BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF041J09

Length=822
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KEH16707.1|  glycoside hydrolase family 1 protein                    419   3e-141   Medicago truncatula
ref|XP_006490742.1|  PREDICTED: beta-glucosidase 44-like                420   3e-141   Citrus sinensis [apfelsine]
ref|NP_001234620.1|  beta-mannosidase enzyme precursor                  417   4e-140   
ref|XP_006341563.1|  PREDICTED: beta-glucosidase 44-like                416   6e-140   Solanum tuberosum [potatoes]
ref|XP_004512738.1|  PREDICTED: beta-glucosidase 44-like                414   3e-139   Cicer arietinum [garbanzo]
ref|XP_004137494.1|  PREDICTED: beta-glucosidase 44-like                413   6e-139   Cucumis sativus [cucumbers]
ref|XP_006451662.1|  hypothetical protein CICLE_v10008010mg             414   6e-139   Citrus clementina [clementine]
ref|XP_004161840.1|  PREDICTED: beta-glucosidase 44-like                413   9e-139   
gb|KDO62879.1|  hypothetical protein CISIN_1g010049mg                   409   1e-138   Citrus sinensis [apfelsine]
gb|KHN44611.1|  Beta-glucosidase 44                                     409   1e-138   Glycine soja [wild soybean]
ref|XP_003534146.1|  PREDICTED: beta-glucosidase 44                     412   3e-138   Glycine max [soybeans]
ref|XP_009757932.1|  PREDICTED: beta-glucosidase 44-like                412   3e-138   Nicotiana sylvestris
gb|KHN23728.1|  Beta-glucosidase 44                                     409   3e-138   Glycine soja [wild soybean]
ref|XP_009600118.1|  PREDICTED: beta-glucosidase 44-like                411   4e-138   Nicotiana tomentosiformis
gb|KDO62878.1|  hypothetical protein CISIN_1g010049mg                   411   7e-138   Citrus sinensis [apfelsine]
ref|XP_010243804.1|  PREDICTED: beta-glucosidase 44-like                410   1e-137   Nelumbo nucifera [Indian lotus]
ref|XP_007152698.1|  hypothetical protein PHAVU_004G151800g             410   2e-137   Phaseolus vulgaris [French bean]
ref|XP_008462973.1|  PREDICTED: beta-glucosidase 44-like                409   2e-137   Cucumis melo [Oriental melon]
ref|XP_003528968.1|  PREDICTED: beta-glucosidase 44-like                409   4e-137   Glycine max [soybeans]
gb|KDP41124.1|  hypothetical protein JCGZ_03615                         409   4e-137   Jatropha curcas
gb|KCW83983.1|  hypothetical protein EUGRSUZ_B00859                     404   3e-136   Eucalyptus grandis [rose gum]
gb|AGV54748.1|  beta-glucosidase 44-like protein                        407   3e-136   Phaseolus vulgaris [French bean]
gb|KCW83977.1|  hypothetical protein EUGRSUZ_B00859                     406   4e-136   Eucalyptus grandis [rose gum]
gb|KCW83975.1|  hypothetical protein EUGRSUZ_B00859                     406   5e-136   Eucalyptus grandis [rose gum]
ref|XP_010032608.1|  PREDICTED: beta-glucosidase 44-like                406   6e-136   Eucalyptus grandis [rose gum]
gb|KCW83978.1|  hypothetical protein EUGRSUZ_B00859                     405   6e-136   Eucalyptus grandis [rose gum]
ref|XP_011000474.1|  PREDICTED: beta-glucosidase 44-like                405   9e-136   Populus euphratica
ref|XP_002322086.2|  hypothetical protein POPTR_0015s04280g             405   1e-135   
ref|XP_002322085.1|  glycosyl hydrolase family 1 family protein         405   1e-135   Populus trichocarpa [western balsam poplar]
gb|ACU24532.1|  unknown                                                 405   1e-135   Glycine max [soybeans]
ref|XP_007036679.1|  B-S glucosidase 44 isoform 1                       405   1e-135   Theobroma cacao [chocolate]
ref|XP_010097587.1|  Beta-glucosidase 44                                403   7e-135   Morus notabilis
ref|XP_007209912.1|  hypothetical protein PRUPE_ppa004380mg             402   2e-134   Prunus persica
ref|XP_008374823.1|  PREDICTED: beta-glucosidase 44-like                402   3e-134   Malus domestica [apple tree]
ref|XP_002533126.1|  beta-glucosidase, putative                         401   3e-134   Ricinus communis
ref|XP_011084444.1|  PREDICTED: beta-glucosidase 44-like                400   5e-134   Sesamum indicum [beniseed]
gb|KCW83979.1|  hypothetical protein EUGRSUZ_B00859                     400   1e-133   Eucalyptus grandis [rose gum]
ref|XP_008240180.1|  PREDICTED: beta-glucosidase 44-like                399   4e-133   Prunus mume [ume]
ref|XP_009624185.1|  PREDICTED: beta-glucosidase 44-like                398   6e-133   Nicotiana tomentosiformis
ref|XP_010032621.1|  PREDICTED: beta-glucosidase 44-like                398   7e-133   Eucalyptus grandis [rose gum]
gb|EYU40222.1|  hypothetical protein MIMGU_mgv1a004735mg                397   9e-133   Erythranthe guttata [common monkey flower]
ref|XP_009347765.1|  PREDICTED: beta-glucosidase 44-like                397   1e-132   Pyrus x bretschneideri [bai li]
emb|CAN74265.1|  hypothetical protein VITISV_040977                     397   2e-132   Vitis vinifera
ref|XP_010686092.1|  PREDICTED: beta-glucosidase 44-like                397   2e-132   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002281407.1|  PREDICTED: beta-glucosidase 44                     397   2e-132   Vitis vinifera
ref|XP_010314225.1|  PREDICTED: beta-glucosidase 44-like isoform X2     396   3e-132   Solanum lycopersicum
ref|XP_010487722.1|  PREDICTED: beta-glucosidase 44-like                396   4e-132   Camelina sativa [gold-of-pleasure]
ref|XP_010533966.1|  PREDICTED: beta-glucosidase 44-like                396   5e-132   Tarenaya hassleriana [spider flower]
gb|KEH16706.1|  glycoside hydrolase family 1 protein                    395   7e-132   Medicago truncatula
gb|KCW83981.1|  hypothetical protein EUGRSUZ_B00859                     395   8e-132   Eucalyptus grandis [rose gum]
gb|KCW83987.1|  hypothetical protein EUGRSUZ_B00860                     394   9e-132   Eucalyptus grandis [rose gum]
gb|KJB34273.1|  hypothetical protein B456_006G057000                    395   1e-131   Gossypium raimondii
ref|XP_010032630.1|  PREDICTED: beta-glucosidase 44-like                395   1e-131   Eucalyptus grandis [rose gum]
ref|XP_004252272.1|  PREDICTED: beta-glucosidase 44-like isoform X1     395   1e-131   Solanum lycopersicum
ref|XP_011039106.1|  PREDICTED: beta-glucosidase 44-like                394   4e-131   Populus euphratica
ref|XP_002883107.1|  glycosyl hydrolase family 1 protein                392   1e-130   
ref|XP_010465882.1|  PREDICTED: beta-glucosidase 44                     392   1e-130   Camelina sativa [gold-of-pleasure]
ref|XP_006353826.1|  PREDICTED: beta-glucosidase 44-like                390   3e-130   Solanum tuberosum [potatoes]
gb|KCW83982.1|  hypothetical protein EUGRSUZ_B00859                     390   5e-130   Eucalyptus grandis [rose gum]
ref|XP_010506359.1|  PREDICTED: beta-glucosidase 44-like                390   5e-130   Camelina sativa [gold-of-pleasure]
ref|XP_009799689.1|  PREDICTED: beta-glucosidase 44-like                390   1e-129   Nicotiana sylvestris
gb|KDO50113.1|  hypothetical protein CISIN_1g0406882mg                  383   1e-129   Citrus sinensis [apfelsine]
ref|XP_004299545.1|  PREDICTED: beta-glucosidase 44-like                388   4e-129   Fragaria vesca subsp. vesca
ref|NP_188436.1|  beta-glucosidase 44                                   387   1e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007036680.1|  B-S glucosidase 44 isoform 2                       385   2e-128   
ref|XP_006297463.1|  hypothetical protein CARUB_v10013483mg             386   3e-128   Capsella rubella
ref|XP_007036681.1|  B-S glucosidase 44 isoform 3                       386   6e-128   
ref|XP_006431835.1|  hypothetical protein CICLE_v10004010mg             385   6e-128   Citrus clementina [clementine]
ref|XP_006471035.1|  PREDICTED: beta-glucosidase 44-like                385   8e-128   
gb|KFK39134.1|  beta-glucosidase 44                                     384   2e-127   Arabis alpina [alpine rockcress]
ref|XP_008810053.1|  PREDICTED: beta-glucosidase 1-like                 384   2e-127   Phoenix dactylifera
emb|CDX95557.1|  BnaC01g34490D                                          383   4e-127   
ref|XP_004299546.1|  PREDICTED: beta-glucosidase 44-like                382   1e-126   Fragaria vesca subsp. vesca
ref|XP_009394432.1|  PREDICTED: beta-glucosidase 1-like                 381   2e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007033088.1|  Beta-glucosidase 44                                381   3e-126   
gb|KFK39133.1|  beta-glucosidase 44                                     380   7e-126   Arabis alpina [alpine rockcress]
gb|EPS65829.1|  beta-mannosidase                                        379   8e-126   Genlisea aurea
emb|CDX95558.1|  BnaC01g34500D                                          377   4e-125   
ref|XP_007048474.1|  Beta-glucosidase 44                                379   6e-125   
emb|CDO98378.1|  unnamed protein product                                375   1e-124   Coffea canephora [robusta coffee]
ref|XP_008792825.1|  PREDICTED: beta-glucosidase 1-like                 377   1e-124   Phoenix dactylifera
ref|NP_001078176.1|  beta glucosidase 43                                374   1e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487721.1|  PREDICTED: beta-glucosidase 43                     376   1e-124   Camelina sativa [gold-of-pleasure]
ref|XP_009113523.1|  PREDICTED: beta-glucosidase 44                     376   2e-124   Brassica rapa
ref|XP_009113531.1|  PREDICTED: beta-glucosidase 43                     375   2e-124   Brassica rapa
gb|KJB16857.1|  hypothetical protein B456_002G251100                    370   3e-124   Gossypium raimondii
emb|CDY18494.1|  BnaA01g27010D                                          376   3e-124   Brassica napus [oilseed rape]
gb|KJB16881.1|  hypothetical protein B456_002G252700                    375   4e-124   Gossypium raimondii
ref|XP_010906974.1|  PREDICTED: beta-glucosidase 1-like                 375   6e-124   Elaeis guineensis
ref|XP_006299658.1|  hypothetical protein CARUB_v10015846mg             374   9e-124   
dbj|BAB02019.1|  beta-glucosidase                                       374   1e-123   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188435.2|  beta glucosidase 43                                   374   2e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010257514.1|  PREDICTED: beta-glucosidase 44-like isoform X2     374   3e-123   Nelumbo nucifera [Indian lotus]
ref|XP_006376723.1|  hypothetical protein POPTR_0012s04670g             374   4e-123   
ref|XP_006845279.1|  hypothetical protein AMTR_s00005p00266150          371   7e-123   
ref|XP_006845277.1|  hypothetical protein AMTR_s00005p00265710          371   8e-123   
ref|XP_002883106.1|  beta-glucosidase                                   372   1e-122   Arabidopsis lyrata subsp. lyrata
gb|ABC55716.1|  beta-mannosidase 3                                      371   2e-122   Oncidium hybrid cultivar
ref|XP_006406654.1|  hypothetical protein EUTSA_v10020536mg             371   2e-122   Eutrema salsugineum [saltwater cress]
gb|KJB16855.1|  hypothetical protein B456_002G250900                    371   2e-122   Gossypium raimondii
gb|ABC55717.1|  beta-mannosidase 2                                      370   4e-122   Oncidium hybrid cultivar
ref|XP_006845278.1|  hypothetical protein AMTR_s00005p00265850          369   5e-122   
gb|KJB16858.1|  hypothetical protein B456_002G251200                    369   2e-121   Gossypium raimondii
gb|ABC55718.1|  beta-mannosidase 1                                      367   3e-121   Oncidium hybrid cultivar
gb|KCW52109.1|  hypothetical protein EUGRSUZ_J01543                     365   6e-121   Eucalyptus grandis [rose gum]
ref|XP_010257596.1|  PREDICTED: beta-glucosidase 44-like isoform X3     367   8e-121   
ref|XP_010257433.1|  PREDICTED: beta-glucosidase 44-like isoform X1     368   8e-121   Nelumbo nucifera [Indian lotus]
ref|XP_010034459.1|  PREDICTED: beta-glucosidase 44-like                367   1e-120   Eucalyptus grandis [rose gum]
ref|XP_007033096.1|  B-S glucosidase 44                                 366   2e-120   
emb|CBI33559.3|  unnamed protein product                                363   3e-120   Vitis vinifera
gb|ABR17739.1|  unknown                                                 365   3e-120   Picea sitchensis
ref|XP_006644213.1|  PREDICTED: beta-glucosidase 1-like                 365   5e-120   Oryza brachyantha
ref|XP_010922562.1|  PREDICTED: beta-glucosidase 1-like                 363   1e-119   Elaeis guineensis
ref|XP_006430656.1|  hypothetical protein CICLE_v10013386mg             363   2e-119   Citrus clementina [clementine]
ref|XP_002272413.2|  PREDICTED: beta-glucosidase 44-like                365   2e-119   Vitis vinifera
ref|XP_008811965.1|  PREDICTED: beta-glucosidase 1-like isoform X1      363   3e-119   
gb|KDO63132.1|  hypothetical protein CISIN_1g046891mg                   363   3e-119   Citrus sinensis [apfelsine]
ref|XP_006482391.1|  PREDICTED: beta-glucosidase 44-like                363   4e-119   
ref|XP_006495386.1|  PREDICTED: beta-glucosidase 44-like                358   1e-118   Citrus sinensis [apfelsine]
ref|XP_006832849.1|  hypothetical protein AMTR_s00095p00053110          361   2e-118   
gb|EEE54664.1|  hypothetical protein OsJ_01954                          357   3e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004140826.1|  PREDICTED: beta-glucosidase 44-like                360   4e-118   Cucumis sativus [cucumbers]
gb|KDO63131.1|  hypothetical protein CISIN_1g036937mg                   359   5e-118   Citrus sinensis [apfelsine]
gb|EAY74244.1|  hypothetical protein OsI_02124                          360   5e-118   Oryza sativa Indica Group [Indian rice]
ref|XP_010916341.1|  PREDICTED: beta-glucosidase 1-like                 360   5e-118   Elaeis guineensis
ref|XP_004157213.1|  PREDICTED: beta-glucosidase 44-like                359   9e-118   
ref|XP_006482389.1|  PREDICTED: beta-glucosidase 44-like                359   1e-117   Citrus sinensis [apfelsine]
ref|XP_006482390.1|  PREDICTED: beta-glucosidase 44-like                359   1e-117   
ref|XP_006430655.1|  hypothetical protein CICLE_v10013521mg             359   1e-117   Citrus clementina [clementine]
ref|NP_001043156.1|  Os01g0508000                                       358   2e-117   
ref|XP_008457084.1|  PREDICTED: beta-glucosidase 44-like                358   4e-117   Cucumis melo [Oriental melon]
ref|XP_006430653.1|  hypothetical protein CICLE_v10013421mg             357   1e-116   
ref|XP_008811966.1|  PREDICTED: beta-glucosidase 1-like isoform X2      353   2e-115   
gb|KHG12317.1|  Beta-glucosidase 44 -like protein                       350   2e-114   Gossypium arboreum [tree cotton]
ref|XP_009394053.1|  PREDICTED: beta-glucosidase 26-like                350   3e-114   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEV76986.1|  beta-glucosidase 4                                      350   4e-114   Triticum aestivum [Canadian hard winter wheat]
gb|KHG17589.1|  Beta-glucosidase 44 -like protein                       345   4e-114   Gossypium arboreum [tree cotton]
gb|KJB08522.1|  hypothetical protein B456_001G086300                    346   7e-113   Gossypium raimondii
ref|XP_004149144.1|  PREDICTED: beta-glucosidase 44-like                337   3e-109   Cucumis sativus [cucumbers]
ref|XP_003562544.1|  PREDICTED: beta-glucosidase 26                     335   2e-108   
ref|XP_008453769.1|  PREDICTED: beta-glucosidase 44-like                335   2e-108   Cucumis melo [Oriental melon]
ref|XP_004163493.1|  PREDICTED: beta-glucosidase 44-like                333   1e-107   
gb|ACF07998.1|  beta-glucosidase                                        333   2e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAA87339.1|  beta-glucosidase                                        332   4e-107   Hordeum vulgare [barley]
gb|EMT08337.1|  Beta-glucosidase 44                                     330   1e-106   
ref|NP_001060502.1|  Os07g0656200                                       324   1e-106   
ref|XP_006658055.1|  PREDICTED: beta-glucosidase 26-like                328   2e-105   Oryza brachyantha
gb|ACL52625.1|  unknown                                                 325   1e-104   Zea mays [maize]
emb|CDM80087.1|  unnamed protein product                                325   2e-104   Triticum aestivum [Canadian hard winter wheat]
gb|EEC76023.1|  hypothetical protein OsI_13187                          327   2e-104   Oryza sativa Indica Group [Indian rice]
gb|ACF35791.1|  beta-mannosidase/beta-glucosidase                       323   3e-104   Oryza sativa Indica Group [Indian rice]
pdb|4JIE|A  Chain A, Structural Analysis And Insights Into Glycon...    324   3e-104   Oryza sativa Indica Group [Indian rice]
ref|NP_001051014.1|  Os03g0703100                                       326   3e-104   
sp|A3BMZ5.1|BGL26_ORYSJ  RecName: Full=Beta-glucosidase 26; Short...    324   5e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EMS60983.1|  Beta-glucosidase 26                                     324   7e-104   Triticum urartu
gb|AAX95520.1|  Putative Glycosyl hydrolase family 1 protein            326   9e-104   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK07108.1|  predicted protein                                      322   1e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006650460.1|  PREDICTED: beta-glucosidase 8-like                 324   3e-103   Oryza brachyantha
ref|XP_002464026.1|  hypothetical protein SORBIDRAFT_01g010825          323   3e-103   Sorghum bicolor [broomcorn]
ref|NP_001148821.1|  LOC100282438 precursor                             322   4e-103   Zea mays [maize]
ref|XP_002461141.1|  hypothetical protein SORBIDRAFT_02g041550          322   4e-103   Sorghum bicolor [broomcorn]
ref|XP_002974513.1|  hypothetical protein SELMODRAFT_149851             320   8e-103   Selaginella moellendorffii
ref|XP_002990785.1|  hypothetical protein SELMODRAFT_185578             320   1e-102   Selaginella moellendorffii
ref|XP_004958541.1|  PREDICTED: beta-glucosidase 26-like                319   9e-102   Setaria italica
ref|XP_003559510.1|  PREDICTED: beta-glucosidase 8-like                 319   3e-101   Brachypodium distachyon [annual false brome]
ref|XP_008655551.1|  PREDICTED: beta-glucosidase 1-like                 317   1e-100   Zea mays [maize]
gb|ABF98424.1|  Glycosyl hydrolase family 1 protein, expressed          306   1e-98    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001151026.1|  LOC100284659 precursor                             311   2e-98    Zea mays [maize]
ref|XP_006651730.1|  PREDICTED: beta-glucosidase 7-like                 306   8e-98    
gb|EAY86111.1|  hypothetical protein OsI_07481                          308   8e-98    Oryza sativa Indica Group [Indian rice]
gb|EMT23872.1|  Beta-glucosidase 44                                     308   1e-97    
ref|XP_002464027.1|  hypothetical protein SORBIDRAFT_01g010830          307   1e-97    Sorghum bicolor [broomcorn]
pdb|3F4V|A  Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Pl...    306   2e-97    Oryza sativa Japonica Group [Japonica rice]
pdb|2RGL|A  Chain A, Rice Bglu1 Beta-Glucosidase, A Plant Exogluc...    306   2e-97    Oryza sativa Japonica Group [Japonica rice]
gb|AFW79802.1|  hypothetical protein ZEAMMB73_091278                    307   3e-97    
ref|NP_001051013.1|  Os03g0703000                                       306   3e-97    
gb|AAA84906.3|  beta-glucosidase                                        306   3e-97    Oryza sativa Japonica Group [Japonica rice]
pdb|3SCR|A  Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant       304   9e-97    Oryza sativa Japonica Group [Japonica rice]
pdb|3SCP|A  Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant       304   1e-96    Oryza sativa Japonica Group [Japonica rice]
pdb|3SCN|A  Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant       303   2e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009388049.1|  PREDICTED: beta-glucosidase 26-like                296   2e-96    Musa acuminata subsp. malaccensis [pisang utan]
pdb|3SCV|A  Chain A, Crystal Structure Of Rice Bglu1 E386gS334A M...    303   2e-96    Oryza sativa Japonica Group [Japonica rice]
pdb|3SCW|A  Chain A, Crystal Structure Of Rice Bglu1 E386gY341A M...    302   7e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006664007.1|  PREDICTED: beta-glucosidase 38-like                302   9e-96    Oryza brachyantha
ref|XP_004982055.1|  PREDICTED: beta-glucosidase 7-like isoform X1      302   1e-95    Setaria italica
gb|EEC69164.1|  hypothetical protein OsI_38122                          300   6e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_004982054.1|  PREDICTED: beta-glucosidase 8-like                 301   1e-94    Setaria italica
ref|NP_001066656.1|  Os12g0420100                                       299   2e-94    
ref|XP_008665263.1|  PREDICTED: beta-glucosidase 7-like                 299   2e-94    Zea mays [maize]
ref|XP_004982056.1|  PREDICTED: beta-glucosidase 7-like isoform X2      298   4e-94    Setaria italica
ref|XP_003559508.1|  PREDICTED: beta-glucosidase 7-like                 297   9e-94    Brachypodium distachyon [annual false brome]
ref|NP_001142124.1|  uncharacterized protein LOC100274288 precursor     296   3e-93    Zea mays [maize]
ref|XP_010237292.1|  PREDICTED: beta-glucosidase 38-like                295   3e-93    Brachypodium distachyon [annual false brome]
gb|AFW69221.1|  hypothetical protein ZEAMMB73_365784                    293   2e-92    
ref|XP_008644990.1|  PREDICTED: beta-glucosidase 38-like                294   4e-92    
ref|XP_004963948.1|  PREDICTED: beta-glucosidase 38-like                292   1e-91    Setaria italica
gb|EMT00720.1|  Beta-glucosidase 1                                      293   1e-91    
ref|XP_003559509.1|  PREDICTED: beta-glucosidase 7-like isoform X1      292   1e-91    Brachypodium distachyon [annual false brome]
gb|EMS62098.1|  Beta-glucosidase 8                                      293   2e-91    Triticum urartu
gb|ADP02192.1|  putative non-cyanogenic beta-glucosidase                291   3e-91    Triticum aestivum [Canadian hard winter wheat]
gb|EMS62097.1|  Beta-glucosidase 7                                      291   5e-91    Triticum urartu
gb|ADP02193.1|  Glyco_hydro_1 domain-containing protein                 291   1e-90    Triticum aestivum [Canadian hard winter wheat]
gb|EMT31426.1|  Beta-glucosidase 1                                      289   1e-90    
dbj|BAJ90056.1|  predicted protein                                      288   2e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB16882.1|  hypothetical protein B456_002G252800                    281   7e-88    Gossypium raimondii
gb|EMS63424.1|  Beta-glucosidase 38                                     280   4e-87    Triticum urartu
emb|CDM83785.1|  unnamed protein product                                279   1e-86    Triticum aestivum [Canadian hard winter wheat]
gb|KJB16934.1|  hypothetical protein B456_002G255400                    270   6e-86    Gossypium raimondii
gb|KDO62881.1|  hypothetical protein CISIN_1g010049mg                   275   7e-86    Citrus sinensis [apfelsine]
gb|AFK37966.1|  unknown                                                 258   6e-83    Medicago truncatula
ref|XP_002438912.1|  hypothetical protein SORBIDRAFT_10g028060          253   7e-77    
gb|EMS48652.1|  Beta-glucosidase 7                                      253   7e-77    Triticum urartu
gb|ACN26454.1|  unknown                                                 241   2e-75    Zea mays [maize]
tpg|DAA44054.1|  TPA: hypothetical protein ZEAMMB73_095768              240   4e-72    
ref|XP_004985213.1|  PREDICTED: beta-glucosidase 6-like                 241   5e-72    Setaria italica
ref|XP_007133703.1|  hypothetical protein PHAVU_011G201700g             241   1e-71    Phaseolus vulgaris [French bean]
ref|NP_001268161.1|  beta-glucosidase precursor                         240   1e-71    Vitis vinifera
gb|EAY94514.1|  hypothetical protein OsI_16286                          236   1e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_008644530.1|  PREDICTED: hypothetical protein isoform X1         240   1e-71    
ref|XP_002987383.1|  hypothetical protein SELMODRAFT_235275             238   2e-71    
ref|XP_002465651.1|  hypothetical protein SORBIDRAFT_01g043030          239   3e-71    
ref|XP_002979904.1|  hypothetical protein SELMODRAFT_268319             239   3e-71    
emb|CBI27264.3|  unnamed protein product                                239   5e-71    Vitis vinifera
gb|EMT02092.1|  Beta-glucosidase 44                                     234   6e-71    
gb|KJB80348.1|  hypothetical protein B456_013G093100                    238   7e-71    Gossypium raimondii
gb|EEE62263.1|  hypothetical protein OsJ_17050                          236   8e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010910030.1|  PREDICTED: beta-glucosidase 25 isoform X2          237   1e-70    Elaeis guineensis
