEOLICOLA 1 [Arabidopsis thaliana]
 gb|AAF27123.1|AC018849_11 putative glycerol kinase; 69575-71670 [Arabidopsis thaliana]
 gb|AAO61418.1| glycerol kinase [Arabidopsis thaliana]
 dbj|BAH19502.1| AT1G80460 [Arabidopsis thaliana]
 gb|AEE36407.1| glycerol kinase-like protein [Arabidopsis thaliana]
Length=522

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA+ V+STGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAMVDSTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N +GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNGKGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+GSPVVRP DIETTALGAAYAAGLAVG W E +IF SGEK K   
Sbjct  430  GATANNLLMQIQADLMGSPVVRPVDIETTALGAAYAAGLAVGFWKEADIFESGEKAKNSK  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EE +RKKKV SWCKAV RTFDLAD
Sbjct  490  VFRPAMEEGIRKKKVASWCKAVERTFDLAD  519



>ref|XP_011044862.1| PREDICTED: glycerol kinase [Populus euphratica]
Length=519

 Score =   334 bits (856),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 190/210 (90%), Gaps = 5/210 (2%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE+LAS+ ++TGGVYFVPAFNGLFAPWWRD
Sbjct  312  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEELASQADTTGGVYFVPAFNGLFAPWWRD  371

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSMHKDA       ++ GEF+LRVDG
Sbjct  372  DARGVCIGITRFTSKAHIARAVLESMCFQVKDVLDSMHKDAAG-----SEEGEFLLRVDG  426

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVG+WTE+EIF+SGEK K DT
Sbjct  427  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWTEEEIFASGEKSKSDT  486

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F+P + EE+RKKKVDSW KAV RTFDLAD
Sbjct  487  TFRPKLNEELRKKKVDSWFKAVERTFDLAD  516



>gb|KDO47427.1| hypothetical protein CISIN_1g0098681mg, partial [Citrus sinensis]
Length=477

 Score =   332 bits (852),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE+LA +V STGGVYFVPAFNGLFAPWWRD
Sbjct  265  NYALEGSIAIAGAAVQWLRDSLGIISSASEIEELALQVNSTGGVYFVPAFNGLFAPWWRD  324

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSM KDA +KG +K+ + EF+LRVDG
Sbjct  325  DARGVCIGITRFTSKAHIARAVLESMCFQVKDVLDSMQKDAVEKGVIKDAKSEFLLRVDG  384

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPV+RPADIETTALGAA+AAGLA+G++ E+EIF SGE+ K  T
Sbjct  385  GATVNNLLMQIQADLLGSPVIRPADIETTALGAAFAAGLAIGVFKEEEIFDSGERTKTST  444

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             FKPV+ EE RKKK +SWC+AV RTF+LAD
Sbjct  445  TFKPVLNEEFRKKKAESWCRAVERTFNLAD  474



>ref|XP_008228677.1| PREDICTED: glycerol kinase [Prunus mume]
Length=530

 Score =   334 bits (856),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYA+EGS AIAGAAVQWLRDSL +I SA EIE LA +VESTGGVYFVPAFNGLFAPWWRD
Sbjct  318  NYAIEGSIAIAGAAVQWLRDSLGIIKSAKEIEDLALQVESTGGVYFVPAFNGLFAPWWRD  377

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HI RAVLESM FQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDG
Sbjct  378  DARGVCIGITRFTNKAHICRAVLESMAFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDG  437

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVN LLMQIQADLLGSPV+RPADIETTALGAAYAAGLAVGIWTE EIF+  E+ K  T
Sbjct  438  GATVNTLLMQIQADLLGSPVLRPADIETTALGAAYAAGLAVGIWTEKEIFAGEERAKVAT  497

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F P ++E +RKKK+DSW KA+SRTFDLAD
Sbjct  498  TFHPKLDEGLRKKKLDSWFKAISRTFDLAD  527



>ref|XP_006385291.1| glycerol kinase family protein [Populus trichocarpa]
 gb|ERP63088.1| glycerol kinase family protein [Populus trichocarpa]
Length=519

 Score =   333 bits (855),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 189/210 (90%), Gaps = 5/210 (2%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SA EIE+LAS+V++TGGVYFVPAFNGLFAPWWRD
Sbjct  312  NYALEGSIAIAGAAVQWLRDSLGVIKSAGEIEELASQVDTTGGVYFVPAFNGLFAPWWRD  371

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSMHKDA        + GEF+LRVDG
Sbjct  372  DARGVCIGITRFTSKAHIARAVLESMCFQVKDVLDSMHKDAAG-----TEEGEFLLRVDG  426

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVG+WTE+EIF+SGEK K DT
Sbjct  427  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWTEEEIFASGEKSKSDT  486

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F+P + EE+RKKKVDSW KAV RTFDLAD
Sbjct  487  TFRPKLNEELRKKKVDSWFKAVERTFDLAD  516



>gb|EPS68115.1| hypothetical protein M569_06657, partial [Genlisea aurea]
Length=509

 Score =   333 bits (853),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 172/211 (82%), Positives = 193/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L +I +A EIE+LA KV+S+GGVYFVPAFNGLFAP WRD
Sbjct  296  NYALEGSIAIAGAAVQWLRDGLGIIKTAGEIEELALKVDSSGGVYFVPAFNGLFAPRWRD  355

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVC+GITRFTNK H+ARAVLESMCFQVRDVL+SMHKDAG++GE +ND+GEFVLRVDG
Sbjct  356  DARGVCVGITRFTNKSHVARAVLESMCFQVRDVLESMHKDAGEEGESRNDKGEFVLRVDG  415

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEK-MKKD  212
            GATVNNLLMQIQAD+LGSPVVRP+DIETTALGAAYAAGLAVGIW+E E+F SGEK  +K 
Sbjct  416  GATVNNLLMQIQADILGSPVVRPSDIETTALGAAYAAGLAVGIWSETEVFGSGEKGGEKP  475

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            T+F P I+EEVRKKKV+SWCKAV R+ DLAD
Sbjct  476  TVFWPFIDEEVRKKKVESWCKAVERSLDLAD  506



>ref|XP_006427440.1| hypothetical protein CICLE_v10025360mg [Citrus clementina]
 gb|ESR40680.1| hypothetical protein CICLE_v10025360mg [Citrus clementina]
Length=523

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE+LA +V STGGVYFVPAFNGLFAPWWRD
Sbjct  311  NYALEGSIAIAGAAVQWLRDSLGIISSASEIEELALQVNSTGGVYFVPAFNGLFAPWWRD  370

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSM KDA +KG +K+ + EF+LRVDG
Sbjct  371  DARGVCIGITRFTSKAHIARAVLESMCFQVKDVLDSMQKDAVEKGVIKDAKSEFLLRVDG  430

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPV+RPADIETTALGAA+AAGLA+G++ E+EIF SGE+ K  T
Sbjct  431  GATVNNLLMQIQADLLGSPVIRPADIETTALGAAFAAGLAIGVFKEEEIFDSGERTKTST  490

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             FKPV+ EE RKKK +SWC+AV RTF+LAD
Sbjct  491  TFKPVLNEEFRKKKAESWCRAVERTFNLAD  520



>ref|XP_006492058.1| PREDICTED: glycerol kinase-like [Citrus sinensis]
Length=523

 Score =   332 bits (850),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I+SASEIE+LA +V STGGVYFVPAFNGLFAPWWRD
Sbjct  311  NYALEGSIAIAGAAVQWLRDSLGIITSASEIEELALQVNSTGGVYFVPAFNGLFAPWWRD  370

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSM KDA +KG +K+ + EF+LRVDG
Sbjct  371  DARGVCIGITRFTSKAHIARAVLESMCFQVKDVLDSMQKDAVEKGVIKDAKSEFLLRVDG  430

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPV+RPADIETTALGAA+AAGLA+G++ E+EIF SGE+ K  T
Sbjct  431  GATVNNLLMQIQADLLGSPVIRPADIETTALGAAFAAGLAIGVFKEEEIFDSGERTKTST  490

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             FKPV+ EE RKKK +SWC+AV RTF+LAD
Sbjct  491  TFKPVLNEEFRKKKAESWCRAVERTFNLAD  520



>ref|XP_002517681.1| glycerol kinase, putative [Ricinus communis]
 gb|EEF44845.1| glycerol kinase, putative [Ricinus communis]
Length=521

 Score =   331 bits (849),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 190/210 (90%), Gaps = 2/210 (1%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L LISSASEIE+LA +V+STGGVYFVPAFNGLFAPWWRD
Sbjct  311  NYALEGSIAIAGAAVQWLRDGLELISSASEIEELAKQVDSTGGVYFVPAFNGLFAPWWRD  370

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITR+TNK HIARAVLESMCFQV+DVLDSMHKD  +K   K+ + EF+LRVDG
Sbjct  371  DARGVCIGITRYTNKSHIARAVLESMCFQVKDVLDSMHKDREEKH--KDTKREFLLRVDG  428

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT+NNLLMQIQADL+G PVVRP+DIETTALGAAYAAGLAVGIWTE EIF+SGEK K DT
Sbjct  429  GATINNLLMQIQADLVGHPVVRPSDIETTALGAAYAAGLAVGIWTEKEIFASGEKAKTDT  488

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF P ++EE+RKKKV+SWCKAV RTF LAD
Sbjct  489  IFCPKLDEELRKKKVESWCKAVERTFGLAD  518



>gb|AAR88660.1| glycerol kinase [Pandanus amaryllifolius]
Length=531

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 190/210 (90%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L +I SA+EIE+LA  VE+TGGVYFVPAFNGLFAPWWR+
Sbjct  320  NYALEGSTAIAGAAVQWLRDGLGIIRSAAEIEELAEGVENTGGVYFVPAFNGLFAPWWRE  379

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVC+GITRFTNK HIARAVLESMCFQV+DVL+SMHKD GD GE KN  GEF+LRVDG
Sbjct  380  DARGVCLGITRFTNKGHIARAVLESMCFQVKDVLNSMHKDVGDVGEAKNKEGEFLLRVDG  439

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLA G+WT ++IF+SG  ++K T
Sbjct  440  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLATGVWTAEQIFASGH-IEKAT  498

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P ++EE RKK+ +SWCKAVSRTFDLAD
Sbjct  499  VFRPKLDEEKRKKRTESWCKAVSRTFDLAD  528



>ref|XP_006652916.1| PREDICTED: glycerol kinase-like [Oryza brachyantha]
Length=538

 Score =   321 bits (822),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 188/210 (90%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSA+EIE+LA  V+ +GG+YFVPAFNGLFAPWWRD
Sbjct  327  NYALEGSIAIAGAAVQWLRDSLGIISSAAEIEKLAETVQDSGGIYFVPAFNGLFAPWWRD  386

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFTNK HIARAVLESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDG
Sbjct  387  DARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDG  446

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQA+LLGSPVVRPADIETTALGAAYAAGLAVGIWT++++F +G   +  T
Sbjct  447  GATVNNLLMQIQANLLGSPVVRPADIETTALGAAYAAGLAVGIWTKEQVF-AGLHRENTT  505

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P ++E  RKK+ DSW KAVSR+FDLAD
Sbjct  506  VFRPQLDEIHRKKRADSWFKAVSRSFDLAD  535



>ref|XP_010097187.1| Glycerol kinase [Morus notabilis]
 gb|EXB67254.1| Glycerol kinase [Morus notabilis]
Length=523

 Score =   320 bits (821),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L +I+ A EIE+LASKVES+GGVYFVPAFNGLFAPWWRD
Sbjct  311  NYALEGSIAIAGAAVQWLRDGLGVINHAGEIEELASKVESSGGVYFVPAFNGLFAPWWRD  370

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFT + HIARAVLESMCFQVRDVL+SM KDA +KGE K +  EF+LRVDG
Sbjct  371  DARGVCIGITRFTTRAHIARAVLESMCFQVRDVLESMKKDALEKGEAKGESEEFLLRVDG  430

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GA VNNLLMQ QADLLGS VVRPADIETTALGAAYAAGLAVG+W E++IF SGEK K DT
Sbjct  431  GAAVNNLLMQTQADLLGSSVVRPADIETTALGAAYAAGLAVGVWKEEDIFGSGEKAKTDT  490

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F  +++EE R KKV+SW KAV+RTFDLAD
Sbjct  491  TFHAILDEEKRNKKVESWYKAVTRTFDLAD  520



>ref|XP_010537930.1| PREDICTED: glycerol kinase [Tarenaya hassleriana]
Length=522

 Score =   318 bits (815),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 187/211 (89%), Gaps = 2/211 (1%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I  AS+IE+LA +VE+TGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIQKASDIEELAKQVETTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV DVLDSM+KD G+KG VK+++ EF+LRVDG
Sbjct  370  DARGVCIGITRFTNKAHIARAVLESMCFQVNDVLDSMNKDVGEKGTVKSEK-EFLLRVDG  428

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKK-D  212
            GAT NNLLMQIQADLLGS VVRPADIETTALGAAYAAGLAVG W E++IF SGEK K   
Sbjct  429  GATANNLLMQIQADLLGSAVVRPADIETTALGAAYAAGLAVGFWKEEDIFESGEKAKNAA  488

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             +FKPV++EE RKKK DSW KAV +TF+LAD
Sbjct  489  AMFKPVLDEETRKKKADSWAKAVEKTFNLAD  519



>gb|KFK42437.1| hypothetical protein AALP_AA2G256400 [Arabis alpina]
Length=522

 Score =   318 bits (814),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE+LA++V+STGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEELAAQVDSTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGV IG+TRFTNK H+ARAVLESMCFQV+DVLDSM KDAG+ G + N  GEF+LRVDG
Sbjct  370  DARGVLIGMTRFTNKSHLARAVLESMCFQVKDVLDSMIKDAGENGSLSNSEGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADL+G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK +   
Sbjct  430  GATANNLLMQIQADLMGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKAENSR  489

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P ++EE RK KV SWC AV RTF LAD
Sbjct  490  VFRPNMDEETRKNKVKSWCIAVERTFGLAD  519



>gb|KHN01314.1| Putative glycerol kinase [Glycine soja]
Length=519

 Score =   317 bits (813),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 190/210 (90%), Gaps = 3/210 (1%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L +ISSA+EIE++A +VESTGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSVAIAGAAVQWLRDGLGIISSAAEIEEMALQVESTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSMHKD+   GE ++ + EF+LRVDG
Sbjct  370  DARGVCIGITRFTSKGHIARAVLESMCFQVKDVLDSMHKDS---GESESQKTEFLLRVDG  426

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADL+G PV+RPADIETTALGAAYAAGLA GIW ED IF++ EK+K   
Sbjct  427  GATVNNLLMQIQADLVGCPVIRPADIETTALGAAYAAGLATGIWKEDFIFNTEEKLKNAR  486

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+PV+ EEVRKKKVDSWCKAVS+TFDLAD
Sbjct  487  VFRPVMTEEVRKKKVDSWCKAVSKTFDLAD  516



>ref|NP_001237303.1| glycerol kinase [Glycine max]
 gb|AAR86687.1| glycerol kinase [Glycine max]
Length=519

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 190/210 (90%), Gaps = 3/210 (1%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L +ISSA+EIE++A +VESTGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSVAIAGAAVQWLRDGLGIISSAAEIEEMALQVESTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSMHKD+   GE ++ + EF+LRVDG
Sbjct  370  DARGVCIGITRFTSKGHIARAVLESMCFQVKDVLDSMHKDS---GESESQKTEFLLRVDG  426

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADL+G PV+RPADIETTALGAAYAAGLA GIW ED IF++ EK+K   
Sbjct  427  GATVNNLLMQIQADLVGCPVIRPADIETTALGAAYAAGLATGIWKEDFIFNTEEKLKNAR  486

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+PV+ EEVRKKKVDSWCKAVS+TFDLAD
Sbjct  487  VFRPVMTEEVRKKKVDSWCKAVSKTFDLAD  516



>ref|XP_008779159.1| PREDICTED: glycerol kinase-like isoform X1 [Phoenix dactylifera]
Length=476

 Score =   316 bits (809),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 190/210 (90%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L +I +A+EIE++A  VE++GGVYFVPAFNGLFAPWW++
Sbjct  265  NYALEGSIAIAGAAVQWLRDGLGIIRTAAEIEKMAESVENSGGVYFVPAFNGLFAPWWKE  324

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVC+GITRFTNK H+ARAVLESMCFQV DVL+SMHKDAG+ GE ++  GEF+LRVDG
Sbjct  325  DARGVCVGITRFTNKGHLARAVLESMCFQVNDVLNSMHKDAGEGGEARSKEGEFLLRVDG  384

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT+NNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVG+WTE++IF++ E  +K T
Sbjct  385  GATINNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWTEEQIFAA-EHKEKTT  443

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF+P ++EE RK++ +SW KAV+RTFDLA+
Sbjct  444  IFRPKLDEEQRKRRNESWYKAVTRTFDLAE  473



>emb|CAJ86056.1| H0821G03.7 [Oryza sativa Indica Group]
 emb|CAH68428.1| H0811D08.16 [Oryza sativa Indica Group]
Length=529

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 188/210 (90%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +IS+A++IE+LA  V+ +GG+YFVPAFNGLFAPWWRD
Sbjct  318  NYALEGSIAIAGAAVQWLRDSLGIISTAADIEKLADTVQDSGGIYFVPAFNGLFAPWWRD  377

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFTNK HIARAVLESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDG
Sbjct  378  DARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDG  437

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVG+W++++IF +G   +  T
Sbjct  438  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWSKEQIF-AGLHKENTT  496

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P ++E  R+K+ DSW KAVSR+FDLAD
Sbjct  497  VFRPKLDEAHRRKRADSWYKAVSRSFDLAD  526



>gb|AGH08245.1| glycerol kinase [Triticum aestivum]
Length=534

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 187/210 (89%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE LA  V+ +GG+YFVPAFNGLFAPWWRD
Sbjct  323  NYALEGSIAIAGAAVQWLRDSLGIISSASEIEGLAESVQDSGGIYFVPAFNGLFAPWWRD  382

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFTNK HIARAVLESMCFQV DVL+SMHKDAG+ GEVK+  GEF+LRVDG
Sbjct  383  DARGICIGITRFTNKGHIARAVLESMCFQVNDVLNSMHKDAGESGEVKSAEGEFLLRVDG  442

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT+NNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLA G+WT++EIF +G   +  T
Sbjct  443  GATINNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAAGVWTKEEIF-AGLHKENTT  501

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +++  RKK+ DSW KAVSR+FDLAD
Sbjct  502  VFRPKLDDAHRKKRGDSWYKAVSRSFDLAD  531



>gb|KDP37048.1| hypothetical protein JCGZ_06104 [Jatropha curcas]
Length=523

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L +I+ ASE E LA +V+S+GGVYFVPAFNGLFAP WRD
Sbjct  311  NYALEGSIAIAGAAVQWLRDGLGIINVASESEVLAKQVDSSGGVYFVPAFNGLFAPHWRD  370

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVC+GITRFT K HIARAVLESMCFQV+DVLDSM KD G+KGE  N +GEF+LRVDG
Sbjct  371  DARGVCVGITRFTTKAHIARAVLESMCFQVKDVLDSMQKDTGEKGEQNNAKGEFLLRVDG  430

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLG+ VVRPADIETTALGAAYAAGLA+G+W E+EIF++GEK+K  T
Sbjct  431  GATVNNLLMQIQADLLGNAVVRPADIETTALGAAYAAGLAIGVWKEEEIFATGEKVKTAT  490

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F P + E+ RKKKV+SWCKAV ++F LAD
Sbjct  491  TFHPNLHEQQRKKKVESWCKAVEKSFGLAD  520



>ref|XP_008779160.1| PREDICTED: glycerol kinase-like isoform X2 [Phoenix dactylifera]
Length=520

 Score =   316 bits (810),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 190/210 (90%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L +I +A+EIE++A  VE++GGVYFVPAFNGLFAPWW++
Sbjct  309  NYALEGSIAIAGAAVQWLRDGLGIIRTAAEIEKMAESVENSGGVYFVPAFNGLFAPWWKE  368

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVC+GITRFTNK H+ARAVLESMCFQV DVL+SMHKDAG+ GE ++  GEF+LRVDG
Sbjct  369  DARGVCVGITRFTNKGHLARAVLESMCFQVNDVLNSMHKDAGEGGEARSKEGEFLLRVDG  428

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT+NNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVG+WTE++IF++ E  +K T
Sbjct  429  GATINNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWTEEQIFAA-EHKEKTT  487

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF+P ++EE RK++ +SW KAV+RTFDLA+
Sbjct  488  IFRPKLDEEQRKRRNESWYKAVTRTFDLAE  517



>gb|EMT01355.1| Putative glycerol kinase [Aegilops tauschii]
Length=561

 Score =   317 bits (811),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 187/210 (89%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE LA  V+ +GG+YFVPAFNGLFAPWWRD
Sbjct  350  NYALEGSIAIAGAAVQWLRDSLGIISSASEIEGLAESVQDSGGIYFVPAFNGLFAPWWRD  409

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFTNK HIARAVLESMCFQV DVL+SMHKDAG+ GEVK+  GEF+LRVDG
Sbjct  410  DARGICIGITRFTNKGHIARAVLESMCFQVNDVLNSMHKDAGESGEVKSAEGEFLLRVDG  469

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT+NNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLA G+WT++EIF +G   +  T
Sbjct  470  GATINNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAAGVWTKEEIF-AGLHKENTT  528

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +++  RKK+ DSW KAVSR+FDLAD
Sbjct  529  VFRPKLDDAHRKKRGDSWYKAVSRSFDLAD  558



>ref|XP_003580683.1| PREDICTED: glycerol kinase [Brachypodium distachyon]
Length=531

 Score =   315 bits (808),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 186/210 (89%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SA+EIE+LA  V+ +GG+YFVPAFNGLFAPWWRD
Sbjct  320  NYALEGSIAIAGAAVQWLRDSLGIIRSAAEIEELAESVQDSGGIYFVPAFNGLFAPWWRD  379

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFTNK HIARAVLESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDG
Sbjct  380  DARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDG  439

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTA+GAAYAAGLA G+WT+++IF +G   +  T
Sbjct  440  GATVNNLLMQIQADLLGSPVVRPADIETTAIGAAYAAGLAAGVWTKEQIF-AGLHKENTT  498

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P ++E  RKK+ DSW KAVSR+FDLAD
Sbjct  499  VFRPKLDEAHRKKRGDSWYKAVSRSFDLAD  528



>ref|NP_001132106.2| uncharacterized protein LOC100193522 [Zea mays]
 gb|ACG42404.1| glycerol kinase [Zea mays]
 gb|ACF80804.2| unknown [Zea mays]
 tpg|DAA35707.1| TPA: glycerol kinase [Zea mays]
Length=523

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 185/210 (88%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SA+EIE+LA  V  +GGVYFVPAFNGLFAPWWRD
Sbjct  312  NYALEGSIAIAGAAVQWLRDSLGIIQSAAEIEKLAETVPDSGGVYFVPAFNGLFAPWWRD  371

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFTNK HIARAVLESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDG
Sbjct  372  DARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDG  431

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLA G+WT++++F +G   +  T
Sbjct  432  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAAGVWTKEKVF-AGLHKENTT  490

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P ++E  RKK+ DSW KAVSR+FDLAD
Sbjct  491  VFRPKLDEAHRKKRADSWYKAVSRSFDLAD  520



>ref|XP_009407371.1| PREDICTED: glycerol kinase [Musa acuminata subsp. malaccensis]
Length=531

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 187/210 (89%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS AIAGAAVQWLRD + +I +ASEIE LA  VE++GGVYFVPAFNGLFAPWWRD
Sbjct  320  SYALEGSIAIAGAAVQWLRDGMGIIHTASEIEDLAELVENSGGVYFVPAFNGLFAPWWRD  379

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLES+CFQV DVL SMHKDAG++GE K +  EF+LRVDG
Sbjct  380  DARGVCIGITRFTNKGHIARAVLESICFQVNDVLASMHKDAGERGEAKTNVREFLLRVDG  439

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPAD+ETTALGAAYAAGLA+G+WTE++I+S+G K +K T
Sbjct  440  GATVNNLLMQIQADLLGSPVVRPADVETTALGAAYAAGLAIGVWTEEQIYSAGHK-EKTT  498

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F P ++E  RKK+ +SW KAVSRTFDLAD
Sbjct  499  VFHPKLDEAHRKKRSESWNKAVSRTFDLAD  528



>ref|NP_001054071.1| Os04g0647800 [Oryza sativa Japonica Group]
 dbj|BAF15985.1| Os04g0647800 [Oryza sativa Japonica Group]
Length=529

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 187/210 (89%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +IS+A++IE+LA  V+ +GG+YFVPAFNGLFAPWWRD
Sbjct  318  NYALEGSIAIAGAAVQWLRDSLGIISTAADIEKLADTVQDSGGIYFVPAFNGLFAPWWRD  377