ref|XP_004505367.1|  PREDICTED: beta-glucosidase 40-like                237   1e-70    Cicer arietinum [garbanzo]
ref|XP_011018314.1|  PREDICTED: beta-glucosidase 40-like isoform X2     235   1e-70    Populus euphratica
ref|XP_002986009.1|  hypothetical protein SELMODRAFT_271823             237   2e-70    Selaginella moellendorffii
ref|XP_004985214.1|  PREDICTED: beta-glucosidase 6-like                 237   2e-70    
ref|XP_007153535.1|  hypothetical protein PHAVU_003G043600g             235   2e-70    Phaseolus vulgaris [French bean]
ref|XP_010910031.1|  PREDICTED: beta-glucosidase 25 isoform X3          234   2e-70    Elaeis guineensis
pdb|3GNO|A  Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-gl...    236   2e-70    Oryza sativa Japonica Group [Japonica rice]
sp|Q7XKV5.2|BGL11_ORYSJ  RecName: Full=Beta-glucosidase 11; Short...    237   2e-70    Oryza sativa Japonica Group [Japonica rice]
emb|CAH66811.1|  OSIGBa0135C13.6                                        237   2e-70    Oryza sativa [red rice]
pdb|3WBE|A  Chain A, Rice Os3bglu6 Beta-glucosidase E178q Mutant ...    236   2e-70    Oryza sativa Japonica Group [Japonica rice]
pdb|3WBA|A  Chain A, Rice Os3bglu6 E178q With Covalent Glucosyl M...    236   2e-70    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049358.1|  Os03g0212800                                       237   3e-70    
ref|XP_003607795.1|  Beta-glucosidase                                   233   3e-70    
emb|CDP05824.1|  unnamed protein product                                236   3e-70    Coffea canephora [robusta coffee]
gb|AES89992.2|  beta-glucosidase                                        234   3e-70    Medicago truncatula
ref|XP_008243590.1|  PREDICTED: beta-glucosidase 12-like                237   3e-70    
ref|XP_011018305.1|  PREDICTED: beta-glucosidase 40-like isoform X1     236   4e-70    Populus euphratica
gb|EEC74750.1|  hypothetical protein OsI_10506                          236   4e-70    Oryza sativa Indica Group [Indian rice]
ref|XP_010551390.1|  PREDICTED: beta-glucosidase 40                     236   4e-70    
gb|ACG44181.1|  non-cyanogenic beta-glucosidase precursor               235   4e-70    Zea mays [maize]
ref|XP_008789190.1|  PREDICTED: putative beta-glucosidase 41 isof...    233   5e-70    Phoenix dactylifera
ref|XP_010910029.1|  PREDICTED: beta-glucosidase 25 isoform X1          235   6e-70    Elaeis guineensis
ref|XP_002966845.1|  hypothetical protein SELMODRAFT_144295             235   6e-70    Selaginella moellendorffii
gb|EAY94510.1|  hypothetical protein OsI_16283                          228   7e-70    Oryza sativa Indica Group [Indian rice]
sp|Q7F9K4.1|BGL10_ORYSJ  RecName: Full=Beta-glucosidase 10; Short...    236   7e-70    Oryza sativa Japonica Group [Japonica rice]
emb|CAH66810.1|  OSIGBa0135C13.5                                        236   8e-70    Oryza sativa [red rice]
ref|XP_011012221.1|  PREDICTED: beta-glucosidase 40                     235   8e-70    Populus euphratica
gb|EEC77464.1|  hypothetical protein OsI_16285                          236   8e-70    Oryza sativa Indica Group [Indian rice]
gb|KDO81804.1|  hypothetical protein CISIN_1g0105881mg                  233   8e-70    Citrus sinensis [apfelsine]
gb|EEE58575.1|  hypothetical protein OsJ_09895                          236   8e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010680724.1|  PREDICTED: beta-glucosidase 40                     235   8e-70    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009406318.1|  PREDICTED: beta-glucosidase 6-like                 235   9e-70    
ref|XP_010521462.1|  PREDICTED: beta-glucosidase 40-like isoform X2     235   1e-69    Tarenaya hassleriana [spider flower]
ref|XP_010521461.1|  PREDICTED: beta-glucosidase 40-like isoform X1     235   1e-69    Tarenaya hassleriana [spider flower]
ref|XP_003607794.1|  Beta-glucosidase                                   234   1e-69    Medicago truncatula
ref|XP_002311330.1|  hydroxyisourate hydrolase family protein           234   2e-69    
ref|XP_006437961.1|  hypothetical protein CICLE_v10031299mg             234   2e-69    Citrus clementina [clementine]
ref|XP_006437962.1|  hypothetical protein CICLE_v10031299mg             233   2e-69    
ref|XP_006858818.1|  hypothetical protein AMTR_s00066p00171930          234   2e-69    Amborella trichopoda
gb|KDO81803.1|  hypothetical protein CISIN_1g0105881mg                  233   3e-69    Citrus sinensis [apfelsine]
ref|XP_008789189.1|  PREDICTED: beta-glucosidase 25 isoform X1          234   3e-69    Phoenix dactylifera
ref|XP_007207700.1|  hypothetical protein PRUPE_ppa024193mg             234   3e-69    
ref|XP_010649498.1|  PREDICTED: beta-glucosidase 40-like                234   3e-69    Vitis vinifera
sp|A3RF67.1|BAGBG_DALNI  RecName: Full=Isoflavonoid 7-O-beta-apio...    234   3e-69    Dalbergia nigrescens
gb|EAZ31068.1|  hypothetical protein OsJ_15164                          226   4e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006484173.1|  PREDICTED: beta-glucosidase 40-like                233   4e-69    Citrus sinensis [apfelsine]
ref|XP_006651165.1|  PREDICTED: beta-glucosidase 6-like                 233   6e-69    Oryza brachyantha
ref|XP_007045907.1|  Beta glucosidase 40 isoform 1                      233   8e-69    
ref|XP_008221519.1|  PREDICTED: beta-glucosidase 40-like                233   8e-69    
ref|XP_010259408.1|  PREDICTED: beta-glucosidase 40-like                233   9e-69    Nelumbo nucifera [Indian lotus]
ref|XP_011095300.1|  PREDICTED: putative beta-glucosidase 41 isof...    232   1e-68    Sesamum indicum [beniseed]
ref|XP_010911113.1|  PREDICTED: beta-glucosidase 13-like                226   1e-68    
ref|XP_002967460.1|  hypothetical protein SELMODRAFT_267120             232   2e-68    
ref|XP_007224102.1|  hypothetical protein PRUPE_ppa015619mg             232   2e-68    
gb|KHG19061.1|  Beta-glucosidase 40 -like protein                       229   2e-68    
gb|KDP25142.1|  hypothetical protein JCGZ_22677                         232   2e-68    
gb|AAV34606.1|  beta-glycosidase                                        232   2e-68    
ref|XP_004975941.1|  PREDICTED: beta-glucosidase 12-like                230   2e-68    
ref|XP_009418476.1|  PREDICTED: beta-glucosidase 25-like                232   3e-68    
ref|XP_002448027.1|  hypothetical protein SORBIDRAFT_06g019840          231   3e-68    
ref|XP_003597481.1|  Beta-glucosidase D4                                231   3e-68    
emb|CBI27265.3|  unnamed protein product                                232   3e-68    
ref|XP_011095298.1|  PREDICTED: putative beta-glucosidase 41 isof...    231   3e-68    
ref|XP_006652406.1|  PREDICTED: beta-glucosidase 13-like                231   4e-68    
ref|XP_006386092.1|  hypothetical protein POPTR_0003s22030g             230   4e-68    
ref|XP_007014882.1|  Beta-glucosidase 17                                231   4e-68    
gb|AES67732.2|  glycoside hydrolase family 1 protein                    231   4e-68    
ref|XP_006661692.1|  PREDICTED: beta-glucosidase 34-like                231   4e-68    
ref|XP_002960254.1|  hypothetical protein SELMODRAFT_163827             231   5e-68    
gb|KHN20526.1|  Beta-glucosidase 40                                     230   7e-68    
ref|XP_004490145.1|  PREDICTED: beta-glucosidase 40-like                230   7e-68    
ref|XP_003556662.1|  PREDICTED: beta-glucosidase 40                     230   7e-68    
ref|XP_010539264.1|  PREDICTED: putative beta-glucosidase 41 isof...    230   8e-68    
ref|XP_002960920.1|  hypothetical protein SELMODRAFT_163822             229   9e-68    
ref|XP_011027871.1|  PREDICTED: beta-glucosidase 24-like                229   1e-67    
ref|XP_002981889.1|  hypothetical protein SELMODRAFT_268527             230   1e-67    
ref|XP_002994357.1|  hypothetical protein SELMODRAFT_163405             229   1e-67    
ref|XP_007150405.1|  hypothetical protein PHAVU_005G150600g             229   1e-67    
ref|XP_010539263.1|  PREDICTED: putative beta-glucosidase 41 isof...    230   2e-67    
ref|XP_010258106.1|  PREDICTED: beta-glucosidase 6                      229   2e-67    
gb|AAF04007.1|AF163097_1  dalcochinin 8'-O-beta-glucoside beta-gl...    230   2e-67    
ref|NP_001053070.1|  Os04g0474800                                       226   2e-67    
ref|XP_002316096.2|  hydroxyisourate hydrolase family protein           229   2e-67    
ref|XP_007133707.1|  hypothetical protein PHAVU_011G202000g             229   2e-67    
ref|XP_009416570.1|  PREDICTED: beta-glucosidase 6-like                 229   2e-67    
dbj|BAG94781.1|  unnamed protein product                                226   2e-67    
ref|XP_002967091.1|  hypothetical protein SELMODRAFT_169039             228   3e-67    
ref|XP_008352397.1|  PREDICTED: beta-glucosidase 12-like                226   3e-67    
ref|XP_009356385.1|  PREDICTED: beta-glucosidase 40                     228   3e-67    
ref|XP_002512138.1|  beta-glucosidase, putative                         228   3e-67    
gb|KJB80347.1|  hypothetical protein B456_013G093000                    228   4e-67    
ref|XP_011025248.1|  PREDICTED: beta-glucosidase 12-like                228   4e-67    
ref|XP_002961162.1|  hypothetical protein SELMODRAFT_73365              226   5e-67    
gb|EYU19188.1|  hypothetical protein MIMGU_mgv1a004736mg                228   5e-67    
gb|EEC66726.1|  hypothetical protein OsI_33062                          228   5e-67    
ref|NP_001064347.1|  Os10g0323500                                       228   5e-67    
gb|ABI34907.3|  glycoside hydrolase family 1 protein                    225   6e-67    
emb|CAH67305.1|  OSIGBa0106G07.1                                        228   6e-67    
ref|XP_003561900.1|  PREDICTED: beta-glucosidase 6                      228   6e-67    
emb|CAH66807.1|  OSIGBa0135C13.2                                        228   6e-67    
ref|XP_008389423.1|  PREDICTED: beta-glucosidase 40-like                228   6e-67    
ref|XP_010267847.1|  PREDICTED: putative beta-glucosidase 41 isof...    225   6e-67    
pdb|3PTK|A  Chain A, The Crystal Structure Of Rice (Oryza Sativa ...    228   6e-67    
emb|CAH66812.1|  OSIGBa0135C13.7                                        228   6e-67    
ref|XP_003517829.1|  PREDICTED: beta-glucosidase 40-like                227   7e-67    
ref|XP_009115373.1|  PREDICTED: beta-glucosidase 40                     228   7e-67    
ref|XP_008792724.1|  PREDICTED: beta-glucosidase 6                      227   8e-67    
ref|XP_004244167.1|  PREDICTED: putative beta-glucosidase 41            227   9e-67    
ref|XP_008778242.1|  PREDICTED: beta-glucosidase 12-like                224   1e-66    
ref|XP_004486932.1|  PREDICTED: beta-glucosidase 12-like                227   1e-66    
ref|XP_008778226.1|  PREDICTED: beta-glucosidase 12-like isoform X2     224   1e-66    
gb|KDP20205.1|  hypothetical protein JCGZ_07925                         227   1e-66    
ref|NP_001053071.1|  Os04g0474900                                       227   1e-66    
ref|XP_004975939.1|  PREDICTED: beta-glucosidase 12-like                226   2e-66    
ref|XP_006369420.1|  hypothetical protein POPTR_0001s23050g             226   2e-66    
gb|AHC04401.1|  beta-glucosidase 1                                      226   2e-66    
gb|KEH26882.1|  glycoside hydrolase family 1 protein                    224   2e-66    
gb|KCW51254.1|  hypothetical protein EUGRSUZ_J00833                     226   2e-66    
ref|XP_010936327.1|  PREDICTED: beta-glucosidase 6 isoform X2           226   2e-66    
ref|XP_010694291.1|  PREDICTED: putative beta-glucosidase 41            226   2e-66    
gb|KEH26883.1|  glycoside hydrolase family 1 protein                    224   2e-66    
ref|XP_006832850.1|  hypothetical protein AMTR_s00095p00053310          215   2e-66    
ref|XP_010936326.1|  PREDICTED: beta-glucosidase 6 isoform X1           226   2e-66    
ref|XP_010267844.1|  PREDICTED: putative beta-glucosidase 41 isof...    226   2e-66    
gb|KFK27066.1|  hypothetical protein AALP_AA8G330000                    226   2e-66    
ref|XP_009414547.1|  PREDICTED: beta-glucosidase 25-like                226   3e-66    
ref|XP_010644313.1|  PREDICTED: putative beta-glucosidase 41            226   3e-66    
ref|XP_009802933.1|  PREDICTED: beta-glucosidase 40-like                226   3e-66    
ref|XP_011008768.1|  PREDICTED: beta-glucosidase 12-like isoform X1     226   3e-66    
ref|XP_006850052.1|  hypothetical protein AMTR_s00022p00199830          221   3e-66    
ref|XP_006307269.1|  hypothetical protein CARUB_v10008883mg             226   3e-66    
sp|Q7XKV4.2|BGL12_ORYSJ  RecName: Full=Beta-glucosidase 12; Short...    226   3e-66    
ref|XP_006369423.1|  linamarase family protein                          226   3e-66    
gb|AFZ78535.1|  beta-glucosidase                                        226   3e-66    
ref|XP_011008769.1|  PREDICTED: beta-glucosidase 12-like isoform X2     226   3e-66    
ref|XP_010031859.1|  PREDICTED: beta-glucosidase 24-like                226   3e-66    
ref|XP_004297254.1|  PREDICTED: beta-glucosidase 40                     226   3e-66    
ref|XP_009335410.1|  PREDICTED: beta-glucosidase 12-like                223   3e-66    
ref|XP_008658981.1|  PREDICTED: uncharacterized protein LOC100502...    223   4e-66    
ref|XP_002512097.1|  beta-glucosidase, putative                         225   4e-66    
ref|XP_006851185.1|  hypothetical protein AMTR_s00043p00189470          225   4e-66    
emb|CDY20561.1|  BnaC07g12280D                                          226   4e-66    
ref|XP_006652405.1|  PREDICTED: beta-glucosidase 12-like                226   4e-66    
ref|XP_009415571.1|  PREDICTED: beta-glucosidase 24-like                226   5e-66    
ref|XP_006384235.1|  hypothetical protein POPTR_0004s10900g             226   5e-66    
gb|ACN41025.1|  unknown                                                 225   5e-66    
gb|ABY48758.1|  glycosylhydrolase 1                                     225   5e-66    
ref|XP_006369422.1|  hypothetical protein POPTR_0001s23070g             226   5e-66    
dbj|BAO04176.1|  hypothetical protein                                   225   5e-66    
ref|XP_004296343.1|  PREDICTED: beta-glucosidase 13-like                226   5e-66    
ref|XP_007045905.1|  Beta glucosidase 40                                226   5e-66    
gb|KHN33323.1|  Beta-glucosidase 12                                     223   6e-66    
ref|XP_002305150.2|  hypothetical protein POPTR_0004s04080g             223   6e-66    
ref|XP_003615724.1|  Beta-glucosidase D7                                225   7e-66    
gb|ABV54754.1|  beta-glucosidase-like protein                           224   7e-66    
gb|AEB61486.1|  beta-glucosidase                                        225   7e-66    
ref|XP_006360112.1|  PREDICTED: putative beta-glucosidase 41-like       225   7e-66    
ref|XP_006475282.1|  PREDICTED: putative beta-glucosidase 41-like       225   8e-66    
gb|EMS61699.1|  Beta-glucosidase 13                                     219   8e-66    
ref|XP_010477846.1|  PREDICTED: beta-glucosidase 40-like                225   8e-66    
ref|XP_002960251.1|  hypothetical protein SELMODRAFT_75234              224   8e-66    
ref|XP_011013402.1|  PREDICTED: beta-glucosidase 12-like                225   9e-66    
ref|XP_011014103.1|  PREDICTED: beta-glucosidase 12-like                225   9e-66    
ref|XP_009343017.1|  PREDICTED: beta-glucosidase 12-like                225   9e-66    
ref|XP_004138903.1|  PREDICTED: beta-glucosidase 42-like                224   1e-65    
ref|XP_008778225.1|  PREDICTED: beta-glucosidase 12-like isoform X1     224   1e-65    
ref|XP_006415932.1|  hypothetical protein EUTSA_v10007404mg             224   1e-65    
emb|CBI20471.3|  unnamed protein product                                226   1e-65    
ref|XP_011048252.1|  PREDICTED: putative beta-glucosidase 41 isof...    224   1e-65    
ref|XP_004985215.1|  PREDICTED: beta-glucosidase 6-like                 224   1e-65    
ref|XP_010673562.1|  PREDICTED: beta-glucosidase 24-like isoform X2     221   1e-65    
ref|XP_007206410.1|  hypothetical protein PRUPE_ppa016757mg             223   1e-65    
ref|XP_004295228.1|  PREDICTED: beta-glucosidase 12-like                224   1e-65    
gb|AFZ78536.1|  beta-glucosidase                                        224   1e-65    
ref|XP_004507316.1|  PREDICTED: beta-glucosidase 12-like                224   2e-65    
ref|XP_009769966.1|  PREDICTED: putative beta-glucosidase 41            224   2e-65    
ref|XP_008777215.1|  PREDICTED: beta-glucosidase 12-like isoform X1     221   2e-65    
ref|XP_006365136.1|  PREDICTED: beta-glucosidase 40-like                224   2e-65    
ref|XP_003620192.1|  Beta-glucosidase                                   224   2e-65    
gb|ABY84677.1|  coniferrin beta glucosidase                             221   2e-65    
gb|KDP41287.1|  hypothetical protein JCGZ_15694                         224   2e-65    
ref|XP_008441736.1|  PREDICTED: beta-glucosidase 42 isoform X2          224   2e-65    
gb|AFK35893.1|  unknown                                                 224   2e-65    
ref|XP_008441738.1|  PREDICTED: beta-glucosidase 42 isoform X3          223   2e-65    
ref|XP_006451661.1|  hypothetical protein CICLE_v10008010mg             221   2e-65    
ref|XP_008441735.1|  PREDICTED: beta-glucosidase 42 isoform X1          224   2e-65    
ref|XP_001771505.1|  predicted protein                                  224   2e-65    
ref|XP_009631811.1|  PREDICTED: beta-glucosidase 40                     223   3e-65    
ref|XP_006371008.1|  hypothetical protein POPTR_0019s02590g             224   3e-65    
gb|ABW76288.1|  beta-glucosidase G3                                     223   3e-65    
emb|CDY61627.1|  BnaA08g19770D                                          223   3e-65    
ref|XP_008363403.1|  PREDICTED: beta-glucosidase 13-like                226   3e-65    
ref|XP_008777216.1|  PREDICTED: beta-glucosidase 12-like isoform X2     221   3e-65    
ref|XP_009347257.1|  PREDICTED: beta-glucosidase 13-like                223   3e-65    
gb|AAL07491.1|AF414608_1  prunasin hydrolase isoform PH I precursor     223   3e-65    
gb|EMT21383.1|  Beta-glucosidase 6                                      223   3e-65    
gb|KDO62882.1|  hypothetical protein CISIN_1g010049mg                   220   3e-65    
ref|XP_008339824.1|  PREDICTED: beta-glucosidase 40                     223   3e-65    
ref|XP_009364717.1|  PREDICTED: beta-glucosidase 12-like                224   4e-65    
ref|XP_003574944.1|  PREDICTED: beta-glucosidase 34-like                223   4e-65    
gb|KEH30278.1|  cyanogenic beta-glucosidase, putative                   223   4e-65    
gb|EMS46293.1|  Beta-glucosidase 34                                     223   4e-65    
ref|XP_003546992.2|  PREDICTED: cyanogenic beta-glucosidase-like ...    223   4e-65    
ref|XP_001765414.1|  predicted protein                                  223   4e-65    
ref|XP_008658979.1|  PREDICTED: uncharacterized protein LOC100502...    223   4e-65    
ref|XP_007221103.1|  hypothetical protein PRUPE_ppa017484mg             223   4e-65    
ref|XP_002448031.1|  hypothetical protein SORBIDRAFT_06g019880          221   4e-65    
gb|AAA93032.1|  prunasin hydrolase isoform PH I precursor               224   5e-65    
ref|XP_009406319.1|  PREDICTED: beta-glucosidase 6-like                 223   5e-65    
ref|XP_008390168.1|  PREDICTED: beta-glucosidase 12-like                219   5e-65    
ref|XP_010460295.1|  PREDICTED: beta-glucosidase 40-like                223   5e-65    
gb|KJB52661.1|  hypothetical protein B456_008G271500                    222   5e-65    
ref|XP_008339477.1|  PREDICTED: beta-glucosidase 13-like                224   5e-65    
ref|XP_004228406.1|  PREDICTED: beta-glucosidase 40                     223   5e-65    
ref|XP_010448307.1|  PREDICTED: putative beta-glucosidase 41 isof...    221   5e-65    
ref|XP_003537946.1|  PREDICTED: beta-glucosidase 12-like                222   5e-65    
gb|KEH30766.1|  glycoside hydrolase family 1 protein                    223   5e-65    
ref|XP_006582226.1|  PREDICTED: beta-glucosidase 25-like isoform X4     220   6e-65    
gb|KJB81859.1|  hypothetical protein B456_013G165100                    221   6e-65    
ref|XP_011008770.1|  PREDICTED: beta-glucosidase 12-like                223   6e-65    
gb|ACN29297.1|  unknown                                                 214   6e-65    
ref|XP_010265850.1|  PREDICTED: beta-glucosidase 12-like                223   6e-65    
gb|KJB52655.1|  hypothetical protein B456_008G271500                    219   7e-65    
ref|XP_009341389.1|  PREDICTED: beta-glucosidase 24-like                224   7e-65    
gb|AGS43007.1|  beta-D-glucoside glucohydrolase                         222   8e-65    
ref|XP_007133712.1|  hypothetical protein PHAVU_011G202500g             223   8e-65    
ref|XP_006652404.1|  PREDICTED: beta-glucosidase 10-like                223   8e-65    
gb|AFZ78537.1|  beta-glucosidase                                        222   8e-65    
ref|XP_011025247.1|  PREDICTED: beta-glucosidase 12-like                219   9e-65    
ref|XP_003546991.1|  PREDICTED: beta-glucosidase 12-like                222   9e-65    
ref|XP_010552540.1|  PREDICTED: beta-glucosidase 32-like                222   9e-65    
ref|XP_009615935.1|  PREDICTED: putative beta-glucosidase 41            222   9e-65    
ref|XP_010553830.1|  PREDICTED: beta-glucosidase 32-like                222   9e-65    
ref|XP_006582224.1|  PREDICTED: beta-glucosidase 25-like isoform X2     221   9e-65    
ref|XP_006582225.1|  PREDICTED: beta-glucosidase 25-like isoform X3     220   9e-65    
ref|XP_004507318.1|  PREDICTED: non-cyanogenic beta-glucosidase-like    222   1e-64    
emb|CDX85027.1|  BnaC05g20280D                                          222   1e-64    
gb|KFK44575.1|  hypothetical protein AALP_AA1G275600                    222   1e-64    
gb|EMT00549.1|  Beta-glucosidase 6                                      222   1e-64    
ref|XP_002973070.1|  hypothetical protein SELMODRAFT_98083              223   1e-64    
ref|XP_010448300.1|  PREDICTED: putative beta-glucosidase 41 isof...    222   1e-64    
ref|XP_010673561.1|  PREDICTED: beta-glucosidase 24-like isoform X1     222   1e-64    
ref|XP_003579957.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    222   1e-64    
gb|AES96995.2|  beta-glucosidase                                        222   1e-64    
ref|XP_008233161.1|  PREDICTED: beta-glucosidase 12-like                219   1e-64    
ref|XP_010499028.1|  PREDICTED: beta-glucosidase 40                     221   1e-64    
ref|XP_010038524.1|  PREDICTED: beta-glucosidase 42                     221   1e-64    
gb|AEB61485.1|  beta-glucosidase                                        221   2e-64    
ref|XP_009110017.1|  PREDICTED: beta-glucosidase 40-like                221   2e-64    
gb|KGN47642.1|  hypothetical protein Csa_6G366400                       221   2e-64    
ref|XP_008366162.1|  PREDICTED: beta-glucosidase 24-like                222   2e-64    
ref|NP_200268.3|  beta glucosidase 41                                   222   2e-64    
ref|NP_001146333.1|  hypothetical protein                               219   2e-64    
gb|KJB81861.1|  hypothetical protein B456_013G165100                    221   2e-64    
ref|XP_001751633.1|  predicted protein                                  221   2e-64    
ref|XP_003527305.1|  PREDICTED: beta-glucosidase 25-like isoform X1     221   2e-64    
gb|AHE74129.1|  prunasin hydrolase                                      222   2e-64    
ref|XP_010943554.1|  PREDICTED: beta-glucosidase 12-like isoform X2     220   2e-64    
gb|KDO75513.1|  hypothetical protein CISIN_1g0095352mg                  219   3e-64    
gb|KDP39010.1|  hypothetical protein JCGZ_00767                         222   3e-64    
gb|KDO75512.1|  hypothetical protein CISIN_1g0095352mg                  219   3e-64    
ref|XP_004144181.1|  PREDICTED: beta-glucosidase 40-like                221   3e-64    
ref|XP_010448292.1|  PREDICTED: putative beta-glucosidase 41 isof...    221   3e-64    
ref|XP_004515053.1|  PREDICTED: beta-glucosidase 12-like isoform X1     221   3e-64    
ref|XP_007157842.1|  hypothetical protein PHAVU_002G102800g             220   3e-64    
ref|XP_008359958.1|  PREDICTED: beta-glucosidase 12-like                217   3e-64    
gb|AHE74131.1|  prunasin hydrolase                                      221   4e-64    
ref|XP_008241169.1|  PREDICTED: beta-glucosidase 12-like                221   4e-64    
ref|XP_010062938.1|  PREDICTED: putative beta-glucosidase 41            220   4e-64    
ref|XP_008245635.1|  PREDICTED: beta-glucosidase 12-like isoform X2     221   4e-64    
gb|AHY21809.1|  linamarase                                              220   4e-64    
gb|ACD65510.1|  beta-glucosidase D2                                     220   4e-64    
ref|XP_008450458.1|  PREDICTED: beta-glucosidase 12-like                220   4e-64    



>gb|KEH16707.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=514

 Score =   419 bits (1078),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 192/243 (79%), Positives = 216/243 (89%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HP+VYGEYP+TMQNIVG RLPKF
Sbjct  272  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPLVYGEYPRTMQNIVGNRLPKF  331

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVK+VKGSID+VGINQYTTYYMY+PHN KP VPGYQ+DWN GFAY KNGVP+GPRA+
Sbjct  332  TKEEVKLVKGSIDFVGINQYTTYYMYDPHNQKPKVPGYQSDWNAGFAYAKNGVPVGPRAY  391

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YK++ Y+KE Y NPTM LSENGMD  GN+TF++  HDT RINYYK YL 
Sbjct  392  SYWLYNVPWGLYKSIMYIKEHYKNPTMFLSENGMDDPGNVTFSKGLHDTTRINYYKGYLT  451

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAIDDGANV GYHAWSLLDNFEWRLGYTSRFG+VYVD+KTLKR PK SA WF+ ++ 
Sbjct  452  QLKKAIDDGANVFGYHAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRTPKMSAYWFKQLLT  511

Query  101  RNK  93
            + K
Sbjct  512  KKK  514



>ref|XP_006490742.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=519

 Score =   420 bits (1079),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLPKF
Sbjct  276  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKF  335

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSID+VGINQYT YYMY+PH  KP   GYQ DWN GFAYEKNGVPIGPRA+
Sbjct  336  TKEEVKMVKGSIDFVGINQYTAYYMYDPHLKKPKQVGYQQDWNAGFAYEKNGVPIGPRAN  395

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYKA+ Y+KERYGNPT+ILSENGMD  GN+T  +  HDT RINYYK YL 
Sbjct  396  SYWLYNVPWGMYKALMYIKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLT  455

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+ TLKR PK SA WF+ +++
Sbjct  456  QLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFTTLKRYPKMSAYWFKQLLK  515

Query  101  RNKH  90
            RNKH
Sbjct  516  RNKH  519



>ref|NP_001234620.1| beta-mannosidase enzyme precursor [Solanum lycopersicum]
 gb|AAL37714.1|AF403444_1 beta-mannosidase enzyme [Solanum lycopersicum]
 gb|AAL37719.1|AF413204_1 beta-mannosidase [Solanum lycopersicum]
Length=514

 Score =   417 bits (1071),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+FGI LDFVWYEPLT+ KADNYAAQRARDFHLGWFLHP+VYGEYPKTMQNIVG RLPKF
Sbjct  271  GKFGILLDFVWYEPLTKGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGTRLPKF  330

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + +EVKMVKGS DYVGINQYT+YYMY+PH   P   GYQ DWNVGFAY++ GVPIGPRAH
Sbjct  331  SKEEVKMVKGSFDYVGINQYTSYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIGPRAH  390

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY+VPWG+YKA++YVKE YGNPT+IL+ENGMDYAGN+T  ++ HDTKRINYYKSYL 
Sbjct  391  SYWLYIVPWGLYKAINYVKEHYGNPTIILAENGMDYAGNITLPKALHDTKRINYYKSYLQ  450

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKK +DDGANVIGY AWSLLDNFEWRLGYTSRFG+VYVD+ TL+R PK SA WF+ +++
Sbjct  451  QLKKTVDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDFNTLRRYPKMSAYWFKKLLK  510

Query  101  RNKH  90
            R KH
Sbjct  511  RQKH  514



>ref|XP_006341563.1| PREDICTED: beta-glucosidase 44-like [Solanum tuberosum]
Length=512

 Score =   416 bits (1069),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+FGI LDFVWYEPLT+ KADNYAAQRARDFHLGWFLHP+VYGEYPKTMQNIVG RLPKF
Sbjct  269  GKFGILLDFVWYEPLTKGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGTRLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + +EVKMVKGS DYVGINQYT+YYMY+PH   P   GYQ DWNVGFAY++ GVPIGPRAH
Sbjct  329  SKEEVKMVKGSFDYVGINQYTSYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIGPRAH  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY+VPWG+YKAV+YVKE YGNPT+IL+ENGMDYAGN+T  ++ HDTKRI+YYKSYL 
Sbjct  389  SYWLYIVPWGLYKAVNYVKEHYGNPTIILAENGMDYAGNITLPKALHDTKRIDYYKSYLQ  448

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKK +DDGANVIGY AWSLLDNFEWRLGYTSRFG+VYVD+ TLKR PK SA WF+ +++
Sbjct  449  QLKKTVDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDFNTLKRYPKMSAYWFKKLLK  508

Query  101  RNKH  90
            R KH
Sbjct  509  RQKH  512



>ref|XP_004512738.1| PREDICTED: beta-glucosidase 44-like [Cicer arietinum]
Length=512

 Score =   414 bits (1064),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 191/243 (79%), Positives = 219/243 (90%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HP+VYGEYP+TMQNIVG RLPKF
Sbjct  270  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPLVYGEYPRTMQNIVGNRLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVK+VKGSID+VGINQYTTYYMY+PH +KP VPGYQ DWNVGFAY KNGVP+GPRA+
Sbjct  330  TKEEVKLVKGSIDFVGINQYTTYYMYDPHKSKPKVPGYQMDWNVGFAYAKNGVPVGPRAY  389

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YK++ Y+KE YGNPT+ILSENGMD  GN+TF++  HDT RINYYK YL 
Sbjct  390  SYWLYNVPWGLYKSLIYIKEHYGNPTVILSENGMDDPGNVTFSKGLHDTTRINYYKGYLS  449

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV+GY+AWSLLDNFEWRLGYTSRFG+VYVD+KTLKR PK SA WF+ ++ 
Sbjct  450  QLKKAVDDGANVVGYYAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKQLLT  509

Query  101  RNK  93
            + K
Sbjct  510  KKK  512



>ref|XP_004137494.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN64162.1| hypothetical protein Csa_1G042700 [Cucumis sativus]
Length=503

 Score =   413 bits (1062),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 195/243 (80%), Positives = 211/243 (87%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWFLHPIVYGEYP+T+QNIVG RLPKF
Sbjct  260  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPRTVQNIVGNRLPKF  319

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSID VGINQYTTYYMY+PH  K  VPGYQ DWN GFAYEKNGVPIGPRAH
Sbjct  320  TKEEVKMVKGSIDLVGINQYTTYYMYDPHQRKAKVPGYQQDWNAGFAYEKNGVPIGPRAH  379

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYKA+ YVK+ YGNPT+ILSENGMD  GN+T  +  HDT RIN+YK YL 
Sbjct  380  SYWLYNVPWGMYKALMYVKKYYGNPTVILSENGMDDPGNVTLPKGLHDTTRINFYKGYLT  439

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANVIGY AWSLLDNFEWRLGYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  440  QLKKAVDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYSNLKRYPKMSAYWFKQLLE  499

Query  101  RNK  93
            R K
Sbjct  500  RKK  502



>ref|XP_006451662.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
 gb|ESR64902.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
Length=519

 Score =   414 bits (1063),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLPKF
Sbjct  276  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKF  335

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSID+VGINQYT YYMY+PH  +P   GYQ DWN GFAYEKNGVPIGPRA+
Sbjct  336  TKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGPRAN  395

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYKA+ Y+KE YGNPT+ILSENGMD  GN+T  +  HDT RINYYK YL 
Sbjct  396  SYWLYNVPWGMYKALMYIKEHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLT  455

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+  LKR PK SA WF+ +++
Sbjct  456  QLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFTNLKRYPKMSAYWFKQLLK  515

Query  101  RNKH  90
            RNKH
Sbjct  516  RNKH  519



>ref|XP_004161840.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=503

 Score =   413 bits (1061),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 195/243 (80%), Positives = 211/243 (87%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWFLHPIVYGEYP+T+QNIVG RLPKF
Sbjct  260  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPRTVQNIVGNRLPKF  319

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSID VGINQYTTYYMY+PH  K  VPGYQ DWN GFAYEKNGVPIGPRAH
Sbjct  320  TKEEVKMVKGSIDLVGINQYTTYYMYDPHQRKAKVPGYQQDWNAGFAYEKNGVPIGPRAH  379

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYKA+ YVK+ YGNPT+ILSENGMD  GN+T  +  HDT RIN+YK YL 
Sbjct  380  SYWLYNVPWGMYKALMYVKKYYGNPTVILSENGMDDPGNVTLPKGLHDTTRINFYKGYLT  439

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANVIGY AWSLLDNFEWRLGYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  440  QLKKAVDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYSNLKRYPKMSAYWFKQLLE  499

Query  101  RNK  93
            R K
Sbjct  500  RKK  502



>gb|KDO62879.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
 gb|KDO62880.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=406

 Score =   409 bits (1051),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 212/244 (87%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLPKF
Sbjct  163  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKF  222

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSID+VGINQYT YYMY+PH  +P   GYQ DWN GFAYEKNGVPIGPRA+
Sbjct  223  TKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGPRAN  282

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYKA+ Y+K  YGNPT+ILSENGMD  GN+T  +  HDT RINYYK YL 
Sbjct  283  SYWLYNVPWGMYKALMYIKGHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLT  342

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+  LKR PK SA WF+ +++
Sbjct  343  QLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFTNLKRYPKMSAYWFKQLLK  402

Query  101  RNKH  90
            RNKH
Sbjct  403  RNKH  406



>gb|KHN44611.1| Beta-glucosidase 44 [Glycine soja]
Length=406

 Score =   409 bits (1050),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 191/244 (78%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADN AAQRARDFH+GWF+HP+VYGEYP T+QNIVG RLPKF
Sbjct  163  GRIGILLDFVWYEPLTRSKADNLAAQRARDFHVGWFIHPLVYGEYPTTIQNIVGNRLPKF  222

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVK+VKGSID+VGINQYTTYYMY+PH  KP VPGYQ DWN GFAY KNGVPIGPRA+
Sbjct  223  TSEEVKIVKGSIDFVGINQYTTYYMYDPHQAKPKVPGYQMDWNAGFAYAKNGVPIGPRAY  282

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYK++ Y+KERYGNPT+ILSENGMD  GN+T  +  HDT RINYYK YL 
Sbjct  283  SYWLYNVPWGMYKSLMYIKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLT  342

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+KTLKR PK SA WF+ +I 
Sbjct  343  QLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKQLIA  402

Query  101  RNKH  90
            + K+
Sbjct  403  KKKY  406



>ref|XP_003534146.1| PREDICTED: beta-glucosidase 44 [Glycine max]
Length=506

 Score =   412 bits (1058),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADN+AAQRARDFH+GWF+HP+VYGEYPKT+QNIVG RLPKF
Sbjct  263  GRIGILLDFVWYEPLTRSKADNFAAQRARDFHIGWFIHPLVYGEYPKTIQNIVGNRLPKF  322

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVK+VKGSID+VGINQYTT+++Y+PH +KP VPGYQ DWN GFAY KNGVPIGPRA+
Sbjct  323  TSEEVKIVKGSIDFVGINQYTTFFIYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGPRAN  382

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYK++ Y+KERYGNPT+ILSENGMD  GN+T  +  HDT RINYYK YL 
Sbjct  383  SYWLYNVPWGMYKSLMYIKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLT  442

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+KTLKR PK SA WF+ +I 
Sbjct  443  QLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKQLIT  502

Query  101  RNKH  90
            + K+
Sbjct  503  KKKY  506



>ref|XP_009757932.1| PREDICTED: beta-glucosidase 44-like [Nicotiana sylvestris]
Length=515

 Score =   412 bits (1058),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+FGI LDFVWYEPLTR KADNYAAQRARDFHLGWFLHP+VYGEYPKTMQNIVGKRLPKF
Sbjct  272  GKFGILLDFVWYEPLTRGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGKRLPKF  331

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSID +GINQYT YYMY+PH   P   GYQ DWNVGFAY++ GVPIGPRAH
Sbjct  332  TKEEVKMVKGSIDLLGINQYTAYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIGPRAH  391

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG++KAV+YVKERYGNPTMIL+ENGMDYAGN+T  ++ +DTKRI YYKSYL 
Sbjct  392  SDWLYIVPWGLHKAVNYVKERYGNPTMILAENGMDYAGNITLPKALYDTKRIAYYKSYLK  451

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKK +D+GANVIGY AWSL+DNFEWRLGYTSRFG+VYVD+ TLKR PK SA WF+ ++R
Sbjct  452  ELKKTVDEGANVIGYFAWSLVDNFEWRLGYTSRFGIVYVDFNTLKRYPKLSALWFKKLLR  511

Query  101  RNKH  90
            R+KH
Sbjct  512  RHKH  515



>gb|KHN23728.1| Beta-glucosidase 44 [Glycine soja]
Length=450

 Score =   409 bits (1052),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADN+AAQRARDFH+GWF+HP+VYGEYPKT+QNIVG RLPKF
Sbjct  207  GRIGILLDFVWYEPLTRSKADNFAAQRARDFHIGWFIHPLVYGEYPKTIQNIVGNRLPKF  266

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVK+VKGSID+VGINQYTT+++Y+PH +KP VPGYQ DWN GFAY KNGVPIGPRA+
Sbjct  267  TSEEVKIVKGSIDFVGINQYTTFFIYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGPRAN  326

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYK++ Y+KERYGNPT+ILSENGMD  GN+T  +  HDT RINYYK YL 
Sbjct  327  SYWLYNVPWGMYKSLIYIKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLT  386

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+KTLKR PK SA WF+ +I 
Sbjct  387  QLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKQLIT  446

Query  101  RNKH  90
            + K+
Sbjct  447  KKKY  450



>ref|XP_009600118.1| PREDICTED: beta-glucosidase 44-like [Nicotiana tomentosiformis]
Length=515

 Score =   411 bits (1057),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 191/244 (78%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+FGI LDFVWYEPLTR KADNYAAQRARDFHLGWFLHP+VYGEYPKTMQNI+GKRLPKF
Sbjct  272  GKFGILLDFVWYEPLTRGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNILGKRLPKF  331

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSID +GINQYT YYMY+PH   P   GYQ DWNVGFAY++ GVPIGPRAH
Sbjct  332  TKEEVKMVKGSIDLLGINQYTAYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIGPRAH  391

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG++KAV+YVKERYGNPTMIL+ENGMDYAGN+T  ++ +DTKRI YYKSYL 
Sbjct  392  SDWLYIVPWGLHKAVNYVKERYGNPTMILAENGMDYAGNITLPKALYDTKRIAYYKSYLQ  451

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKK +D+GANVIGY AWSL+DNFEWRLGYTSRFG+VYVD+ TLKR PK SA WF+ ++R
Sbjct  452  ELKKTVDEGANVIGYFAWSLVDNFEWRLGYTSRFGIVYVDFNTLKRYPKLSALWFKKLLR  511