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFTNK HIARAVLESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDG
Sbjct  378  DARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDG  437

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVG+W++++IF +G   +   
Sbjct  438  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWSKEQIF-AGLHKENTR  496

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P ++E  R+K+ DSW KAVSR+FDLAD
Sbjct  497  VFRPKLDEAHRRKRADSWYKAVSRSFDLAD  526



>gb|EMS68114.1| Glycerol kinase [Triticum urartu]
Length=479

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 185/210 (88%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE LA  V+ +GG+YFVPAFNGLFAPWWRD
Sbjct  268  NYALEGSIAIAGAAVQWLRDSLGIISSASEIEGLAESVQDSGGIYFVPAFNGLFAPWWRD  327

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFTNK HIARAVLESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDG
Sbjct  328  DARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDG  387

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPAD ETTALGAAYAAGLA G+WT++EIF +G   +  T
Sbjct  388  GATVNNLLMQIQADLLGSPVVRPADTETTALGAAYAAGLAAGVWTKEEIF-AGLHKENTT  446

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +++  RKK+ +SW KAVSR+FDLAD
Sbjct  447  VFRPKLDDAHRKKRGESWNKAVSRSFDLAD  476



>gb|AAR18687.1| glycerol kinase-like protein [Oryza sativa Japonica Group]
 gb|EAZ32203.1| hypothetical protein OsJ_16410 [Oryza sativa Japonica Group]
Length=529

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 187/210 (89%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +IS+A++IE+LA  V+ +GG+YFVPAFNGLFAPWWRD
Sbjct  318  NYALEGSIAIAGAAVQWLRDSLGIISTAADIEKLADTVQDSGGIYFVPAFNGLFAPWWRD  377

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFTNK HIARAVLESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDG
Sbjct  378  DARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDG  437

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVG+W++++IF +G   +   
Sbjct  438  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWSKEQIF-AGLHKENTR  496

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P ++E  R+K+ DSW KAVSR+FDLAD
Sbjct  497  VFRPKLDEAHRRKRADSWYKAVSRSFDLAD  526



>ref|XP_004977029.1| PREDICTED: glycerol kinase-like [Setaria italica]
Length=523

 Score =   313 bits (803),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 184/210 (88%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I +A+EIE+LA  V  +GG+YFVPAFNGLFAPWWRD
Sbjct  312  NYALEGSIAIAGAAVQWLRDSLGIIQTAAEIEKLAETVPDSGGIYFVPAFNGLFAPWWRD  371

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFTNK HIARAVLESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDG
Sbjct  372  DARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDG  431

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLA G+WT +++F +G   +  T
Sbjct  432  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAAGVWTGEQVF-AGLHKENTT  490

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P ++E  RKK+ DSW KAVSR+FDLAD
Sbjct  491  VFRPQLDETHRKKRADSWYKAVSRSFDLAD  520



>ref|XP_002448637.1| hypothetical protein SORBIDRAFT_06g030600 [Sorghum bicolor]
 gb|EES12965.1| hypothetical protein SORBIDRAFT_06g030600 [Sorghum bicolor]
Length=523

 Score =   310 bits (795),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 184/210 (88%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I +A+EIE+LA  V  +GGVYFVPAFNGLFAPWWRD
Sbjct  312  NYALEGSIAIAGAAVQWLRDSLGIIQTAAEIEKLAETVPDSGGVYFVPAFNGLFAPWWRD  371

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG+CIGITRFTNK HIARAVLESM FQV DVL SMHKDAG+ GEVK+  GEF+LRVDG
Sbjct  372  DARGICIGITRFTNKGHIARAVLESMSFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDG  431

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLA G+WT++++F +G   +  T
Sbjct  432  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAAGVWTKEQVF-AGLHKENTT  490

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P ++E  RKK+ DSW KAVSR+FDLAD
Sbjct  491  VFRPKLDEAHRKKRADSWYKAVSRSFDLAD  520



>ref|XP_007135771.1| hypothetical protein PHAVU_010G157400g [Phaseolus vulgaris]
 gb|ESW07765.1| hypothetical protein PHAVU_010G157400g [Phaseolus vulgaris]
Length=521

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 184/210 (88%), Gaps = 2/210 (1%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L LISSASEIE LA +VES+GG+YFVPAFNGL+APWWRD
Sbjct  311  NYALEGSVAIAGAAVQWLRDGLGLISSASEIEALALQVESSGGIYFVPAFNGLYAPWWRD  370

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGV +G+TRFT+K HIARAVLESMCFQV+DVL+SMHKD+    +V + +    LRVDG
Sbjct  371  DARGVIVGMTRFTSKAHIARAVLESMCFQVKDVLNSMHKDSAQ--DVSSSKEALSLRVDG  428

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRP DIETTALGAAYAAGLA G+W E+ IF+SGEKMK   
Sbjct  429  GATVNNLLMQIQADLLGSPVVRPVDIETTALGAAYAAGLATGVWKEEHIFNSGEKMKNAK  488

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P++ EEVRKKK +SWCKAV+RTFDLAD
Sbjct  489  VFRPIMSEEVRKKKFESWCKAVTRTFDLAD  518



>ref|XP_010244913.1| PREDICTED: glycerol kinase-like [Nelumbo nucifera]
Length=541

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 181/208 (87%), Gaps = 2/208 (1%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A AG AVQWLRD + LI S  E+E+LA KV++ GG YFVPAFNGLFAPWWR+D
Sbjct  332  YALEGSIATAGDAVQWLRDGIELIESTEEVEELAGKVDNCGGCYFVPAFNGLFAPWWRED  391

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGVC+GITRFT+K HIARAVLES+CFQV DVLDSMHKD GD+GE KND+GEF+LRVDGG
Sbjct  392  ARGVCLGITRFTSKAHIARAVLESVCFQVNDVLDSMHKDVGDEGEFKNDKGEFLLRVDGG  451

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
            ATVNNLLMQIQADLLGSPVVRPAD+ETTALGAAYAAG+AVG+WTED IF+  E+  K TI
Sbjct  452  ATVNNLLMQIQADLLGSPVVRPADVETTALGAAYAAGIAVGLWTEDVIFA--ERAGKPTI  509

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLA  122
            F P +++E R KK++SW KAVSR FDLA
Sbjct  510  FSPKLDKEQRMKKLESWSKAVSRAFDLA  537



>ref|XP_010907017.1| PREDICTED: glycerol kinase [Elaeis guineensis]
Length=521

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 187/210 (89%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L +I +A+EIE++A  VE++GGVYFVPAFNGLFAPWW++
Sbjct  310  NYALEGSIAIAGAAVQWLRDGLGIIRTAAEIEKMAESVENSGGVYFVPAFNGLFAPWWKE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVC+GITRFTNK H+ARAVLESMCFQV DVL+SMHKDAG+ GE ++  GEF+LRVDG
Sbjct  370  DARGVCVGITRFTNKGHLARAVLESMCFQVNDVLNSMHKDAGEGGEARSKEGEFLLRVDG  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLA G+WTE++IF+  E  +K T
Sbjct  430  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLATGVWTEEQIFAV-EHREKTT  488

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF+P ++E  RK++ +SW KAV+RTFDLA+
Sbjct  489  IFRPKLDEAQRKRRNESWYKAVTRTFDLAE  518



>ref|XP_003604353.1| Glycerol kinase [Medicago truncatula]
 gb|AES86550.1| glycerol kinase-like protein [Medicago truncatula]
Length=519

 Score =   303 bits (776),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 183/210 (87%), Gaps = 3/210 (1%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L LI++A +IE LA +VES GGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSVAIAGAAVQWLRDGLGLITTAKDIEALALEVESNGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITR+T+K HIARAVLES+CFQV+DV+DSMHKD+G     ++ + EF+LRVDG
Sbjct  370  DARGVCIGITRYTSKAHIARAVLESICFQVKDVIDSMHKDSGAD---QSKKDEFLLRVDG  426

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQ QADLL + V+RPADIETTALGAAYAAGLAVGIW ED +F S + +K  +
Sbjct  427  GATVNNLLMQTQADLLATSVIRPADIETTALGAAYAAGLAVGIWKEDFVFDSKDLLKNAS  486

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P++ EE+RKKKVDSW KAVSR+FDLAD
Sbjct  487  VFRPLMVEEIRKKKVDSWGKAVSRSFDLAD  516



>ref|XP_004506960.1| PREDICTED: glycerol kinase-like [Cicer arietinum]
Length=519

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 178/210 (85%), Gaps = 3/210 (1%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL LISSA +IE LA  V+ TGGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSVAIAGAAVQWLRDSLGLISSAKDIEALALTVDCTGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITR+T+K HIARAVLES+CFQV+DV+DSMHKD+G     K+D   F+LRVDG
Sbjct  370  DARGVCIGITRYTSKAHIARAVLESICFQVKDVIDSMHKDSGIDETKKSD---FLLRVDG  426

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GAT NNLLMQIQADLL +PVVRPADIETTALGAAYAAGLA+G+W ED +F   EK+K   
Sbjct  427  GATANNLLMQIQADLLATPVVRPADIETTALGAAYAAGLAIGVWKEDYVFDCREKLKDAG  486

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F PV+  +VRKKK DSW KAV R+FDLAD
Sbjct  487  VFSPVMAADVRKKKTDSWSKAVGRSFDLAD  516



>gb|ABK24550.1| unknown [Picea sitchensis]
Length=534

 Score =   290 bits (742),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 179/210 (85%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
             YALEGS AIAGAAVQWLRDSL +I SASEIE LA  VE+TGGVYFVPAFNGLFAPWWRD
Sbjct  323  TYALEGSIAIAGAAVQWLRDSLGVIQSASEIEGLARSVENTGGVYFVPAFNGLFAPWWRD  382

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITR+T K HI+RAVLESMCFQV++VL++M  D   + E   +  EF+LRVDG
Sbjct  383  DARGVCIGITRYTTKAHISRAVLESMCFQVKEVLNAMSIDV-KQDEKSKENEEFLLRVDG  441

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GA+VNNLLMQIQADL+GSPV+RPAD ETTALGAAYAAGLA G+WTE++IFSSG K ++ T
Sbjct  442  GASVNNLLMQIQADLMGSPVLRPADTETTALGAAYAAGLATGVWTEEQIFSSGAKKEEPT  501

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F P + +E RKK+ +SWCKAV RTFDLA+
Sbjct  502  VFYPKVGDEHRKKRYESWCKAVERTFDLAN  531



>gb|ABK25673.1| unknown [Picea sitchensis]
Length=530

 Score =   290 bits (741),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 178/210 (85%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
             YALEGS AIAGAAVQWLRDSL +I SASEIE LA  VE+TGGVYFVPAFNGLFAPWWRD
Sbjct  319  TYALEGSIAIAGAAVQWLRDSLGVIQSASEIEDLAGSVENTGGVYFVPAFNGLFAPWWRD  378

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITR+T K HIARAVLESMCFQV++VL+SM  D   + E   +  EF+LRVDG
Sbjct  379  DARGVCIGITRYTTKAHIARAVLESMCFQVKEVLNSMSIDV-KQDEKSKENEEFLLRVDG  437

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GA+VNNLLMQIQADL+GSPV+RPAD ETTALGAAYAAGLA G+WTE++IFSS  K ++ T
Sbjct  438  GASVNNLLMQIQADLMGSPVLRPADTETTALGAAYAAGLATGVWTEEQIFSSEAKKEEPT  497

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F P + +E RKK+ +SWCKAV RTFDLA+
Sbjct  498  VFYPKVGDEQRKKRYESWCKAVERTFDLAN  527



>gb|KEH28675.1| glycerol kinase-like protein [Medicago truncatula]
Length=508

 Score =   286 bits (733),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 174/201 (87%), Gaps = 3/201 (1%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRD L LI++A +IE LA +VES GGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSVAIAGAAVQWLRDGLGLITTAKDIEALALEVESNGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITR+T+K HIARAVLES+CFQV+DV+DSMHKD+G     ++ + EF+LRVDG
Sbjct  370  DARGVCIGITRYTSKAHIARAVLESICFQVKDVIDSMHKDSGAD---QSKKDEFLLRVDG  426

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQ QADLL + V+RPADIETTALGAAYAAGLAVGIW ED +F S + +K  +
Sbjct  427  GATVNNLLMQTQADLLATSVIRPADIETTALGAAYAAGLAVGIWKEDFVFDSKDLLKNAS  486

Query  208  IFKPVIEEEVRKKKVDSWCKA  146
            +F+P++ EE+RKKKVDSW KA
Sbjct  487  VFRPLMVEEIRKKKVDSWGKA  507



>gb|ABR26079.1| glycerol kinase [Oryza sativa Indica Group]
Length=189

 Score =   276 bits (705),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 167/187 (89%), Gaps = 1/187 (1%)
 Frame = -3

Query  679  LISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDDARGVCIGITRFTNKCHIARAVL  500
            +IS+A++IE+LA  V+ +GG+YFVPAFNGLFAPWWRDDARG+CIGITRFTNK HIARAVL
Sbjct  1    IISTAADIEKLADTVQDSGGIYFVPAFNGLFAPWWRDDARGICIGITRFTNKGHIARAVL  60

Query  499  ESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSPVVRP  320
            ESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDGGATVNNLLMQIQADLLGSPVVRP
Sbjct  61   ESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGSPVVRP  120

Query  319  ADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWCKAVS  140
            ADIETTALGAAYAAGLAVG+W++++IF +G   +  T+F+P ++E  R+K+ DSW KAVS
Sbjct  121  ADIETTALGAAYAAGLAVGVWSKEQIF-AGLHKENTTVFRPKLDEAHRRKRADSWYKAVS  179

Query  139  RTFDLAD  119
            R+FDLAD
Sbjct  180  RSFDLAD  186



>ref|XP_006442415.1| hypothetical protein CICLE_v10024258mg [Citrus clementina]
 gb|ESR55655.1| hypothetical protein CICLE_v10024258mg [Citrus clementina]
Length=368

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -3

Query  697  LRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDDARGVCIGITRFTNKCH  518
            L DSL +IS+ASEIE+LA +V STGG+YFV AFNGL APWWRDDAR VCIGITRFT+K H
Sbjct  173  LEDSLGIISNASEIEELALRVNSTGGIYFVRAFNGLLAPWWRDDARSVCIGITRFTSKAH  232

Query  517  IARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLG  338
             ARAVLESMCF V+DVLDSM KDA +KG +K+ + EFVLRVDGGATVNNLLMQIQADLLG
Sbjct  233  FARAVLESMCFLVKDVLDSMQKDAVEKGVIKDAKPEFVLRVDGGATVNNLLMQIQADLLG  292

Query  337  SPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  158
            SPV+RPADIE TALGAA+AAGLA+G++ E+EIF+S E+ K  T FKP++ EE RKKK +S
Sbjct  293  SPVLRPADIEATALGAAFAAGLAIGVFKEEEIFASSERTKTSTTFKPLLNEEFRKKKAES  352

Query  157  WCKAVSRTFDLAD  119
             C+AV RTF+LAD
Sbjct  353  QCRAVERTFNLAD  365



>ref|XP_008795833.1| PREDICTED: glycerol kinase-like [Phoenix dactylifera]
Length=538

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 181/210 (86%), Gaps = 1/210 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAA+QWLRD L +I +A+E+E+LA  VE++GGVYFVPAF GLFAPWWRD
Sbjct  327  NYALEGSIAIAGAAIQWLRDGLGIIQNAAEVEELAELVENSGGVYFVPAFIGLFAPWWRD  386

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIG+TRF+NK HIARAVLES+CFQV DVL+SM+KD  + G V++  G F+LRVDG
Sbjct  387  DARGVCIGMTRFSNKGHIARAVLESICFQVNDVLESMYKDVVEHGGVESKDGSFLLRVDG  446

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GA+ NNLLMQ QADLLGS VVRP +IETTALGAAYAAGLAVGIW+E++IF+ G+  K  T
Sbjct  447  GASANNLLMQTQADLLGSAVVRPGNIETTALGAAYAAGLAVGIWSEEQIFAFGDNAKA-T  505

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF+P ++E  R+K+ DSWCKAVSRTFDLAD
Sbjct  506  IFQPQLDESKRQKRSDSWCKAVSRTFDLAD  535



>gb|KDO41571.1| hypothetical protein CISIN_1g046958mg [Citrus sinensis]
Length=417

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -3

Query  697  LRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDDARGVCIGITRFTNKCH  518
            L DSL +IS+ASEIE+LA +V STGG+YFV AFNGL APWWRDDAR VCIGITRFT+K H
Sbjct  222  LEDSLGIISNASEIEELALRVNSTGGIYFVRAFNGLLAPWWRDDARSVCIGITRFTSKAH  281

Query  517  IARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLG  338
             ARAVLESMCF V+DVLDS  KDA +KG +K+ + EFVLRVDGGATVNNLLMQIQADLLG
Sbjct  282  FARAVLESMCFLVKDVLDSKQKDAVEKGVIKDAKPEFVLRVDGGATVNNLLMQIQADLLG  341

Query  337  SPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  158
            SPV+RPADIE+TALGAA+AAGLA+G++ E+EIF+S E+ K  T FKP++ EE RKKK +S
Sbjct  342  SPVLRPADIESTALGAAFAAGLAIGVFKEEEIFASSERTKTSTTFKPLLNEEFRKKKAES  401

Query  157  WCKAVSRTFDLAD  119
             C+AV RTF+LAD
Sbjct  402  QCRAVERTFNLAD  414



>ref|XP_010913342.1| PREDICTED: glycerol kinase-like [Elaeis guineensis]
Length=537

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 177/210 (84%), Gaps = 2/210 (1%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYA+EGS AIAGAAVQWLRD L +I  A+E+E+LA  VE++GGVYFVPAFNGLFAPWWRD
Sbjct  327  NYAVEGSIAIAGAAVQWLRDGLGIIEHAAEVEELAELVENSGGVYFVPAFNGLFAPWWRD  386

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIG+TRFTNK HIARAVLES+CFQV DV+ SM KDA D G V++  G F+LRVDG
Sbjct  387  DARGVCIGMTRFTNKGHIARAVLESICFQVNDVIKSMCKDAADNG-VESKDGLFLLRVDG  445

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GA+ NNLLMQ QADLLGS VVRP +IETTALGA YAAGLAVGIW+E++IF+ G+  K  T
Sbjct  446  GASANNLLMQTQADLLGSAVVRPGNIETTALGAGYAAGLAVGIWSEEQIFAFGDNAKA-T  504

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            IF+P ++   R+K+ D WCKAVSRTFDLAD
Sbjct  505  IFQPQLDASKRQKRSDCWCKAVSRTFDLAD  534



>ref|XP_006427437.1| hypothetical protein CICLE_v10025756mg [Citrus clementina]
 gb|ESR40677.1| hypothetical protein CICLE_v10025756mg [Citrus clementina]
Length=405

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = -3

Query  637  VESTGGVYFVPAFNGLFAPWWRDDARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSM  458
            V STGGVYFVPAFNGLFAPWWRDDARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSM
Sbjct  230  VNSTGGVYFVPAFNGLFAPWWRDDARGVCIGITRFTSKAHIARAVLESMCFQVKDVLDSM  289

Query  457  HKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaa  278
             KDA +KG +K+ + EF+LRVDGGATVNNLLMQIQADLLGSPV+RPAD ETTALGAA+A 
Sbjct  290  QKDAVEKGVIKDAKSEFLLRVDGGATVNNLLMQIQADLLGSPVIRPADKETTALGAAFAD  349

Query  277  glAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            GLA+G++ E+EIF+SGE  K  T FKPV+ EE RKKK +SWC+AV RTF+LAD
Sbjct  350  GLAIGVFKEEEIFASGEWAKTSTTFKPVLNEEGRKKKAESWCRAVERTFNLAD  402



>ref|XP_002985935.1| hypothetical protein SELMODRAFT_123030 [Selaginella moellendorffii]
 gb|EFJ13112.1| hypothetical protein SELMODRAFT_123030 [Selaginella moellendorffii]
Length=519

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 175/209 (84%), Gaps = 7/209 (3%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AIAGAAVQWLRD+L +I SASEIE LAS VE+TGGVYFVPAF+GL+AP WRDD
Sbjct  316  YALEGSIAIAGAAVQWLRDNLGIIKSASEIEALASTVENTGGVYFVPAFSGLYAPRWRDD  375

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGVC+GITRFT+K H+AR+VLESMCFQ ++VLDSM KDA  K E K    +FVLRVDGG
Sbjct  376  ARGVCVGITRFTHKGHLARSVLESMCFQAKEVLDSMLKDA--KVEHKE---KFVLRVDGG  430

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
            ATVNNLLMQIQADLLG+ VVRP DIETTALGAAYAAGLAVG+W E++IF++ E++ +   
Sbjct  431  ATVNNLLMQIQADLLGTDVVRPKDIETTALGAAYAAGLAVGLWKEEQIFTADEEVGQT--  488

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            F P I E  R+K+  SWCKAV R++ LAD
Sbjct  489  FTPSIAEPEREKRYTSWCKAVERSYALAD  517



>ref|XP_002984877.1| hypothetical protein SELMODRAFT_121015 [Selaginella moellendorffii]
 gb|EFJ14127.1| hypothetical protein SELMODRAFT_121015 [Selaginella moellendorffii]
Length=519

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 175/209 (84%), Gaps = 7/209 (3%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AIAGAAVQWLRD+L +I SASEIE LAS VE+TGGVYFVPAF+GL+AP WRDD
Sbjct  316  YALEGSIAIAGAAVQWLRDNLGIIKSASEIEALASTVENTGGVYFVPAFSGLYAPRWRDD  375

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGVC+GITRFT+K H+AR+VLESMCFQ ++VLDSM KDA  K E K    +FVLRVDGG
Sbjct  376  ARGVCVGITRFTHKGHLARSVLESMCFQAKEVLDSMLKDA--KVEHKE---KFVLRVDGG  430

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
            ATVNNLLMQIQADLLG+ VVRP DIETTALGAAYAAGLAVG+W E++IF++ E++ +   
Sbjct  431  ATVNNLLMQIQADLLGTDVVRPKDIETTALGAAYAAGLAVGLWKEEQIFTADEEVGQT--  488

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            F P I E  R+K+  SWCKAV R++ LAD
Sbjct  489  FTPSIAEPEREKRYTSWCKAVERSYALAD  517



>ref|XP_001763943.1| predicted protein [Physcomitrella patens]
 gb|EDQ71347.1| predicted protein [Physcomitrella patens]
Length=527

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 168/210 (80%), Gaps = 2/210 (1%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AI GAAVQWLRD+L +I S+SEIE LA  V +TGGVYFVPAF+GLFAPWWRD
Sbjct  317  NYALEGSIAIGGAAVQWLRDNLGIIKSSSEIESLAKTVNNTGGVYFVPAFSGLFAPWWRD  376

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGV +GITR+TNK HIARA LESMC+QV++VL SM  DAG+        GEF+LRVDG
Sbjct  377  DARGVLVGITRYTNKAHIARATLESMCYQVKEVLTSMKADAGNIEATVG--GEFLLRVDG  434

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQ+QADLLGSPVVRP DIETTALGAAYAAGLAVG+WT+++I   G   +  T
Sbjct  435  GATVNNLLMQLQADLLGSPVVRPVDIETTALGAAYAAGLAVGVWTKEQIIEQGAVQEAPT  494

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F   I ++ R K+  SW KAV R+F LA+
Sbjct  495  VFHSQITDDERNKRCLSWNKAVERSFGLAE  524



>ref|XP_006852853.1| hypothetical protein AMTR_s00033p00197360 [Amborella trichopoda]
 gb|ERN14320.1| hypothetical protein AMTR_s00033p00197360 [Amborella trichopoda]
Length=477

 Score =   267 bits (682),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 171/213 (80%), Gaps = 11/213 (5%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKV--ESTGGVYFVPAFNGLFAPWW  575
            +YALEGS AIAGAAVQWLRD L LI +ASEIE LA     E  GGVYFVPAF GL APWW
Sbjct  271  SYALEGSIAIAGAAVQWLRDGLGLIKTASEIEGLAELAGEEGAGGVYFVPAFGGLLAPWW  330

Query  574  RDDARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGE-FVLR  398
            RDDARGV +G+TR T+K HIARAVLESMCFQVRDV+++M  DAG+        GE FVLR
Sbjct  331  RDDARGVLVGMTRATSKAHIARAVLESMCFQVRDVVEAMRADAGE--------GEGFVLR  382

Query  397  VDGGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMK  218
            VDGGATVNNLLMQ+QADLLGSPV+RPADIETTALGAAYAAGLA G+WTED+IF+SG K  
Sbjct  383  VDGGATVNNLLMQLQADLLGSPVLRPADIETTALGAAYAAGLATGVWTEDDIFTSGNKAS  442

Query  217  KDTIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             DT+F P + EE R ++  SW KAV ++FDLAD
Sbjct  443  NDTVFNPRVCEEERDRRFKSWHKAVEKSFDLAD  475