Query  101  RNKH  90
            R+KH
Sbjct  512  RHKH  515



>gb|KDO62878.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=519

 Score =   411 bits (1056),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 212/244 (87%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLPKF
Sbjct  276  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKF  335

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSID+VGINQYT YYMY+PH  +P   GYQ DWN GFAYEKNGVPIGPRA+
Sbjct  336  TKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGPRAN  395

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYKA+ Y+K  YGNPT+ILSENGMD  GN+T  +  HDT RINYYK YL 
Sbjct  396  SYWLYNVPWGMYKALMYIKGHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLT  455

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+  LKR PK SA WF+ +++
Sbjct  456  QLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFTNLKRYPKMSAYWFKQLLK  515

Query  101  RNKH  90
            RNKH
Sbjct  516  RNKH  519



>ref|XP_010243804.1| PREDICTED: beta-glucosidase 44-like [Nelumbo nucifera]
Length=518

 Score =   410 bits (1054),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTR KAD  AAQRARDFH+GWFLHPIVYGEYPKT+QNIVGKRLPKF
Sbjct  275  GRIGILLDFVWYEPLTRGKADQQAAQRARDFHVGWFLHPIVYGEYPKTVQNIVGKRLPKF  334

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSID+VGINQYTTYYMY+PH  K   PGYQNDWN GFAY K GVPIGPRA+
Sbjct  335  TDEEVKMVKGSIDFVGINQYTTYYMYDPHQTKKQPPGYQNDWNAGFAYAKKGVPIGPRAN  394

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YKA+ Y+KERYGNPT+ILSENGMD  GN+T  +  HDT RINYYKSYL+
Sbjct  395  SYWLYEVPWGLYKALIYIKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKSYLL  454

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKA+D+GANVIGY AWSLLDNFEWRLGYTSRFG+VYVD+KTLKR PK SA WF+ ++ 
Sbjct  455  ELKKAVDEGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKELLG  514

Query  101  RNKH  90
            R KH
Sbjct  515  RKKH  518



>ref|XP_007152698.1| hypothetical protein PHAVU_004G151800g [Phaseolus vulgaris]
 gb|ESW24692.1| hypothetical protein PHAVU_004G151800g [Phaseolus vulgaris]
Length=540

 Score =   410 bits (1055),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 190/244 (78%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HP+VYGEYPKT+Q IVG+RLPKF
Sbjct  297  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPLVYGEYPKTVQEIVGQRLPKF  356

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVK+VKGSID+VGINQYTTYYMY+PH +KP VPGYQ DWN GFAY KNGVPIGPRA+
Sbjct  357  TSEEVKIVKGSIDFVGINQYTTYYMYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGPRAN  416

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YK++ Y+KE YGNPT+ILSENGMD  GN+T  +  HDT RINYYK YL 
Sbjct  417  SYWLYNVPWGIYKSLMYIKEHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLT  476

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
             LKKA+DDGANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+KTLKR PK SA WF+ +  
Sbjct  477  NLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRHPKMSAYWFKQLNA  536

Query  101  RNKH  90
            R KH
Sbjct  537  RKKH  540



>ref|XP_008462973.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=507

 Score =   409 bits (1051),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 192/243 (79%), Positives = 211/243 (87%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWFLHPIVYGEYP+T+Q IVG RLPKF
Sbjct  264  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFLHPIVYGEYPRTVQEIVGNRLPKF  323

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSID+VGINQYTTYYMY+PH  K  VPGYQ DWN GFAYEK+GVPIGPRAH
Sbjct  324  TKEEVKMVKGSIDFVGINQYTTYYMYDPHQRKAKVPGYQQDWNAGFAYEKHGVPIGPRAH  383

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYKA+ YVK+ YGNPT+ILSENGMD  GN+T  +  HDT RIN+YK YL 
Sbjct  384  SYWLYNVPWGMYKALMYVKKYYGNPTVILSENGMDDPGNVTLPKGLHDTTRINFYKGYLT  443

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV+GY AWSLLDNFEWRLGYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  444  QLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDYSNLKRYPKMSAYWFKQLLE  503

Query  101  RNK  93
            R K
Sbjct  504  RKK  506



>ref|XP_003528968.1| PREDICTED: beta-glucosidase 44-like [Glycine max]
Length=515

 Score =   409 bits (1051),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 190/244 (78%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADN AAQRARDFH+GWF+HP+VYGEYP T+QNIVG RLPKF
Sbjct  272  GRIGILLDFVWYEPLTRSKADNLAAQRARDFHVGWFIHPLVYGEYPTTIQNIVGNRLPKF  331

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVK+VKGSID+VGINQYTTYYMY+PH  KP VPGYQ DWN GFAY KNGVPIGPRA+
Sbjct  332  TSEEVKIVKGSIDFVGINQYTTYYMYDPHQAKPKVPGYQMDWNAGFAYAKNGVPIGPRAY  391

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYK++ Y+KERYGNPT+ LSENGMD  GN+T  +  HDT RINYYK YL 
Sbjct  392  SYWLYNVPWGMYKSLMYIKERYGNPTVFLSENGMDDPGNVTLPKGLHDTTRINYYKGYLT  451

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+KTLKR PK SA WF+ +I 
Sbjct  452  QLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKQLIA  511

Query  101  RNKH  90
            + K+
Sbjct  512  KKKY  515



>gb|KDP41124.1| hypothetical protein JCGZ_03615 [Jatropha curcas]
Length=516

 Score =   409 bits (1050),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 212/244 (87%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLPKF
Sbjct  273  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKF  332

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +E+K+VKGSIDYVGINQYTTYYMY+PH +KP   GYQ DWN GFAYEKNGV IGPRA+
Sbjct  333  TQEEIKIVKGSIDYVGINQYTTYYMYDPHQSKPKDLGYQQDWNAGFAYEKNGVQIGPRAN  392

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YKA+ Y+KERYGNPT+ LSENGMD  GN+T  +  HDT RINYY+SYL 
Sbjct  393  SYWLYNVPWGLYKALIYIKERYGNPTVFLSENGMDDPGNVTLPKGLHDTTRINYYRSYLT  452

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANVIGY AWSLLDNFEWR GYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  453  QLKKAVDDGANVIGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMSAYWFKQLME  512

Query  101  RNKH  90
            R KH
Sbjct  513  RKKH  516



>gb|KCW83983.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=450

 Score =   404 bits (1039),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 210/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG RLPKF
Sbjct  207  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKF  266

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGINQYT +YMY+PH  K  VPGYQ DWN GFAY K GVPIGPRAH
Sbjct  267  TKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAH  326

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YKAV Y+KERYGNPTMILSENGMD  GN+T ++  HDT RIN+YK YL 
Sbjct  327  SYWLYNVPWGLYKAVMYIKERYGNPTMILSENGMDDPGNVTLSQGLHDTTRINFYKGYLT  386

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGAN++GY AWSLLDNFEWR GYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  387  QLKKAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMSAYWFKQLLT  446

Query  101  RNKH  90
            R K+
Sbjct  447  RKKN  450



>gb|AGV54748.1| beta-glucosidase 44-like protein [Phaseolus vulgaris]
Length=518

 Score =   407 bits (1045),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP +RSKADNYAAQRARDFH+GWF+HP+VYGEYPKT+Q IVG+RLPKF
Sbjct  275  GRIGILLDFVWYEPFSRSKADNYAAQRARDFHIGWFIHPLVYGEYPKTVQEIVGQRLPKF  334

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVK+VKGSID+VGINQYTTYYMY+PH +KP VPGYQ DWN GFAY KNGVPIGPRA+
Sbjct  335  TSEEVKIVKGSIDFVGINQYTTYYMYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGPRAN  394

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YK++ Y+KE YGNPT+ILSENGMD  GN+T  +  HDT RINYYK YL 
Sbjct  395  SYWLYNVPWGIYKSLMYIKEHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLT  454

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
             LKKA+DDGANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+KTLKR PK SA WF+ +  
Sbjct  455  NLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRHPKMSAYWFKQLNA  514

Query  101  RNKH  90
            R KH
Sbjct  515  RKKH  518



>gb|KCW83977.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   406 bits (1044),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 210/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG RLPKF
Sbjct  269  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGINQYT +YMY+PH  K  VPGYQ DWN GFAY K GVPIGPRAH
Sbjct  329  TKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAH  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YKAV Y+KERYGNPTMILSENGMD  GN+T ++  HDT RIN+YK YL 
Sbjct  389  SYWLYNVPWGLYKAVMYIKERYGNPTMILSENGMDDPGNVTLSQGLHDTTRINFYKGYLT  448

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGAN++GY AWSLLDNFEWR GYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  449  QLKKAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMSAYWFKQLLT  508

Query  101  RNKH  90
            R K+
Sbjct  509  RKKN  512



>gb|KCW83975.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
 gb|KCW83976.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   406 bits (1043),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 210/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG RLPKF
Sbjct  269  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGINQYT +YMY+PH  K  VPGYQ DWN GFAY K GVPIGPRAH
Sbjct  329  TKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAH  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YKAV Y+KERYGNPTMILSENGMD  GN+T ++  HDT RIN+YK YL 
Sbjct  389  SYWLYNVPWGLYKAVMYIKERYGNPTMILSENGMDDPGNVTLSQGLHDTTRINFYKGYLT  448

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGAN++GY AWSLLDNFEWR GYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  449  QLKKAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMSAYWFKQLLT  508

Query  101  RNKH  90
            R K+
Sbjct  509  RKKN  512



>ref|XP_010032608.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=512

 Score =   406 bits (1043),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 210/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG RLPKF
Sbjct  269  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGINQYT +YMY+PH  K  VPGYQ DWN GFAY K GVPIGPRAH
Sbjct  329  TKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAH  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YKAV Y+KERYGNPTMILSENGMD  GN+T ++  HDT RIN+YK YL 
Sbjct  389  SYWLYNVPWGLYKAVMYIKERYGNPTMILSENGMDDPGNVTLSQGLHDTTRINFYKGYLT  448

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGAN++GY AWSLLDNFEWR GYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  449  QLKKAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMSAYWFKQLLT  508

Query  101  RNKH  90
            R K+
Sbjct  509  RKKN  512



>gb|KCW83978.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   405 bits (1042),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 210/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG RLPKF
Sbjct  269  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGINQYT +YMY+PH  K  VPGYQ DWN GFAY K GVPIGPRAH
Sbjct  329  TKEEVKMVKGSMDFVGINQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAH  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YKAV Y+KERYGNPTMILSENGMD  GN+T ++  HDT RIN+YK YL 
Sbjct  389  SYWLYNVPWGLYKAVMYIKERYGNPTMILSENGMDDPGNVTLSQGLHDTTRINFYKGYLT  448

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGAN++GY AWSLLDNFEWR GYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  449  QLKKAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMSAYWFKQLLT  508

Query  101  RNKH  90
            R K+
Sbjct  509  RKKN  512



>ref|XP_011000474.1| PREDICTED: beta-glucosidase 44-like [Populus euphratica]
Length=514

 Score =   405 bits (1042),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFV+YEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLPKF
Sbjct  271  GRIGILLDFVYYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGSRLPKF  330

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGIN YTTYYMY+PH +KP   GYQ DWN GFAY+K GV IGPRA+
Sbjct  331  TEEEVKMVKGSMDFVGINHYTTYYMYDPHQSKPKNLGYQQDWNAGFAYKKKGVEIGPRAY  390

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYKAV Y+KERYGNPT+ILSENGMD  GNLT +++  DT RI YYK+YL 
Sbjct  391  SYWLYNVPWGMYKAVMYIKERYGNPTIILSENGMDDPGNLTRSKALQDTTRIGYYKAYLS  450

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGAN++GY AWSLLDNFEWRLGYTSRFG+VYVDY +LKR PK SA WF++++ 
Sbjct  451  QLKKAVDDGANLVGYFAWSLLDNFEWRLGYTSRFGIVYVDYSSLKRYPKMSANWFKHLLE  510

Query  101  RNKH  90
            RNKH
Sbjct  511  RNKH  514



>ref|XP_002322086.2| hypothetical protein POPTR_0015s04280g [Populus trichocarpa]
 gb|EEF06213.2| hypothetical protein POPTR_0015s04280g [Populus trichocarpa]
Length=515

 Score =   405 bits (1041),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/244 (78%), Positives = 212/244 (87%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFV+YEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLPKF
Sbjct  272  GRIGILLDFVYYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGSRLPKF  331

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGIN YTTYYMY+PH +KP   GYQ DWN GFAY+K GV IGPRA+
Sbjct  332  TEEEVKMVKGSMDFVGINHYTTYYMYDPHQSKPKNLGYQQDWNAGFAYKKKGVEIGPRAN  391

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYKAV Y+KERYGNPTMILSENGMD  GNLT +++  DT RI YYK+YL 
Sbjct  392  SYWLYNVPWGMYKAVMYIKERYGNPTMILSENGMDDPGNLTRSKAMQDTTRIGYYKAYLS  451

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA DDGAN++GY AWSLLDNFEWRLGYTSRFG+VYVDY  LKR PK SA WF++++ 
Sbjct  452  QLKKAADDGANLVGYFAWSLLDNFEWRLGYTSRFGIVYVDYSNLKRYPKMSANWFKHLLE  511

Query  101  RNKH  90
            RNKH
Sbjct  512  RNKH  515



>ref|XP_002322085.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEF06212.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=514

 Score =   405 bits (1041),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/244 (78%), Positives = 212/244 (87%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFV+YEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLPKF
Sbjct  271  GRIGILLDFVYYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGSRLPKF  330

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGIN YTTYYMY+PH +KP   GYQ DWN GFAY+K GV IGPRA+
Sbjct  331  TEEEVKMVKGSMDFVGINHYTTYYMYDPHQSKPKNLGYQQDWNAGFAYKKKGVEIGPRAN  390

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYKAV Y+KERYGNPTMILSENGMD  GNLT +++  DT RI YYK+YL 
Sbjct  391  SYWLYNVPWGMYKAVMYIKERYGNPTMILSENGMDDPGNLTRSKAMQDTTRIGYYKAYLS  450

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA DDGAN++GY AWSLLDNFEWRLGYTSRFG+VYVDY  LKR PK SA WF++++ 
Sbjct  451  QLKKAADDGANLVGYFAWSLLDNFEWRLGYTSRFGIVYVDYSNLKRYPKMSANWFKHLLE  510

Query  101  RNKH  90
            RNKH
Sbjct  511  RNKH  514



>gb|ACU24532.1| unknown [Glycine max]
Length=506

 Score =   405 bits (1040),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP TRSKADN+AAQRARDFH+GWF+HP+VYGEYPKT+QNIVG RLPKF
Sbjct  263  GRIGILLDFVWYEPPTRSKADNFAAQRARDFHIGWFIHPLVYGEYPKTIQNIVGNRLPKF  322

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVK+VKGSID+VGINQYTT+++Y+PH +KP VPGYQ DWN GFAY KNGVPIGPRA+
Sbjct  323  TSEEVKIVKGSIDFVGINQYTTFFIYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGPRAN  382

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY V WGMYK++ Y+KERYGNPT+ILSENGMD  GN+T  +  HDT RINYYK YL 
Sbjct  383  SYWLYNVLWGMYKSLMYIKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLT  442

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+KTLKR PK SA WF+ +I 
Sbjct  443  QLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKQLIT  502

Query  101  RNKH  90
            + K+
Sbjct  503  KKKY  506



>ref|XP_007036679.1| B-S glucosidase 44 isoform 1 [Theobroma cacao]
 gb|EOY21180.1| B-S glucosidase 44 isoform 1 [Theobroma cacao]
Length=513

 Score =   405 bits (1041),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 211/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG RLPKF
Sbjct  270  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGNRLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSID+VGINQYT YYMY+PH +KP V GYQ DWN GFAY K GVPIGPRA+
Sbjct  330  TKEEVKMVKGSIDFVGINQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYAKRGVPIGPRAN  389

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWG+YKA+ Y+KERYGNPT+ILSENGMD  GN+T ++  HDT RINYYK+YL 
Sbjct  390  SNWLYNVPWGLYKALMYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRINYYKAYLT  449

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QL+KA+D GANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+  LKR PK SA WF+ ++ 
Sbjct  450  QLRKAVDGGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFSNLKRYPKMSAYWFKQLLT  509

Query  101  RNKH  90
            R KH
Sbjct  510  RKKH  513



>ref|XP_010097587.1| Beta-glucosidase 44 [Morus notabilis]
 gb|EXB69119.1| Beta-glucosidase 44 [Morus notabilis]
Length=512

 Score =   403 bits (1036),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 213/243 (88%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI  DFVWYEPLTRSKADNYAAQRARDFH+GWFLHPIVYGEYP+T+Q IVG+RLPKF
Sbjct  270  GRIGILTDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPRTIQEIVGERLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T ++VKMVKGSID+VGINQYT+YYMY+PH +KP V GYQ DWNVGFAY KNG  IGPRA+
Sbjct  330  TKEQVKMVKGSIDFVGINQYTSYYMYDPHASKPKVLGYQQDWNVGFAYAKNGKLIGPRAY  389

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VP G+YK + Y+KERYGNPT+ILSENGMD  GN+T A+  HDT R+NYY+SYL+
Sbjct  390  SEWLYQVPSGLYKCLMYLKERYGNPTVILSENGMDDPGNVTLAQGLHDTTRVNYYRSYLL  449

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA DDGANVIGY AWSLLDNFEWRLGYTSRFG+VYVDY +LKR PK SA WFQ +++
Sbjct  450  QLKKAADDGANVIGYFAWSLLDNFEWRLGYTSRFGMVYVDYHSLKRYPKMSAYWFQKLLK  509

Query  101  RNK  93
            RNK
Sbjct  510  RNK  512



>ref|XP_007209912.1| hypothetical protein PRUPE_ppa004380mg [Prunus persica]
 gb|EMJ11111.1| hypothetical protein PRUPE_ppa004380mg [Prunus persica]
Length=513

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+T+Q IVG RLPKF
Sbjct  270  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTIQEIVGDRLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGINQYT YYMY+PH +KP V GYQ DWN GFAY+KNGVPIGPRA+
Sbjct  330  TKEEVKMVKGSMDFVGINQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYKKNGVPIGPRAY  389

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWG+YKA++Y+KE YGNP +ILSENGMD  GN T AE  HDT RI +YKSY+I
Sbjct  390  SSWLYQVPWGLYKALTYIKEHYGNPPVILSENGMDNPGNWTRAEVLHDTTRIKFYKSYMI  449

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+D+GANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+KTL+R PK SA WF+ ++ 
Sbjct  450  QLKKAVDEGANVLGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLERYPKMSAYWFKKLLT  509

Query  101  RNKH  90
            + KH
Sbjct  510  KTKH  513



>ref|XP_008374823.1| PREDICTED: beta-glucosidase 44-like [Malus domestica]
Length=513

 Score =   402 bits (1032),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 209/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKT+Q IVG RLPKF
Sbjct  270  GRIGILLDFVWYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTVQEIVGDRLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+DYVGINQYTTYYMY P  +K  V GYQ DWN GFAY KNGVPIGPRA+
Sbjct  330  TKEEVKMVKGSMDYVGINQYTTYYMYHPKPSKSNVLGYQQDWNAGFAYAKNGVPIGPRAY  389

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YKAV Y+KE YGNP +ILSENGMD  GN+T AE   DT R N+Y+SY+ 
Sbjct  390  SYWLYQVPWGLYKAVMYIKEHYGNPPVILSENGMDDPGNVTLAEGLRDTTRANFYRSYIT  449

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA DDGANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+KTLKR PK SA WF+ ++ 
Sbjct  450  QLKKAADDGANVMGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSANWFKKLLT  509

Query  101  RNKH  90
            RNKH
Sbjct  510  RNKH  513



>ref|XP_002533126.1| beta-glucosidase, putative [Ricinus communis]
 gb|EEF29253.1| beta-glucosidase, putative [Ricinus communis]
Length=517

 Score =   401 bits (1031),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 212/244 (87%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLPKF
Sbjct  274  GKIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGTRLPKF  333

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T  EV+MVKGSID+VGINQYTTYY+ +PH  KP   GYQ DW+ GFAYEKNGVP+GP+A+
Sbjct  334  TKQEVEMVKGSIDFVGINQYTTYYISDPHQAKPKYLGYQQDWDAGFAYEKNGVPVGPKAN  393

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWGMYKA++Y+KE YGNPT+ILSENGMD  GN+T  +  HDT RINYYK YL 
Sbjct  394  SYWLYNVPWGMYKALTYIKEHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLT  453

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            Q+KKAIDDGANV+GY AWSL+DNFEWR GYTSRFG+VYVD+ TLKR PK SA WF+ M++
Sbjct  454  QMKKAIDDGANVVGYFAWSLVDNFEWRSGYTSRFGIVYVDFTTLKRYPKMSAYWFKQMLQ  513

Query  101  RNKH  90
            R K+
Sbjct  514  RKKN  517



>ref|XP_011084444.1| PREDICTED: beta-glucosidase 44-like [Sesamum indicum]
Length=502

 Score =   400 bits (1029),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 211/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HP+VYGEYPKTMQNIVGKRLPKF
Sbjct  259  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFMHPLVYGEYPKTMQNIVGKRLPKF  318

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS D+VGINQYT YYMY+         GYQ DW  GFAY+++GVPIGPRAH
Sbjct  319  TKEEVKMVKGSFDFVGINQYTAYYMYDAKQTNSKDLGYQQDWQCGFAYDRHGVPIGPRAH  378

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY+VPWG+YKAV+Y+KERYGNPTMIL+ENGMD  GNLT  +  HDT RINYYKSYL+
Sbjct  379  SYWLYIVPWGLYKAVNYIKERYGNPTMILAENGMDQPGNLTIPKVLHDTVRINYYKSYLV  438

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAI DGANV+GY  W+ +DNFEWRLGYTSRFG+VYVD+KTLKR PK SA WF+ + +
Sbjct  439  ELKKAIKDGANVVGYFQWTFVDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKRLQQ  498

Query  101  RNKH  90
            R+KH
Sbjct  499  RDKH  502



>gb|KCW83979.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
 gb|KCW83980.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 209/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQNIVG RLPKF
Sbjct  269  GSIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQNIVGDRLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGINQYT YY+ +P+  K  VPGYQ DWN GFAY K GVPIGPRAH
Sbjct  329  TKEEVKMVKGSMDFVGINQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAH  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YKAV Y+KERYGNPTMILSENGMD  GN+T ++  HDT RIN+YK YL 
Sbjct  389  SYWLYNVPWGLYKAVMYIKERYGNPTMILSENGMDDPGNVTLSQGLHDTTRINFYKGYLT  448