>ref|NP_001031307.1| glycerol kinase [Arabidopsis thaliana]
 gb|AEE36408.1| glycerol kinase-like protein [Arabidopsis thaliana]
Length=482

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 148/210 (70%), Gaps = 40/210 (19%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA+ V+STGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAMVDSTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N +GEF+LRVD 
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNGKGEFLLRVDA  429

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
                                                    VG W E +IF SGEK K   
Sbjct  430  ----------------------------------------VGFWKEADIFESGEKAKNSK  449

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P +EE +RKKKV SWCKAV RTFDLAD
Sbjct  450  VFRPAMEEGIRKKKVASWCKAVERTFDLAD  479



>ref|XP_006442413.1| hypothetical protein CICLE_v10020202mg [Citrus clementina]
 gb|ESR55653.1| hypothetical protein CICLE_v10020202mg [Citrus clementina]
Length=435

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 168/210 (80%), Gaps = 23/210 (11%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE+LA +V STGGV                
Sbjct  246  NYALEGSVAIAGAAVQWLRDSLGVISSASEIEELALQVNSTGGV----------------  289

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
                 CIGITRFT+K HIARAVLESMCFQV+DVLDS+ KDA +KG +K+ +  F+LRVDG
Sbjct  290  -----CIGITRFTSKVHIARAVLESMCFQVKDVLDSLQKDAVEKGVIKDAK--FLLRVDG  342

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GATVNNLLMQIQADLLGSPV+RPADIETTALGAA+AAGLA+G++ E+EIF+SGE+ K  T
Sbjct  343  GATVNNLLMQIQADLLGSPVIRPADIETTALGAAFAAGLAIGVFKEEEIFASGERTKTST  402

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             FKPV+ EE RKKK +SWC+AV R F+LAD
Sbjct  403  TFKPVLNEEFRKKKAESWCRAVERIFNLAD  432



>ref|XP_007023295.1| Actin-like ATPase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY25917.1| Actin-like ATPase superfamily protein isoform 2 [Theobroma cacao]
Length=450

 Score =   248 bits (634),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +IS+ASEIE LA +V+STGGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIISTASEIESLALQVDSTGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTSKAHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQ  353
            GATVNNLLMQIQ
Sbjct  430  GATVNNLLMQIQ  441



>ref|XP_007023296.1| Actin-like ATPase superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY25918.1| Actin-like ATPase superfamily protein isoform 3 [Theobroma cacao]
Length=448

 Score =   248 bits (634),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +IS+ASEIE LA +V+STGGVYFVPAFNGLFAPWWRD
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIISTASEIESLALQVDSTGGVYFVPAFNGLFAPWWRD  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTSKAHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQ  353
            GATVNNLLMQIQ
Sbjct  430  GATVNNLLMQIQ  441



>ref|XP_006302136.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
 gb|EOA35034.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
Length=444

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA  V+STGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAKMVDSTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQ  353
            GAT NNLLMQIQ
Sbjct  430  GATANNLLMQIQ  441



>ref|XP_006389796.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
 gb|ESQ27082.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
Length=455

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I  ASEIE LA+ VESTGGVYFVPAFNGLFAPWWR+
Sbjct  310  NYALEGSIAIAGAAVQWLRDSLGIIKKASEIEDLAAMVESTGGVYFVPAFNGLFAPWWRE  369

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDG
Sbjct  370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDG  429

Query  388  GATVNNLLMQIQ  353
            GA+ NNLLMQIQ
Sbjct  430  GASANNLLMQIQ  441



>ref|XP_006427439.1| hypothetical protein CICLE_v10027554mg, partial [Citrus clementina]
 gb|ESR40679.1| hypothetical protein CICLE_v10027554mg, partial [Citrus clementina]
Length=267

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +ISSASEIE+LA +V STGG+YFVPAFNGLFAPWWRD
Sbjct  129  NYALEGSIAIAGAAVQWLRDSLGIISSASEIEELALQVNSTGGIYFVPAFNGLFAPWWRD  188

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DAR VCIGITRFT+K HIARAVLESMCF V+DVLDSM KDA +KG +K+ + EFVLRVDG
Sbjct  189  DARSVCIGITRFTSKAHIARAVLESMCFLVKDVLDSMQKDAVEKGVIKDAKSEFVLRVDG  248

Query  388  GATVNNLLMQIQ  353
            GATVNNLLMQIQ
Sbjct  249  GATVNNLLMQIQ  260



>emb|CDY03995.1| BnaC02g37100D [Brassica napus]
Length=180

 Score =   223 bits (567),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 137/179 (77%), Gaps = 10/179 (6%)
 Frame = -3

Query  724  AIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDDARGVCIG  545
            A  GAAVQWLRDSL +I+SASEIE LA+ VE+TGGVYFVPAFNGLFAPW R+DARGVCIG
Sbjct  11   AKTGAAVQWLRDSLGIINSASEIEDLAAMVETTGGVYFVPAFNGLFAPWLREDARGVCIG  70

Query  544  ITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLL  365
            ITRFTNK HIARAVLESMCFQV+DVLDS++          N++GEF LRVDG AT NNLL
Sbjct  71   ITRFTNKSHIARAVLESMCFQVKDVLDSLN----------NEKGEFFLRVDGAATANNLL  120

Query  364  MQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIE  188
            M IQADL+G+PVVRP DIETTALG AYA    + +  E ++ +  + +    I K + E
Sbjct  121  MHIQADLMGTPVVRPVDIETTALGTAYALYFFLKMLEETDVPTKEDNIVYKEILKNLCE  179



>emb|CDY72493.1| BnaCnng77930D [Brassica napus]
Length=198

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 118/139 (85%), Gaps = 12/139 (9%)
 Frame = -3

Query  718  AGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDDARGVCIGIT  539
            AGAAVQWLRDSL +I SASEIE LA+ VE+TGGVYFVPAFNGLFA  WR+DARGVCIGIT
Sbjct  33   AGAAVQWLRDSLGIIKSASEIEDLAAMVETTGGVYFVPAFNGLFA--WREDARGVCIGIT  90

Query  538  RFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQ  359
            RFT K HIARAVLESMCFQV+DVLDS++          N++ EF+LRVDGGAT NNLLMQ
Sbjct  91   RFTYKSHIARAVLESMCFQVKDVLDSLN----------NEKAEFLLRVDGGATANNLLMQ  140

Query  358  IQADLLGSPVVRPADIETT  302
            IQADL+G+PVVRP DIETT
Sbjct  141  IQADLMGTPVVRPVDIETT  159



>dbj|BAH56977.1| AT1G80460 [Arabidopsis thaliana]
Length=423

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA+ V+STGGVYFVPAFNGLFAPWWR+
Sbjct  259  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAMVDSTGGVYFVPAFNGLFAPWWRE  318

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N +GEF+LRVDG
Sbjct  319  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNGKGEFLLRVDG  378

Query  388  G  386
            G
Sbjct  379  G  379



>ref|XP_002500482.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61740.1| predicted protein [Micromonas sp. RCC299]
Length=527

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 150/221 (68%), Gaps = 20/221 (9%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AIAGA VQWLRD+L LI SA+++E LA+ V   GGVYFVPAF+GLFAP WR D
Sbjct  309  YALEGSVAIAGAGVQWLRDNLGLIRSAADVEPLAASVPDAGGVYFVPAFSGLFAPRWRPD  368

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGVC+G+T+FT K H+ARA+LE++CFQ  DVL++M KDA       +D     L VDGG
Sbjct  369  ARGVCVGLTQFTTKAHLARALLEAICFQTVDVLEAMRKDA-------SDLDMTALHVDGG  421

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSG--------  230
            AT N L+MQ QADLLG  V RPA++ETTA+GAA AAG+  G+++E  +F           
Sbjct  422  ATANGLMMQTQADLLGLRVFRPANVETTAMGAALAAGVGAGLFSERAVFEDTPADESIAD  481

Query  229  -----EKMKKDTIFKPVIEEEVRKKKVDSWCKAVSRTFDLA  122
                 ++M     F+P I E+ R ++   WC AV R+ +LA
Sbjct  482  AEWLRDEMANRAYFEPAIGEDERARRYAGWCDAVERSLNLA  522



>ref|WP_040860438.1| glycerol kinase [Nocardia niigatensis]
Length=508

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 149/210 (71%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS A+ +E LA +V   GG+YFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGAAGVETLARQVPDNGGIYFVPAFSGLFAPYWRAD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++RF+N  HIARA LES+C+Q RDV+++M +D+G +           LRVDGG
Sbjct  365  ARGVIVGLSRFSNNAHIARATLESICYQTRDVVEAMQQDSGVR--------LGTLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             T N L MQIQAD LG PV RP   ETTALGAAYAAGLAVG W + DE+ ++    ++D 
Sbjct  417  VTANELAMQIQADFLGVPVSRPVVAETTALGAAYAAGLAVGFWRSTDELVAN---WREDR  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P + EE R++    W KAVSRT D  D
Sbjct  474  NWQPAMTEEQRRRGYTRWRKAVSRTLDWVD  503



>ref|XP_641267.1| hypothetical protein DDB_G0280371 [Dictyostelium discoideum AX4]
 sp|Q54VT8.1|GLPK_DICDI RecName: Full=Probable glycerol kinase; Short=GK; Short=Glycerokinase; 
AltName: Full=ATP:glycerol 3-phosphotransferase [Dictyostelium 
discoideum]
 gb|EAL67412.1| hypothetical protein DDB_G0280371 [Dictyostelium discoideum AX4]
Length=539

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 145/209 (69%), Gaps = 14/209 (7%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEG  A+AG+ V+WL D++ +  S+ EIE LA  V+ TGG+YFVPAF+GLFAP+WRDD
Sbjct  342  YALEGGVAVAGSGVRWLIDNMGIAESSQEIEDLAKSVQDTGGMYFVPAFSGLFAPYWRDD  401

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+T  TN+CHIAR+VLES C Q  +VLD+M KD+G+K           LRVDGG
Sbjct  402  ARGVMVGLTHHTNRCHIARSVLESTCLQTFEVLDAMQKDSGNK--------LVELRVDGG  453

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               NNLL+QIQ+DLLG PVV+P  +ETT  GAA+AAG+A G+W E   F  G K      
Sbjct  454  MAKNNLLLQIQSDLLGLPVVKPISLETTCFGAAFAAGIATGVWKETMQFKIGGK------  507

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            F P ++E  + +K+  W KA+S++ D  D
Sbjct  508  FTPQLDENHKTQKLKEWKKAISKSLDWID  536



>ref|WP_033086797.1| glycerol kinase [Nocardia seriolae]
 dbj|GAM45888.1| glycerol kinase [Nocardia seriolae]
Length=512

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 147/207 (71%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS A  +E LA +V   GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGAERVEALALQVTDNGGVYFVPAFSGLFAPYWRAD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++RF+N  HIARA LES+C+Q RDV+++M +D+G    VK D     LRVDGG
Sbjct  365  ARGVIVGLSRFSNNAHIARATLESICYQTRDVVEAMQQDSG----VKLD----TLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             T N L MQIQAD LG PV RP   ETTALGAAYAAGLAVG W   DE+ ++    ++D 
Sbjct  417  VTANELAMQIQADFLGVPVSRPVVAETTALGAAYAAGLAVGFWRNTDELVAN---WREDK  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             ++P   E+ R+K    W KAVSRT D
Sbjct  474  NWQPAWTEDARQKGYARWLKAVSRTLD  500



>ref|XP_010654824.1| PREDICTED: glycerol kinase-like [Vitis vinifera]
Length=128

 Score =   197 bits (502),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  493  MCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSPVVRPAD  314
            MCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGAT+NNLLMQIQADLLG+PVVRPAD
Sbjct  1    MCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATINNLLMQIQADLLGNPVVRPAD  60

Query  313  IETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWCKAVSRT  134
            IETTALGAAYAAGLAVGIWTEDEIF SGEK+K  T F P ++EE R KKV+SWCKAVSRT
Sbjct  61   IETTALGAAYAAGLAVGIWTEDEIFDSGEKVKLATTFYPALDEERRNKKVESWCKAVSRT  120

Query  133  FDLAD  119
            FDLAD
Sbjct  121  FDLAD  125



>ref|XP_003288686.1| hypothetical protein DICPUDRAFT_34436 [Dictyostelium purpureum]
 gb|EGC34771.1| hypothetical protein DICPUDRAFT_34436 [Dictyostelium purpureum]
Length=529

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 147/209 (70%), Gaps = 14/209 (7%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEG  A+AG+ V+WL D++ +  ++ EIE LA+ V+ TGG+YFVPAF+GLFAP+WR+D
Sbjct  309  YALEGGVAVAGSGVRWLIDNMGIAKTSQEIEDLATSVKDTGGMYFVPAFSGLFAPYWRED  368

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+T  TN+CH+ARAVLES C Q  +VL++M KD+GD            LRVDGG
Sbjct  369  ARGVMVGLTHHTNRCHMARAVLESTCLQTYEVLEAMQKDSGDT--------LLELRVDGG  420

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               NNLL+Q QADLL  PVV+P ++ETT  GAA+AAGLAVG+W E   F  G K      
Sbjct  421  MAKNNLLLQTQADLLSLPVVKPCNLETTCFGAAFAAGLAVGVWKESMEFKVGSK------  474

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            F P ++++ + KKV+ W KAVS++ +  D
Sbjct  475  FTPQLDQKNKMKKVNEWKKAVSKSLNWVD  503



>ref|WP_043669782.1| glycerol kinase [Clavibacter michiganensis]
Length=505

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 153/211 (73%), Gaps = 12/211 (6%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ VQW+RD+L L+SSA+EIE LA+ VE  GGVYFVPAF+GLFAP+WR 
Sbjct  302  HYALEGSIAVTGSLVQWMRDNLGLVSSAAEIETLAATVEDNGGVYFVPAFSGLFAPYWRS  361

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TRF NK HIARA LE+  FQ R+VLD+++ D+G D  E         L+VD
Sbjct  362  DARGALVGLTRFVNKGHIARAALEATAFQTREVLDAVNADSGVDLTE---------LKVD  412

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKD  212
            GG   NNLLMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W + +   S    ++D
Sbjct  413  GGMIANNLLMQFQADILGVPVVRPVVAETTALGAAYAAGLAVGFWKDLDDLRS--NWQED  470

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            + + P +++  R++++  W KAV++TFD  D
Sbjct  471  SRWTPDMDDAERERQLRLWKKAVTKTFDWVD  501



>ref|WP_031459864.1| glycerol kinase [Chloroflexus sp. MS-G]
Length=498

 Score =   208 bits (529),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 149/207 (72%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AI GA VQWLRD+L LI+S++E+E LA+ VE  GG+YFVPAF+GLFAP+WR D
Sbjct  300  YALEGSIAITGALVQWLRDNLGLITSSAEVESLANLVEDNGGIYFVPAFSGLFAPYWRSD  359

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TR+ NK HIARAVLE+  +Q R+VLD+M +D+G K           L+VDGG
Sbjct  360  ARGVIVGLTRYVNKGHIARAVLEATAYQTREVLDAMEQDSGVK--------LTALKVDGG  411

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
               NN LMQ QAD+LG PV+RP   ETT+LGAAYAAGLAVG W+  DE+ ++      D 
Sbjct  412  MVYNNTLMQFQADILGVPVIRPKVAETTSLGAAYAAGLAVGFWSNTDEMRAN---WGVDH  468

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R++    W KAV+RTFD
Sbjct  469  TWTPQMDEATRERLYRGWKKAVTRTFD  495



>ref|WP_028456954.1| glycerol kinase [Chloroflexus sp. Y-396-1]
Length=498

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 149/207 (72%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AI GA VQWLRD+L LI+S++E+E LA+ VE  GG+YFVPAF+GLFAP+WR D
Sbjct  300  YALEGSIAITGALVQWLRDNLGLITSSAEVEALANLVEDNGGIYFVPAFSGLFAPYWRSD  359

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TR+ NK HIARAVLE+  +Q R+VLD+M +D+G K           L+VDGG
Sbjct  360  ARGVIVGLTRYVNKGHIARAVLEATAYQTREVLDAMEQDSGVK--------LTALKVDGG  411

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
               NN LMQ QAD+LG PV+RP   ETT+LGAAYAAGLAVG W+  DE+ ++      D 
Sbjct  412  MVYNNTLMQFQADILGVPVIRPKVAETTSLGAAYAAGLAVGFWSNTDEMRAN---WGVDH  468

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R++    W KAV+RTFD
Sbjct  469  TWTPQMDEATRERLYRGWKKAVTRTFD  495



>ref|WP_026419357.1| glycerol kinase [Actinoalloteichus cyanogriseus]
Length=505

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 151/209 (72%), Gaps = 12/209 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LI SA E+E+LAS V  +GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGLIGSAPEVERLASTVPDSGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLARAVLEATAFQTREVIDAMNADSGVA--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I        +DT
Sbjct  415  MVVNELLMQFQADILGVPVIRPKVNETTALGAAYAAGLAVGFWDSEDDIR---RNWIQDT  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLA  122
             + P + E+ R+ +   W KAV+RTFD A
Sbjct  472  QWDPSLAEQTREARYREWKKAVTRTFDWA  500



>ref|WP_030104795.1| glycerol kinase [Actinoalloteichus cyanogriseus]
Length=505

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 151/209 (72%), Gaps = 12/209 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LI SA E+E+LAS V  +GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGLIGSAPEVERLASTVPDSGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLARAVLEATAFQTREVIDAMNADSGVA--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I        +DT
Sbjct  415  MVVNELLMQFQADILGVPVIRPKVNETTALGAAYAAGLAVGFWDSEDDIR---RNWIQDT  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLA  122
             + P + E+ R+ +   W KAV+RTFD A
Sbjct  472  QWDPSLAEQTREARYREWKKAVTRTFDWA  500



>ref|WP_026371016.1| glycerol kinase [bacterium JKG1]
Length=501

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 148/205 (72%), Gaps = 10/205 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            +ALEGS A+ G+ VQWLRD+LNLISSA EIE LA KVE  GGVY VPAF+GLFAP+WR+D
Sbjct  300  WALEGSIAVTGSLVQWLRDNLNLISSAPEIEDLARKVEDNGGVYIVPAFSGLFAPYWRND  359

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TR+ NK HIARA LE+  +Q RDVL++M +D+G   ++K       L+VDGG
Sbjct  360  ARGVIVGLTRYVNKYHIARAALEATAYQTRDVLEAMEQDSGV--QLKE------LKVDGG  411

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               N+LLMQ QAD+LG PVVRP   ETT+LGAAYAAGLAVG W   +   +   M K   
Sbjct  412  MVYNDLLMQFQADILGVPVVRPKVAETTSLGAAYAAGLAVGYWKGTDDMRANWAMDKR--  469

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTF  131
            ++P + EE R+K    W KAV+RTF
Sbjct  470  WEPRMSEEQREKLYAGWKKAVTRTF  494



>ref|WP_033441033.1| glycerol kinase [Saccharothrix sp. NRRL B-16314]
Length=501

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 149/210 (71%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I SA+EIEQ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGMIGSAAEIEQHARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+V+D+M  D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLARAVLEATAFQTREVIDAMDADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I    +   +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWASEDDIR---QNWAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P +++E R +    W KAV+RTFD  D
Sbjct  472  QWDPAMDDETRARTYAQWKKAVTRTFDWVD  501



>ref|WP_015805093.1| glycerol kinase [Actinosynnema mirum]
 gb|ACU40210.1| glycerol kinase [Actinosynnema mirum DSM 43827]
Length=504

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 152/207 (73%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I +A+EIEQ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGMIGTAAEIEQYARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  +Q R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLARAVLEATAYQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I    +   +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWASEDDIR---QNWAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P +++ VR+K+  SW KAV++TFD
Sbjct  472  QWDPAMDDSVREKRYRSWKKAVTKTFD  498



>ref|WP_015909396.1| glycerol kinase [Chloroflexus sp. Y-400-fl]
 sp|B9LD34.1|GLPK_CHLSY RecName: Full=Glycerol kinase; AltName: Full=ATP:glycerol 3-phosphotransferase; 
AltName: Full=Glycerokinase; Short=GK [Chloroflexus 
sp. Y-400-fl]
 gb|ACM54923.1| glycerol kinase [Chloroflexus sp. Y-400-fl]
Length=498

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 149/207 (72%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AI GA VQWLRD+L LI+S++E+E LA+ VE  GG+YFVPAF+GLFAP+WR D
Sbjct  300  YALEGSIAITGALVQWLRDNLGLITSSAEVEALANLVEDNGGIYFVPAFSGLFAPYWRSD  359

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TR+ NK H+ARAVLE+  +Q R+VLD+M +D+G K           L+VDGG
Sbjct  360  ARGVIVGLTRYVNKGHLARAVLEATAYQTREVLDAMEQDSGVK--------LTALKVDGG  411

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
               NN LMQ QAD+LG PV+RP   ETT+LGAAYAAGLAVG W+  DE+ ++      D 
Sbjct  412  MVYNNTLMQFQADILGVPVIRPKVAETTSLGAAYAAGLAVGFWSNTDEMRAN---WGVDH  468

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R++    W KAV+RTFD
Sbjct  469  TWTPQMDEATRERLYRGWKKAVTRTFD  495



>ref|WP_040732517.1| glycerol kinase [Nocardia tenerifensis]
Length=506

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 146/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS AS+ E LA +VE  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVEDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++RF+   H+ARA LES+C+Q RDV+++M  D+G    V+ D    VLRVDGG
Sbjct  365  ARGAIVGLSRFSTNAHLARATLESICYQTRDVVEAMQADSG----VQLD----VLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N L MQ+QAD LG PV RP   ETTALGAAYAAGLAVG W+  DE+    +   +D 
Sbjct  417  VTANELCMQLQADFLGVPVSRPVVAETTALGAAYAAGLAVGFWSSTDELV---QNWHEDK  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P   EE R++    W KAVSRT D  D
Sbjct  474  RWNPTGSEEQRERGYARWQKAVSRTLDWID  503



>ref|WP_013349045.1| glycerol kinase [Arthrobacter arilaitensis]
 emb|CBT75915.1| glycerol kinase [Arthrobacter arilaitensis Re117]
Length=506

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 148/209 (71%), Gaps = 10/209 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+AG+ VQWLRD++ +ISSA EIE+LA+KVE  GGVY VPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVAGSLVQWLRDNIGMISSAPEIEELAAKVEDNGGVYIVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HIARA LE+  FQ R+VLD+++ DA    EV        L+VDGG
Sbjct  363  ARGAIVGLTRFANKNHIARAALEATAFQTREVLDAVNADA----EVPLTE----LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               N  LMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W   ++        +DT 
Sbjct  415  MVANEALMQFQADILGVPVVRPKVTETTALGAAYAAGLAVGFW--KDLGELEANWSEDTR  472

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            ++P ++E  R++ +  W KAV+RTFD  D
Sbjct  473  WEPAMDEATRERSLRLWKKAVTRTFDWVD  501



>ref|WP_012038518.1| glycerol kinase [Clavibacter michiganensis]
 sp|A5CS23.1|GLPK_CLAM3 RecName: Full=Glycerol kinase; AltName: Full=ATP:glycerol 3-phosphotransferase; 
AltName: Full=Glycerokinase; Short=GK [Clavibacter 
michiganensis subsp. michiganensis NCPPB 382]
 emb|CAN01886.1| putative glycerol kinase [Clavibacter michiganensis subsp. michiganensis 
NCPPB 382]
 gb|KDP89980.1| glycerol kinase [Clavibacter cf. michiganensis LMG 26808]
Length=505

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 153/211 (73%), Gaps = 12/211 (6%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ VQW+RD+L L+SSA+EIE LA+ VE  GGVYFVPAF+GLFAP+WR 
Sbjct  302  HYALEGSIAVTGSLVQWMRDNLGLVSSAAEIETLAATVEDNGGVYFVPAFSGLFAPYWRS  361

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TR+ NK HIARA LE+  FQ R+VLD+++ D+G D  E         L+VD
Sbjct  362  DARGALVGLTRYVNKGHIARAALEATAFQTREVLDAVNADSGVDLTE---------LKVD  412

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKD  212
            GG   NNLLMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W + +     +  ++D
Sbjct  413  GGMIANNLLMQFQADILGVPVVRPVVAETTALGAAYAAGLAVGFWKDLDDLR--QNWQED  470

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            + + P +++  R++++  W KAV++TFD  D
Sbjct  471  SRWTPDMDDAERERQLRLWKKAVTKTFDWVD  501



>ref|WP_020662584.1| glycerol kinase [Amycolatopsis benzoatilytica]
Length=502

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 152/207 (73%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LISSA+E+E+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSVAVTGSLVQWLRDNLGLISSAAEVEEFARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLARAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I    +   +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWSSEDDIR---KNWAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R+K+  +W KAV++TFD
Sbjct  472  QWDPAMDESRREKEYRNWKKAVTKTFD  498



>ref|WP_012259133.1| glycerol kinase [Chloroflexus aurantiacus]
 ref|YP_001636869.1| glycerol kinase [Chloroflexus aurantiacus J-10-fl]
 sp|A9WJ21.1|GLPK_CHLAA RecName: Full=Glycerol kinase; AltName: Full=ATP:glycerol 3-phosphotransferase; 
AltName: Full=Glycerokinase; Short=GK [Chloroflexus 
aurantiacus J-10-fl]
 gb|ABY36480.1| glycerol kinase [Chloroflexus aurantiacus J-10-fl]
Length=498

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 149/207 (72%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AI GA VQWLRD+L LI+S++E+E LA+ VE  GG+YFVPAF+GLFAP+WR D
Sbjct  300  YALEGSIAITGALVQWLRDNLGLITSSAEVEALANLVEDNGGIYFVPAFSGLFAPYWRSD  359

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TR+ NK H+ARAVLE+  +Q R+VLD+M +D+G K           L+VDGG
Sbjct  360  ARGVIVGLTRYVNKDHLARAVLEATAYQTREVLDAMEQDSGVK--------LTALKVDGG  411

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
               NN LMQ QAD+LG PV+RP   ETT+LGAAYAAGLAVG W+  DE+ ++      D 
Sbjct  412  MVYNNTLMQFQADILGVPVIRPKVAETTSLGAAYAAGLAVGFWSNTDEMRAN---WGVDH  468

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R++    W KAV+RTFD
Sbjct  469  TWTPQMDEATRERLYRGWKKAVTRTFD  495



>ref|WP_030149055.1| glycerol kinase [Mycetocola saprophilus]
Length=504

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 153/211 (73%), Gaps = 12/211 (6%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ VQWLRD+L LISSA+E+E+LA  VE  GG YFVPAF+GLFAP+WR 
Sbjct  301  HYALEGSIAVTGSLVQWLRDNLGLISSAAEVEELARGVEDNGGAYFVPAFSGLFAPYWRS  360

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TRF NK HIARA LE++ +Q  +VLD+++ DAG D  E         LRVD
Sbjct  361  DARGALVGLTRFVNKGHIARAALEAIAYQTAEVLDAVNADAGVDLTE---------LRVD  411

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKD  212
            GGAT N+LL+Q QAD+LG PVVRP   ETTALGAAYAAGLAVG W + +  +  +  ++D
Sbjct  412  GGATANDLLLQFQADILGVPVVRPVVAETTALGAAYAAGLAVGFWKDTDDLA--KNWQED  469

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
              ++P +++  R +   +W KAV++TFD  D
Sbjct  470  KRWEPSMDKGERDRLYRNWKKAVTKTFDWVD  500



>ref|WP_012615391.1| glycerol kinase [Chloroflexus aggregans]
 sp|B8GC51.1|GLPK_CHLAD RecName: Full=Glycerol kinase; AltName: Full=ATP:glycerol 3-phosphotransferase; 
AltName: Full=Glycerokinase; Short=GK [Chloroflexus 
aggregans DSM 9485]
 gb|ACL23025.1| glycerol kinase [Chloroflexus aggregans DSM 9485]
Length=498

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 149/207 (72%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AI GA VQWLRD+L LI++++E+E LA+ VE  GG+YFVPAF+GLFAP+WR D
Sbjct  300  YALEGSIAITGALVQWLRDNLGLITTSAEVEALANLVEDNGGIYFVPAFSGLFAPYWRSD  359

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TR+ NK H+ARAVLE+  +Q R+VLD+M +D+G K           L+VDGG
Sbjct  360  ARGVIVGLTRYVNKGHLARAVLEATAYQTREVLDAMEQDSGVK--------LTALKVDGG  411

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
               NN LMQ QAD+LG PV+RP   ETT+LGAAYAAGLAVG W+  DE+ ++      D 
Sbjct  412  MVYNNTLMQFQADILGVPVIRPKVAETTSLGAAYAAGLAVGFWSNTDEMRAN---WGVDH  468

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R++    W KAV+RTFD
Sbjct  469  TWTPQMDEATRERLYRGWKKAVTRTFD  495



>ref|WP_018189990.1| MULTISPECIES: glycerol kinase [Microbacteriaceae]
Length=506

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 152/211 (72%), Gaps = 12/211 (6%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ VQWLRD+L +ISSA EIE+LA  V+  GG YFVPAF+GLFAP+WR 
Sbjct  301  HYALEGSIAVTGSLVQWLRDNLGIISSAPEIEELAKTVDDNGGAYFVPAFSGLFAPYWRA  360

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TR+ NK HIARAVLE+  FQ R+VLD+++ D+G D  E         L+VD
Sbjct  361  DARGALVGLTRYVNKGHIARAVLEATAFQTREVLDAVNADSGVDLTE---------LKVD  411

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKD  212
            GG   NNLLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W++ +     +  ++D
Sbjct  412  GGMIANNLLMQFQADILGVPVIRPVVAETTALGAAYAAGLAVGFWSDLDDLR--KNWQED  469

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            + + P ++ E R +++  W KAV++TFD  D
Sbjct  470  SRWTPNMDAEERDRQIRLWKKAVTKTFDWVD  500



>ref|WP_030528182.1| glycerol kinase [Phycicoccus jejuensis]
Length=505

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 143/206 (69%), Gaps = 10/206 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS A+  E LA +V   GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGAAHSEALARQVPDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++RF    HIARA LE++C+Q RDV D+M KD+G + E        VL+VDGG
Sbjct  365  ARGAIVGLSRFNTNAHIARATLEAICYQSRDVADAMEKDSGVRLE--------VLKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
             T N+L MQIQAD+LG PV RP   ETTALG+AYAAGLAVG W++ E   +     +D  
Sbjct  417  VTANDLCMQIQADVLGVPVSRPVVAETTALGSAYAAGLAVGFWSDPEELRA--NWNEDRR  474

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFD  128
            + PV  EE R++    W KAV+RT D
Sbjct  475  WTPVWSEEERQEGYRGWQKAVTRTLD  500



>ref|WP_043607522.1| glycerol kinase [Cellulomonas carbonis]
 gb|KGM10200.1| glycerol kinase [Cellulomonas carbonis T26]
Length=505

 Score =   205 bits (522),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 148/211 (70%), Gaps = 14/211 (7%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LI  A EIE+LA+ VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGLIKDAPEIEKLAASVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVDG  389
            ARG  +G+TR+ NK HIARA LE+  FQ R+VLD+M+ D+G D  E         L+VDG
Sbjct  363  ARGALVGLTRYVNKGHIARAALEATAFQTREVLDAMNADSGVDLTE---------LKVDG  413

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWT-EDEIFSSGEKMKKD  212
            G   N LLMQ QAD+LG PVVRP   ETTALGAAYAAG+AVG W+ E ++    +   +D
Sbjct  414  GMVANELLMQFQADILGVPVVRPKVAETTALGAAYAAGIAVGFWSGEQDVI---DNWAED  470

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
              ++P +E+  R+K   +W KAV++TFD  D
Sbjct  471  KRWEPSMEDAAREKTYRNWKKAVTKTFDWVD  501



>ref|XP_005851284.1| hypothetical protein CHLNCDRAFT_18995 [Chlorella variabilis]
 gb|EFN59182.1| hypothetical protein CHLNCDRAFT_18995 [Chlorella variabilis]
Length=543

 Score =   206 bits (524),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 146/210 (70%), Gaps = 8/210 (4%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS AIAG  + WLRD L  I+SA++ E++A+ V  +GGVYFVPAF GL APWWRD
Sbjct  305  SYALEGSIAIAGQGISWLRDRLGFIASAADSEEVAAGVPDSGGVYFVPAFGGLLAPWWRD  364

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG  +G+T+++ K HI RA+LE++CFQ  DVL +M +DA D  E++       L VDG
Sbjct  365  DARGAIVGLTQYSTKAHIVRAMLEAICFQTLDVLLAMQQDA-DCSELRT------LFVDG  417

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            GA+ N+LLMQ+QAD+L  PV RPA +ETT+LGAA AAG+ VG WT +E F    K    T
Sbjct  418  GASQNSLLMQMQADILQVPVRRPAHMETTSLGAALAAGIGVGFWTAEEAFED-LKHNTGT  476

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            +F+P I      ++   W KAV R+F LAD
Sbjct  477  LFEPQITAAAASRRHAKWKKAVERSFALAD  506



>ref|WP_033429062.1| glycerol kinase [Saccharothrix syringae]
Length=500

 Score =   205 bits (522),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 149/207 (72%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I++A+EIE+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  302  YALEGSIAVTGSLVQWLRDNLGMITTAAEIEEHARTVEDNGGAYFVPAFSGLFAPYWRSD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TR+ N+ H+ARAVLE+  FQ R+V+D+M+ D+G             L+VDGG
Sbjct  362  ARGAIVGLTRYVNRGHLARAVLEATAFQTREVIDAMNADSG--------VALTSLKVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I    +   +D 
Sbjct  414  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWESEDDIR---QNWARDK  470

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             ++P ++EE R++    W KAV+RTFD
Sbjct  471  QWEPAMDEEARERHYHLWKKAVTRTFD  497



>ref|WP_016698736.1| glycerol kinase [Actinoalloteichus spitiensis]
Length=505

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 149/209 (71%), Gaps = 12/209 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LI SA E+E+LA+ V  +GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGLIGSAPEVERLAATVSDSGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+V+D+M+ D+G   +         L+ DGG
Sbjct  363  ARGAIVGLTRFVNKGHLARAVLEATAFQTREVIDAMNADSGVALK--------ALKADGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN+LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W  ED+I        +DT
Sbjct  415  MVVNDLLMQFQADILGVPVIRPKVNETTALGAAYAAGLAVGFWGGEDDIR---RNWIQDT  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLA  122
             ++P + E+ R+ +   W KAV+RTFD A
Sbjct  472  QWEPSLAEQTREARYREWKKAVTRTFDWA  500



>ref|WP_042264218.1| glycerol kinase [Nocardia brasiliensis]
 dbj|GAJ86376.1| glycerol kinase [Nocardia brasiliensis NBRC 14402]
Length=506

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 146/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS AS+ E LA +VE  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVEDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++RF+   H+ARA LES+C+Q RDV+++M  D+G    V+ D    VLRVDGG
Sbjct  365  ARGAIVGLSRFSTNAHLARATLESICYQTRDVVEAMQADSG----VQLD----VLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N L MQ+QAD LG PV RP   ETTALGAAYAAGLAVG W+  DE+    +   +D 
Sbjct  417  VTANELCMQLQADFLGVPVSRPVVAETTALGAAYAAGLAVGFWSSTDELV---QNWHEDK  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P   EE R++    W KAV+RT D  D
Sbjct  474  RWNPTWTEEQRERGYARWKKAVARTLDWID  503



>ref|WP_022888254.1| glycerol kinase [Agromyces italicus]
Length=504

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 151/212 (71%), Gaps = 14/212 (7%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ +QWLRD+L LIS+A EIE+LA  VE  GG YFVPAF+GLFAP+WR 
Sbjct  301  HYALEGSIAVTGSLIQWLRDNLGLISTAPEIEELAKSVEDNGGAYFVPAFSGLFAPYWRP  360

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TR+ NK HIARA LE++ FQ RDV+++++ DAG D  E         LRVD
Sbjct  361  DARGALVGLTRYVNKGHIARAALEAIAFQTRDVIEAVNADAGVDLTE---------LRVD  411

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKK  215
            GGAT N  L+Q QAD+LG PVVRP   ETTALGAAYAAGLAVG W+  DE+ ++    ++
Sbjct  412  GGATANETLLQFQADILGVPVVRPVVAETTALGAAYAAGLAVGFWSSLDELRAN---WQE  468

Query  214  DTIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            D  + P ++E  R +   SW KAVS+T D  D
Sbjct  469  DRRWTPSMDEAARARLDRSWKKAVSKTLDWVD  500



>ref|WP_012823872.1| glycerol kinase [Halothiobacillus neapolitanus]
 gb|ACX95836.1| glycerol kinase [Halothiobacillus neapolitanus c2]
Length=504

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 146/206 (71%), Gaps = 10/206 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AI GA VQWLRD+LNLI  A++IE LA+ VE  GGVY VPAF+GL+AP+W+DD
Sbjct  301  YALEGSIAITGALVQWLRDNLNLIEKAADIEPLAASVEDNGGVYIVPAFSGLYAPYWKDD  360

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TR+ N+ HIARA LES  FQVRDV+++M  D+G   E+K       LRVDGG
Sbjct  361  ARGVIVGLTRYANRAHIARAALESAAFQVRDVVEAMQADSGI--ELK------ALRVDGG  412

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               NNLLMQ Q+D+L +PVVRP   ETTALGAAYAAGLAVG W   +   +   +  D  
Sbjct  413  MVCNNLLMQFQSDMLAAPVVRPRITETTALGAAYAAGLAVGYWKNTDDLRANWSV--DHT  470

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFD  128
            + P++  E R+     W +AV+R+FD
Sbjct  471  WSPIMPNEQRETYYRYWKRAVTRSFD  496



>ref|XP_002951253.1| hypothetical protein VOLCADRAFT_91722 [Volvox carteri f. nagariensis]
 gb|EFJ47782.1| hypothetical protein VOLCADRAFT_91722 [Volvox carteri f. nagariensis]
Length=504

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 145/211 (69%), Gaps = 15/211 (7%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            NYALEGS A+AG  + WLRD+L +I SA+E E LA+ V  TGGVYFVPAF+GL AP WR 
Sbjct  294  NYALEGSVAVAGLGISWLRDNLGVIGSAAESEVLAASVPDTGGVYFVPAFSGLLAPHWRA  353

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEF-VLRVD  392
            DARGV +G+T FT + H+ RA+LE++CFQ R+VLD+M +DA    E+    G    LRVD
Sbjct  354  DARGVLLGMTSFTTRAHVVRAMLEAICFQTREVLDAMRRDA----ELDEHHGGLAALRVD  409

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKD  212
            GGA  N+LLMQ+QADLL  PVVRPA  ETT+LGAA AAGLAV +W+++E           
Sbjct  410  GGAAANDLLMQLQADLLQVPVVRPAFRETTSLGAALAAGLAVNMWSKEEA----------  459

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            T F+P +      ++ D W KAV R  DLAD
Sbjct  460  TAFQPGVTPAAAGRRYDRWRKAVERALDLAD  490



>ref|WP_040752000.1| glycerol kinase [Nocardia transvalensis]
Length=506

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 149/210 (71%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+A+QWLRD L +IS A++ E LA +V+  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAIQWLRDQLGIISGAAQSESLARQVDDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++RF+N  H+ARA LE++C+Q RDV+++M  D+G    V+ D    VLRVDGG
Sbjct  365  ARGVIVGLSRFSNNAHLARAALEAICYQTRDVVEAMQADSG----VQLD----VLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N L MQ+QAD LG PV RP   ETTALGAAYAAGLAVG W + DE+  + ++ K+  
Sbjct  417  VTANELCMQLQADFLGVPVSRPVVAETTALGAAYAAGLAVGFWKDTDELAQNWQESKR--  474

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P   EE R+     W KAVSRT D  D
Sbjct  475  -WNPTSTEEQRESGYARWKKAVSRTLDWID  503



>ref|WP_022895397.1| glycerol kinase [Corynebacterium-like bacterium B27]
Length=506

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 153/212 (72%), Gaps = 14/212 (7%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ +QWLRD+L +ISSA E+E+LA  VE  GG YFVPAF+GLFAP+WR 
Sbjct  303  HYALEGSIAVTGSLIQWLRDNLGIISSAPEVEELAKTVEDNGGAYFVPAFSGLFAPYWRP  362

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TR+ NK HIARA LE+  FQ R+VLD+++ D+G D  E         L+VD
Sbjct  363  DARGALVGLTRYVNKGHIARAALEATAFQTREVLDAVNADSGVDLTE---------LKVD  413

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKK  215
            GG   NNLLMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W   DE+ ++    ++
Sbjct  414  GGMIANNLLMQFQADILGVPVVRPVVAETTALGAAYAAGLAVGFWANLDELRAN---WQE  470

Query  214  DTIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            D+ ++P ++E  R +++ +W KAV++T D  D
Sbjct  471  DSRWEPQMDEAERDRQLRNWKKAVTKTLDWVD  502



>ref|WP_009072696.1| glycerol kinase [Streptomyces sp. AA4]
 gb|EFL04944.1| glycerol kinase [Streptomyces sp. AA4]
Length=502

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 153/207 (74%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LISSA++IE+ A  V+  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSVAVTGSLVQWLRDNLGLISSAAQIEEFARTVDDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HI+RAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHISRAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     KD 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWESEDDIRTN---WAKDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R+K+  +W KAV++TFD
Sbjct  472  QWDPSMDESRREKEYRNWKKAVTKTFD  498



>ref|WP_043663224.1| glycerol kinase [Nocardia vulneris]
 gb|KIA66675.1| glycerol kinase [Nocardia vulneris]
Length=506

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 146/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS AS+ E LA +VE  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVEDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++RF+   H+ARA LES+C+Q RDV+++M  D+G    V+ D    VLRVDGG
Sbjct  365  ARGAIVGLSRFSTNAHLARATLESICYQTRDVVEAMQADSG----VQLD----VLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N L MQ+QAD LG PV RP   ETTALGAAYAAGLAVG W+  DE+    +   +D 
Sbjct  417  VTANELCMQLQADFLGVPVSRPVVAETTALGAAYAAGLAVGFWSSTDELV---QNWHEDK  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P   EE R++    W KAV+RT D  D
Sbjct  474  RWNPTGTEEQRERGYARWKKAVARTLDWID  503



>ref|WP_037816066.1| glycerol kinase [Streptomyces sp. NRRL F-3213]
Length=502

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 153/207 (74%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LISSA++IE+ A  V+  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSVAVTGSLVQWLRDNLGLISSAAQIEEFARTVDDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HI+RAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHISRAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     KD 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWESEDDIRTN---WAKDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R+K+  +W KAV++TFD
Sbjct  472  QWDPSMDESRREKEYRNWKKAVTKTFD  498



>ref|WP_040161505.1| glycerol kinase [bacterium SIT7]
Length=506

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 149/211 (71%), Gaps = 14/211 (7%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD++ + SSA E+E+LA +VE  GG YFVPAF+GLFAP+WR D
Sbjct  304  YALEGSIAVTGSLVQWLRDNMKMFSSAPEVEELAKQVEDNGGCYFVPAFSGLFAPYWRSD  363

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVDG  389
            ARGV +G+TR+ N+ HIARA LES  +Q R+VLD+M+ D+G D  E         L+VDG
Sbjct  364  ARGVLVGLTRYINRNHIARAALESTAYQTREVLDAMNADSGVDLTE---------LKVDG  414

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWT-EDEIFSSGEKMKKD  212
            G T N+ LMQ QAD+LG PVVRP   ETTALGAAYAAG+AVG W  E ++    +  K+D
Sbjct  415  GMTANDTLMQFQADMLGVPVVRPVVAETTALGAAYAAGIAVGYWKGEQDVI---DNWKED  471

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
              ++P ++E  R++    W KA+ RTFD  D
Sbjct  472  KRWEPTMDEAERERLYRQWKKAIERTFDWVD  502



>ref|WP_029901568.1| glycerol kinase [Nocardia brasiliensis]
Length=506

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 146/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS AS+ E LA +VE  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVEDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++RF+   H+ARA LES+C+Q RDV+++M  D+G    V+ D    VLRVDGG
Sbjct  365  ARGAIVGLSRFSTNAHLARATLESICYQTRDVVEAMQADSG----VQLD----VLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N L MQ+QAD LG PV RP   ETTALGAAYAAGLAVG W+  DE+    +   +D 
Sbjct  417  VTANELCMQLQADFLGVPVSRPVVAETTALGAAYAAGLAVGFWSSTDELV---QNWHEDK  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P   EE R++    W KAV+RT D  D
Sbjct  474  RWNPTGTEEQRERGYARWKKAVARTLDWID  503



>ref|WP_043831849.1| glycerol kinase [Amycolatopsis orientalis]
Length=502

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 153/207 (74%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LISSA++IE+ A  V+  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSVAVTGSLVQWLRDNLGLISSAAQIEEFARTVDDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HI+RAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHISRAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     KD 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWESEDDIRTN---WAKDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R+K+  +W KAV++TFD
Sbjct  472  QWDPSMDESRREKEYRNWKKAVTKTFD  498



>ref|WP_007031951.1| glycerol kinase [Amycolatopsis decaplanina]
 gb|EME57610.1| glycerol kinase [Amycolatopsis decaplanina DSM 44594]
Length=503

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 153/210 (73%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LISSA+E+EQ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGLISSAAEVEQHARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HI+RAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHISRAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWKSEDDIRNN---WAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P ++E  R+ +  +W KAV++TFD  D
Sbjct  472  QWDPSMDEGRRESEYRNWKKAVTKTFDWVD  501



>ref|WP_037332341.1| glycerol kinase [Amycolatopsis sp. MJM2582]
 gb|KFZ82610.1| glycerol kinase [Amycolatopsis sp. MJM2582]
Length=503

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 152/210 (72%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LI SA+E+EQ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGLIGSAAEVEQHARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HIARAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHIARAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWKSEDDIRNN---WAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P ++E  R+ +  +W KAV++TFD  D
Sbjct  472  QWDPSMDETRRESEYRNWKKAVTKTFDWVD  501



>ref|WP_016331321.1| glycerol kinase [Amycolatopsis orientalis]
 gb|AGM03510.1| glycerol kinase [Amycolatopsis orientalis HCCB10007]
Length=503

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 152/210 (72%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LI SA+E+EQ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGLIGSAAEVEQHARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HIARAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHIARAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWKSEDDIRNN---WAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P ++E  R+ +  +W KAV++TFD  D
Sbjct  472  QWDPSMDETRRESEYRNWKKAVTKTFDWVD  501



>ref|WP_027772783.1| hypothetical protein, partial [Streptomyces sp. CNQ329]
Length=204

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 143/205 (70%), Gaps = 10/205 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AI GA VQW+RD + +IS+A+EIE LA  VE  GG YFVPAF+GLFAP+WRDD
Sbjct  3    YALEGSIAITGALVQWMRDQMGIISTAAEIETLALSVEDNGGAYFVPAFSGLFAPYWRDD  62

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV  G+TR+  K H+ARAVLE+  +Q R+++D+M KD+G   E+ +      L+VDGG
Sbjct  63   ARGVIAGLTRYVTKAHLARAVLEATAWQTREIVDAMTKDSG--VELTS------LKVDGG  114

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
             T NNLLMQ  AD+L +PVVRP   ETT LGAAYAAGLAVG W + +   +  +   +  
Sbjct  115  MTANNLLMQTLADVLDAPVVRPLVAETTCLGAAYAAGLAVGYWPDTDALRANWRRAAE--  172

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTF  131
            + P ++ E R+++   W KAV RT 
Sbjct  173  WTPRMDAETREREYKDWLKAVQRTM  197



>ref|WP_022875171.1| glycerol kinase [Arthrobacter sp. PAO19]
Length=506

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 148/209 (71%), Gaps = 10/209 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+AG+ VQWLRD++ +ISSA EIE+LA+KV+  GGVY VPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVAGSLVQWLRDNIGMISSAPEIEELAAKVDDNGGVYVVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HIARA LES  FQ R+VLD+++ DA    EV        L+VDGG
Sbjct  363  ARGAIVGLTRFANKNHIARAALESTAFQTREVLDAVNADA----EVPLTE----LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               N  LMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W   ++        +D  
Sbjct  415  MVANEALMQFQADILGVPVVRPKVTETTALGAAYAAGLAVGFW--KDLGELEANWSEDKR  472

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            ++P ++E+ R++ +  W KAV+RTFD  D
Sbjct  473  WEPTMDEDARERNLRLWKKAVTRTFDWVD  501



>ref|WP_037366005.1| glycerol kinase [Amycolatopsis orientalis]
Length=502

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 153/207 (74%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LISSA++IE+ A  V+  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSVAVTGSLVQWLRDNLGLISSAAQIEEFARTVDDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H++RAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLSRAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     KD 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWESEDDIRTN---WAKDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R+K+  +W KAV++TFD
Sbjct  472  QWDPSMDESRREKEYRNWKKAVTKTFD  498



>ref|WP_022882980.1| glycerol kinase [Gryllotalpicola ginsengisoli]
Length=504

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 153/211 (73%), Gaps = 12/211 (6%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ VQWLRD++ +ISSA EIEQLA  VE  GG YFVPAF+GLFAP+WR 
Sbjct  301  HYALEGSIAVTGSLVQWLRDNIGIISSAPEIEQLAGSVEDNGGAYFVPAFSGLFAPYWRS  360