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGAN++GY AWSLLDNFEWR GYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  449  QLKKAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMSAYWFKQLLT  508

Query  101  RNKH  90
            R K+
Sbjct  509  RKKN  512



>ref|XP_008240180.1| PREDICTED: beta-glucosidase 44-like [Prunus mume]
Length=513

 Score =   399 bits (1024),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+T+Q IVG RLPKF
Sbjct  270  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTIQEIVGDRLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGINQYT YYMY+PH +KP V GYQ DWN GFAY+KN VPIGPRA+
Sbjct  330  TKEEVKMVKGSMDFVGINQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYKKNEVPIGPRAY  389

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWG+YKA++Y+KE YGNP +ILSENGMD  GN T A+  HDT RI +YKSY+I
Sbjct  390  SSWLYQVPWGLYKALTYIKEHYGNPPVILSENGMDNPGNWTRAKGLHDTTRIKFYKSYII  449

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+D+GANV+GY AWSLLDNFEWRLGYTSRFGLVYVD+KTL+R PK SA WF+ ++ 
Sbjct  450  QLKKAVDEGANVMGYFAWSLLDNFEWRLGYTSRFGLVYVDFKTLERYPKMSAYWFKKLLT  509

Query  101  RNKH  90
            + KH
Sbjct  510  KTKH  513



>ref|XP_009624185.1| PREDICTED: beta-glucosidase 44-like [Nicotiana tomentosiformis]
Length=513

 Score =   398 bits (1022),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+FGI LDFVW+EPLT+SKADNYAAQRARDF LGWFLHP++YGEYPKTMQNIVG RLPKF
Sbjct  270  GKFGIILDFVWFEPLTKSKADNYAAQRARDFELGWFLHPLIYGEYPKTMQNIVGNRLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +E+KMVKGSIDYVGIN YTT+Y Y+ H +KP   GY+ DWN  FAY++ G PIGPRAH
Sbjct  330  TKEEIKMVKGSIDYVGINHYTTFYAYDRHLSKPKALGYRQDWNCAFAYDRKGAPIGPRAH  389

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKAV+YVKE YGNPT++LSENGMDYAGN++  E+ HDTKRI+YY+SYL 
Sbjct  390  SDWLYIVPWGLYKAVNYVKEHYGNPTIVLSENGMDYAGNISLPEALHDTKRIDYYRSYLA  449

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAID GANVIGY AWSLLDNFEWR GYTSRFG++YVDY+TL+R PK SA WF+ +++
Sbjct  450  ELKKAIDKGANVIGYFAWSLLDNFEWRRGYTSRFGIIYVDYRTLERYPKMSAYWFKQLLQ  509

Query  101  RNKH  90
            R+ H
Sbjct  510  RHMH  513



>ref|XP_010032621.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
 gb|KCW83984.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   398 bits (1022),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 209/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQNIVG RLPKF
Sbjct  269  GSIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQNIVGDRLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGINQYT YY+ +P+  K  VPGYQ DWN GFAY K GVPIGPRAH
Sbjct  329  TKEEVKMVKGSMDFVGINQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAH  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YKAV Y+KERYGNP +ILSENGMD  GN+T ++  HDT RIN+YK YL 
Sbjct  389  SYWLYNVPWGLYKAVMYIKERYGNPPVILSENGMDDPGNVTLSQGLHDTTRINFYKGYLT  448

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGAN++GY AWSLLDNFEWRLGYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  449  QLKKAVDDGANLVGYFAWSLLDNFEWRLGYTSRFGIVYVDYTNLKRYPKMSAYWFKQLLT  508

Query  101  RNKH  90
            R K+
Sbjct  509  RKKN  512



>gb|EYU40222.1| hypothetical protein MIMGU_mgv1a004735mg [Erythranthe guttata]
Length=512

 Score =   397 bits (1021),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 210/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLT+SKADNYAAQRARDFH+GWF+HP+VYGEYPKTMQNIVGKRLPKF
Sbjct  269  GRIGILLDFVWYEPLTKSKADNYAAQRARDFHIGWFMHPLVYGEYPKTMQNIVGKRLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T DEVKMVKGS D+VGINQYT YY+Y+     P   GYQ DWN GFAY+++GVPIGPRAH
Sbjct  329  TKDEVKMVKGSFDFVGINQYTAYYIYDAKQENPKNLGYQQDWNSGFAYDRHGVPIGPRAH  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY+VPWG+YKAV+Y+KE YGNPTMIL+ENGMD  G LT     +DT RINYYKSYL+
Sbjct  389  SYWLYIVPWGLYKAVNYIKEHYGNPTMILAENGMDQPGELTLPAVLNDTIRINYYKSYLV  448

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAID+GANV GY  W+ +DNFEWRLGYTSRFG+VYVD+KTLKR PK SA WFQ + +
Sbjct  449  ELKKAIDEGANVEGYFQWTFVDNFEWRLGYTSRFGIVYVDFKTLKRYPKFSAYWFQKLQQ  508

Query  101  RNKH  90
            RNKH
Sbjct  509  RNKH  512



>ref|XP_009347765.1| PREDICTED: beta-glucosidase 44-like [Pyrus x bretschneideri]
Length=513

 Score =   397 bits (1020),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 208/244 (85%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKT+Q IVG RLPKF
Sbjct  270  GRIGILLDFVWYEPLTRSKADNLAAQRARDFHVGWFIHPIVYGEYPKTVQEIVGDRLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+DYVGINQYTTYYMY P  +K    GYQ DWN GFAY KNGVPIGPRA+
Sbjct  330  TKEEVKMVKGSMDYVGINQYTTYYMYHPKPSKSNDLGYQQDWNAGFAYAKNGVPIGPRAY  389

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YKAV Y+KERYGNP +ILSENGMD  GN+T AE   DT R N+Y+SY+ 
Sbjct  390  SYWLYQVPWGLYKAVMYIKERYGNPPVILSENGMDDPGNVTLAEGLRDTTRANFYRSYIT  449

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA DDGANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+KTLKR PK SA WF+ ++ 
Sbjct  450  QLKKAADDGANVMGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKKLLT  509

Query  101  RNKH  90
             NKH
Sbjct  510  GNKH  513



>emb|CAN74265.1| hypothetical protein VITISV_040977 [Vitis vinifera]
Length=506

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 213/244 (87%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADN AAQR+RDFH+GWF+HPIVYGEYP+TMQ IVG RLPKF
Sbjct  265  GRIGILLDFVWYEPLTRSKADNLAAQRSRDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKF  324

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T  EVKMVKGS+D+VGINQYT YYMY+    KP VPGYQ DW+ GFAYEK+GVPIGPRA+
Sbjct  325  TKAEVKMVKGSMDFVGINQYTAYYMYD--KPKPKVPGYQEDWHAGFAYEKHGVPIGPRAY  382

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWG+YKAV+Y+KERYGNPT+ILSENGMD  GN+T ++  HDTKR+N+Y +YL 
Sbjct  383  SSWLYKVPWGLYKAVTYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTKRVNFYTNYLT  442

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAIDDGANVIGY AWSLLDNFEWRLGYTSRFG+VYVD++TLKR PK SAKWF+ M+ 
Sbjct  443  ELKKAIDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDWRTLKRYPKMSAKWFKQMLA  502

Query  101  RNKH  90
            +  H
Sbjct  503  QKGH  506



>ref|XP_010686092.1| PREDICTED: beta-glucosidase 44-like [Beta vulgaris subsp. vulgaris]
Length=514

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/242 (77%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTR K DNYAAQRARDFH+GWF+HPIVYGEYPKTMQ+IV  RLPKF
Sbjct  273  GRIGILLDFVWYEPLTRGKKDNYAAQRARDFHIGWFIHPIVYGEYPKTMQDIVKDRLPKF  332

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGINQYTTYYMY    N    PGYQ DW+ GF + KNGV IGPRA+
Sbjct  333  TTEEVKMVKGSMDFVGINQYTTYYMYNQQINTTKPPGYQQDWHAGFNFSKNGVQIGPRAN  392

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YKA++Y+KERYGNPTMILSENGMD  GN+T AE  HDTKRI+YY+SYL+
Sbjct  393  SYWLYEVPWGLYKAINYIKERYGNPTMILSENGMDDPGNVTLAEGLHDTKRIHYYRSYLV  452

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
             LKK ID+GANVIGY AWSL+DNFEWRLGYTSRFG+VYVDYK LKR PK SA WF+YM+R
Sbjct  453  ALKKTIDEGANVIGYFAWSLVDNFEWRLGYTSRFGIVYVDYKDLKRYPKMSANWFKYMLR  512

Query  101  RN  96
            R 
Sbjct  513  RQ  514



>ref|XP_002281407.1| PREDICTED: beta-glucosidase 44 [Vitis vinifera]
 emb|CBI15543.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 213/244 (87%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADN AAQR+RDFH+GWF+HPIVYGEYP+TMQ IVG RLPKF
Sbjct  266  GRIGILLDFVWYEPLTRSKADNLAAQRSRDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKF  325

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T  EVKMVKGS+D+VGINQYT YYMY+    KP VPGYQ DW+ GFAYEK+GVPIGPRA+
Sbjct  326  TKAEVKMVKGSMDFVGINQYTAYYMYD--KPKPKVPGYQEDWHAGFAYEKHGVPIGPRAY  383

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWG+YKAV+Y+KERYGNPT+ILSENGMD  GN+T ++  HDTKR+N+Y +YL 
Sbjct  384  SSWLYKVPWGLYKAVTYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTKRVNFYTNYLT  443

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAIDDGANVIGY AWSLLDNFEWRLGYTSRFG+VYVD++TLKR PK SAKWF+ M+ 
Sbjct  444  ELKKAIDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDWRTLKRYPKMSAKWFKQMLA  503

Query  101  RNKH  90
            +  H
Sbjct  504  QKGH  507



>ref|XP_010314225.1| PREDICTED: beta-glucosidase 44-like isoform X2 [Solanum lycopersicum]
Length=502

 Score =   396 bits (1017),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 214/244 (88%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+FGI LDFVWYEPLTRSKADNYAAQRARDF LGWFLHP+V+GEYPKTMQNIVG RLPKF
Sbjct  260  GKFGIILDFVWYEPLTRSKADNYAAQRARDFELGWFLHPLVHGEYPKTMQNIVGNRLPKF  319

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +E+KMVKGSIDYVGIN YTT+Y Y+ H +K     YQ D N GFA ++NGVPIGPRAH
Sbjct  320  TTEEIKMVKGSIDYVGINHYTTFYAYD-HVSKLKALAYQQDQNCGFANDRNGVPIGPRAH  378

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY+VPWG+YKAV+YVKE YGNPT++LSENGMDYAGN++ +E+ HDTKRI+YY+SYL 
Sbjct  379  SYWLYIVPWGLYKAVNYVKEHYGNPTILLSENGMDYAGNISISEALHDTKRIDYYRSYLA  438

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAID+GANVIGY AWSLLDNFEWR GYTSRFG+VYVDY TL+R PK SA WF  +++
Sbjct  439  ELKKAIDEGANVIGYFAWSLLDNFEWRSGYTSRFGIVYVDYTTLERYPKMSAYWFNQLLK  498

Query  101  RNKH  90
             +KH
Sbjct  499  SHKH  502



>ref|XP_010487722.1| PREDICTED: beta-glucosidase 44-like [Camelina sativa]
Length=513

 Score =   396 bits (1018),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 190/243 (78%), Positives = 205/243 (84%), Gaps = 1/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIV  RLPKF
Sbjct  269  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKDRLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPH-NNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMVKGSIDYVGINQYTTYYM EPH   KP   GYQ DWNV F + K G PIGPRA
Sbjct  329  TAEEVKMVKGSIDYVGINQYTTYYMSEPHFTTKPKDLGYQQDWNVQFGFAKLGKPIGPRA  388

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY VPWGMYKA+ Y+KERYGNPTMILSENGMD  GN+T A+  HDT RI YY+ YL
Sbjct  389  HSTWLYNVPWGMYKALMYIKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRDYL  448

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
              LKKA DDGANV+GY AWSLLDNFEW  GYTSRFG+VYVDYKTLKR PK SAKWF+ ++
Sbjct  449  TNLKKATDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSAKWFRKLL  508

Query  104  RRN  96
            +RN
Sbjct  509  KRN  511



>ref|XP_010533966.1| PREDICTED: beta-glucosidase 44-like [Tarenaya hassleriana]
Length=514

 Score =   396 bits (1017),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 209/244 (86%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTR KADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLPKF
Sbjct  270  GRIGILLDFVWYEPLTRGKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGDRLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPP-VPGYQNDWNVGFAYEKNGVPIGPRA  465
            + +EVKMVKGS+D+VGINQYTTYYMY+PH + PP   GYQ DWN GFA+ K G PIGPRA
Sbjct  330  SEEEVKMVKGSMDFVGINQYTTYYMYDPHLSNPPKYFGYQQDWNAGFAFSKKGKPIGPRA  389

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +SYWLY VPWGMYKA+ Y+KERYGNPT+ILSENGMD  GN+T ++  HDT RI +Y+ YL
Sbjct  390  NSYWLYNVPWGMYKALMYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRIGFYRGYL  449

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             QLKKA+DDGANV GY AWSLLDNFEW+LGYTSRFG+VYVDYK LKR PK SA WF+ ++
Sbjct  450  TQLKKAVDDGANVAGYFAWSLLDNFEWKLGYTSRFGIVYVDYKNLKRYPKMSAHWFKQLL  509

Query  104  RRNK  93
             RNK
Sbjct  510  ERNK  513



>gb|KEH16706.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=514

 Score =   395 bits (1016),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 183/243 (75%), Positives = 205/243 (84%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LD VWYE LTRSKADNYAAQRARDFH+GWFLHPIVYGEYP+TMQ IVG RLPKF
Sbjct  272  GSIGILLDLVWYESLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPRTMQTIVGNRLPKF  331

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EV +VKGSID+VGINQYTT+Y+Y+P   KP VPGYQ DWN  FAY KNGVP+GPR +
Sbjct  332  TKEEVNLVKGSIDFVGINQYTTFYVYDPRQQKPKVPGYQKDWNAEFAYAKNGVPVGPREY  391

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWG+YK+V Y+KE Y NPTM LSENGMD  GN+TF++  HDT RINYYK YL 
Sbjct  392  SSWLYNVPWGLYKSVMYIKEHYKNPTMFLSENGMDDPGNVTFSKGLHDTTRINYYKGYLT  451

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAIDDGANV GYHAWSLLDNFEWRLGYTSRFG+VYVD+KTLKR PK SA WF+ ++ 
Sbjct  452  QLKKAIDDGANVFGYHAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRTPKMSAYWFKQLLT  511

Query  101  RNK  93
            + K
Sbjct  512  KKK  514



>gb|KCW83981.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   395 bits (1015),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/244 (75%), Positives = 208/244 (85%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQNIVG RLPKF
Sbjct  269  GSIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQNIVGDRLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGINQYT YY+ +P+  K  VPGYQ DWN GFAY K GVPIGPRAH
Sbjct  329  TKEEVKMVKGSMDFVGINQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAH  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YKAV Y+KERYGNP +ILSENGMD  GN+T ++  HDT RIN+YK YL 
Sbjct  389  SYWLYNVPWGLYKAVMYIKERYGNPPVILSENGMDDPGNVTLSQGLHDTTRINFYKGYLT  448

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGAN++GY AWSLLDNFEWR GYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  449  QLKKAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMSAYWFKQLLT  508

Query  101  RNKH  90
            R K+
Sbjct  509  RKKN  512



>gb|KCW83987.1| hypothetical protein EUGRSUZ_B00860 [Eucalyptus grandis]
Length=490

 Score =   394 bits (1013),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 208/244 (85%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDF WYEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYP+TMQ IVG RLPKF
Sbjct  247  GRIGILLDFTWYEPLTRSKADNDAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKF  306

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGINQYT YYMY+PH  K  V GYQ DWN G+A+EK+GVPIGPRAH
Sbjct  307  TKEEVKMVKGSMDFVGINQYTAYYMYDPHQPKAKVSGYQQDWNAGYAFEKHGVPIGPRAH  366

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWG+YKAV Y+KERYGNPT+ILSENGMD  GN+T ++  HDT RIN+YK Y+ 
Sbjct  367  SSWLYNVPWGLYKAVMYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRINFYKGYIT  426

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV+GY AWSLLDNFEW+ GYTSRFG+VY+DY  LKR PK SA WF+ ++ 
Sbjct  427  QLKKAVDDGANVVGYFAWSLLDNFEWKSGYTSRFGIVYIDYTNLKRYPKMSAYWFEQLLS  486

Query  101  RNKH  90
            R K+
Sbjct  487  RKKN  490



>gb|KJB34273.1| hypothetical protein B456_006G057000 [Gossypium raimondii]
 gb|KJB34274.1| hypothetical protein B456_006G057000 [Gossypium raimondii]
Length=506

 Score =   395 bits (1014),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/244 (75%), Positives = 209/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKAD YAAQRA DFH+GWF+HP+VYGEYP+TMQ I G RLPKF
Sbjct  263  GRIGILLDFVWYEPLTRSKADRYAAQRAIDFHVGWFIHPLVYGEYPRTMQVIAGNRLPKF  322

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS D+VGINQYTTYY+Y+PH +KP VPGYQ DWN GFAY K GV IGPRA+
Sbjct  323  TKEEVKMVKGSFDFVGINQYTTYYIYDPHQSKPKVPGYQQDWNAGFAYAKRGVAIGPRAY  382

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWG+YK + Y+KE+YGNPT+ILSENGMD  GN+T A+  HDT R+NYYK+YL 
Sbjct  383  SPWLYNVPWGLYKCLMYIKEKYGNPTVILSENGMDDPGNVTLAQGLHDTTRMNYYKAYLT  442

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+D+GANVIGY AWSLLDNFEWRLGYTSRFG+VYVDY TL+R PK SA WF+ ++ 
Sbjct  443  QLKKAVDNGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYSTLQRYPKMSAYWFKQLLT  502

Query  101  RNKH  90
            R KH
Sbjct  503  RKKH  506



>ref|XP_010032630.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=512

 Score =   395 bits (1014),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 208/244 (85%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDF WYEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYP+TMQ IVG RLPKF
Sbjct  269  GRIGILLDFTWYEPLTRSKADNDAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGINQYT YYMY+PH  K  V GYQ DWN G+A+EK+GVPIGPRAH
Sbjct  329  TKEEVKMVKGSMDFVGINQYTAYYMYDPHQPKAKVSGYQQDWNAGYAFEKHGVPIGPRAH  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWG+YKAV Y+KERYGNPT+ILSENGMD  GN+T ++  HDT RIN+YK Y+ 
Sbjct  389  SSWLYNVPWGLYKAVMYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRINFYKGYIT  448

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV+GY AWSLLDNFEW+ GYTSRFG+VY+DY  LKR PK SA WF+ ++ 
Sbjct  449  QLKKAVDDGANVVGYFAWSLLDNFEWKSGYTSRFGIVYIDYTNLKRYPKMSAYWFEQLLS  508

Query  101  RNKH  90
            R K+
Sbjct  509  RKKN  512



>ref|XP_004252272.1| PREDICTED: beta-glucosidase 44-like isoform X1 [Solanum lycopersicum]
Length=526

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 214/244 (88%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+FGI LDFVWYEPLTRSKADNYAAQRARDF LGWFLHP+V+GEYPKTMQNIVG RLPKF
Sbjct  284  GKFGIILDFVWYEPLTRSKADNYAAQRARDFELGWFLHPLVHGEYPKTMQNIVGNRLPKF  343

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +E+KMVKGSIDYVGIN YTT+Y Y+ H +K     YQ D N GFA ++NGVPIGPRAH
Sbjct  344  TTEEIKMVKGSIDYVGINHYTTFYAYD-HVSKLKALAYQQDQNCGFANDRNGVPIGPRAH  402

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY+VPWG+YKAV+YVKE YGNPT++LSENGMDYAGN++ +E+ HDTKRI+YY+SYL 
Sbjct  403  SYWLYIVPWGLYKAVNYVKEHYGNPTILLSENGMDYAGNISISEALHDTKRIDYYRSYLA  462

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAID+GANVIGY AWSLLDNFEWR GYTSRFG+VYVDY TL+R PK SA WF  +++
Sbjct  463  ELKKAIDEGANVIGYFAWSLLDNFEWRSGYTSRFGIVYVDYTTLERYPKMSAYWFNQLLK  522

Query  101  RNKH  90
             +KH
Sbjct  523  SHKH  526



>ref|XP_011039106.1| PREDICTED: beta-glucosidase 44-like [Populus euphratica]
Length=514

 Score =   394 bits (1011),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 184/244 (75%), Positives = 210/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFV+YEPLT SKADN AAQRARDFH+GWF+HPIVYGEYPKTM+NIVG RLP+F
Sbjct  271  GRIGILLDFVYYEPLTSSKADNLAAQRARDFHIGWFIHPIVYGEYPKTMKNIVGNRLPQF  330

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EV+MVKGS+D+VGINQYTT+YMY+PH  KP   GYQ DWNVGFAY+KNGVPIGPRA+
Sbjct  331  TKEEVRMVKGSMDFVGINQYTTFYMYDPHQPKPKYLGYQQDWNVGFAYKKNGVPIGPRAN  390

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWGMYKAV Y+KERYGNPT+ILSENGMD  GN T +++ HDT RI Y+K+YL 
Sbjct  391  SNWLYNVPWGMYKAVMYIKERYGNPTIILSENGMDDPGNFTRSKALHDTTRIGYFKAYLT  450

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA D+GAN+ GY AWSLLDNFEWR GYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  451  QLKKAADEGANLAGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMSAYWFKKLLE  510

Query  101  RNKH  90
            RNKH
Sbjct  511  RNKH  514



>ref|XP_002883107.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59366.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score =   392 bits (1008),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 206/243 (85%), Gaps = 1/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIV +RLPKF
Sbjct  269  GRIGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKERLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPH-NNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMVKGSID+VGINQYTTYYM EPH   KP   GYQ DWNV F + K G PIGPRA
Sbjct  329  TKEEVKMVKGSIDFVGINQYTTYYMSEPHPTTKPKALGYQQDWNVDFGFAKLGKPIGPRA  388

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +SYWLY VPWGMYKA+ Y+KERYGNPTMILSENGMD  GN+T A+  HDT RI YYK YL
Sbjct  389  YSYWLYNVPWGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYKDYL  448

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
              LKKA DDGANV+GY AWSLLDNFEW  GYTSRFG+VYVDYKTLKR PK SA+WF+ ++
Sbjct  449  TNLKKARDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSAQWFKQLL  508