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG  +G+TR+  K HIARAVLE+  FQ R+VLD+++ D+G   E         L+VDG
Sbjct  361  DARGALVGLTRYVTKAHIARAVLEATAFQTREVLDAVNADSGVDLE--------ELKVDG  412

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKD  212
            G T N+LLMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W+  D++ ++ ++ K+ 
Sbjct  413  GMTANDLLMQFQADILGVPVVRPVVAETTALGAAYAAGLAVGFWSGLDDLRANWQEDKR-  471

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
              ++P ++   R +++  W KAV++TFD  D
Sbjct  472  --WEPQLDPAERDRQLRLWKKAVTKTFDWVD  500



>ref|WP_007272149.1| glycerol kinase [Arthrobacter gangotriensis]
 gb|EMQ97602.1| glycerol kinase [Arthrobacter gangotriensis Lz1y]
Length=504

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 148/209 (71%), Gaps = 10/209 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+AG+ VQWLRDS+ +ISSA+E+E LASKV+  GGVY VPAF+GLFAP+WR D
Sbjct  302  YALEGSIAVAGSLVQWLRDSIGMISSAAEVEVLASKVKDNGGVYIVPAFSGLFAPYWRAD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TR+ NK HIARA LES  FQ R+VLD+++ D+G             L+VDGG
Sbjct  362  ARGAIVGLTRYANKNHIARAALESTAFQTREVLDAVNADSGVP--------LTELKVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               N+ LMQ QADLLG PV+RP   ETTALGAAYAAGLAVG W   ++   G    +D  
Sbjct  414  MVANDGLMQFQADLLGVPVIRPKVTETTALGAAYAAGLAVGFW--KDLGELGANWSEDKR  471

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            ++P++E   R +++  W KAV+RTFD  D
Sbjct  472  WEPLMEPAERDRQMRLWKKAVTRTFDWVD  500



>ref|WP_028680535.1| hypothetical protein, partial [Salinispora arenicola]
Length=233

 Score =   196 bits (499),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 146/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +I++A + E LA +V+  GGVYFVPAF+GLFAP+WR D
Sbjct  33   YALEGSIAVTGSAVQWLRDQLKIINTAGQSEMLARQVDDNGGVYFVPAFSGLFAPYWRSD  92

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++RF    HIARA LES+C+Q RDV ++M  D+G   E         L+VDGG
Sbjct  93   ARGVIVGLSRFNTDAHIARATLESICYQSRDVAEAMATDSGVPLE--------CLKVDGG  144

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             TVN+L MQ+QAD+LG PV RP   ETTALGAAYAAGLAVG W + DE+  +  + ++  
Sbjct  145  VTVNDLCMQLQADILGVPVSRPVVAETTALGAAYAAGLAVGFWRSTDELRENWNESRR--  202

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P    E R+ + + W +AV RT D  D
Sbjct  203  -WQPTWPSEQREAEYERWKRAVQRTLDWVD  231



>ref|WP_021755755.1| glycerol kinase [Leifsonia aquatica]
 gb|ERK72621.1| glycerol kinase [Leifsonia aquatica ATCC 14665]
Length=506

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 150/211 (71%), Gaps = 12/211 (6%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ VQWLRD+L LISSA EIE+LA  VE  GG YFVPAF+GLFAP+WR 
Sbjct  301  HYALEGSIAVTGSLVQWLRDNLGLISSAPEIEELAKTVEDNGGAYFVPAFSGLFAPYWRS  360

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TR+ NK HIARA LE+  FQ R+VLD+++ D+G D  E         L+VD
Sbjct  361  DARGALVGLTRYVNKGHIARAALEATAFQTREVLDAVNADSGVDLTE---------LKVD  411

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKD  212
            GG   NN LMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W  + +    +  ++D
Sbjct  412  GGMIANNTLMQFQADILGVPVIRPVVAETTALGAAYAAGLAVGFW--ENLDDLRKNWQED  469

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            + ++P +E+  R +++  W KAV++TFD  D
Sbjct  470  SRWEPKMEDAERDRQLRLWKKAVTKTFDWVD  500



>ref|WP_025103335.1| glycerol kinase [Microbacterium paraoxydans]
Length=504

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 151/211 (72%), Gaps = 12/211 (6%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ +QWLRD L +ISSA E+E+LA KVE  GGVY VPAF+GLFAP+WR 
Sbjct  301  HYALEGSIAVTGSLIQWLRDQLGIISSAPEVEELAEKVEDNGGVYIVPAFSGLFAPYWRP  360

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TR+ NK HIARA LE++ FQ RDVLD+++ DAG D  E         L+VD
Sbjct  361  DARGAIVGLTRYANKNHIARAALEAVAFQTRDVLDAVNADAGVDLSE---------LKVD  411

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKD  212
            GG   N+ LMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W++ +  S+    ++D
Sbjct  412  GGMVANDALMQFQADILGVPVVRPVVAETTALGAAYAAGLAVGFWSDLDDLSA--NWQED  469

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
              ++P ++E  R +++  W KAV+++ D  D
Sbjct  470  RRWEPTLDEAERDRQLRLWRKAVTKSMDWVD  500



>ref|WP_014982240.1| glycerol kinase [Nocardia brasiliensis]
 gb|AFT99384.1| glycerol kinase [Nocardia brasiliensis ATCC 700358]
Length=506

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 146/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS A++ E LA +VE  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGAAQSESLARQVEDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++RF+   H+ARA LES+C+Q RDV+++M  D+G    V+ D    VLRVDGG
Sbjct  365  ARGAIVGLSRFSTNAHLARATLESICYQTRDVVEAMQADSG----VQLD----VLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N L MQ+QAD LG PV RP   ETTALGAAYAAGLAVG W+  DE+    +   +D 
Sbjct  417  VTANELCMQLQADFLGVPVSRPVVAETTALGAAYAAGLAVGFWSSTDELV---QNWHEDK  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P   EE R++    W KAV+RT D  D
Sbjct  474  RWNPTGTEEQRERGYARWKKAVARTLDWID  503



>ref|WP_020633536.1| glycerol kinase [Amycolatopsis alba]
Length=504

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 152/207 (73%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LISSA+E+EQ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGLISSAAEVEQHARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HI+RAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHISRAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWKSEDDIRNN---WAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R+ +  +W KAV++TFD
Sbjct  472  QWDPSMDEARRESEYRNWKKAVTKTFD  498



>ref|WP_038519322.1| glycerol kinase [Amycolatopsis japonica]
 gb|AIG79799.1| Glycerol kinase [Amycolatopsis japonica]
Length=503

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 152/210 (72%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LI SA+E+EQ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGLIGSAAEVEQHARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HI+RAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHISRAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWKSEDDIRNN---WAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P ++E  R+ +  +W KAV++TFD  D
Sbjct  472  QWDPSMDEARRESEYRNWKKAVTKTFDWVD  501



>ref|WP_020643440.1| glycerol kinase [Amycolatopsis balhimycina]
Length=504

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 154/210 (73%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LI++A+EIE+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSVAVTGSLVQWLRDNLGLITTAAEIEEHARSVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLARAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWKSEDDIRTN---WAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P +++  R+++  +W KAV++TFD  D
Sbjct  472  QWDPAMDDSRREREYRNWKKAVTKTFDWVD  501



>ref|WP_034304739.1| glycerol kinase [Amycolatopsis lurida]
 gb|KFU83240.1| glycerol kinase [Amycolatopsis lurida NRRL 2430]
 gb|AJK52223.1| glycerol kinase [Amycolatopsis lurida NRRL 2430]
Length=503

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 152/210 (72%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LI SA+E+EQ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGLIGSAAEVEQHARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HI+RAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHISRAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWESEDDIRNN---WAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P ++E  R+ +  +W KAV++TFD  D
Sbjct  472  QWDPSMDEARRESEYRNWKKAVTKTFDWVD  501



>ref|WP_033293216.1| glycerol kinase [Amycolatopsis jejuensis]
Length=501

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 153/210 (73%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LISSA+EIE+ A  V+  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSVAVTGSLVQWLRDNLGLISSAAEIEEFARTVDDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H++RAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLSRAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     KD 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWSSEDDIRTN---WAKDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P ++E  R+ +  +W KAV++TF+  D
Sbjct  472  QWDPAMDESRRESEYANWKKAVTKTFNWVD  501



>ref|WP_025155617.1| glycerol kinase [Leifsonia aquatica]
Length=506

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 149/211 (71%), Gaps = 12/211 (6%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ VQWLRD+L LISSA EIE+LA  VE  GG YFVPAF+GLFAP+WR 
Sbjct  301  HYALEGSIAVTGSLVQWLRDNLGLISSAPEIEELAKTVEDNGGAYFVPAFSGLFAPYWRS  360

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TR+ NK HIARA LE+  FQ R+VLD+++ D+G D  E         L+VD
Sbjct  361  DARGALVGLTRYVNKGHIARAALEATAFQTREVLDAVNADSGVDLTE---------LKVD  411

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKD  212
            GG   NN LMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W  + +    +  ++D
Sbjct  412  GGMIANNTLMQFQADILGVPVIRPVVAETTALGAAYAAGLAVGFW--ENLDDLRKNWQED  469

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            + ++P +E   R +++  W KAV++TFD  D
Sbjct  470  SRWEPKMEAAERDRQLRLWKKAVTKTFDWVD  500



>gb|EFA75245.1| Glycerol kinase 2 [Polysphondylium pallidum PN500]
Length=519

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 147/210 (70%), Gaps = 15/210 (7%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+AGA V+WL ++L   +++ EIE LA+ V+ TGG+Y VPAF+GLFAP WRD
Sbjct  324  HYALEGSIAVAGAGVKWLIENLGFANNSKEIEALANSVQDTGGMYIVPAFSGLFAPHWRD  383

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGV +G+T  TNK HIARA+LES CFQ  +VL SM KD+ DK           LRVDG
Sbjct  384  DARGVMVGLTHHTNKAHIARAMLESTCFQTYEVLKSMEKDSNDK--------LVELRVDG  435

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            G T+N+LL+QIQAD+LG PVVRP ++ETT  GAAYAAGL VG+W+    F  G++   + 
Sbjct  436  GMTMNDLLLQIQADILGLPVVRPHNLETTCFGAAYAAGLTVGVWSSAMQFHIGKRFTPN-  494

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
               P I+     K+++ W KAVS++ D  D
Sbjct  495  ---PNID---HMKRINDWHKAVSKSVDWVD  518



>ref|WP_019045228.1| MULTISPECIES: glycerol kinase [Actinomycetales]
 dbj|GAD87706.1| glycerol kinase [Nocardia asteroides NBRC 15531]
Length=505

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 147/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +I+ A+++E LA +V  +GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIIAGAAQVEDLAEQVADSGGVYFVPAFSGLFAPYWRPD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++R++   H+ARA LES+ +Q RDV+++M +D+G +           LRVDGG
Sbjct  365  ARGAVVGLSRYSTNAHLARATLESIAYQTRDVVEAMQRDSGVR--------LATLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T+N L MQIQADLLG PV RP   ETTALGAAYAAGLAVG+WT  DE+ ++     +D 
Sbjct  417  VTMNKLAMQIQADLLGVPVSRPVVAETTALGAAYAAGLAVGVWTSTDELLAN---WHEDV  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P   +E R +    W KAV RT D AD
Sbjct  474  RWFPTWSDEQRARGYGRWLKAVERTLDWAD  503



>ref|WP_034270380.1| glycerol kinase [Amycolatopsis halophila]
Length=506

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 143/209 (68%), Gaps = 10/209 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS A + E LAS+VE  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGAEQSESLASQVEDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++R++   H+ARA LES+C+Q RDV+D+M  D+G    V  D    VLRVDGG
Sbjct  365  ARGAIVGLSRYSTNAHVARATLESICYQTRDVVDAMAADSG----VTLD----VLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
             T N+L MQIQAD+LG PV RP   ETTALGAAYAAGLAVG W   +         +D  
Sbjct  417  VTANSLCMQIQADILGVPVSRPVVAETTALGAAYAAGLAVGFWQNTDELE--RNWNEDVR  474

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            ++P   E+ R++    W KAV RT D  D
Sbjct  475  WQPTWSEQQRERGYGRWKKAVERTLDWID  503



>ref|WP_026273704.1| glycerol kinase, partial [Salinispora pacifica]
Length=407

 Score =   200 bits (509),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 149/210 (71%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +I+SA++ E LA +V+  GGVYFVPAF+GLFAP+WR D
Sbjct  207  YALEGSIAVTGSAVQWLRDQLKIINSAAQSETLARQVDDNGGVYFVPAFSGLFAPYWRSD  266

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++RF    HIARA LES+C+Q RDV ++M KD+G    V   R    L+VDGG
Sbjct  267  ARGVIVGLSRFNTDAHIARATLESICYQSRDVAEAMAKDSG----VALGR----LKVDGG  318

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             TVN+L MQ+QAD+LG PV RP   ETTALGAAYAAGLAVG W + DE+  +  + ++  
Sbjct  319  VTVNDLCMQLQADILGVPVSRPTVAETTALGAAYAAGLAVGFWRSTDELRENWNESRR--  376

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P    E R+ + D W +AV RT D  D
Sbjct  377  -WQPTWPSEQREAEYDRWKRAVQRTLDWVD  405



>ref|WP_014453961.1| glycerol kinase [Caldisericum exile]
 dbj|BAL81566.1| glycerol kinase [Caldisericum exile AZM16c01]
Length=504

 Score =   202 bits (515),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 148/213 (69%), Gaps = 18/213 (8%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AI GA VQWLRD+L +I+ +S+IE+LA  V   GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAITGALVQWLRDNLKIINKSSDIEELARSVPDNGGVYFVPAFSGLFAPYWRTD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV IG+TR+ N+ HIARA LE+  FQ +DV+D+M  D+  K E        VL+VDGG
Sbjct  365  ARGVIIGLTRYANRGHIARAALEATAFQTKDVIDAMEHDSNIKLE--------VLKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKK---  215
              VN LLMQ Q+D+L  PVVRP  IETTALGA+Y AGLAV      ++F+S E+++K   
Sbjct  417  MVVNELLMQFQSDILSVPVVRPKVIETTALGASYVAGLAV------KLFTSEEELRKNWA  470

Query  214  -DTIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             D I+ P ++E  R      W +A+ ++ +LAD
Sbjct  471  VDKIWTPNMDENTRNNLYKRWLRAIEKSLNLAD  503



>ref|WP_006502359.1| glycerol kinase [Austwickia chelonae]
 dbj|GAB77607.1| glycerol kinase [Austwickia chelonae NBRC 105200]
Length=506

 Score =   202 bits (515),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 149/210 (71%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +ISSA +IE+LA+ VE  GG YFVPAF+GLFAP+WR D
Sbjct  304  YALEGSIAVTGSLVQWLRDNLGIISSAPQIEELAASVEDNGGAYFVPAFSGLFAPYWRSD  363

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVDG  389
            ARG  +G+TR+ NK HIARA LE+  +Q R+VLD+M+ D+G D  E         L+VDG
Sbjct  364  ARGALVGMTRYVNKGHIARAALEATAYQTREVLDAMNADSGVDLTE---------LKVDG  414

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            G T N+ LMQ QAD+LG PVVRP   ETTALGAAYAAG+AVG WT +E   +     +D 
Sbjct  415  GMTANDTLMQFQADILGVPVVRPKVAETTALGAAYAAGIAVGFWTGEEDVVA--NWAEDK  472

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P +++  R+K +  W KAV++T D  D
Sbjct  473  RWEPQMDDAQREKLLRQWKKAVTKTLDWVD  502



>dbj|BAL98869.1| glycerol kinase [Caldilinea aerophila DSM 14535 = NBRC 104270]
Length=487

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 146/207 (71%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AIAGA VQWLRD+L LI SA E+E LA  VE+ GG+YFVPAF+GL+AP+WR D
Sbjct  288  YALEGSIAIAGALVQWLRDNLRLIDSAPEVENLARTVENNGGIYFVPAFSGLYAPYWRSD  347

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TRF ++ H ARA LE+  FQ R+VLD+MH+D+G   +         L+VDGG
Sbjct  348  ARGVIVGLTRFIHRGHFARAALEATAFQTREVLDAMHQDSGVALQ--------ALKVDGG  399

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
               N LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W   DE+ ++      D 
Sbjct  400  MVRNELLMQFQADVLGVPVIRPRVSETTALGAAYAAGLAVGFWKNIDEMRAN---WGVDK  456

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
            I++P  ++  R K    W KAV+RTFD
Sbjct  457  IWQPSEDDAPRTKLYAQWKKAVTRTFD  483



>ref|WP_030470708.1| glycerol kinase [Lechevalieria aerocolonigenes]
Length=502

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 146/207 (71%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I SA+EIE+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGMIGSAAEIEEHARSVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+VLD+M+ D+G             L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLARAVLEATAFQTREVLDAMNADSGVN--------LTALKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I    E   +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVAETTALGAAYAAGLAVGFWKSEDDIR---ENWAEDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             ++P ++   R  +  +W KAV++TFD
Sbjct  472  KWEPQMDSARRDSEYANWKKAVTKTFD  498



>ref|WP_018824072.1| glycerol kinase, partial [Salinispora pacifica]
Length=407

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 148/207 (71%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +I+SA++ E LA +V+  GGVYFVPAF+GLFAP+WR D
Sbjct  207  YALEGSIAVTGSAVQWLRDQLKIINSAAQSETLARQVDDNGGVYFVPAFSGLFAPYWRSD  266

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++RF    HIARA LES+C+Q RDV ++M KD+G    V   R    L+VDGG
Sbjct  267  ARGVIVGLSRFNTDAHIARATLESICYQSRDVAEAMAKDSG----VALGR----LKVDGG  318

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             TVN+L MQ+QAD+LG PV RP   ETTALGAAYAAGLAVG W + DE+  +  + ++  
Sbjct  319  VTVNDLCMQLQADILGVPVSRPTVAETTALGAAYAAGLAVGFWRSTDELRENWNESRR--  376

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             ++P    E R+   D W +AV RTFD
Sbjct  377  -WQPTWPSEQREAGYDRWKRAVRRTFD  402



>ref|WP_028936593.1| glycerol kinase [Pseudonocardia spinosispora]
Length=501

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 146/207 (71%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A++G+ VQWLRD+L +I SA EIEQLA+ VE  GG YFVPAF+GLFAP WR D
Sbjct  302  YALEGSIAVSGSLVQWLRDNLGIIGSAPEIEQLAASVEDNGGAYFVPAFSGLFAPHWRSD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+VL++M+ D+G             L+VDGG
Sbjct  362  ARGAIVGLTRFVNKGHLARAVLEATAFQSREVLEAMNADSGVP--------LTELKVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W   D+I ++     KD 
Sbjct  414  MIVNELLMQFQADILGVPVIRPVVAETTALGAAYAAGLAVGFWENTDDIRTN---WAKDK  470

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             ++P + E+ R +    W KAV+RTFD
Sbjct  471  QWEPTMAEDERARLYGQWQKAVTRTFD  497



>ref|WP_028852037.1| glycerol kinase [Thermocrispum municipale]
Length=504

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 155/207 (75%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            +ALEG+ A+ G+ VQWLRD+L +I+SA+EIE+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  FALEGAIAVTGSLVQWLRDNLKMITSAAEIEEHARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLARAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN+LLMQ QAD+LG PV+RP   ETTALGA+YAAGLAVG W +ED+I S+     +D 
Sbjct  415  MVVNDLLMQFQADILGVPVIRPKVNETTALGASYAAGLAVGFWESEDDIRSN---WAEDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             ++P ++E  R+++  +W KAV++TFD
Sbjct  472  RWEPNMDEARREREYKNWKKAVTKTFD  498



>ref|WP_026378244.1| glycerol kinase [Agromyces italicus]
Length=497

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 152/212 (72%), Gaps = 14/212 (7%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ +QWLRD+L L SS+ E+E+LA  VE  GG YFVPAF+GLFAP+WR 
Sbjct  294  HYALEGSIAVTGSLIQWLRDNLGLFSSSPEVEELAKSVEDNGGAYFVPAFSGLFAPYWRP  353

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TR+ NK HIARA LE+  FQ R+VLD+++ D+G D  E         L+VD
Sbjct  354  DARGALVGLTRYVNKGHIARAALEATAFQTREVLDAVNADSGVDLTE---------LKVD  404

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKK  215
            GG   NN LMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W+  DE+ ++    ++
Sbjct  405  GGMIANNTLMQFQADILGVPVVRPVVAETTALGAAYAAGLAVGFWSSLDELRAN---WQE  461

Query  214  DTIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            D+ ++P ++ + R +++  W KAVS+TFD  D
Sbjct  462  DSRWEPKMDADERDRQLRLWKKAVSKTFDWVD  493



>ref|WP_030478525.1| glycerol kinase [Lentzea albidocapillata]
Length=502

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 147/207 (71%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I SA+EIE+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGMIGSAAEIEEHARSVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+VLD+M+ D+G             L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLARAVLEATAFQTREVLDAMNADSGVD--------LTALKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              +N LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +EDEI    E   +D 
Sbjct  415  MVMNELLMQFQADILGVPVIRPVVAETTALGAAYAAGLAVGFWKSEDEIR---ENWAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             ++P +++  R  +  +W KAV++TF+
Sbjct  472  QWEPQMDDSRRASEYANWKKAVTKTFN  498



>ref|WP_018267275.1| glycerol kinase [Methylosinus sp. LW4]
Length=493

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 147/209 (70%), Gaps = 10/209 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AIAGA VQWLRD+L +I  +++IE LA+ V   G VYF PAF+GL+AP+WR+ 
Sbjct  295  YALEGSVAIAGALVQWLRDNLGIIEKSADIEALAASVPDNGDVYFTPAFSGLYAPYWRES  354

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG+  G+TRF+ K HIARA LE++ FQ RDV+ +M +D+G   E         LRVDGG
Sbjct  355  ARGIIAGLTRFSTKAHIARAALEAVAFQTRDVVAAMAEDSGVALE--------ELRVDGG  406

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
              VN LLMQ QAD+LG+PVVRP  IETTALGAAY AGLAVG W +    ++  + +K   
Sbjct  407  MAVNALLMQFQADILGAPVVRPRCIETTALGAAYTAGLAVGFWKDKREIATHWRAEKR--  464

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            + P++  E R++++  W KAV+R+FD  D
Sbjct  465  WSPMMSTEERERRIAKWAKAVTRSFDWTD  493



>ref|WP_009152547.1| glycerol kinase [Saccharomonospora marina]
 gb|EHR49161.1| glycerol kinase [Saccharomonospora marina XMU15]
Length=504

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 154/207 (74%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            +ALEG+ A+ G+ VQWLRD+LN+ISSA+EIE+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  FALEGAIAVTGSLVQWLRDNLNMISSAAEIEEHARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV  G+TR+ NK H+ARAVLE+  FQ R+V+D+M+ D+G   +         L+VDGG
Sbjct  363  ARGVIAGLTRYVNKGHLARAVLEATAFQTREVIDAMNADSGVPLK--------TLKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN+LLMQ QAD+LG  V+RP   ETTALG+AYAAGLAVG W +ED+I ++  + K+  
Sbjct  415  MVVNDLLMQFQADILGVSVIRPKVSETTALGSAYAAGLAVGFWESEDDIRTNWAEDKR--  472

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             ++P ++E  R+++  +W KAV++TFD
Sbjct  473  -WEPSMDEARREREYRNWKKAVTKTFD  498



>ref|WP_038991109.1| glycerol kinase [Arthrobacter sp. W1]
Length=506

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 148/209 (71%), Gaps = 10/209 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+AG+ +QWLRD++ +I++A E+EQLA++VE  GGVY VPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVAGSLIQWLRDNIGMIATAPEVEQLAAQVEDNGGVYIVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TR+ NK HIARA LES  FQ R+VLD+++ DA    EV        L+VDGG
Sbjct  363  ARGAIVGLTRYANKNHIARAALESTAFQTREVLDAVNADA----EVPLTE----LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               N  LMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W   ++    +   +D  
Sbjct  415  MVANEALMQFQADILGVPVVRPQVTETTALGAAYAAGLAVGFW--KDLGELEQNWAEDKR  472

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            ++P ++E  R++ +  W KAV+RTFD  D
Sbjct  473  WEPTMDEASRERSLRLWKKAVTRTFDWVD  501



>ref|WP_005167726.1| Glycerol kinase [Amycolatopsis azurea]
 gb|EMD22120.1| Glycerol kinase [Amycolatopsis azurea DSM 43854]
Length=513

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 151/207 (73%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LI SA+E+EQ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  312  YALEGSIAVTGSLVQWLRDNLGLIGSAAEVEQHARTVEDNGGAYFVPAFSGLFAPYWRSD  371

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HI+RAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  372  ARGAIVGLTRFVNKGHISRAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  423

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  424  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWKSEDDIRNN---WAQDK  480

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R+ +  +W KAV++TFD
Sbjct  481  QWDPSMDEARRESEYRNWKKAVTKTFD  507



>ref|WP_044276192.1| glycerol kinase [Caldilinea aerophila]
Length=504

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 146/207 (71%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AIAGA VQWLRD+L LI SA E+E LA  VE+ GG+YFVPAF+GL+AP+WR D
Sbjct  305  YALEGSIAIAGALVQWLRDNLRLIDSAPEVENLARTVENNGGIYFVPAFSGLYAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TRF ++ H ARA LE+  FQ R+VLD+MH+D+G   +         L+VDGG
Sbjct  365  ARGVIVGLTRFIHRGHFARAALEATAFQTREVLDAMHQDSGVALQ--------ALKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
               N LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W   DE+ ++      D 
Sbjct  417  MVRNELLMQFQADVLGVPVIRPRVSETTALGAAYAAGLAVGFWKNIDEMRAN---WGVDK  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
            I++P  ++  R K    W KAV+RTFD
Sbjct  474  IWQPSEDDAPRTKLYAQWKKAVTRTFD  500



>ref|WP_027942070.1| glycerol kinase [Amycolatopsis taiwanensis]
Length=500

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 148/206 (72%), Gaps = 10/206 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +IS+A+EIE+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  302  YALEGSIAVTGSLVQWLRDNLGMISTAAEIEEHARTVEDNGGAYFVPAFSGLFAPYWRSD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TR+ NK H+ARAVLE+  FQ R+V+++M+ D+G    +K+      L+VDGG
Sbjct  362  ARGAIVGLTRYVNKGHLARAVLEATAFQTREVIEAMNADSGVP--LKS------LKVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W  +E   +     +D  
Sbjct  414  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWASEEDIRT--NWAQDKE  471

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFD  128
            + P + EE R+ +  +W KAV++TFD
Sbjct  472  WTPNMAEETRETQYRNWKKAVTKTFD  497



>ref|WP_014692584.1| glycerol kinase [Actinoplanes sp. SE50/110]
 gb|AEV86513.1| glycerol kinase [Actinoplanes sp. SE50/110]
Length=505

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 146/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L+LI+SA + E LA++V  +GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLHLITSADQSEALAAQVPDSGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++RF    HIARA LES+C+Q RDV+D+M +D+G    V  D    VL+VDGG
Sbjct  365  ARGAIVGLSRFNTDAHIARATLESICYQTRDVVDAMAQDSG----VTLD----VLKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             T NNL MQIQAD+LG PV RP   ETTALGAAYAAGLAVG W + DE+    E   +  
Sbjct  417  ITANNLCMQIQADVLGVPVSRPVVAETTALGAAYAAGLAVGFWKSTDELR---ENWNESQ  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P    E R +    W KAV RT D  D
Sbjct  474  RWQPTWSAERRDQGHGRWKKAVQRTLDWVD  503



>ref|WP_013561135.1| glycerol kinase [Anaerolinea thermophila]
 dbj|BAJ64787.1| glycerol kinase [Anaerolinea thermophila UNI-1]
Length=495

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 145/206 (70%), Gaps = 12/206 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AI GA VQWLRD+L +I ++ +IE LA  VE  GG+YFVPAF+GLFAP+WR D
Sbjct  296  YALEGSIAITGALVQWLRDNLKMIENSRDIEGLARTVEDNGGIYFVPAFSGLFAPYWRSD  355

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG+ +G+TR+ N+ HIARA LE+  +Q R+VLD+M++D+G             L+VDGG
Sbjct  356  ARGIIVGLTRYINRGHIARAALEATAYQTREVLDAMNRDSGIT--------LTALKVDGG  407

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
               N LLMQ QAD+LG PV+RP   ETT+LGAAYAAGLAVG W T DE+ ++     KDT
Sbjct  408  MVYNQLLMQFQADILGVPVIRPKVAETTSLGAAYAAGLAVGFWETFDELRAN---WGKDT  464

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTF  131
             + P +  E+R+K    W KAV RTF
Sbjct  465  EWHPQMSPELREKLYAGWKKAVERTF  490



>ref|WP_013772655.1| glycerol kinase [Cellulomonas fimi]
 gb|AEE47632.1| glycerol kinase [Cellulomonas fimi ATCC 484]
Length=507

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 147/211 (70%), Gaps = 14/211 (7%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +ISSA EIEQLA  VE  GG YFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSLVQWLRDNLGIISSAPEIEQLAETVEDNGGAYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVDG  389
            ARG  +G+TR+ NK HIARA LE+  FQ R+VLD+M+ D+G D  E         L+VDG
Sbjct  365  ARGALVGLTRYVNKGHIARAALEATAFQTREVLDAMNADSGVDLTE---------LKVDG  415

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWT-EDEIFSSGEKMKKD  212
            G   N+ LMQ QAD+LG PV+RP   ETTALGAAYAAG+AVG W+ E ++    +   +D
Sbjct  416  GMVANDALMQFQADILGVPVIRPKVAETTALGAAYAAGIAVGFWSGEQDVI---DNWAED  472

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
              ++P  +E  R ++   W KAV++TFD  D
Sbjct  473  KRWEPGADEGERDRQYRLWKKAVTKTFDWVD  503



>ref|XP_785650.3| PREDICTED: glycerol kinase-like, partial [Strongylocentrotus 
purpuratus]
Length=530

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 148/206 (72%), Gaps = 13/206 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ GAAV+WLRD+L +I +A+E+E LA +V++ GGVYFVPAF+GL+AP+W  D
Sbjct  291  YALEGSVAVTGAAVRWLRDNLGIIKTAAEVETLAKEVDNNGGVYFVPAFSGLYAPYWEAD  350

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG   G+T+F+ K HIARAVLE++C+Q R++LD+M +D+G   E         LRVDGG
Sbjct  351  ARGTICGLTQFSTKAHIARAVLEAVCYQTRELLDAMDQDSGIPLE--------KLRVDGG  402

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
             T NNLLMQ+QAD L  PVVRP+  ETTALG A AAG AVG+W + E  S+G     DT 
Sbjct  403  MTQNNLLMQLQADTLNIPVVRPSMPETTALGVAMAAGHAVGVW-KIEDASAG---NTDT-  457

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFD  128
            F PVIEE+VR+     W  AV ++ +
Sbjct  458  FTPVIEEDVRESHYAKWKLAVQKSMN  483



>ref|WP_026533037.1| glycerol kinase [Arthrobacter sp. H41]
Length=504

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 146/209 (70%), Gaps = 10/209 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I +A E+EQLA+ VE  GGVY VPAF+GLFAP+WR D
Sbjct  302  YALEGSIAVTGSLVQWLRDNLGIIKTAPEVEQLATTVEDNGGVYIVPAFSGLFAPYWRSD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HIARA LE+  FQ R+VLD+ + D+G   E         LRVDGG
Sbjct  362  ARGAIVGLTRFVNKGHIARAALEATAFQTREVLDAANADSGVDME--------DLRVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               N+ LMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W + +  ++     +D  
Sbjct  414  MVANDALMQFQADILGIPVIRPKVTETTALGAAYAAGLAVGFWKDTDELAT--NWAEDKR  471

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            + P ++E  R++++  W KAV++TFD  D
Sbjct  472  WNPSMDEAERERQLRLWKKAVTKTFDWVD  500



>ref|WP_043445494.1| glycerol kinase [Arthrobacter sp. L77]
Length=505

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 145/209 (69%), Gaps = 10/209 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ +QWLRD+L +I SA E+EQLA+ VE  GGVY VPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLIQWLRDNLGIIKSAPEVEQLATTVEDNGGVYIVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HIARA LE+  FQ R+VLD+ + D+G   E         LRVDGG
Sbjct  363  ARGAIVGLTRFVNKGHIARAALEATAFQTREVLDAANADSGVNME--------DLRVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               N+ LMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W + +  ++     +D  
Sbjct  415  MVANDALMQFQADILGIPVIRPKVTETTALGAAYAAGLAVGFWKDTDELAT--NWAEDKR  472

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            + P +++  R +++  W KAV++TFD  D
Sbjct  473  WNPAMDDAERDRQLRMWKKAVTKTFDWVD  501



>ref|WP_043496580.1| glycerol kinase [Georgenia sp. SUBG003]
 gb|KEP24672.1| glycerol kinase [Georgenia sp. SUBG003]
Length=506

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 146/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +ISSA EIEQLA  VE  GG YFVPAF+GLFAP+W+ D
Sbjct  304  YALEGSIAVTGSLVQWLRDNLGIISSAPEIEQLADTVEDNGGAYFVPAFSGLFAPYWKSD  363

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TR+ NK HIARAVLE+  FQ R+V D+M  D+G   E+        L+VDGG
Sbjct  364  ARGALVGLTRYVNKGHIARAVLEATAFQTREVNDAMKIDSGV--ELTE------LKVDGG  415

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWT-EDEIFSSGEKMKKDT  209
               N  LMQ QAD+LG PVVRP   ETTALGAAYAAG+AVG W  E ++    +   +D 
Sbjct  416  MVANETLMQFQADILGVPVVRPKVAETTALGAAYAAGIAVGYWQGEQDVI---DNWAEDK  472

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P ++EE R++    W KAV+RTFD  D
Sbjct  473  RWEPSMDEEERERTYRLWKKAVTRTFDWVD  502



>ref|WP_026818401.1| glycerol kinase [Arthrobacter castelli]
Length=506

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 147/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I SA EIEQLA  VE  GGVY VPAF+GLFAP+WR D
Sbjct  302  YALEGSIAVTGSLVQWLRDNLGMIKSAPEIEQLADSVEDNGGVYIVPAFSGLFAPYWRGD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HI RA LE+  FQ R+VLD+ + DAG   E         +RVDGG
Sbjct  362  ARGAMVGLTRFVNKGHIGRAALEATAFQSREVLDAANADAGVDME--------DMRVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
               N+ LMQ QAD+LG PV+RP  IETTALGAAYAAGLAVG W + DE+ ++  + K+  
Sbjct  414  MVANDALMQFQADILGIPVIRPEIIETTALGAAYAAGLAVGFWESTDEVAANWSEGKR--  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P ++   R +++  W KAV+RTFD  D
Sbjct  472  -WEPRMDAAERDRQLRLWKKAVTRTFDWVD  500



>ref|WP_017830735.1| glycerol kinase [Microbacterium sp. UCD-TDU]
 gb|EYT59355.1| glycerol kinase [Microbacterium sp. UCD-TDU]
Length=504

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 149/211 (71%), Gaps = 12/211 (6%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ +QWLRD L +ISSA E+E+LA KVE  GGVY VPAF+GLFAP+WR 
Sbjct  301  HYALEGSIAVTGSLIQWLRDQLGIISSAPEVEELAEKVEDNGGVYIVPAFSGLFAPYWRP  360

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TR+ NK HIARA LE++ FQ RDVLD+++ DAG D  E         L+VD
Sbjct  361  DARGAIVGLTRYANKNHIARAALEAVAFQTRDVLDAVNADAGVDLTE---------LKVD  411

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKD  212
            GG   N+ LMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W   +  S+    ++D
Sbjct  412  GGMVANDALMQFQADVLGVPVVRPVVAETTALGAAYAAGLAVGFWNGLDDLSA--NWQED  469

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
              ++P +EE  R +++  W KA++++ D  D
Sbjct  470  KRWEPSMEEAERDRQLRLWRKAITKSMDWVD  500



>ref|WP_029263516.1| MULTISPECIES: glycerol kinase [Microbacterium]
Length=504

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 150/211 (71%), Gaps = 12/211 (6%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ +QWLRD L +ISSA E+E+LA +VE  GGVY VPAF+GLFAP+WR 
Sbjct  301  HYALEGSIAVTGSLIQWLRDQLGIISSAPEVEKLAEQVEDNGGVYIVPAFSGLFAPYWRS  360

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARGV +G+TR+ NK HIARA LE++ FQ RDVLD+++ DAG D  E         L+VD
Sbjct  361  DARGVIVGLTRYANKNHIARAALEAVAFQTRDVLDAVNADAGVDLTE---------LKVD  411

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKD  212
            GG   N+ LMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W   +  S+    ++D
Sbjct  412  GGMVANDALMQFQADVLGVPVVRPVVAETTALGAAYAAGLAVGFWNGLDDLSA--NWQED  469

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
              ++P +E+  R +++  W KAV+++ D  D
Sbjct  470  KRWQPSMEDAERDRQLRLWRKAVTKSMDWVD  500



>ref|WP_030533893.1| glycerol kinase [Prauserella rugosa]
Length=501

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 145/206 (70%), Gaps = 10/206 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I SA+E+E  A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGMIGSAAEVEGYARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+V+D+M+ D+G             L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLARAVLEATAFQTREVIDAMNADSGVPLR--------TLKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
              VN+LLMQ QAD+LG  V+RP   ETTALGAAYAAGLAVG W  +E   S     KD  
Sbjct  415  MVVNDLLMQFQADILGVDVIRPKVNETTALGAAYAAGLAVGFWESEEDIRS--NWAKDKE  472

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFD  128
            ++P ++E  R+++  +W KAV++TFD
Sbjct  473  WQPAMDEARREREYHNWKKAVTKTFD  498



>ref|XP_004367171.1| Glycerol kinase 2 [Dictyostelium fasciculatum]
 gb|EGG20188.1| Glycerol kinase 2 [Dictyostelium fasciculatum]
Length=623

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 139/206 (67%), Gaps = 14/206 (7%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+AGA V+WL D+L + SSA E+E+LA KVE+  GVY VPAF+GLFAP+WRDD
Sbjct  426  YALEGSVAVAGAGVKWLVDNLGIASSADEVEELAGKVENNAGVYIVPAFSGLFAPYWRDD  485

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+T  TN+CHIARA+LES CFQ  +VL SM KDA  K           LRVDGG
Sbjct  486  ARGVIVGMTHQTNRCHIARAMLESTCFQTHEVLSSMEKDANTKLT--------ELRVDGG  537

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
             T N LLMQ+Q+++LG PVV+P + ETT  GAA+AAGL VG+W +   F      K    
Sbjct  538  MTKNELLMQMQSNILGLPVVKPYNSETTCFGAAFAAGLTVGVWKQSMEF------KVSQT  591

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFD  128
            F P    E    ++  W KAVS++ +
Sbjct  592  FTPFTTPESNAIRIKEWHKAVSKSIN  617



>ref|WP_029259104.1| glycerol kinase [Microbacterium sp. Cr-K29]
Length=504

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 149/211 (71%), Gaps = 12/211 (6%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ +QWLRD L +ISSA E+E+LA KVE  GGVY VPAF+GLFAP+WR 
Sbjct  301  HYALEGSIAVTGSLIQWLRDQLGIISSAPEVEELADKVEDNGGVYIVPAFSGLFAPYWRP  360

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TR+ NK HIARA LE++ FQ RDVLD+++ DAG D  E         L+VD
Sbjct  361  DARGAIVGLTRYANKNHIARAALEAVAFQTRDVLDAVNADAGVDLTE---------LKVD  411

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKD  212
            GG   N+ LMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W   +  S+    ++D
Sbjct  412  GGMVANDALMQFQADVLGVPVVRPVVAETTALGAAYAAGLAVGFWNGLDDLSA--NWQED  469

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
              ++P +EE  R +++  W KA++++ D  D
Sbjct  470  KRWEPSMEEAERDRQLRLWRKAITKSMDWVD  500



>ref|WP_034224024.1| glycerol kinase [Actinotalea ferrariae]
 gb|EYR64209.1| glycerol kinase [Actinotalea ferrariae CF5-4]
Length=505

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 146/211 (69%), Gaps = 14/211 (7%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEG+ A+ G+ VQWLRD+L LI  A EIE+LA+ VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGAIAVTGSLVQWLRDNLGLIKDAPEIEKLAATVEDNGGAYFVPAFSGLFAPYWRGD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVDG  389
            ARGV  G+TR+ NK HIARA LE+  FQ R+VLD+M+ D+G D  E         L+VDG
Sbjct  363  ARGVLAGLTRYVNKGHIARAALEATAFQTREVLDAMNADSGVDLTE---------LKVDG  413

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWT-EDEIFSSGEKMKKD  212
            G   N LLMQ QAD+LG PVVRP   ETTALGAAYAAG+AVG W  E ++    +   +D
Sbjct  414  GMVQNELLMQFQADILGVPVVRPKVAETTALGAAYAAGIAVGFWQGEQDVI---DNWAED  470

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
              + P ++EE R +   +W KAV++TFD  D
Sbjct  471  KRWTPDMDEEHRARTYRNWKKAVTKTFDWVD  501



>ref|WP_021200455.1| MULTISPECIES: glycerol kinase [Microbacterium]
 gb|EQM74357.1| glycerol kinase [Microbacterium maritypicum MF109]
Length=504

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 149/211 (71%), Gaps = 12/211 (6%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ +QWLRD L +ISSA E+E+LA KVE  GGVY VPAF+GLFAP+WR 
Sbjct  301  HYALEGSIAVTGSLIQWLRDQLGIISSAPEVEELADKVEDNGGVYIVPAFSGLFAPYWRP  360

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TR+ NK HIARA LE++ FQ RDVLD+++ DAG D  E         L+VD
Sbjct  361  DARGAIVGLTRYANKNHIARAALEAVAFQTRDVLDAVNADAGVDLTE---------LKVD  411

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKD  212
            GG   N+ LMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W   +  S+    ++D
Sbjct  412  GGMVANDALMQFQADVLGVPVVRPVVAETTALGAAYAAGLAVGFWNGLDDLSA--NWQED  469

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
              ++P +EE  R +++  W KA++++ D  D
Sbjct  470  KRWEPSMEEAERDRQLRLWRKAITKSMDWVD  500



>ref|WP_028473143.1| glycerol kinase [Nocardioides alkalitolerans]
Length=509

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 140/209 (67%), Gaps = 10/209 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS AS+ E LA +VE  GGVYFVPAF+GLFAP+WR D
Sbjct  309  YALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVEDNGGVYFVPAFSGLFAPYWRSD  368

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++RF    H+ARA LE++C+Q RDV D+M KD+G K E        VL+VDGG
Sbjct  369  ARGAIVGLSRFNTNAHLARATLEAICYQSRDVADAMEKDSGVKLE--------VLKVDGG  420

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
             T N L MQIQAD+LG PV RP   ETTALGAAYAAGLAVG W + E   +     K   
Sbjct  421  VTANELCMQIQADVLGVPVSRPVVAETTALGAAYAAGLAVGFWKDTEELRANWNESKR--  478

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            ++P  +EE R      W KAV RT    D
Sbjct  479  WEPTWDEERRDTGHGQWKKAVERTLGWVD  507



>ref|WP_026875140.1| glycerol kinase [Jiangella gansuensis]
Length=502

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 147/207 (71%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I SA EIE LAS VE  GG YFVPAF+GLFAP+WR D
Sbjct  302  YALEGSIAVTGSLVQWLRDNLGIIGSAPEIESLASGVEDNGGAYFVPAFSGLFAPYWRSD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF N+ HIARAVLE+  FQ R+V+D+M+ D+G             L+VDGG
Sbjct  362  ARGAIVGLTRFVNRGHIARAVLEATAFQSREVIDAMNADSGVD--------LTSLKVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
               N LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  414  MVANELLMQFQADILGVPVIRPVVAETTALGAAYAAGLAVGFWESEDDIRTN---WAQDK  470

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P +++  R+K   +W KAV++TFD
Sbjct  471  QWDPSMDDAHREKIYKTWKKAVTKTFD  497



>ref|WP_010315712.1| glycerol kinase [Saccharopolyspora spinosa]
Length=500

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 146/206 (71%), Gaps = 10/206 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            Y LEGS A+ G+ VQWLRD+L +I++A EIEQLA  V+  GG YFVPAF+GLFAP WR D
Sbjct  302  YCLEGSIAVTGSLVQWLRDNLGIIATAPEIEQLARSVDDNGGAYFVPAFSGLFAPHWRSD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TR+ N+ H+ARAVLE+  FQ R+V+++M+ D+G    +K+      L+VDGG
Sbjct  362  ARGAIVGLTRYVNRGHLARAVLEATAFQTREVIEAMNADSGVP--LKS------LKVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W  +E   S     KD  
Sbjct  414  MVVNELLMQFQADILGVPVIRPVVAETTALGAAYAAGLAVGFWASEEDIRS--NWAKDKQ  471

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFD  128
            + P +  E+R+K+   W KAV++TFD
Sbjct  472  WDPQMPTELREKQYHQWQKAVTKTFD  497



>ref|WP_020668184.1| glycerol kinase [Amycolatopsis nigrescens]
Length=502

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 150/207 (72%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LI SA+EIE+ A  V   GG YFVPAF+GLFAP+WR D
Sbjct  302  YALEGSIAVTGSLVQWLRDNLGLIGSAAEIEEHARGVSDNGGTYFVPAFSGLFAPYWRSD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HI+RAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  362  ARGAIVGLTRFVNKGHISRAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     KD 
Sbjct  414  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWASEDDIRNN---WAKDK  470

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R+ +  +W KAV++TFD
Sbjct  471  QWDPSMDESRRESEYRAWKKAVTKTFD  497



>ref|WP_026549280.1| glycerol kinase [Arthrobacter sp. Br18]
Length=504

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 145/209 (69%), Gaps = 10/209 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I SA E+EQLA+ V+  GGVY VPAF+GLFAP+WR D
Sbjct  302  YALEGSIAVTGSLVQWLRDNLGIIKSAPEVEQLATTVDDNGGVYIVPAFSGLFAPYWRSD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HIARA LE+  FQ R+VLD+ + D+G   E         LRVDGG
Sbjct  362  ARGAIVGLTRFVNKGHIARAALEATAFQTREVLDAANADSGVNME--------DLRVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               N+ LMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W + +  ++     +D  
Sbjct  414  MVANDALMQFQADILGIPVIRPKVTETTALGAAYAAGLAVGFWKDTDELAT--NWAEDKR  471

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            + P ++E  R +++  W KAV++TFD  D
Sbjct  472  WNPSMDEAERDRQLRLWKKAVTKTFDWVD  500



>ref|WP_024877819.1| glycerol kinase [Saccharomonospora sp. CNQ490]
Length=504

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 152/207 (73%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEG+ A+ G+ VQWLRD+LN+I+SA+EIE  A  V+  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGAIAVTGSLVQWLRDNLNMITSAAEIEDYARTVDDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TR+ NK H+ARAVLE+  FQ R+V+D+M+ D+G   +         L+VDGG
Sbjct  363  ARGAIVGLTRYVNKGHLARAVLEATAFQSREVIDAMNADSGVPLK--------TLKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWT-EDEIFSSGEKMKKDT  209
              VN+LLMQ QAD+LG  V+RP   ETTALGAAYAAGLAVG W  ED+I S+  + K+  
Sbjct  415  MVVNDLLMQFQADILGVSVIRPKVNETTALGAAYAAGLAVGFWEGEDDIRSNWAEDKR--  472

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             ++P ++E  R+++  +W KAV+RTFD
Sbjct  473  -WEPSMDESRREREYRNWKKAVTRTFD  498



>ref|WP_018832895.1| glycerol kinase, partial [Salinispora tropica]
Length=336

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 146/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +I++A + E LA +V+  GGVYFVPAF+GLFAP+WR D
Sbjct  136  YALEGSIAVTGSAVQWLRDQLKIINTAGQSEMLARQVDDNGGVYFVPAFSGLFAPYWRSD  195

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++RF    HIARA LES+C+Q RDV ++M  D+G   E         L+VDGG
Sbjct  196  ARGVIVGLSRFNTDAHIARATLESICYQSRDVAEAMATDSGVPLE--------CLKVDGG  247

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             TVN+L MQ+QAD+LG PV RP   ETTALGAAYAAGLAVG W + DE+  +  + ++  
Sbjct  248  VTVNDLCMQLQADILGVPVSRPVVAETTALGAAYAAGLAVGFWRSTDELRENWNESRR--  305

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P    E R+ + + W +AV RT D  D
Sbjct  306  -WQPTWPSEQREAEYERWKRAVQRTLDWVD  334



>ref|WP_040826898.1| glycerol kinase [Nocardia jiangxiensis]
Length=506

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 149/210 (71%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS A++ E LA++V+  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGAAQSESLAAQVQDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++R++   H+ARA LES+C+Q RDV+ +M  D+G    V+ D    VLRVDGG
Sbjct  365  ARGVIVGLSRYSTNAHLARATLESICYQTRDVVAAMQADSG----VELD----VLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             T N L MQIQAD LG PV RP   ETTALGAAYAAGLAVG W + DE+    +  ++D 
Sbjct  417  VTANELCMQIQADFLGVPVSRPVVAETTALGAAYAAGLAVGFWRSTDEL---EQNWQEDK  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P + E+ R++    W KAV RT +  D
Sbjct  474  RWEPALGEQERERGYARWKKAVERTLNWID  503