Query  104  RRN  96
            +RN
Sbjct  509  KRN  511



>ref|XP_010465882.1| PREDICTED: beta-glucosidase 44 [Camelina sativa]
Length=513

 Score =   392 bits (1008),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 204/243 (84%), Gaps = 1/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HP+VYGEYPKTMQNIV  RLPKF
Sbjct  269  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPLVYGEYPKTMQNIVKDRLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPH-NNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            T  EVKMVKGSIDYVGINQYTTYYM EPH   KP   GYQ DWNV F + K G PIGPRA
Sbjct  329  TAKEVKMVKGSIDYVGINQYTTYYMSEPHPTTKPKDLGYQQDWNVEFGFAKLGKPIGPRA  388

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY VPWGMYKA+ Y+KERYGNPTMILSENGMD  GN+T A+  HDT RI YY+ YL
Sbjct  389  HSTWLYNVPWGMYKALMYIKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRDYL  448

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
              LKKA DDGANV+GY AWSLLDNFEW  GYTSRFG+VYVDYKTLKR PK SA+WF+ ++
Sbjct  449  TNLKKATDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSARWFRKLL  508

Query  104  RRN  96
            +RN
Sbjct  509  KRN  511



>ref|XP_006353826.1| PREDICTED: beta-glucosidase 44-like [Solanum tuberosum]
Length=502

 Score =   390 bits (1003),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/241 (76%), Positives = 211/241 (88%), Gaps = 1/241 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+FGI LDFVWYEPLTRSKADNYAAQRARDF LGWFLHP+VYGEYPKTMQNIV  RLPKF
Sbjct  262  GKFGIILDFVWYEPLTRSKADNYAAQRARDFELGWFLHPLVYGEYPKTMQNIVRDRLPKF  321

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T DE+KMVKGSIDYVGIN YTT+Y Y+ H +K     YQ D N GFA ++NGVPIGPRAH
Sbjct  322  TTDEIKMVKGSIDYVGINHYTTFYAYD-HLSKLKALAYQQDQNCGFANDRNGVPIGPRAH  380

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY+VPWG+YKAV+YVKE YGNPT++LSENGMDYAGN++ +++ HDTKRI+YY+SYL 
Sbjct  381  SYWLYIVPWGLYKAVNYVKEHYGNPTILLSENGMDYAGNISLSDALHDTKRIDYYRSYLA  440

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAID+GANVIGY AWSLLDNFEWR GYTSRFG+VYVDY TLKR PK SA WF+ +++
Sbjct  441  KLKKAIDEGANVIGYFAWSLLDNFEWRSGYTSRFGIVYVDYTTLKRYPKMSAYWFKQLLQ  500

Query  101  R  99
             
Sbjct  501  E  501



>gb|KCW83982.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=513

 Score =   390 bits (1003),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 184/245 (75%), Positives = 208/245 (85%), Gaps = 1/245 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQNIVG RLPKF
Sbjct  269  GSIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQNIVGDRLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGS+D+VGINQYT YY+ +P+  K  VPGYQ DWN GFAY K GVPIGPRAH
Sbjct  329  TKEEVKMVKGSMDFVGINQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAH  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY VPWG+YKAV Y+KERYGNP +ILSENGMD  GN+T ++  HDT RIN+YK YL 
Sbjct  389  SYWLYNVPWGLYKAVMYIKERYGNPPVILSENGMDDPGNVTLSQGLHDTTRINFYKGYLT  448

Query  281  QLKK-AIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
            QLKK A+DDGAN++GY AWSLLDNFEWR GYTSRFG+VYVDY  LKR PK SA WF+ ++
Sbjct  449  QLKKAAVDDGANLVGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMSAYWFKQLL  508

Query  104  RRNKH  90
             R K+
Sbjct  509  TRKKN  513



>ref|XP_010506359.1| PREDICTED: beta-glucosidase 44-like [Camelina sativa]
Length=513

 Score =   390 bits (1003),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 205/243 (84%), Gaps = 1/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIV +RLPKF
Sbjct  269  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKERLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPH-NNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMVKGSIDYVGINQYTTYYM EPH   KP   GYQ DWNV F + K G  IGPRA
Sbjct  329  TAEEVKMVKGSIDYVGINQYTTYYMSEPHPTTKPKDLGYQQDWNVQFGFAKLGKLIGPRA  388

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY VPWGMYKA+ Y+KERYGNPTMILSENGMD  GN+T A+  HDT RI YY+ YL
Sbjct  389  HSTWLYNVPWGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRDYL  448

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
              LKKA DDGANV+GY AWSLLDNFEW  GYTSRFG+VYVDYKTLKR PK SA+WF+ ++
Sbjct  449  TNLKKATDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSAQWFRKLL  508

Query  104  RRN  96
            +RN
Sbjct  509  KRN  511



>ref|XP_009799689.1| PREDICTED: beta-glucosidase 44-like [Nicotiana sylvestris]
Length=513

 Score =   390 bits (1001),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 210/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+FGI LDFVW+EPLTRSK DNYAAQRARDF LGWFLHP+VYGEYPKTMQNIVG RLPKF
Sbjct  270  GKFGIILDFVWFEPLTRSKVDNYAAQRARDFELGWFLHPLVYGEYPKTMQNIVGNRLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSIDYVGIN YTT+Y ++ H +KP   GY+ DWN  FAY++ GVPIGPRAH
Sbjct  330  TKEEVKMVKGSIDYVGINHYTTFYAFDRHLSKPKALGYRQDWNCAFAYDRKGVPIGPRAH  389

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKAV+YVKE YGNPT+ILSENGMDYAGN++  E+  DTKR +YY+SYL 
Sbjct  390  SDWLYIVPWGLYKAVNYVKENYGNPTIILSENGMDYAGNISLPEALQDTKRTDYYRSYLA  449

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAI +GANV GY AWSLLDNFEWR GYTSRFG++YVDY+TLKR PK SA WF+ +++
Sbjct  450  ELKKAIVEGANVTGYFAWSLLDNFEWRRGYTSRFGIIYVDYRTLKRYPKMSAYWFKQLLQ  509

Query  101  RNKH  90
             + H
Sbjct  510  HHMH  513



>gb|KDO50113.1| hypothetical protein CISIN_1g0406882mg, partial [Citrus sinensis]
Length=331

 Score =   383 bits (984),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 176/243 (72%), Positives = 210/243 (86%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEPLTRSKADN AAQRARDFH+GWFLHPI YGEYP+TMQ IVG+RLPKF
Sbjct  89   GKIGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFLHPITYGEYPRTMQEIVGERLPKF  148

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T  EV+MVKGSIDY+G+NQYTT+YM++P   KP + GYQNDWNVGFAY++ GVP+GPRA+
Sbjct  149  TDAEVEMVKGSIDYLGVNQYTTFYMFDPPWPKPNITGYQNDWNVGFAYDRKGVPVGPRAN  208

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKA++YVKERY NPTMIL+ENGMD  GN+TF ++ HD  R+NY++ YL 
Sbjct  209  SGWLYIVPWGIYKAITYVKERYQNPTMILAENGMDDPGNVTFPQALHDATRVNYFRDYLS  268

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
             LKKA+DDGAN+IGY AWSLLDNFEW  GYTSRFG+VYVDY  LKR PK SA WFQ +++
Sbjct  269  YLKKAVDDGANLIGYFAWSLLDNFEWLSGYTSRFGIVYVDYDNLKRYPKMSAYWFQKLLK  328

Query  101  RNK  93
            R++
Sbjct  329  RDQ  331



>ref|XP_004299545.1| PREDICTED: beta-glucosidase 44-like [Fragaria vesca subsp. vesca]
Length=512

 Score =   388 bits (997),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/246 (74%), Positives = 209/246 (85%), Gaps = 2/246 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEPLTRSKAD YAAQRARDFH+GWF+HPIVYGEYPKT+QNIVG RLPKF
Sbjct  267  GKIGILLDFVWYEPLTRSKADRYAAQRARDFHVGWFIHPIVYGEYPKTIQNIVGNRLPKF  326

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNN--KPPVPGYQNDWNVGFAYEKNGVPIGPR  468
            T +EVKMVKGS+D+VGIN+YT YY+Y P  N  K    GYQNDWN GFAYEKNGVPIGPR
Sbjct  327  TKEEVKMVKGSMDFVGINEYTAYYIYAPDKNQTKSNALGYQNDWNAGFAYEKNGVPIGPR  386

Query  467  AHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSY  288
            A+S WLY VPWGMYK ++Y+KE YGNP +ILSENGMD  GN T  ++ HDT RI+YY+SY
Sbjct  387  AYSSWLYQVPWGMYKCITYIKEHYGNPPVILSENGMDNPGNQTLPKALHDTNRIHYYRSY  446

Query  287  LIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYM  108
            L QLKKA+D+GANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+ TLKR PK SA WF+ +
Sbjct  447  LEQLKKAVDEGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFTTLKRYPKMSAYWFKKL  506

Query  107  IRRNKH  90
            + + KH
Sbjct  507  LTKKKH  512



>ref|NP_188436.1| beta-glucosidase 44 [Arabidopsis thaliana]
 sp|Q9LV33.1|BGL44_ARATH RecName: Full=Beta-glucosidase 44; Short=AtBGLU44; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB02020.1| beta-glucosidase [Arabidopsis thaliana]
 gb|AAM61427.1| beta-glucosidase, putative [Arabidopsis thaliana]
 dbj|BAH19552.1| AT3G18080 [Arabidopsis thaliana]
 dbj|BAH19607.1| AT3G18080 [Arabidopsis thaliana]
 gb|AEE76044.1| beta-glucosidase 44 [Arabidopsis thaliana]
Length=512

 Score =   387 bits (994),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/243 (77%), Positives = 204/243 (84%), Gaps = 1/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADN AAQRARDFH+GWF+HP+VYGEYPKTMQNIV +RLPKF
Sbjct  268  GRVGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFIHPLVYGEYPKTMQNIVKERLPKF  327

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPH-NNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            T  EVKMVKGSID+VGINQYTTYYM EPH   KP   GYQ DWNV F + K G PIGPRA
Sbjct  328  TEKEVKMVKGSIDFVGINQYTTYYMSEPHPTTKPKDLGYQQDWNVEFGFAKLGKPIGPRA  387

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +S WLY VPWGMYKA+ Y+KERYGNPTMILSENGMD  GN+T A+  HDT RI YYK YL
Sbjct  388  YSSWLYNVPWGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYKDYL  447

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
              LKKA DDGANV+GY AWSLLDNFEW  GYTSRFG+VYVDYKTLKR PK SA+WF+ ++
Sbjct  448  TNLKKARDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSAQWFKQLL  507

Query  104  RRN  96
            +RN
Sbjct  508  KRN  510



>ref|XP_007036680.1| B-S glucosidase 44 isoform 2 [Theobroma cacao]
 gb|EOY21181.1| B-S glucosidase 44 isoform 2 [Theobroma cacao]
Length=469

 Score =   385 bits (989),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 199/227 (88%), Gaps = 0/227 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG RLPKF
Sbjct  207  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGNRLPKF  266

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSID+VGINQYT YYMY+PH +KP V GYQ DWN GFAY K GVPIGPRA+
Sbjct  267  TKEEVKMVKGSIDFVGINQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYAKRGVPIGPRAN  326

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWG+YKA+ Y+KERYGNPT+ILSENGMD  GN+T ++  HDT RINYYK+YL 
Sbjct  327  SNWLYNVPWGLYKALMYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRINYYKAYLT  386

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRA  141
            QL+KA+D GANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+  LK A
Sbjct  387  QLRKAVDGGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFSNLKSA  433



>ref|XP_006297463.1| hypothetical protein CARUB_v10013483mg [Capsella rubella]
 gb|EOA30361.1| hypothetical protein CARUB_v10013483mg [Capsella rubella]
Length=511

 Score =   386 bits (992),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 204/244 (84%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIV +RLPKF
Sbjct  267  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKERLPKF  326

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPH-NNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            T DEVKMVKGSID+VGINQYTTYYM EPH   K    GYQ DWNV F + K G PIG RA
Sbjct  327  TADEVKMVKGSIDFVGINQYTTYYMSEPHPTTKSKDLGYQQDWNVEFGFAKLGKPIGSRA  386

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +S WLY VPWGMYKA+ Y+KERYGNPTMILSENGMD  GN+T A+  HDT RI YY+ YL
Sbjct  387  YSKWLYNVPWGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRDYL  446

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
              LKKA DDGANV+GY AWSLLDNFEW  GYTSRFG+VYVDY TLKR PK SA+WF+ ++
Sbjct  447  TNLKKARDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDYTTLKRYPKMSAQWFRKLL  506

Query  104  RRNK  93
            +RNK
Sbjct  507  KRNK  510



>ref|XP_007036681.1| B-S glucosidase 44 isoform 3 [Theobroma cacao]
 gb|EOY21182.1| B-S glucosidase 44 isoform 3 [Theobroma cacao]
Length=532

 Score =   386 bits (991),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 199/227 (88%), Gaps = 0/227 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG RLPKF
Sbjct  270  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGNRLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSID+VGINQYT YYMY+PH +KP V GYQ DWN GFAY K GVPIGPRA+
Sbjct  330  TKEEVKMVKGSIDFVGINQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYAKRGVPIGPRAN  389

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWG+YKA+ Y+KERYGNPT+ILSENGMD  GN+T ++  HDT RINYYK+YL 
Sbjct  390  SNWLYNVPWGLYKALMYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRINYYKAYLT  449

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRA  141
            QL+KA+D GANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+  LK A
Sbjct  450  QLRKAVDGGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFSNLKSA  496



>ref|XP_006431835.1| hypothetical protein CICLE_v10004010mg [Citrus clementina]
 gb|ESR45075.1| hypothetical protein CICLE_v10004010mg [Citrus clementina]
Length=506

 Score =   385 bits (989),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 176/243 (72%), Positives = 210/243 (86%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEPLTRSKADN AAQRARDFH+GWFLHPI YGEYP+TMQ IVG+RLPKF
Sbjct  264  GKIGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFLHPITYGEYPRTMQEIVGERLPKF  323

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T  EV+MVKGSIDY+G+NQYTT+YM++P   KP + GYQNDWNVGFAY++ GVP+GPRA+
Sbjct  324  TDAEVEMVKGSIDYLGVNQYTTFYMFDPPWPKPNITGYQNDWNVGFAYDRKGVPVGPRAN  383

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKA++YVKERY NPTMIL+ENGMD  GN+TF ++ HD  R+NY++ YL 
Sbjct  384  SGWLYIVPWGIYKAITYVKERYQNPTMILAENGMDDPGNVTFPQALHDATRVNYFRDYLS  443

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
             LKKA+DDGAN+IGY AWSLLDNFEW  GYTSRFG+VYVDY  LKR PK SA WFQ +++
Sbjct  444  YLKKAVDDGANLIGYFAWSLLDNFEWLSGYTSRFGIVYVDYDNLKRYPKMSAYWFQKLLK  503

Query  101  RNK  93
            R++
Sbjct  504  RDQ  506



>ref|XP_006471035.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=507

 Score =   385 bits (988),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 176/243 (72%), Positives = 210/243 (86%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEPLTRSKADN AAQRARDFH+GWFLHPI YGEYP+TMQ IVG+RLPKF
Sbjct  265  GKIGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFLHPITYGEYPRTMQEIVGERLPKF  324

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T  EV+MVKGSIDY+G+NQYTT+YM++P   KP + GYQNDWNVGFAY++ GVP+GPRA+
Sbjct  325  TDAEVEMVKGSIDYLGVNQYTTFYMFDPPWPKPNITGYQNDWNVGFAYDRKGVPVGPRAN  384

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKA++YVKERY NPTMIL+ENGMD  GN+TF ++ HD  R+NY++ YL 
Sbjct  385  SGWLYIVPWGIYKAITYVKERYQNPTMILAENGMDDPGNVTFPQALHDATRVNYFRDYLS  444

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
             LKKA+DDGAN+IGY AWSLLDNFEW  GYTSRFG+VYVDY  LKR PK SA WFQ +++
Sbjct  445  YLKKAVDDGANLIGYFAWSLLDNFEWLSGYTSRFGIVYVDYDNLKRYPKMSAYWFQKLLK  504

Query  101  RNK  93
            R++
Sbjct  505  RDQ  507



>gb|KFK39134.1| beta-glucosidase 44 [Arabis alpina]
Length=514

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/245 (75%), Positives = 207/245 (84%), Gaps = 5/245 (2%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADN AAQRARDFH+GWF+HP+VYGEYPKTMQ IV +RLPKF
Sbjct  270  GRIGILLDFVWYEPLTRSKADNLAAQRARDFHIGWFIHPLVYGEYPKTMQYIVKERLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVP---GYQNDWNVGFAYEKNGVPIGP  471
            T +EVKMVKGSID+VGINQYTTY+M + HN  P +P   GYQ DWN  F++ K G PIGP
Sbjct  330  TEEEVKMVKGSIDFVGINQYTTYFMSDTHN--PTIPKDLGYQQDWNATFSFAKLGKPIGP  387

Query  470  RAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKS  291
            RA+SYWLY VPWGMYKA+ Y+KERYGNPTMILSENGMD  GN+T A+  HDT RI YYK 
Sbjct  388  RAYSYWLYNVPWGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYKD  447

Query  290  YLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQY  111
            YL QLKKA+DDGANV GY AWSLLDNFEW  GYTSRFG+VYVDYKTLKR PK SA+WF+ 
Sbjct  448  YLTQLKKAVDDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSAQWFKQ  507

Query  110  MIRRN  96
            +++RN
Sbjct  508  LLKRN  512



>ref|XP_008810053.1| PREDICTED: beta-glucosidase 1-like [Phoenix dactylifera]
Length=509

 Score =   384 bits (986),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/241 (77%), Positives = 207/241 (86%), Gaps = 1/241 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLT SK D+ AAQRARDFHLGWFLHPI+YGEYPKTMQNIV +RLPKF
Sbjct  266  GRIGILLDFVWYEPLTDSKDDHAAAQRARDFHLGWFLHPIIYGEYPKTMQNIVKERLPKF  325

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPG-YQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMV GSIDYVGINQYT YYMY+ H ++P  P  Y NDW+V FAY +NGVPIGPRA
Sbjct  326  TVEEVKMVNGSIDYVGINQYTAYYMYDSHLSEPQKPTRYANDWHVVFAYARNGVPIGPRA  385

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +S WLY+VPWGMYKAVSYVKE Y NPTMILSENGMD  GN+T  +  HDT RINYYKSY+
Sbjct  386  YSDWLYIVPWGMYKAVSYVKEHYRNPTMILSENGMDDPGNMTLPKGLHDTTRINYYKSYI  445

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAIDDGANVIGY AWSLLDNFEW+LGYTSRFG+VYVD++TLKR PK SA WF+ M+
Sbjct  446  TELKKAIDDGANVIGYFAWSLLDNFEWKLGYTSRFGIVYVDFRTLKRYPKMSAYWFREML  505

Query  104  R  102
            +
Sbjct  506  K  506



>emb|CDX95557.1| BnaC01g34490D [Brassica napus]
Length=514

 Score =   383 bits (984),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 184/244 (75%), Positives = 204/244 (84%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKAD  AAQRARDFH+GWF+HPIVYGEYP+TMQNIV  RLPKF
Sbjct  270  GRIGILLDFVWYEPLTRSKADYLAAQRARDFHIGWFIHPIVYGEYPQTMQNIVKDRLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVP-GYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMVKGSID+VGINQYTTY+M + HN   P   GYQ DWN  F + K G PIGPRA
Sbjct  330  TEEEVKMVKGSIDFVGINQYTTYFMSDTHNATIPKELGYQQDWNATFGFAKLGKPIGPRA  389

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +SYWLY VPWGMYKA+ Y+KERYGNPTMILSENGMD +GN+T A+  HDT RI YYK YL
Sbjct  390  YSYWLYNVPWGMYKALMYMKERYGNPTMILSENGMDDSGNVTLAQGLHDTTRIKYYKDYL  449

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             QLKKA+DDGANV GY AWSLLDNFEW  GYTSRFG+VYVDYKTLKR PK SA+WF  ++
Sbjct  450  TQLKKAVDDGANVKGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSAQWFMQLL  509

Query  104  RRNK  93
            +RNK
Sbjct  510  KRNK  513



>ref|XP_004299546.1| PREDICTED: beta-glucosidase 44-like [Fragaria vesca subsp. vesca]
Length=513

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/246 (73%), Positives = 207/246 (84%), Gaps = 2/246 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LDF WYEPLT SK D  AAQRARDFH+GWF+HPIVYGEYPKTMQ+IVG RLPKF
Sbjct  268  GSVGILLDFNWYEPLTSSKDDRDAAQRARDFHIGWFIHPIVYGEYPKTMQHIVGDRLPKF  327

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNK--PPVPGYQNDWNVGFAYEKNGVPIGPR  468
            T +EVKMVKGSID+VGINQYT YYMY+PH NK  P   GYQNDWN GFA+EKNGV IGP+
Sbjct  328  TKEEVKMVKGSIDFVGINQYTAYYMYDPHQNKTKPNALGYQNDWNAGFAFEKNGVLIGPQ  387

Query  467  AHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSY  288
            A+S WLY VPWG+YK V+Y+K+ YGNPT+I+SENGMD  GN T  E+ HDT RI++Y+SY
Sbjct  388  AYSSWLYQVPWGLYKCVTYIKKNYGNPTVIISENGMDNPGNQTLQEALHDTNRIDFYRSY  447

Query  287  LIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYM  108
            L QLKKA+D+GANV+GY AWSLLDNFEWRLGYTSRFG+VYVD+ TLKR PK SA WF+ +
Sbjct  448  LEQLKKAVDEGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFTTLKRYPKMSAYWFKKL  507

Query  107  IRRNKH  90
            + + KH
Sbjct  508  LTKKKH  513



>ref|XP_009394432.1| PREDICTED: beta-glucosidase 1-like [Musa acuminata subsp. malaccensis]
Length=511

 Score =   381 bits (979),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/245 (74%), Positives = 204/245 (83%), Gaps = 1/245 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLT SK D  AAQR+RDFHLGWFLHPI+YGEYPK+MQ IV  RLPKF
Sbjct  266  GRIGILLDFVWYEPLTDSKDDQDAAQRSRDFHLGWFLHPIIYGEYPKSMQEIVQARLPKF  325

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPG-YQNDWNVGFAYEKNGVPIGPRA  465
            T +E+KMVKGSIDYVGINQYT YYM++PH  K   P  YQ+DWN GFA+E+NGVPIGPRA
Sbjct  326  TEEEIKMVKGSIDYVGINQYTAYYMFDPHLPKQEKPTRYQSDWNAGFAFERNGVPIGPRA  385