>ref|WP_025619269.1| glycerol kinase [Salinispora pacifica]
Length=505

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 147/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +I+SA++ E LA +VE +GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLKIINSAAQSEALARQVEDSGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++RF    HIARA LES+C+Q RDV ++M KD+G    V   R    L+VDGG
Sbjct  365  ARGVIVGLSRFNTDAHIARATLESICYQSRDVAEAMAKDSG----VALGR----LKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             T N+L MQ+QAD+LG PV RP   ETTALGAAYAAGLAVG W + DE+    E   +  
Sbjct  417  VTENDLCMQLQADILGVPVSRPTVAETTALGAAYAAGLAVGFWRSTDELR---ENWNESR  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P    E R+   D W +AV RTFD  D
Sbjct  474  CWQPTWPSEQREVGYDRWKRAVQRTFDWVD  503



>ref|WP_030858775.1| glycerol kinase [Streptomyces sp. NRRL S-37]
Length=507

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 147/207 (71%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ GAAVQWLRD L +I SAS+ EQLA  VE  GG+YFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGAAVQWLRDQLKIIGSASDSEQLARSVEDNGGMYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+ R+    HIARA LE++C+Q RDV+++M +D+G    V+ D    VL+VDGG
Sbjct  365  ARGAMVGLARYNTGGHIARATLEAICYQSRDVVEAMEQDSG----VRMD----VLKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N+L MQIQAD+LG PV RP   ETTALGAAYAAGLAVG W + DE+ +  ++ K+  
Sbjct  417  VTANDLCMQIQADVLGVPVSRPVVAETTALGAAYAAGLAVGFWRDTDELRTHWQESKR--  474

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P   EE R++    W +AV RT D
Sbjct  475  -WTPQWSEERRQEGYQDWKRAVERTLD  500



>ref|WP_044854511.1| glycerol kinase [Amycolatopsis orientalis]
Length=504

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 151/207 (73%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LI SA+E+E+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGLIGSAAEVEEHARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TR+ NK HIARAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRYVNKGHIARAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWKSEDDIRNN---WAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R+ +  +W KAV++TFD
Sbjct  472  QWDPSMDEARREAEYRNWKKAVTKTFD  498



>ref|WP_028278664.1| glycerol kinase [Arthrobacter sp. H5]
Length=504

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 145/209 (69%), Gaps = 10/209 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ +QWLRD+L +I SA E+EQLA+ VE  GGVY VPAF+GLFAP+WR D
Sbjct  302  YALEGSIAVTGSLIQWLRDNLGIIKSAPEVEQLATTVEDNGGVYIVPAFSGLFAPYWRSD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HIARA LE+  FQ R+VLD+ + D+G   E         LRVDGG
Sbjct  362  ARGAIVGLTRFVNKGHIARAALEATAFQTREVLDAANADSGVDME--------DLRVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               N+ LMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +    ++     +D  
Sbjct  414  MVANDALMQFQADILGIPVIRPKVTETTALGAAYAAGLAVGFWKDTAELAT--NWAEDKR  471

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            + P +++  R +++ +W KAV++TFD  D
Sbjct  472  WTPTMDDAERDRQLRNWKKAVTKTFDWVD  500



>emb|CEA08195.1| Glycerol kinase [Arthrobacter sp. 11W110_air]
Length=508

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 147/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I+SA EIEQLA KVE  GGVY VPAF+GLFAP+WR D
Sbjct  306  YALEGSIAVTGSLVQWLRDNLGMINSAPEIEQLAEKVEDNGGVYIVPAFSGLFAPYWRSD  365

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF N+ HIARA LE+  FQ R+VLD+++ D+G             LRVDGG
Sbjct  366  ARGAIVGLTRFVNRNHIARAALEATAFQTREVLDAVNADSGVP--------LTELRVDGG  417

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
               N+ LMQ QAD+LG  VVRP  IETT+LGAAYAAGLAVG W + DE+   G    +D 
Sbjct  418  MVANDALMQFQADILGVDVVRPEVIETTSLGAAYAAGLAVGYWNDTDEL---GRNWNEDK  474

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P +++  + +++  W KAV++TFD  D
Sbjct  475  RWTPQMDQAEQDRQMRQWKKAVTKTFDWVD  504



>ref|WP_043786485.1| glycerol kinase [Amycolatopsis rifamycinica]
 gb|KDN18356.1| glycerol kinase [Amycolatopsis rifamycinica]
Length=504

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 153/207 (74%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I++A+EIE+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGMITTAAEIEEHARSVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLARAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWASEDDIRTN---WAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P +++  R+++  +W KAV++TFD
Sbjct  472  QWDPSMDDARREREYRNWKKAVTKTFD  498



>ref|WP_005443559.1| glycerol kinase [Saccharomonospora azurea]
 gb|EHY90267.1| glycerol kinase [Saccharomonospora azurea NA-128]
Length=504

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 150/207 (72%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I SA+EIEQ A  V+  GG Y VPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLKMIGSAAEIEQHARTVDDNGGAYIVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TRF NK H+ARAVLE+  FQ R+V+++M+ D+G   +         L+VDGG
Sbjct  363  ARGVLVGLTRFVNKGHLARAVLEATAFQSREVIEAMNADSGVPLK--------TLKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN+LLMQ QAD+LG  V+RP   ETTALGAAYAAGLAVG W +ED+I    E   +D 
Sbjct  415  MVVNDLLMQFQADILGVSVIRPKVNETTALGAAYAAGLAVGFWESEDDIR---ENWAEDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             ++P ++EE R+ +  +W KAV+RTFD
Sbjct  472  RWEPNMDEERREHEFRNWKKAVTRTFD  498



>ref|WP_040813279.1| glycerol kinase [Nocardia concava]
Length=512

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 143/205 (70%), Gaps = 12/205 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS A  +E LA +V   GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGAERVEALARQVHDNGGVYFVPAFSGLFAPYWRAD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++R++N  HIARA LES+ +Q RDV+++M +D+G    VK D     LRVDGG
Sbjct  365  ARGAIVGLSRYSNNAHIARATLESIAYQTRDVVEAMQQDSG----VKLD----TLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             T N L MQIQ+D LG PV RP   ETTALGAAYAAGLAVG W   DE+ ++     +D 
Sbjct  417  VTANELAMQIQSDFLGVPVSRPVVSETTALGAAYAAGLAVGFWRNTDELVAN---WHEDK  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRT  134
             ++P   EE R+K    W KAVSRT
Sbjct  474  NWQPTWTEEQRQKGYARWLKAVSRT  498



>ref|WP_024804016.1| glycerol kinase [Nocardia sp. BMG51109]
Length=506

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 149/210 (71%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+A+QWLRD L +IS A++ E LA +V+  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAIQWLRDQLGIISGAAQSESLARQVDDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++R++N  H+ARA LE++C+Q RDV+++M  D+G    V  D    VLRVDGG
Sbjct  365  ARGVIVGLSRYSNNAHLARAALEAICYQTRDVVEAMEADSG----VTLD----VLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N L MQ+Q+D LG PV RP   ETTALGAAYAAGLAVG W + DE+  + ++ K+  
Sbjct  417  VTANELCMQLQSDFLGVPVSRPVVAETTALGAAYAAGLAVGFWKDVDELQENWQESKR--  474

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P   EE R++    W +AV+RT D  D
Sbjct  475  -WTPTWSEEQRERGYARWKRAVARTLDWVD  503



>ref|WP_005447261.1| glycerol kinase [Saccharomonospora azurea]
 gb|EHK88292.1| glycerol kinase [Saccharomonospora azurea SZMC 14600]
Length=504

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 150/207 (72%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I SA+EIEQ A  V+  GG Y VPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLKMIGSAAEIEQHARTVDDNGGAYIVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TRF NK H+ARAVLE+  FQ R+V+++M+ D+G   +         L+VDGG
Sbjct  363  ARGVIVGLTRFVNKGHLARAVLEATAFQSREVIEAMNADSGVPLK--------TLKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN+LLMQ QAD+LG  V+RP   ETTALGAAYAAGLAVG W +ED+I    E   +D 
Sbjct  415  MVVNDLLMQFQADILGVSVIRPKVNETTALGAAYAAGLAVGFWESEDDIR---ENWAEDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             ++P ++EE R+ +  +W KAV+RTFD
Sbjct  472  RWEPNMDEERREHEFRNWKKAVTRTFD  498



>ref|WP_040775205.1| glycerol kinase [Nocardia pneumoniae]
Length=506

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 147/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS A++ E LA + E  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGAAQSESLARQAEDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++R++   H+ARA LES+C+Q RDV+++M  D+G    V+ D    VLRVDGG
Sbjct  365  ARGAIVGLSRYSTNAHLARATLESICYQTRDVVEAMQADSG----VQLD----VLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N L MQ+QAD LG PV RP   ETTALGAAYAAGLAVG W++ DE+  +  + K+  
Sbjct  417  VTANELCMQLQADFLGVPVSRPVVAETTALGAAYAAGLAVGFWSDTDELEQNWNEAKR--  474

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P   +E R++    W KAV+RT D  D
Sbjct  475  -WSPTWSQEQRERGYARWKKAVARTLDWID  503



>ref|WP_003082344.1| glycerol kinase [Amycolatopsis vancoresmycina]
 gb|EOD67392.1| glycerol kinase [Amycolatopsis vancoresmycina DSM 44592]
Length=504

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 150/207 (72%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I++A+EIE+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGMITTAAEIEEHARSVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+V+D+M+ D+G             L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLARAVLEATAFQSREVIDAMNADSG--------VALTSLKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWKSEDDIRTN---WAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P +++  R+++  +W KAV++TFD
Sbjct  472  QWDPSMDDARREREYRNWKKAVTKTFD  498



>ref|WP_015028738.1| glycerol kinase [Emticicia oligotrophica]
 gb|AFK03040.1| Glycerol kinase [Emticicia oligotrophica DSM 17448]
Length=498

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 146/208 (70%), Gaps = 12/208 (6%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS AIAGA VQWLRD+L +I  ++++E LA  VE  GG YFVPAF+GL+AP+W+ 
Sbjct  299  HYALEGSVAIAGALVQWLRDNLGIIEKSTDVEALAKTVEDNGGAYFVPAFSGLYAPYWKS  358

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
             ARGV  G+TR+ NK HIARAVLE+  +Q +DVL++M KD+G   EV +      LRVDG
Sbjct  359  SARGVIAGLTRYVNKGHIARAVLEATAYQTKDVLEAMEKDSGI--EVSS------LRVDG  410

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKD  212
            G  VN LLMQ Q+D+L  PV+RP  IETTALGAAYAAGLAVG W   D++    +   KD
Sbjct  411  GMVVNELLMQFQSDMLKVPVIRPKMIETTALGAAYAAGLAVGFWANLDDLL---QNWGKD  467

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFD  128
              +KP ++   RKK    W KA+ R+FD
Sbjct  468  KTWKPKMKAAERKKLYTGWKKAIKRSFD  495



>ref|WP_030435889.1| glycerol kinase [Actinoplanes subtropicus]
Length=505

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 147/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L++I+SA+E E LA+ V   GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLHVINSAAESESLAATVPDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++RF    HIARA LES+C+Q RDV+D+M +D+G    V  D    VL+VDGG
Sbjct  365  ARGAIVGLSRFNTGAHIARATLESICYQSRDVVDAMAQDSG----VHLD----VLKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             T NNL MQIQAD+LG PV RP   ETTALGAAYAAGLAVG W + DE+  +  + ++  
Sbjct  417  ITANNLCMQIQADVLGVPVSRPVVAETTALGAAYAAGLAVGFWKSTDELRDNWNESQR--  474

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P   +E R      W KAV RT D  D
Sbjct  475  -WQPTWTDEQRADGYARWKKAVQRTLDWVD  503



>ref|WP_033776276.1| glycerol kinase, partial [Salinispora pacifica]
Length=357

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 146/207 (71%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +I+SA++ E LA +V+  GGVYFVPAF+GLFAP+WR D
Sbjct  157  YALEGSIAVTGSAVQWLRDQLKIINSAAQSETLARQVDDNGGVYFVPAFSGLFAPYWRSD  216

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++RF    HIARA LES+C+Q RDV ++M KD+G    V   R    L+VDGG
Sbjct  217  ARGVIVGLSRFNTDAHIARATLESICYQSRDVAEAMAKDSG----VALGR----LKVDGG  268

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWT-EDEIFSSGEKMKKDT  209
             T N+L MQ+QAD+LG PV RP   ETTALGAAYAAGLAVG W   DE+  +  + ++  
Sbjct  269  VTENDLCMQLQADILGVPVSRPTVAETTALGAAYAAGLAVGFWRGTDELRENWNESRR--  326

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             ++P    E R+   D W +AV RTFD
Sbjct  327  -WQPTWSSEQREAGYDRWKRAVRRTFD  352



>ref|WP_043731252.1| glycerol kinase [Kutzneria sp. 744]
 gb|EWM15787.1| glycerol kinase [Kutzneria sp. 744]
Length=500

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 148/207 (71%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQW+RD+L +IS+A+EIE+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  302  YALEGSIAVTGSLVQWIRDNLGMISTAAEIEEHARSVEDNGGCYFVPAFSGLFAPYWRSD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF N+ H+ARAVLE+  FQ R+V+D+M+ D+G             L+VDGG
Sbjct  362  ARGAIVGLTRFVNRGHLARAVLEATAFQTREVIDAMNADSGVP--------LTSLKVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ Q+D+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I    +   KD 
Sbjct  414  MVVNELLMQFQSDILGVPVIRPVVAETTALGAAYAAGLAVGFWKSEDDIR---QNWAKDK  470

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E+ R  +  +W KAV++TFD
Sbjct  471  EWTPSMDEDRRASEYANWKKAVTKTFD  497



>ref|WP_006562876.1| glycerol kinase [Oscillochloris trichoides]
 gb|EFO79796.1| glycerol kinase [Oscillochloris trichoides DG-6]
Length=497

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 138/206 (67%), Gaps = 10/206 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AIAGA VQWLRD+L +I SASEIE LA++V  TGG+Y VPAF+GLFAP+WR D
Sbjct  299  YALEGSIAIAGALVQWLRDNLGIIKSASEIETLANEVADTGGIYIVPAFSGLFAPYWRSD  358

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TR+  K H+ARAVLE+  +Q R+VLD+M  D+G             L+VDGG
Sbjct  359  ARGVIVGLTRYVTKAHLARAVLEATAYQTREVLDAMRADSG--------MALRSLKVDGG  410

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               N  LMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W       +      D  
Sbjct  411  MVFNQTLMQFQADILGVPVVRPKVAETTALGAAYAAGLAVGYWPNSAALCA--HWGVDQT  468

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFD  128
            + P ++E  R      W KAV+RTFD
Sbjct  469  WTPQLDEPTRTGLYQGWKKAVTRTFD  494



>ref|WP_030907160.1| glycerol kinase [Streptosporangium amethystogenes]
Length=505

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 149/210 (71%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS A++ E LA +VE  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGAAQSESLARQVEDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++RF N  H+ARA LE++C+Q RDV+++M +D+G    V  D    VLRVDGG
Sbjct  365  ARGAIVGLSRFNNNAHLARATLEAICYQSRDVVEAMRQDSG----VTLD----VLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             T N+L MQIQA+LLG PV RP   ETTALGAAYAAGLAVG W ++DE+  + ++ ++  
Sbjct  417  VTANDLCMQIQANLLGVPVSRPVVAETTALGAAYAAGLAVGFWKSKDELKQNWQEGRR--  474

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P   EE R      W KAV RT +  D
Sbjct  475  -WEPQWSEEQRAAGYAGWKKAVERTLNWVD  503



>ref|WP_026153798.1| glycerol kinase [Amycolatopsis methanolica]
 gb|AIJ20953.1| glycerol kinase [Amycolatopsis methanolica 239]
Length=501

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 152/207 (73%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +IS+A+EIE+LA  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGIISTAAEIEELARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV  G+TR+ NK HIARAVLE+  FQ R+V+++M+ D+G    +K+      L+VDGG
Sbjct  363  ARGVIAGLTRYVNKGHIARAVLEATAFQTREVIEAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+L  PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  415  MVVNELLMQFQADILDVPVIRPVVAETTALGAAYAAGLAVGFWASEDDIRNN---WAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++ + R+ +  +W KAV++TFD
Sbjct  472  EWNPSMDAQHREAQYHNWKKAVTKTFD  498



>gb|KGA05763.1| glpK [actinobacterium acMicro-4]
Length=500

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 140/210 (67%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ +QWLRD+L LIS ASE+E LA+ V   GG Y VPAF+GLFAP+WR D
Sbjct  302  YALEGSIAVTGSLIQWLRDNLGLISEASEVEALAASVPDNGGCYVVPAFSGLFAPYWRSD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVDG  389
            ARGV +G+TRF NK HIARA LE+  FQ R+VLD+++ DAG D  E         L+VDG
Sbjct  362  ARGVIVGLTRFINKGHIARAALEATAFQTREVLDAVNADAGVDLTE---------LKVDG  412

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            G   N  LMQ QAD+LG PV+RP   ETTALGAAY AGLAVG W+  E      K  +D 
Sbjct  413  GMVKNETLMQFQADILGVPVIRPQVAETTALGAAYVAGLAVGYWSSREELRG--KWAEDK  470

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F P +  E   K +  W KAV+RTFD  D
Sbjct  471  RFVPGMPAETSAKLLAQWKKAVTRTFDWVD  500



>ref|WP_038297944.1| glycerol kinase [actinobacterium acMicro-4]
Length=504

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 140/210 (67%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ +QWLRD+L LIS ASE+E LA+ V   GG Y VPAF+GLFAP+WR D
Sbjct  306  YALEGSIAVTGSLIQWLRDNLGLISEASEVEALAASVPDNGGCYVVPAFSGLFAPYWRSD  365

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVDG  389
            ARGV +G+TRF NK HIARA LE+  FQ R+VLD+++ DAG D  E         L+VDG
Sbjct  366  ARGVIVGLTRFINKGHIARAALEATAFQTREVLDAVNADAGVDLTE---------LKVDG  416

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            G   N  LMQ QAD+LG PV+RP   ETTALGAAY AGLAVG W+  E      K  +D 
Sbjct  417  GMVKNETLMQFQADILGVPVIRPQVAETTALGAAYVAGLAVGYWSSREELRG--KWAEDK  474

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             F P +  E   K +  W KAV+RTFD  D
Sbjct  475  RFVPGMPAETSAKLLAQWKKAVTRTFDWVD  504



>ref|WP_014445904.1| glycerol kinase [Actinoplanes missouriensis]
 dbj|BAL91016.1| putative glycerol kinase [Actinoplanes missouriensis 431]
Length=505

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 148/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L+LI+ A++ E LA++V   GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLHLINDAAQSETLAAQVADNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++R+    HIARA LE++C+Q RDV+D+M +D+G    V  D    VL+VDGG
Sbjct  365  ARGAIVGLSRYNTGAHIARATLEAICYQTRDVVDAMAQDSG----VTLD----VLKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             TVNNL MQIQAD+LG PV RP   ETTALGAAYAAGLAVG W + DE+    E   +  
Sbjct  417  ITVNNLCMQIQADVLGVPVSRPVVAETTALGAAYAAGLAVGFWKSTDELR---ENWNESQ  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P   +E R++    W KAV RT D  D
Sbjct  474  RWQPNWSQEQREQGFGKWKKAVQRTLDWVD  503



>ref|WP_026534792.1| glycerol kinase [Arthrobacter sp. H14]
Length=504

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 148/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ +QWLRD+L LI +A E+EQLA  VE  GGVY VPAF+GLFAP+WR D
Sbjct  302  YALEGSIAVTGSLIQWLRDNLGLIKTAPEVEQLAETVEDNGGVYIVPAFSGLFAPYWRGD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK HIARA LE+  FQ R+VLD+ + DAG   E         +RVDGG
Sbjct  362  ARGAMVGLTRFVNKGHIARAALEATAFQTREVLDAANADAGVDME--------DMRVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
               N+ LMQ QAD+LG PV+RP  IETTALGAAYAAGLAVG W + D++ ++  + K+  
Sbjct  414  MVANDALMQFQADILGIPVIRPQVIETTALGAAYAAGLAVGFWDSTDDVTANWSEDKR--  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P ++   R +++  W KAV+RTFD  D
Sbjct  472  -WEPQMDAGERDRQLRLWKKAVTRTFDWVD  500



>ref|WP_038254265.1| glycerol kinase [Williamsia sp. D3]
Length=495

 Score =   200 bits (508),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 145/209 (69%), Gaps = 12/209 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LIS+A EIE +A  VE  GG YFVPAF+GLFAP WR D
Sbjct  298  YALEGSIAVTGSLVQWLRDNLGLISAAGEIETVAQTVEDNGGAYFVPAFSGLFAPRWRPD  357

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TRF NK HIARA LE+  FQ R+V+++M  D+G +           L+VDGG
Sbjct  358  ARGVIVGLTRFVNKGHIARAALEATAFQTREVIEAMQADSGVELS--------TLKVDGG  409

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ Q+D+LG PVVRP   ETTALGAAYAAGLAVG W TE +I    +   +D 
Sbjct  410  MVVNELLMQFQSDILGVPVVRPVVSETTALGAAYAAGLAVGYWGTEQDIR---DNWMQDK  466

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLA  122
             ++P +  E R K+   W KAV R++DLA
Sbjct  467  SWEPSMAAEDRDKRFAEWNKAVERSYDLA  495



>ref|WP_027661174.1| glycerol kinase [Salinispora pacifica]
Length=505

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 146/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +I+SA++ E LA +V+  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLKIINSAAQSEMLARQVDDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++RF    HIARA LES+C+Q RDV ++M KD+G    V  +R    L+VDGG
Sbjct  365  ARGVIVGLSRFNTDAHIARATLESICYQSRDVAEAMAKDSG----VALER----LKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             T N+L MQ+QAD+LG PV RP   ETTALGAAYAAGLAVG W   DE+    E   +  
Sbjct  417  VTENDLCMQLQADILGVPVSRPTVAETTALGAAYAAGLAVGFWRNTDELR---ENWNESR  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P    E R+   D W +AV RTFD  D
Sbjct  474  CWQPTWPSEQREAGYDRWKRAVQRTFDWVD  503



>gb|ETD30933.1| glycerol kinase [Williamsia sp. D3]
Length=502

 Score =   200 bits (508),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 145/209 (69%), Gaps = 12/209 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LIS+A EIE +A  VE  GG YFVPAF+GLFAP WR D
Sbjct  305  YALEGSIAVTGSLVQWLRDNLGLISAAGEIETVAQTVEDNGGAYFVPAFSGLFAPRWRPD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TRF NK HIARA LE+  FQ R+V+++M  D+G +           L+VDGG
Sbjct  365  ARGVIVGLTRFVNKGHIARAALEATAFQTREVIEAMQADSGVELS--------TLKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ Q+D+LG PVVRP   ETTALGAAYAAGLAVG W TE +I    +   +D 
Sbjct  417  MVVNELLMQFQSDILGVPVVRPVVSETTALGAAYAAGLAVGYWGTEQDIR---DNWMQDK  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLA  122
             ++P +  E R K+   W KAV R++DLA
Sbjct  474  SWEPSMAAEDRDKRFAEWNKAVERSYDLA  502



>ref|WP_018720195.1| glycerol kinase [Salinispora pacifica]
Length=505

 Score =   200 bits (508),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 146/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +I+SA++ E LA +V+  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLKIINSAAQSEMLARQVDDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++RF    HIARA LES+C+Q RDV ++M KD+G    V  +R    L+VDGG
Sbjct  365  ARGVIVGLSRFNTDAHIARATLESICYQSRDVAEAMAKDSG----VALER----LKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             T N+L MQ+QAD+LG PV RP   ETTALGAAYAAGLAVG W   DE+    E   +  
Sbjct  417  VTENDLCMQLQADILGVPVSRPTVAETTALGAAYAAGLAVGFWRNTDELR---ENWNESR  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P    E R+   D W +AV RTFD  D
Sbjct  474  CWQPTWPSEQREAGYDRWKRAVQRTFDWVD  503



>ref|WP_013222837.1| glycerol kinase [Amycolatopsis mediterranei]
 ref|YP_003763146.1| glycerol kinase [Amycolatopsis mediterranei U32]
 gb|ADJ42744.1| glycerol kinase [Amycolatopsis mediterranei U32]
 gb|AEK39435.1| glycerol kinase [Amycolatopsis mediterranei S699]
 gb|AFO74458.1| glycerol kinase [Amycolatopsis mediterranei S699]
 gb|AGT81587.1| glycerol kinase [Amycolatopsis mediterranei RB]
 gb|KDO09956.1| glycerol kinase [Amycolatopsis mediterranei]
 gb|KDU86115.1| glycerol kinase [Amycolatopsis mediterranei]
Length=504

 Score =   200 bits (508),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 153/207 (74%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I++A+EIE+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGMIATAAEIEEHARSVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRFVNKGHLARAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWKSEDDIRTN---WAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P +++  R+++  +W KAV++TFD
Sbjct  472  QWDPGMDDARREREYRNWKKAVTKTFD  498