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY+VPWGMYKAV+YVKE YGNPT+ILSENGMD  GN+T  +  HDT RINYY+SY+
Sbjct  386  HSEWLYIVPWGMYKAVTYVKEHYGNPTVILSENGMDDPGNVTLRQGLHDTTRINYYRSYI  445

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAIDDGA VIGY AWSLLDNFEW+ GYTSRFG+VYVDYK L+R  K SA WF+ M+
Sbjct  446  TELKKAIDDGATVIGYFAWSLLDNFEWKSGYTSRFGIVYVDYKNLRRYAKMSAYWFKQML  505

Query  104  RRNKH  90
             R K 
Sbjct  506  DRGKR  510



>ref|XP_007033088.1| Beta-glucosidase 44 [Theobroma cacao]
 gb|EOY04014.1| Beta-glucosidase 44 [Theobroma cacao]
Length=511

 Score =   381 bits (978),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 176/244 (72%), Positives = 207/244 (85%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTR KADNYAAQRARDFH+GWFLHP+VYGEYPKTMQNIVG+RLPKF
Sbjct  268  GRIGILLDFVWYEPLTRGKADNYAAQRARDFHIGWFLHPLVYGEYPKTMQNIVGERLPKF  327

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            +  +V+ VK S D++GIN YT++YMY+PH  KP V GYQ DWNVGFA+E+ G PIG RAH
Sbjct  328  SKSDVETVKNSFDFIGINHYTSFYMYDPHQPKPNVTGYQQDWNVGFAFERWGEPIGRRAH  387

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWG+YKAV+YVKERYGNP +IL+ENGMD  GN+TF E+  D +R+NYY+SYL 
Sbjct  388  SGWLYQVPWGIYKAVTYVKERYGNPNVILAENGMDNPGNVTFPEALFDRERVNYYRSYLK  447

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+A+DDGANV GY AWSLLDNFEW LGY+SRFG+VYVD+KTLKR PK SA WF+ M+ 
Sbjct  448  ELKRAMDDGANVTGYFAWSLLDNFEWLLGYSSRFGMVYVDFKTLKRYPKMSAYWFKQMLE  507

Query  101  RNKH  90
            R + 
Sbjct  508  RKQQ  511



>gb|KFK39133.1| beta-glucosidase 44 [Arabis alpina]
Length=497

 Score =   380 bits (975),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 175/244 (72%), Positives = 206/244 (84%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVW+EPLT S+ADN AAQRARDFH+GWF+HP+VYGEYPKTMQNIV +RLP+F
Sbjct  253  GRIGILLDFVWFEPLTSSEADNDAAQRARDFHVGWFIHPVVYGEYPKTMQNIVKERLPRF  312

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVP-GYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMVKGSID+VGINQYTTY+M +PH + PP   GYQ DWNV F + KNG PIG RA
Sbjct  313  TEEEVKMVKGSIDFVGINQYTTYFMSDPHLSTPPKDLGYQQDWNVAFNFAKNGTPIGSRA  372

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY VPWGMYKA+ Y+KE YGNPTMILSENGMD  GN+T A+  +DT R NYY+ YL
Sbjct  373  HSEWLYNVPWGMYKALMYIKEHYGNPTMILSENGMDDPGNITLAQGLNDTTRTNYYRDYL  432

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
            +QLKKA+DDGAN+ GY AWSLLDNFEW  GYTSRFG+VYVDY++LKR PK SA WF+ ++
Sbjct  433  LQLKKAVDDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYQSLKRYPKMSALWFKQLL  492

Query  104  RRNK  93
            +R++
Sbjct  493  KRDQ  496



>gb|EPS65829.1| beta-mannosidase, partial [Genlisea aurea]
Length=472

 Score =   379 bits (972),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 175/243 (72%), Positives = 203/243 (84%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDF WYEP TRSKAD+YAAQRARDFHLGWFLHP+VYGEYPKTMQNIV +RLPKF
Sbjct  230  GRIGILLDFTWYEPHTRSKADSYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVSERLPKF  289

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T  EVKMVKGS D+VG+NQYT YY Y+     P   GYQ DWN GFAYE+NG+PIGPRA+
Sbjct  290  TSREVKMVKGSFDFVGLNQYTAYYAYDAGRPNPTNKGYQQDWNCGFAYERNGIPIGPRAN  349

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY+VPWG+YKAVSY+KERYGNPT+ILSENGMD  GNLT  E+  D +RI+YY+ Y+ 
Sbjct  350  SYWLYIVPWGLYKAVSYIKERYGNPTVILSENGMDQPGNLTLPEALRDRRRIDYYERYIG  409

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+A+D+GANVIGY  W+ +DNFEWRLGYTSRFG+VYVD+KTL+R PK SA WF    +
Sbjct  410  ELKRAVDEGANVIGYFQWTFVDNFEWRLGYTSRFGIVYVDFKTLRRYPKSSAYWFGKFQK  469

Query  101  RNK  93
            R K
Sbjct  470  REK  472



>emb|CDX95558.1| BnaC01g34500D [Brassica napus]
Length=493

 Score =   377 bits (969),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 204/244 (84%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVW+EPLT S+ADN AAQRARDFHLGWF+HPIVYGEYPKTMQ+IV +RLPKF
Sbjct  250  GRIGILLDFVWFEPLTSSEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQDIVKERLPKF  309

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPH-NNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVK+VKGSID+VGINQYTTYYM  PH   KP   GYQ DWNV F + K+G PIGPRA
Sbjct  310  TEEEVKLVKGSIDFVGINQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDGKPIGPRA  369

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY VPWGMYKA+ YVKE YGNPTMILSENGMD AGN+T A+  +DT RI YY+ YL
Sbjct  370  HSEWLYNVPWGMYKAMMYVKEHYGNPTMILSENGMDDAGNITQAQGVNDTSRITYYRDYL  429

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             QLKKA+DDGANV GY AWSLLDNFEW  GYTSRFG+VYVDYK LKR PK SA WF+ ++
Sbjct  430  TQLKKAVDDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFRRLL  489

Query  104  RRNK  93
            +R++
Sbjct  490  KRDQ  493



>ref|XP_007048474.1| Beta-glucosidase 44 [Theobroma cacao]
 gb|EOX92631.1| Beta-glucosidase 44 [Theobroma cacao]
Length=562

 Score =   379 bits (974),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 174/244 (71%), Positives = 206/244 (84%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTR KADNYAAQRARDFH+GWFLHP+VYGEYP+TMQ IVG+RLPKF
Sbjct  319  GRIGILLDFVWYEPLTRGKADNYAAQRARDFHVGWFLHPLVYGEYPRTMQEIVGERLPKF  378

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            +  +VK VK S D++GINQYT+YYMY+P   KP V GYQ DWNVGFA+E+ G PIG RA+
Sbjct  379  SKSDVKTVKNSFDFIGINQYTSYYMYDPDQPKPNVTGYQQDWNVGFAHERTGNPIGRRAY  438

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWGMYKAV+Y+KERYGNP +IL+ENGMD  GN+T  ++ +D +R+NYY+SYL 
Sbjct  439  SPWLYEVPWGMYKAVTYIKERYGNPNVILAENGMDDPGNVTLPDALYDRERVNYYRSYLK  498

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+A+DDGANV GY AWSLLDNFEW  GY+SRFG+VYVD+KTLKR PK SA WF+ M+ 
Sbjct  499  ELKRAMDDGANVTGYFAWSLLDNFEWLSGYSSRFGIVYVDFKTLKRYPKMSAHWFKQMLE  558

Query  101  RNKH  90
            R KH
Sbjct  559  RKKH  562



>emb|CDO98378.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   375 bits (963),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 201/242 (83%), Gaps = 0/242 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEP T SK D+ AAQRARDFH+GWF+HP+VYGEYPK +QNIV  RLPKF
Sbjct  207  GKIGILLDFVWYEPHTYSKEDSDAAQRARDFHIGWFMHPLVYGEYPKNLQNIVADRLPKF  266

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVK+VKGS DYVG+NQYT YYMY+PH  +    GYQ DWN GFAY++NGVPIGPRAH
Sbjct  267  TKEEVKIVKGSFDYVGVNQYTAYYMYDPHRGQQKDLGYQQDWNCGFAYDRNGVPIGPRAH  326

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWG+YKAV YVKE+Y NPT+IL+ENGMD  GNLT      DT RI+YYK+YL 
Sbjct  327  SDWLYKVPWGLYKAVMYVKEKYQNPTIILAENGMDDPGNLTLPAGLKDTARISYYKAYLA  386

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QL+K +DDGANVIGY AWSLLDNFEWRLGYTSRFG+VYVD+KTLKR PK SA+WFQ ++ 
Sbjct  387  QLRKTMDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSARWFQKLLH  446

Query  101  RN  96
            R 
Sbjct  447  RQ  448



>ref|XP_008792825.1| PREDICTED: beta-glucosidase 1-like [Phoenix dactylifera]
Length=512

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 209/244 (86%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLT SKAD  AAQRARDFHLGWFLHPIVYGEYPKTMQ IV +RLPKF
Sbjct  269  GRIGILLDFVWYEPLTISKADQAAAQRARDFHLGWFLHPIVYGEYPKTMQEIVKERLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPG-YQNDWNVGFAYEKNGVPIGPRA  465
            T +E+KMVKGSIDYVGINQYTTYYMY P    P  P  Y NDWN GFAYE+NGVPIGPRA
Sbjct  329  TVEEIKMVKGSIDYVGINQYTTYYMYHPLLPAPQKPTRYANDWNCGFAYERNGVPIGPRA  388

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY+VPWGMYKAVSYVKE+YGNPT+ILSENGMD  GN+T  +  HDT RINYYKSY+
Sbjct  389  HSDWLYIVPWGMYKAVSYVKEQYGNPTVILSENGMDDPGNITLPKGLHDTTRINYYKSYI  448

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LK+AIDDGANVIGY AWSLLDNFEW+LGYTSRFG+VYVDY+TLKR PK SA WF  M+
Sbjct  449  TELKRAIDDGANVIGYFAWSLLDNFEWKLGYTSRFGVVYVDYRTLKRYPKMSAYWFGEML  508

Query  104  RRNK  93
            RR K
Sbjct  509  RRKK  512



>ref|NP_001078176.1| beta glucosidase 43 [Arabidopsis thaliana]
 gb|ABE65945.1| glycosyl hydrolase family 1 protein [Arabidopsis thaliana]
 gb|AEE76043.1| beta glucosidase 43 [Arabidopsis thaliana]
Length=424

 Score =   374 bits (960),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/244 (71%), Positives = 203/244 (83%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYGEYP T+QNIV +RLPKF
Sbjct  180  GRVGILLDFVWFEPLTSSQADNDAAQRARDFHVGWFIHPIVYGEYPNTLQNIVKERLPKF  239

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPH-NNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMVKGSID+VGINQYTTY+M +P  +  P   GYQ DWNV F + KNG PIGPRA
Sbjct  240  TEEEVKMVKGSIDFVGINQYTTYFMSDPKISTTPKDLGYQQDWNVTFNFAKNGTPIGPRA  299

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY VPWGMYKA+ Y++ERYGNPTMILSENGMD  GN+T  +  +DT R+ YY+ YL
Sbjct  300  HSEWLYNVPWGMYKALMYIEERYGNPTMILSENGMDDPGNITLTQGLNDTTRVKYYRDYL  359

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
            +QLKKA+DDGAN+ GY AWSLLDNFEW  GYTSRFG+VYVDYK LKR PK SA WF+ ++
Sbjct  360  VQLKKAVDDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFKQLL  419

Query  104  RRNK  93
            +R++
Sbjct  420  KRDQ  423



>ref|XP_010487721.1| PREDICTED: beta-glucosidase 43 [Camelina sativa]
Length=504

 Score =   376 bits (966),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/244 (72%), Positives = 204/244 (84%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYG+YP TMQNIV +RLPKF
Sbjct  260  GRIGILLDFVWFEPLTSSEADNDAAQRARDFHVGWFIHPIVYGKYPNTMQNIVKERLPKF  319

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPP-VPGYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMVKGSID++GINQYTTY+M +P  + PP   GYQ DWNV F + KNG PIGPRA
Sbjct  320  TEEEVKMVKGSIDFIGINQYTTYFMSDPKISTPPKALGYQQDWNVAFNFAKNGTPIGPRA  379

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY VPWGMYKA+ Y+KE YGNPTMILSENGMD  GN+T A+  +DT RINYY+ YL
Sbjct  380  HSEWLYNVPWGMYKALMYIKEHYGNPTMILSENGMDDPGNITLAQGLNDTTRINYYRDYL  439

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             QLKKA+D+GANV GY AWSLLDNFEW  GYTSRFG+VYVDYK LKR PK SA WF+ ++
Sbjct  440  AQLKKAVDEGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFKQLL  499

Query  104  RRNK  93
            +R++
Sbjct  500  KRDQ  503



>ref|XP_009113523.1| PREDICTED: beta-glucosidase 44 [Brassica rapa]
 emb|CDY18495.1| BnaA01g27000D [Brassica napus]
Length=514

 Score =   376 bits (966),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/244 (75%), Positives = 200/244 (82%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKAD  AAQRARDFH+GWF+HPIVYGEYP+TMQ IV  RLPKF
Sbjct  270  GRIGILLDFVWYEPLTRSKADYLAAQRARDFHIGWFIHPIVYGEYPQTMQYIVKDRLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVP-GYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMVKGSID+VGINQYTTY+M + HN   P   GYQ DWN  F Y K G PIGPRA
Sbjct  330  TEEEVKMVKGSIDFVGINQYTTYFMSDTHNATIPKELGYQQDWNATFGYAKLGKPIGPRA  389

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +SYWLY VPWGMYKA+ Y+KE YGNPTMILSENGMD  GN+T A+  HDT RI YYK YL
Sbjct  390  YSYWLYNVPWGMYKALMYMKEHYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYKDYL  449

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             QLKKA+DDGANV GY AWSLLDNFEW  GYTSRFG+VYVDYKTLKR PK SA+WF  ++
Sbjct  450  TQLKKAVDDGANVKGYFAWSLLDNFEWLSGYTSRFGIVYVDYKTLKRYPKMSAQWFMQLL  509

Query  104  RRNK  93
             RNK
Sbjct  510  NRNK  513



>ref|XP_009113531.1| PREDICTED: beta-glucosidase 43 [Brassica rapa]
Length=498

 Score =   375 bits (964),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 202/244 (83%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVW+EPLT S+ADN AAQRARDFHLGWF+HPIVYGEYPKTMQNIV +RLP F
Sbjct  255  GRIGILLDFVWFEPLTSSEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQNIVKERLPNF  314

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPH-NNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMVKGSID+VGINQYTTYYM  PH   KP   GYQ DWNV F + K+G PIGPRA
Sbjct  315  TEEEVKMVKGSIDFVGINQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDGKPIGPRA  374

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY VPWGMYKA+ YVKE YGNPTMILSENGMD AGN+T A+  +DT RI YY+ YL
Sbjct  375  HSEWLYNVPWGMYKAMMYVKEHYGNPTMILSENGMDDAGNITQAQGVNDTSRITYYRDYL  434

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             QLKKA++DGANV GY AWSLLDNFEW  GYTSRFG+VYVDYK LKR PK SA WF+ ++
Sbjct  435  TQLKKAVEDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFKRIL  494

Query  104  RRNK  93
             R++
Sbjct  495  ERDQ  498



>gb|KJB16857.1| hypothetical protein B456_002G251100 [Gossypium raimondii]
Length=337

 Score =   370 bits (949),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 201/241 (83%), Gaps = 0/241 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GIFLDFVWYEPLTRSKADNYAAQRARDFH+GWFLHP+VYG+YP+TMQ IV +RLPKF
Sbjct  94   GRIGIFLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPLVYGKYPRTMQKIVRERLPKF  153

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T  EV+ VK S D + +N YT+YY+YEPH     V GYQ DWN GFAYE+NGVPIG RAH
Sbjct  154  TKSEVEKVKNSFDVLCLNHYTSYYIYEPHQPPSNVTGYQQDWNAGFAYERNGVPIGRRAH  213

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWGMYKAV+YVK+RYG+P +ILSENGMD  GNLTF ES +D  R+++Y+SYL 
Sbjct  214  SEWLYEVPWGMYKAVTYVKKRYGSPNIILSENGMDDPGNLTFPESLYDINRVSFYRSYLK  273

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+A+DDGANV GY AWS+LDNFEW LGYTSRFGLVYVD+  LKR PK SA WF+ M+ 
Sbjct  274  ELKRAMDDGANVTGYFAWSILDNFEWLLGYTSRFGLVYVDHNDLKRYPKLSAYWFKQMLE  333

Query  101  R  99
            R
Sbjct  334  R  334



>emb|CDY18494.1| BnaA01g27010D [Brassica napus]
Length=524

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 202/244 (83%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVW+EPLT S+ADN AAQRARDFHLGWF+HPIVYGEYPKTMQNIV +RLP F
Sbjct  281  GRIGILLDFVWFEPLTSSEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQNIVKERLPNF  340

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPH-NNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMVKGSID+VGINQYTTYYM  PH   KP   GYQ DWNV F + K+G PIGPRA
Sbjct  341  TEEEVKMVKGSIDFVGINQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDGKPIGPRA  400

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY VPWGMYKA+ YVKE YGNPTMILSENGMD AGN+T A+  +DT RI YY+ YL
Sbjct  401  HSEWLYNVPWGMYKAMMYVKEHYGNPTMILSENGMDDAGNITQAQGVNDTSRITYYRDYL  460

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             QLKKA++DGANV GY AWSLLDNFEW  GYTSRFG+VYVDYK LKR PK SA WF+ ++
Sbjct  461  TQLKKAVEDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFKRIL  520

Query  104  RRNK  93
             R++
Sbjct  521  ERDQ  524



>gb|KJB16881.1| hypothetical protein B456_002G252700 [Gossypium raimondii]
Length=512

 Score =   375 bits (964),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 175/241 (73%), Positives = 202/241 (84%), Gaps = 0/241 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GIFLDFVWYEPLTRSKADNYAAQRARDFH+GWFLHP+VYG+YP+TMQ IVG+RLPKF
Sbjct  269  GRIGIFLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPLVYGKYPRTMQKIVGERLPKF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T  EV+ +K S D + +N YT+YY+Y+PH     V GYQ DWN GFAYE+NGVPIG RAH
Sbjct  329  TKSEVEKIKNSFDVLCLNHYTSYYIYDPHRPPSNVTGYQQDWNAGFAYERNGVPIGRRAH  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWGMYK V+YVKERYGNP +ILSENGMD  GNLTF ES +D+ R+N+Y+SYL 
Sbjct  389  SEWLYEVPWGMYKVVTYVKERYGNPNIILSENGMDDPGNLTFPESLYDSNRVNFYRSYLK  448

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+A+DDGANV GY AWS+LDNFEW LGYTSRFGLVYVD+  LKR PK SA WF+ M+ 
Sbjct  449  ELKRAMDDGANVSGYFAWSILDNFEWLLGYTSRFGLVYVDHNDLKRYPKLSAYWFKQMLE  508

Query  101  R  99
            R
Sbjct  509  R  509



>ref|XP_010906974.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=510

 Score =   375 bits (963),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 211/244 (86%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLT S+AD  AAQRARDFHLGWFLHPIVYGEYPKT+Q+IV  RLPKF
Sbjct  267  GRIGILLDFVWYEPLTNSEADQAAAQRARDFHLGWFLHPIVYGEYPKTLQDIVKDRLPKF  326

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPG-YQNDWNVGFAYEKNGVPIGPRA  465
            T +E+KMVKGSIDYVGIN YT+YYMY+PH  +P  P  Y NDWN GFA+E+NGVPIGPRA
Sbjct  327  TVEEIKMVKGSIDYVGINHYTSYYMYDPHLPEPQKPTRYANDWNCGFAFERNGVPIGPRA  386

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +SYWLY+VPWGMYKAV+YVKE+YGNPT+ILSENGMD  GN+T     HDT RINYYKSY+
Sbjct  387  YSYWLYIVPWGMYKAVTYVKEQYGNPTVILSENGMDDPGNVTLPNGLHDTTRINYYKSYI  446

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAIDDGANVIGY AWSLLDNFEW+LGYTSRFGLVYVDY+ LKR PK SA WF  M+
Sbjct  447  TELKKAIDDGANVIGYFAWSLLDNFEWKLGYTSRFGLVYVDYRNLKRYPKMSAYWFGQML  506

Query  104  RRNK  93
            +RNK
Sbjct  507  QRNK  510



>ref|XP_006299658.1| hypothetical protein CARUB_v10015846mg [Capsella rubella]
 gb|EOA32556.1| hypothetical protein CARUB_v10015846mg [Capsella rubella]
Length=491

 Score =   374 bits (960),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 177/245 (72%), Positives = 203/245 (83%), Gaps = 1/245 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LDFVW+EPLT SKADN AAQRARDFH+GWF+HPIVYGEYP TMQNIV +RLPKF
Sbjct  247  GMIGILLDFVWFEPLTSSKADNDAAQRARDFHVGWFIHPIVYGEYPNTMQNIVKERLPKF  306

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVP-GYQNDWNVGFAYEKNGVPIGPRA  465
            T +EV+M+KGSID+VGINQYTTY+M +P    PP   GYQ DWNV F Y KNG PIGPRA
Sbjct  307  TEEEVRMMKGSIDFVGINQYTTYFMSDPKITTPPKNLGYQQDWNVAFNYAKNGTPIGPRA  366

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +S WLY VPWGMYKA+ Y+KE YGNPTMILSENGMD  GN+T A+  +DT RI+YY+ YL
Sbjct  367  YSEWLYNVPWGMYKALMYIKEHYGNPTMILSENGMDDPGNITLAQGLNDTTRISYYRDYL  426

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             QLKKA+DDGANV GY AWSLLDNFEW  GYTSRFG+VYVDYK LKR PK SA WF+ ++
Sbjct  427  AQLKKAVDDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFKQLL  486

Query  104  RRNKH  90
            +R+K+
Sbjct  487  KRDKN  491



>dbj|BAB02019.1| beta-glucosidase [Arabidopsis thaliana]
Length=495

 Score =   374 bits (959),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/244 (71%), Positives = 203/244 (83%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYGEYP T+QNIV +RLPKF
Sbjct  251  GRVGILLDFVWFEPLTSSQADNDAAQRARDFHVGWFIHPIVYGEYPNTLQNIVKERLPKF  310