>ref|WP_012851581.1| glycerol kinase [Thermomonospora curvata]
 gb|ACY96797.1| glycerol kinase [Thermomonospora curvata DSM 43183]
Length=505

 Score =   200 bits (508),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 143/209 (68%), Gaps = 10/209 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS+A++ E LA +V+  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLRIISTAAQSEILARQVDDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++R+ N  HIARA LES+C+Q RDV+++M +D+G    V  D    VLRVDGG
Sbjct  365  ARGVIVGLSRYNNAAHIARATLESICYQTRDVVEAMQQDSG----VVLD----VLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
             T N+L MQIQAD+LG PV RP   ETTALGAAYAAG+A G W   E         +D  
Sbjct  417  VTANDLCMQIQADVLGVPVSRPVVAETTALGAAYAAGMATGFWKSTEELV--RNWNEDRR  474

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            + P  ++E R      W KAV RT D  D
Sbjct  475  WLPQWDDEQRAAGYAGWKKAVERTLDWVD  503



>ref|WP_025361152.1| glycerol kinase [Kutzneria albida]
 gb|AHI01338.1| hypothetical protein KALB_7980 [Kutzneria albida DSM 43870]
Length=501

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 146/206 (71%), Gaps = 10/206 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I SA+EIE+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  302  YALEGSIAVTGSLVQWLRDNLGMIGSAAEIEEHARSVEDNGGCYFVPAFSGLFAPYWRSD  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TRF NK H+ARAVLE+  FQ R+V+++M+ D+G    +K+      L+VDGG
Sbjct  362  ARGAIVGLTRFVNKGHLARAVLEATAFQSREVIEAMNADSGVP--LKS------LKVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W  +E     +   +D  
Sbjct  414  MVVNELLMQFQADILGVPVIRPVVAETTALGAAYAAGLAVGFWAGEEDIR--QNWAQDKQ  471

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFD  128
            + P + E  R ++  +W +AV++TFD
Sbjct  472  WDPAMAESTRTEQYQNWKRAVTKTFD  497



>ref|WP_006237808.1| glycerol kinase [Saccharomonospora xinjiangensis]
 gb|EID53674.1| glycerol kinase [Saccharomonospora xinjiangensis XJ-54]
Length=504

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 154/207 (74%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L +I SA+EIE+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLKMIGSAAEIEEHARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TR+ NK H+ARAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRYVNKGHLARAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN+LLMQ QAD+LG  V+RP   ETTALGAAYAAGLAVG W +ED+I ++  + K+  
Sbjct  415  MVVNDLLMQFQADILGVSVIRPKVNETTALGAAYAAGLAVGFWESEDDIRTNWAEDKR--  472

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             ++P ++E  R+++  +W KAV+RTFD
Sbjct  473  -WEPSMDEARREREYRNWKKAVTRTFD  498



>ref|WP_022884044.1| glycerol kinase [Glaciibacter superstes]
Length=504

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 149/210 (71%), Gaps = 10/210 (5%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ VQWLRD+L L+ SA EIE LA  V+  GG YFVPAF+GLFAP+WR 
Sbjct  301  HYALEGSIAVTGSLVQWLRDNLGLVKSADEIEALAKTVDDNGGAYFVPAFSGLFAPYWRS  360

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG  +G+TR+ NK HIARAVLE+  FQ R+V+D+++ D+G             L+VDG
Sbjct  361  DARGALVGLTRYVNKGHIARAVLEATAFQTREVVDAVNADSGVP--------LTELKVDG  412

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            G   NNLLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W + +   +    ++D+
Sbjct  413  GMIANNLLMQFQADILGVPVIRPVVAETTALGAAYAAGLAVGFWKDLDDLRA--NWQEDS  470

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P +++  R +++ +W KAV++TFD  D
Sbjct  471  RWEPKMDDAERDRQLRNWKKAVTKTFDWVD  500



>ref|XP_001416856.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95149.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=522

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 145/211 (69%), Gaps = 7/211 (3%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS AIAGA V WLRD+L LI +AS+IE LA  VE   GV FVPAF+GLFAP WR+D
Sbjct  315  YALEGSVAIAGAVVHWLRDNLGLIKTASDIESLAGTVEDAAGVSFVPAFSGLFAPRWRED  374

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+T++ NK HIARA L+++ FQ RDVLD+M +D  +            L+VDGG
Sbjct  375  ARGVIVGLTQYVNKGHIARAALDAIAFQSRDVLDAMRQDMAE----STSHSLSALKVDGG  430

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIF---SSGEKMKK  215
            A+ NNLLMQIQAD +G  V+RP+D+ETTA GAAYAA +  G+ TE+++F   S G+  + 
Sbjct  431  ASANNLLMQIQADCIGLNVIRPSDVETTARGAAYAAAIGAGLMTEEDVFANVSEGDGDRD  490

Query  214  DTIFKPVIEEEVRKKKVDSWCKAVSRTFDLA  122
             T F P +  E R+     W  AV RT +L+
Sbjct  491  ITEFVPKLSIEARETNYARWNDAVERTLNLS  521



>ref|WP_036533578.1| glycerol kinase [Nocardia cyriacigeorgica]
Length=499

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 145/211 (69%), Gaps = 9/211 (4%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQW RD+L +ISSA+EIE LA  VE  GG Y VPAF+GLFAP WR D
Sbjct  296  YALEGSIAVTGSLVQWFRDNLGIISSAAEIEPLARSVEDNGGAYIVPAFSGLFAPRWRPD  355

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEF-VLRVDG  389
            ARGV  G+TRF NK H+ARAVLES  FQ R+V D+M  DA    E +  R E   L+VDG
Sbjct  356  ARGVITGLTRFVNKAHLARAVLESTAFQTREVTDAMRADA----ESQQLRLELTTLKVDG  411

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWT-EDEIFSSGEKMKKD  212
            G   N LLMQ QAD+LG PVVRP   ETTALGAAYAAGLAVG W   D+I    +    D
Sbjct  412  GMVNNELLMQFQADILGVPVVRPVVNETTALGAAYAAGLAVGYWAGTDDI---QDNWAAD  468

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
              ++P + ++ R+ ++D+W KAV RT++  D
Sbjct  469  KTWEPTMSDDDRRARLDAWNKAVERTYNWVD  499



>ref|WP_037561466.1| glycerol kinase [Spirochaeta sp. JC202]
 gb|KGM43729.1| glycerol kinase [Spirochaeta sp. JC202]
Length=503

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 144/205 (70%), Gaps = 10/205 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            Y LEGS AI GA VQWLRD+L LISSA EIE+LA+ VE  GG YFVPAF+GLFAP+WR D
Sbjct  305  YCLEGSIAITGALVQWLRDNLGLISSAPEIEELAATVEDNGGAYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV  G+TRF NK H+ARAVLE+  +Q RD++++M+KD+G    + N      L+VDGG
Sbjct  365  ARGVVAGLTRFVNKGHLARAVLEASAYQTRDIVEAMNKDSGVA--LTN------LKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               N +LMQ Q+D+L  PV+RP   ETTALGAAYAAG+AVG W++ +     +    D  
Sbjct  417  MVGNEMLMQFQSDILNVPVIRPEVSETTALGAAYAAGMAVGYWSDAQELR--QNWAVDKT  474

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTF  131
            ++P +E  VR+K    W KAV RTF
Sbjct  475  WQPSMEAGVREKYYREWKKAVDRTF  499



>ref|WP_037315944.1| glycerol kinase [Amycolatopsis orientalis]
Length=504

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 151/207 (73%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ VQWLRD+L LI SA+E+E+ A  VE  GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGSIAVTGSLVQWLRDNLGLIGSAAEVEEHARTVEDNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TR+ NK HI+RAVLE+  FQ R+V+D+M+ D+G    +K+      L+VDGG
Sbjct  363  ARGAIVGLTRYVNKGHISRAVLEATAFQSREVIDAMNADSGVP--LKS------LKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN LLMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +ED+I ++     +D 
Sbjct  415  MVVNELLMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWKSEDDIRNN---WAQDK  471

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P ++E  R+ +  +W KAV++TFD
Sbjct  472  QWDPSMDEARREAEYRNWKKAVTKTFD  498



>ref|WP_028478492.1| glycerol kinase [Nocardia sp. CNY236]
Length=506

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 146/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS A++ E LA + E  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGAAQSESLARQAEDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++R++   H+ARA LES+C+Q RDV+++M  D+G    V+ D    VLRVDGG
Sbjct  365  ARGAIVGLSRYSTNAHLARATLESICYQTRDVVEAMQADSG----VRLD----VLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N L MQ+QAD LG PV RP   ETTALGAAYAAGLAVG WT+ DE+  +  + K+  
Sbjct  417  VTANELCMQLQADFLGVPVSRPEVAETTALGAAYAAGLAVGFWTDTDELEQNWHEAKR--  474

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P    + R++    W KAV RT D  D
Sbjct  475  -WEPTWSPQQREQGYARWQKAVDRTLDWID  503



>ref|WP_026552192.1| glycerol kinase [Arthrobacter sp. H20]
Length=504

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 143/209 (68%), Gaps = 10/209 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+ +QWLRD+L +I SA E+EQLA  VE  GGVY VPAF+GLFAP+WR +
Sbjct  302  YALEGSIAVTGSLIQWLRDNLGIIKSAPEVEQLAESVEDNGGVYIVPAFSGLFAPYWRGE  361

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G+TRF NK HIARA LE+  FQ R+VLD+ + D+G   E         LRVDGG
Sbjct  362  ARGVIVGLTRFVNKGHIARAALEATAFQTREVLDAANADSGVDME--------DLRVDGG  413

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
               N+ LMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +    ++     +D  
Sbjct  414  MVANDALMQFQADILGIPVIRPKVTETTALGAAYAAGLAVGFWKDTAELAT--NWAEDKR  471

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            + P +E   R +++  W KAV+RTFD  D
Sbjct  472  WNPSMEAGERDRQLRLWKKAVTRTFDWVD  500



>ref|WP_042166131.1| glycerol kinase [Streptomyces sp. NBRC 110035]
Length=505

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 146/207 (71%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ GAAVQWLRD L +I+SA+E EQLA  VE  GG++FVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGAAVQWLRDQLKIITSAAESEQLARSVEDNGGMFFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+ R+    HIARA LE++C+Q RDV+++M +D+G    V  D    VL+VDGG
Sbjct  365  ARGAMVGLARYNTGAHIARATLEAICYQSRDVVEAMEQDSG----VHLD----VLKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N+L MQIQAD+LG PV RP   ETTALGAAYAAGLAVG W + DE+ S  ++ K+  
Sbjct  417  VTANDLCMQIQADVLGVPVSRPVVAETTALGAAYAAGLAVGFWRDTDELRSHWQESKR--  474

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P   EE R+     W +AV RT D
Sbjct  475  -WNPEWSEERRQDGYQDWKRAVERTLD  500



>ref|WP_026935893.1| glycerol kinase [Gulosibacter molinativorax]
Length=499

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 145/209 (69%), Gaps = 10/209 (5%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ VQWLRD+L LIS+++EIE LA+ V+  GG Y VPAF+GL+APWWR 
Sbjct  301  HYALEGSIAVTGSLVQWLRDNLGLISTSAEIEPLAASVDDNGGCYIVPAFSGLYAPWWRP  360

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARGV +G+TR+  K HIARA LES  FQ  DVL++ + DA        D     LRVDG
Sbjct  361  DARGVIVGLTRYITKGHIARAALESTAFQSADVLEACNADA--------DEPLTELRVDG  412

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            G TVN+ LMQ QAD+LG PVVRP   ETTALGAA+AAGLAVG W + +   +    ++D 
Sbjct  413  GMTVNDALMQFQADVLGVPVVRPVITETTALGAAFAAGLAVGFWADLDALRA--LWREDR  470

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLA  122
             F+P +  + R +    W KAVSR+FDLA
Sbjct  471  RFEPAMSPDERARLRREWRKAVSRSFDLA  499



>ref|WP_004932569.1| glycerol kinase [Streptomyces griseoflavus]
 gb|EFL41930.1| glycerol kinase [Streptomyces griseoflavus Tu4000]
Length=505

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 147/207 (71%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ GAAVQWLRD L +I+SA E EQLA +V+  GG++FVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGAAVQWLRDQLKIINSAPESEQLARQVDDNGGMFFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+ R+    HIARA LE++C+Q RDV+++M +D+G    V  D    VL+VDGG
Sbjct  365  ARGAMVGLARYNTGAHIARATLEAICYQSRDVVEAMEQDSG----VHLD----VLKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N+L MQIQAD+LG PV RP   ETTALGAAYAAGLAVG W + DE+ S  ++ K+  
Sbjct  417  VTANDLCMQIQADVLGVPVSRPVVAETTALGAAYAAGLAVGFWNDTDELRSHWQESKR--  474

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             + P   EE R++    W +AV RT D
Sbjct  475  -WSPEWSEEQRQEGYQDWKRAVERTLD  500



>ref|WP_022905305.1| glycerol kinase, partial [Curtobacterium sp. B18]
Length=433

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 149/212 (70%), Gaps = 14/212 (7%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ +QWLRD+L LI SA E+E LA  VE  GGVYFVPAF+GLFAP+WR 
Sbjct  230  HYALEGSIAVTGSLIQWLRDNLGLIGSAPEVEALAKTVEDNGGVYFVPAFSGLFAPYWRP  289

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TR+ NK HIARA LE+   Q R+VLD+++ D+G D  E         L+VD
Sbjct  290  DARGAIVGLTRYVNKGHIARAALEATALQTREVLDAVNADSGVDLTE---------LKVD  340

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKK  215
            GG T N+ LMQ QAD+L  PVVRP   ETTALGAAYAAGLAVG W   DE+ ++ ++ K+
Sbjct  341  GGMTANDALMQFQADILNVPVVRPVVAETTALGAAYAAGLAVGFWANLDELRANWQEDKR  400

Query  214  DTIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
               + P ++E  R++ +  W KAV++TFD  D
Sbjct  401  ---WVPQLDEAERERTLRLWKKAVTKTFDWVD  429



>ref|WP_012245351.1| glycerol kinase [Renibacterium salmoninarum]
 sp|A9WS93.1|GLPK_RENSM RecName: Full=Glycerol kinase; AltName: Full=ATP:glycerol 3-phosphotransferase; 
AltName: Full=Glycerokinase; Short=GK [Renibacterium 
salmoninarum ATCC 33209]
 gb|ABY23681.1| glycerol kinase [Renibacterium salmoninarum ATCC 33209]
Length=504

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 148/210 (70%), Gaps = 10/210 (5%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+AG+ +QWLRD+L +ISSA E+E+LA+ VE  GGVY VPAF+GLFAP+WR 
Sbjct  301  HYALEGSIAVAGSLIQWLRDTLGMISSAPEVEELAASVEDNGGVYIVPAFSGLFAPYWRS  360

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG  389
            DARG  +G+TR+ N+ HIARA LE+  FQ R+VLD+++ D+G             L+VDG
Sbjct  361  DARGAIVGMTRYVNRNHIARAALEATAFQTREVLDAVNADSGVP--------LTELKVDG  412

Query  388  GATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDT  209
            G   N+ LMQ QAD+LG PV+RP   ETTALGAAYAAGLAVG W +    SS     +D 
Sbjct  413  GMVANDALMQFQADILGVPVIRPKVTETTALGAAYAAGLAVGFWNDLGELSS--NWAEDK  470

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P +EE+ R +++  W KAV+++ D  D
Sbjct  471  RWEPAMEEDERARQLRLWKKAVTKSMDWVD  500



>ref|WP_039799920.1| glycerol kinase [Nocardia araoensis]
Length=506

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 145/210 (69%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS A++ E LA + E  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGAAQSESLARQAEDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++R++   H+ARA LES+C+Q RDV+++M  D+G    V+ D    VLRVDGG
Sbjct  365  ARGAIVGLSRYSTNAHLARATLESICYQTRDVVEAMQADSG----VRLD----VLRVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N L MQ+QAD LG PV RP   ETTALGAAYAAGLAVG W + DE+  +  + K+  
Sbjct  417  VTANELCMQLQADFLGVPVSRPVVAETTALGAAYAAGLAVGFWNDTDELEQNWNEAKR--  474

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P    E R++    W KAV+RT D  D
Sbjct  475  -WHPTWSAEQRERGYARWKKAVARTLDWID  503



>ref|WP_027652531.1| glycerol kinase [Salinispora pacifica]
Length=505

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 147/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +I+SA++ E LA +V+ +GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLKIINSAAQSEVLARQVDDSGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARGV +G++RF    HIARA LES+C+Q RDV ++M KD+G    V   R    L+VDGG
Sbjct  365  ARGVIVGLSRFNTDAHIARATLESICYQSRDVAEAMAKDSG----VALGR----LKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             T N+L MQ+QAD+LG PV RP   ETTALGAAYAAGLAVG W + DE+    E   +  
Sbjct  417  VTENDLCMQLQADILGVPVSRPTVAETTALGAAYAAGLAVGFWRSTDELR---ENWNESR  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             ++P    E R+   D W +AV RTFD  D
Sbjct  474  CWQPTWPSEQREAGYDRWKRAVQRTFDWVD  503



>ref|WP_012920815.1| glycerol kinase [Kribbella flavida]
 gb|ADB32259.1| glycerol kinase [Kribbella flavida DSM 17836]
Length=505

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 141/210 (67%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS ASE E LA +V+  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGASETETLARQVKDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++RF    H+ARA LE++C+Q +DV D+M KD+G K E        VL+VDGG
Sbjct  365  ARGAIVGLSRFNTNAHLARATLEAICYQSKDVADAMEKDSGVKLE--------VLKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N L MQ+QAD+LG PV +P   ETTALGAAYAAGLAVG W   DE+    +   +D 
Sbjct  417  VTANELCMQMQADILGVPVSKPVVAETTALGAAYAAGLAVGFWNNTDELV---QNWNEDK  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P   +E R      W KAV RT D  D
Sbjct  474  RWNPEWNDEQRADGYKGWEKAVRRTLDWVD  503



>ref|WP_043778835.1| glycerol kinase [Amycolatopsis rifamycinica]
 gb|KDN22356.1| glycerol kinase [Amycolatopsis rifamycinica]
Length=504

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 143/210 (68%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS AS+ E LA +VE  GGVYFVPAF+GLFAP+WR D
Sbjct  304  YALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVEDNGGVYFVPAFSGLFAPYWRSD  363

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TR T   HIARA LE++C+Q RDV+++M  D+G    V  D    VLRVDGG
Sbjct  364  ARGAIVGLTRATTNAHIARATLEAICYQTRDVVEAMQNDSG----VTLD----VLRVDGG  415

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
             T N L MQ+QAD+LG PV +P   ETTALGAAYAAGLAVG W + DE+    +   +D 
Sbjct  416  VTANELCMQLQADILGVPVSKPVVAETTALGAAYAAGLAVGFWKSTDELE---QNWNEDK  472

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P   +E R +    W KAV RT D  D
Sbjct  473  RWTPTWSDEQRAEGYAGWQKAVGRTLDWVD  502



>ref|WP_014044407.1| MULTISPECIES: glycerol kinase [Streptomyces]
 gb|AEN08415.1| glycerol kinase [Streptomyces sp. SirexAA-E]
Length=505

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 146/207 (71%), Gaps = 12/207 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD + +I SA E E+LA  VE  GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQMKIIKSAPESEELARTVEDNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+ R+ +  H+ARA LES+C+Q RDV+++M +D+G    V  D    VL+VDGG
Sbjct  365  ARGAIVGLARYNDNAHLARATLESICYQSRDVVEAMERDSG----VHLD----VLKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N+L MQIQAD+LG PV RP   ETTALGAAYAAGLAVG W + DE+ +  ++ K+  
Sbjct  417  VTANDLCMQIQADILGVPVSRPVVAETTALGAAYAAGLAVGFWRDTDELRTQWDESKR--  474

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFD  128
             ++P   EE R +    W KAV RT D
Sbjct  475  -WQPQWSEERRAEGYAGWQKAVERTLD  500



>ref|WP_019810702.1| glycerol kinase [Saccharomonospora halophila]
Length=509

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 151/206 (73%), Gaps = 12/206 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEG+ A+ G+ VQWLRD+LN+I SA+EIE  A  VE+ GG YFVPAF+GLFAP+WR D
Sbjct  303  YALEGAIAVTGSLVQWLRDNLNMIGSAAEIENHARTVENNGGAYFVPAFSGLFAPYWRSD  362

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TR+ NK H+ARAVLE+  FQ R+V+D+M+ D+G   +         L+VDGG
Sbjct  363  ARGAIVGLTRYVNKGHLARAVLEATAFQTREVIDAMNADSGVPLK--------TLKVDGG  414

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDT  209
              VN+LLMQ QAD+LG  V+RP   ETTALGAAYAAGLAVG W +ED+I ++  + K+  
Sbjct  415  MVVNDLLMQFQADILGVSVIRPQVSETTALGAAYAAGLAVGFWASEDDIRANWSEDKR--  472

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTF  131
             ++P ++E  R ++  +W KAV++TF
Sbjct  473  -WEPSMDETRRAREYRNWKKAVTKTF  497



>ref|WP_015490495.1| hypothetical protein [Clavibacter michiganensis]
 emb|CCE75753.1| glpK [Clavibacter michiganensis subsp. nebraskensis NCPPB 2581]
Length=505

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 152/211 (72%), Gaps = 12/211 (6%)
 Frame = -3

Query  748  NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD  569
            +YALEGS A+ G+ VQW+RD+L L+SSA+EIE LA+ VE  GGVYFVPAF+GLFAP+WR 
Sbjct  302  HYALEGSIAVTGSLVQWMRDNLGLVSSAAEIETLAATVEDNGGVYFVPAFSGLFAPYWRS  361

Query  568  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD  392
            DARG  +G+TRF NK HIARA LE+  FQ R+VLD+++ D+G D  E         L+VD
Sbjct  362  DARGALVGLTRFVNKGHIARAALEATAFQTREVLDAVNADSGVDLTE---------LKVD  412

Query  391  GGATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKD  212
            GG   NNLLMQ QAD+LG PVVRP   ETTALGAAYAAGLA G W + +   S    ++D
Sbjct  413  GGMIANNLLMQFQADILGVPVVRPVVAETTALGAAYAAGLATGFWKDLDDLRS--NWQED  470

Query  211  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            + + P +++  R++++  W KAV++TFD  D
Sbjct  471  SRWTPDMDDAERERQLRLWKKAVTKTFDWVD  501



>ref|WP_037266528.1| glycerol kinase [Rhodococcus rhodnii]
Length=498

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 141/209 (67%), Gaps = 10/209 (5%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS A++ E LAS+V   GG+YFVPAF+GLFAP+WR D
Sbjct  298  YALEGSIAVTGSAVQWLRDQLGIISGAAQSETLASQVADNGGIYFVPAFSGLFAPYWRSD  357

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G+TR T   H+ARA LE++C+Q RDV+++M  D+G    VK D    VLRVDGG
Sbjct  358  ARGAIVGLTRATTNAHVARATLEAICYQSRDVVEAMENDSG----VKLD----VLRVDGG  409

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTI  206
             T N L MQ+QAD+LG PV +P   ETTALGAAYAAGLAVG W   E     +   +D  
Sbjct  410  VTANQLCMQMQADVLGVPVSKPVVAETTALGAAYAAGLAVGFWKSTEELE--QNWNEDRR  467

Query  205  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
            ++P   EE R      W KAV RT D  D
Sbjct  468  WQPSWSEEQRAAGYAGWQKAVGRTLDWVD  496



>ref|WP_020384896.1| glycerol kinase [Kribbella catacumbae]
Length=505

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 140/210 (67%), Gaps = 12/210 (6%)
 Frame = -3

Query  745  YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD  566
            YALEGS A+ G+AVQWLRD L +IS ASE E LA +V   GGVYFVPAF+GLFAP+WR D
Sbjct  305  YALEGSIAVTGSAVQWLRDQLGIISGASETETLARQVADNGGVYFVPAFSGLFAPYWRSD  364

Query  565  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG  386
            ARG  +G++RF    H+ARA LE++C+Q +DV D+M KD+G K E        VL+VDGG
Sbjct  365  ARGAIVGLSRFNTNAHLARATLEAICYQSKDVADAMEKDSGVKLE--------VLKVDGG  416

Query  385  ATVNNLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDT  209
             T N L MQ+QAD+LG PV +P   ETTALGAAYAAGLAVG W   DE+    +   +D 
Sbjct  417  VTANELCMQMQADILGVPVSKPVVAETTALGAAYAAGLAVGFWNNTDELV---QNWNEDK  473

Query  208  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  119
             + P   +E R      W KAV RT D  D
Sbjct  474  RWSPEWNDEQRAAGYKGWEKAVQRTLDWVD  503



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840