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPH-NNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMVKGSID+VGINQYTTY+M +P  +  P   GYQ DWNV F + KNG PIGPRA
Sbjct  311  TEEEVKMVKGSIDFVGINQYTTYFMSDPKISTTPKDLGYQQDWNVTFNFAKNGTPIGPRA  370

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY VPWGMYKA+ Y++ERYGNPTMILSENGMD  GN+T  +  +DT R+ YY+ YL
Sbjct  371  HSEWLYNVPWGMYKALMYIEERYGNPTMILSENGMDDPGNITLTQGLNDTTRVKYYRDYL  430

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
            +QLKKA+DDGAN+ GY AWSLLDNFEW  GYTSRFG+VYVDYK LKR PK SA WF+ ++
Sbjct  431  VQLKKAVDDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFKQLL  490

Query  104  RRNK  93
            +R++
Sbjct  491  KRDQ  494



>ref|NP_188435.2| beta glucosidase 43 [Arabidopsis thaliana]
 sp|Q9LV34.2|BGL43_ARATH RecName: Full=Beta-glucosidase 43; Short=AtBGLU43; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE76042.1| beta glucosidase 43 [Arabidopsis thaliana]
Length=501

 Score =   374 bits (959),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/244 (71%), Positives = 203/244 (83%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVW+EPLT S+ADN AAQRARDFH+GWF+HPIVYGEYP T+QNIV +RLPKF
Sbjct  257  GRVGILLDFVWFEPLTSSQADNDAAQRARDFHVGWFIHPIVYGEYPNTLQNIVKERLPKF  316

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPH-NNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMVKGSID+VGINQYTTY+M +P  +  P   GYQ DWNV F + KNG PIGPRA
Sbjct  317  TEEEVKMVKGSIDFVGINQYTTYFMSDPKISTTPKDLGYQQDWNVTFNFAKNGTPIGPRA  376

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY VPWGMYKA+ Y++ERYGNPTMILSENGMD  GN+T  +  +DT R+ YY+ YL
Sbjct  377  HSEWLYNVPWGMYKALMYIEERYGNPTMILSENGMDDPGNITLTQGLNDTTRVKYYRDYL  436

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
            +QLKKA+DDGAN+ GY AWSLLDNFEW  GYTSRFG+VYVDYK LKR PK SA WF+ ++
Sbjct  437  VQLKKAVDDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFKQLL  496

Query  104  RRNK  93
            +R++
Sbjct  497  KRDQ  500



>ref|XP_010257514.1| PREDICTED: beta-glucosidase 44-like isoform X2 [Nelumbo nucifera]
Length=534

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 202/244 (83%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDF+WYEPLTR KAD YAAQRA DF+LGWFLHPIVYGEYPKTMQN VGKRLPKF
Sbjct  291  GRIGIVLDFIWYEPLTRRKADQYAAQRAIDFYLGWFLHPIVYGEYPKTMQNTVGKRLPKF  350

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T + +KMVKGSID++GINQYT +Y Y  H  K   PGY+ D NVGFA+ K+GVPIGPRA+
Sbjct  351  TKENIKMVKGSIDFLGINQYTAHYAYALHQTKKHAPGYEKDLNVGFAFAKSGVPIGPRAN  410

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPW +YK ++Y+KE YGNPT+I++ENGMD  GN+T  +  HDT+RIN+Y+ YL 
Sbjct  411  SAWLYDVPWSLYKVLTYIKEYYGNPTVIITENGMDEPGNVTLPKGLHDTRRINFYRGYLT  470

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAIDDG NV+GY AWSL+D FEWRLGYT+RFG+VY+D+KTLKR PK SA WF+ ++ 
Sbjct  471  QLKKAIDDGVNVVGYFAWSLIDTFEWRLGYTTRFGIVYIDFKTLKRYPKMSAYWFRELLH  530

Query  101  RNKH  90
            R KH
Sbjct  531  RKKH  534



>ref|XP_006376723.1| hypothetical protein POPTR_0012s04670g [Populus trichocarpa]
 gb|ERP54520.1| hypothetical protein POPTR_0012s04670g [Populus trichocarpa]
Length=546

 Score =   374 bits (960),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 199/238 (84%), Gaps = 0/238 (0%)
 Frame = -2

Query  803  LDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKFTPDEVK  624
            L F      T SKADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLP+FT +EVK
Sbjct  309  LGFCLLRTFTSSKADNLAAQRARDFHIGWFIHPIVYGEYPKTMQNIVGNRLPQFTKEEVK  368

Query  623  MVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAHSYWLYM  444
            MVKGS+D+VGINQYTT+YMY+PH  KP   GYQ DWNVGFAY+KNGVPIGPRA+S WLY 
Sbjct  369  MVKGSMDFVGINQYTTFYMYDPHQPKPKYLGYQQDWNVGFAYKKNGVPIGPRANSNWLYN  428

Query  443  VPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLIQLKKAI  264
            VPWGMYKAV Y+KERYGNPT+ILSENGMD  GN T +++ HDT R+ Y+K+YL QLKKA 
Sbjct  429  VPWGMYKAVMYIKERYGNPTIILSENGMDDPGNFTRSKALHDTTRVGYFKAYLTQLKKAA  488

Query  263  DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIRRNKH  90
            D+GAN+ GY AWSLLDNFEWR GYTSRFG+VYVDY  LKR PK SA WF+ ++ RNKH
Sbjct  489  DEGANLAGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMSAYWFKKLLERNKH  546



>ref|XP_006845279.1| hypothetical protein AMTR_s00005p00266150 [Amborella trichopoda]
 gb|ERN06954.1| hypothetical protein AMTR_s00005p00266150 [Amborella trichopoda]
Length=482

 Score =   371 bits (953),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 173/244 (71%), Positives = 203/244 (83%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + +KAD  AAQR+RDFH+GWFLHPIV+G YP++M  +VG RLPKF
Sbjct  239  GRIGILLDFVWYEPFSNAKADVRAAQRSRDFHIGWFLHPIVFGTYPRSMVRVVGDRLPKF  298

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EV+MVKGSID+VGINQYT+YY+ + H     V  YQ DW+ GF Y ++G  IGP+A+
Sbjct  299  TNEEVEMVKGSIDFVGINQYTSYYITDQHIKNGTVTDYQMDWHAGFEYSRDGKLIGPQAN  358

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLYMVPWGMYKAV+Y+KE Y NPTMILSENGMDYA N+T   + HDTKRI+YY+SYLI
Sbjct  359  SYWLYMVPWGMYKAVTYIKENYRNPTMILSENGMDYAANITLPAALHDTKRISYYRSYLI  418

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
             LKKAIDDGANVIGY AWSL+DNFEWRLGYTSRFGLVYVDY+TLKR PK SA WF+ +I+
Sbjct  419  NLKKAIDDGANVIGYFAWSLVDNFEWRLGYTSRFGLVYVDYQTLKRYPKMSASWFRGLIQ  478

Query  101  RNKH  90
            R  H
Sbjct  479  RKSH  482



>ref|XP_006845277.1| hypothetical protein AMTR_s00005p00265710 [Amborella trichopoda]
 gb|ERN06952.1| hypothetical protein AMTR_s00005p00265710 [Amborella trichopoda]
Length=479

 Score =   371 bits (952),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 173/244 (71%), Positives = 202/244 (83%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + +KAD  AAQR+RDFH+GWFLHPIV+G YP++M  +VG RLPKF
Sbjct  236  GRIGILLDFVWYEPFSNAKADVRAAQRSRDFHIGWFLHPIVFGTYPRSMVRVVGDRLPKF  295

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EV+MVKGSID+VGINQYT+YY+ + H     V  YQ DW+ GF Y ++G  IGP+A+
Sbjct  296  TNEEVEMVKGSIDFVGINQYTSYYIKDQHIKNGTVTDYQMDWHAGFEYSRDGKLIGPQAN  355

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLYMVPWGMYKAV+Y+KE Y NPTMILSENGMDYA N+T   + HDTKRI YY+SYLI
Sbjct  356  SYWLYMVPWGMYKAVTYIKENYRNPTMILSENGMDYAANITLPAALHDTKRIGYYRSYLI  415

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
             LKKAIDDGANVIGY AWSL+DNFEWRLGYTSRFGLVYVDY+TLKR PK SA WF+ +I+
Sbjct  416  NLKKAIDDGANVIGYFAWSLVDNFEWRLGYTSRFGLVYVDYQTLKRYPKMSASWFRGLIQ  475

Query  101  RNKH  90
            R  H
Sbjct  476  RKSH  479



>ref|XP_002883106.1| beta-glucosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59365.1| beta-glucosidase [Arabidopsis lyrata subsp. lyrata]
Length=503

 Score =   372 bits (954),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/244 (72%), Positives = 201/244 (82%), Gaps = 1/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVW+EPLT SKADN AAQRARDFH+GWF+HPIVYGEYP TMQNIV +RLPKF
Sbjct  259  GRIGILLDFVWFEPLTSSKADNDAAQRARDFHVGWFIHPIVYGEYPYTMQNIVKERLPKF  318

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPH-NNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
              +EVKMVKGSID+VGINQYTTY+M +P  +  P   GYQ DWNV F + KNG PIGPRA
Sbjct  319  AEEEVKMVKGSIDFVGINQYTTYFMSDPKISTIPKDLGYQQDWNVTFNFAKNGTPIGPRA  378

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY VPWGMYKA+ Y+KERYGNPTMILSENGMD  GN+T  +  +DT RI YY+ YL
Sbjct  379  HSEWLYNVPWGMYKALMYIKERYGNPTMILSENGMDDPGNITLTQGQNDTTRIKYYRDYL  438

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             QLKKA+DDGAN+ GY AWSLLDNFEW  GYTSRFG+VYVDYK LKR PK SA WF+ ++
Sbjct  439  AQLKKAVDDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKDLKRYPKMSALWFKQLL  498

Query  104  RRNK  93
            +R++
Sbjct  499  KRDQ  502



>gb|ABC55716.1| beta-mannosidase 3 [Oncidium hybrid cultivar]
Length=491

 Score =   371 bits (952),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/243 (70%), Positives = 204/243 (84%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLT S  D  AAQRARDFH+GWFLHPI+YGEYPK++Q+IV +RLP F
Sbjct  249  GRIGILLDFVWYEPLTNSTDDEAAAQRARDFHIGWFLHPIIYGEYPKSVQDIVKERLPTF  308

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +E+ +VKGS+DY+G+NQYT+YYM++PH       GYQ DWNVGFAYE+NGVPIGPRA+
Sbjct  309  TAEEISLVKGSVDYLGVNQYTSYYMFDPHLPTQTSTGYQTDWNVGFAYERNGVPIGPRAN  368

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMYKAV+YVKE Y NPT+ILSENGMD  GN++     HDT R+NYYKSY+ 
Sbjct  369  SEWLYIVPWGMYKAVTYVKENYQNPTIILSENGMDDPGNVSLKVGLHDTTRLNYYKSYIS  428

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+AIDDGA VIGY AWSLLDNFEW+ GYTSRFG+VYVD+KTLKR PK SA WF+ +++
Sbjct  429  ELKRAIDDGATVIGYFAWSLLDNFEWKSGYTSRFGIVYVDFKTLKRYPKMSAYWFRDVLQ  488

Query  101  RNK  93
            + K
Sbjct  489  KKK  491



>ref|XP_006406654.1| hypothetical protein EUTSA_v10020536mg [Eutrema salsugineum]
 ref|XP_006406658.1| hypothetical protein EUTSA_v10020535mg [Eutrema salsugineum]
 gb|ESQ48107.1| hypothetical protein EUTSA_v10020536mg [Eutrema salsugineum]
 gb|ESQ48111.1| hypothetical protein EUTSA_v10020535mg [Eutrema salsugineum]
Length=512

 Score =   371 bits (952),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/243 (73%), Positives = 199/243 (82%), Gaps = 1/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPL +SKAD  AAQRARDFH+GWF+HP+VYGEYPKTMQ IV +RLPKF
Sbjct  268  GRIGILLDFVWYEPLQKSKADYLAAQRARDFHIGWFIHPLVYGEYPKTMQLIVKERLPKF  327

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVP-GYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMVKGSID+VGINQYTTY+M + HN+  P   GYQ DWNV F + K G PIGPRA
Sbjct  328  TEEEVKMVKGSIDFVGINQYTTYFMSDTHNSTIPKDLGYQQDWNVTFGFSKLGKPIGPRA  387

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +SYWLY VPWGMYKA+ Y+KE YGNPTMILSENGMD  GN T A+  HDT RI YY+ YL
Sbjct  388  NSYWLYNVPWGMYKALMYMKEHYGNPTMILSENGMDDPGNFTLAQGLHDTTRIKYYRDYL  447

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             QLKKA+DDGANV GY AWSLLDNFEW  GYTSRFG+VYVDY TLKR PK SA WF  ++
Sbjct  448  TQLKKAVDDGANVKGYFAWSLLDNFEWLSGYTSRFGIVYVDYNTLKRYPKMSALWFNQLL  507

Query  104  RRN  96
            +RN
Sbjct  508  KRN  510



>gb|KJB16855.1| hypothetical protein B456_002G250900 [Gossypium raimondii]
Length=504

 Score =   371 bits (952),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 201/241 (83%), Gaps = 0/241 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GIFLDFVWYEPLTRSKADNYAAQRARDFH+GWFLHP+VYG+YP+TMQ IV +RLPKF
Sbjct  261  GRIGIFLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPLVYGKYPRTMQKIVRERLPKF  320

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T  EV+ VK S D + +N YT+YY+YEPH     V GYQ DWN GFAYE+NGVPIG RAH
Sbjct  321  TKSEVEKVKNSFDVLCLNHYTSYYIYEPHQPPSNVTGYQQDWNAGFAYERNGVPIGRRAH  380

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWGMYKAV+YVK+RYG+P +ILSENGMD  GNLTF ES +D  R+++Y+SYL 
Sbjct  381  SEWLYEVPWGMYKAVTYVKKRYGSPNIILSENGMDDPGNLTFPESLYDINRVSFYRSYLK  440

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+A+DDGANV GY AWS+LDNFEW LGYTSRFGLVYVD+  LKR PK SA WF+ M+ 
Sbjct  441  ELKRAMDDGANVTGYFAWSILDNFEWLLGYTSRFGLVYVDHNDLKRYPKLSAYWFKQMLE  500

Query  101  R  99
            R
Sbjct  501  R  501



>gb|ABC55717.1| beta-mannosidase 2 [Oncidium hybrid cultivar]
Length=501

 Score =   370 bits (950),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 204/243 (84%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLT S  D  AAQRARDFH+GWFLHPI+YGEYPK++Q+IV +RLP F
Sbjct  259  GRIGILLDFVWYEPLTNSTDDEAAAQRARDFHIGWFLHPIIYGEYPKSVQDIVKERLPTF  318

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +E+ +VKGS+DY+G+NQYT+YYM++PH       GYQ DWNVGFAYE++GVPIGPRA+
Sbjct  319  TAEEISIVKGSVDYLGVNQYTSYYMFDPHLPTQTSTGYQTDWNVGFAYERDGVPIGPRAN  378

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMYKAV+YVKE Y NPT+ILSENGMD  GN++     HD  R+NYYKSY+ 
Sbjct  379  SDWLYIVPWGMYKAVTYVKENYQNPTIILSENGMDDPGNVSLTVGVHDATRLNYYKSYIS  438

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+AIDDGA VIGY AWSLLDNFEW+LGYTSRFG+VYVD+KTLKR PK SA WF+ +++
Sbjct  439  ELKRAIDDGATVIGYFAWSLLDNFEWKLGYTSRFGIVYVDFKTLKRYPKMSAYWFKDVLQ  498

Query  101  RNK  93
            + K
Sbjct  499  KKK  501



>ref|XP_006845278.1| hypothetical protein AMTR_s00005p00265850 [Amborella trichopoda]
 gb|ERN06953.1| hypothetical protein AMTR_s00005p00265850 [Amborella trichopoda]
Length=479

 Score =   369 bits (947),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 172/244 (70%), Positives = 201/244 (82%), Gaps = 0/244 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + +KAD  AAQR+RDFH+GWFLHPIV+G YP++M  +VG RLPKF
Sbjct  236  GRIGILLDFVWYEPFSNAKADVRAAQRSRDFHIGWFLHPIVFGTYPRSMVRVVGDRLPKF  295

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EV+MVKGSID+VGIN YT+YY+ + H     V  YQ DW+ GF Y ++G  IGP+A+
Sbjct  296  TNEEVEMVKGSIDFVGINHYTSYYIKDQHIKNGTVTDYQMDWHAGFEYSRDGKLIGPQAN  355

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLYMVPWGMYKAV+Y+KE Y NPTMILSENGMDYA N+T   + HDTKRI YY+SYLI
Sbjct  356  SYWLYMVPWGMYKAVTYIKENYRNPTMILSENGMDYAANITLPAALHDTKRIGYYRSYLI  415

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
             LKKAIDDGANVIGY AWSL+DNFEWRLGYTSRFGLVYVDY+TLKR PK SA WF+ +I+
Sbjct  416  NLKKAIDDGANVIGYFAWSLVDNFEWRLGYTSRFGLVYVDYQTLKRYPKMSASWFRGLIQ  475

Query  101  RNKH  90
            R  H
Sbjct  476  RKSH  479



>gb|KJB16858.1| hypothetical protein B456_002G251200 [Gossypium raimondii]
Length=504

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/241 (72%), Positives = 200/241 (83%), Gaps = 0/241 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GIFLDFVWYEPLTRSKADNYAAQRARDFH+GWFLHP+VYG+YP+TMQ IV +RLPKF
Sbjct  261  GRIGIFLDFVWYEPLTRSKADNYAAQRARDFHIGWFLHPLVYGKYPRTMQKIVRERLPKF  320

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T  EV+ VK S D + +N YT+YY+YEPH     V GYQ DWN GFAYE+NGVPIG RAH
Sbjct  321  TKSEVEKVKNSFDVLCLNHYTSYYIYEPHQPPSNVTGYQQDWNAGFAYERNGVPIGHRAH  380

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWGMYKAV+YVK+ YG+P +ILSENGMD  GNLTF ES +D  R+++Y+SYL 
Sbjct  381  SEWLYEVPWGMYKAVTYVKKHYGSPNIILSENGMDDPGNLTFPESLYDINRVSFYRSYLK  440

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+A+DDGANV GY AWS+LDNFEW LGYTSRFGLVYVD+  LKR PK SA WF+ M+ 
Sbjct  441  ELKRAMDDGANVTGYFAWSILDNFEWLLGYTSRFGLVYVDHNDLKRYPKLSAYWFKQMLE  500

Query  101  R  99
            R
Sbjct  501  R  501



>gb|ABC55718.1| beta-mannosidase 1 [Oncidium hybrid cultivar]
Length=491

 Score =   367 bits (943),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 203/243 (84%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLT S  D  AAQRARDFH+GWFLHPI+YGEYPK++Q+IV +RL  F
Sbjct  249  GRIGILLDFVWYEPLTNSTDDEAAAQRARDFHIGWFLHPIIYGEYPKSVQDIVKERLLTF  308

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +E+ +VKGS+DY+G+NQYT+YYM++PH       GYQ DWNVGFAYE+NGVPIGPRA+
Sbjct  309  TAEEISLVKGSVDYLGVNQYTSYYMFDPHLPTQTSTGYQTDWNVGFAYERNGVPIGPRAN  368

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMYKAV+YVKE Y NPT+ILSENGMD  GN++     HDT R+NYYKSY+ 
Sbjct  369  SEWLYIVPWGMYKAVTYVKENYQNPTIILSENGMDDPGNVSLKVGLHDTTRLNYYKSYIS  428

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+AIDDGA VIGY AWSLLDNFEW+ GYTSRFG+VYVD+KTLKR PK SA WF+ +++
Sbjct  429  ELKRAIDDGATVIGYFAWSLLDNFEWKSGYTSRFGIVYVDFKTLKRYPKMSAYWFRDVLQ  488

Query  101  RNK  93
            + K
Sbjct  489  KKK  491



>gb|KCW52109.1| hypothetical protein EUGRSUZ_J01543 [Eucalyptus grandis]
Length=448

 Score =   365 bits (937),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 172/242 (71%), Positives = 200/242 (83%), Gaps = 0/242 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLT S  DNYAAQRARDFH+GWFLHP+VYGEYPKTMQNIVG+RLPKF
Sbjct  207  GRIGILLDFVWYEPLTSSLEDNYAAQRARDFHIGWFLHPLVYGEYPKTMQNIVGERLPKF  266

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T  EV +VKG  D+VG+N YT+YYMY P+  +   PGYQ DWNVGFA+EKNGVPIGPRA+
Sbjct  267  TKREVNIVKGGFDFVGVNHYTSYYMYNPNWTETSPPGYQADWNVGFAFEKNGVPIGPRAN  326

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+ KAV+YVKE YGNP M LSENGMD  GN+T+ E  HD+ RINYY+SYL 
Sbjct  327  SGWLYIVPWGVNKAVTYVKENYGNPYMFLSENGMDDPGNVTYLEGLHDSTRINYYRSYLQ  386

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK AID+GANV GY AWSLLDNFEW LGYT+RFG+VY+D+  L R PK SA WF+ ++ 
Sbjct  387  ELKAAIDNGANVNGYFAWSLLDNFEWLLGYTARFGIVYMDFNDLSRHPKMSAYWFKQLLE  446

Query  101  RN  96
            +N
Sbjct  447  KN  448



>ref|XP_010257596.1| PREDICTED: beta-glucosidase 44-like isoform X3 [Nelumbo nucifera]
 ref|XP_010257682.1| PREDICTED: beta-glucosidase 44-like isoform X3 [Nelumbo nucifera]
Length=518

 Score =   367 bits (943),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 202/249 (81%), Gaps = 5/249 (2%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDF+WYEPLTR KAD YAAQRA DF+LGWFLHPIVYGEYPKTMQN VGKRLPKF
Sbjct  270  GRIGIVLDFIWYEPLTRRKADQYAAQRAIDFYLGWFLHPIVYGEYPKTMQNTVGKRLPKF  329

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPR--  468
            T + +KMVKGSID++GINQYT +Y Y  H  K   PGY+ D NVGFA+ K+GVPIGPR  
Sbjct  330  TKENIKMVKGSIDFLGINQYTAHYAYALHQTKKHAPGYEKDLNVGFAFAKSGVPIGPRVI  389

Query  467  ---AHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYY  297
               A+S WLY VPW +YK ++Y+KE YGNPT+I++ENGMD  GN+T  +  HDT+RIN+Y
Sbjct  390  KITANSAWLYDVPWSLYKVLTYIKEYYGNPTVIITENGMDEPGNVTLPKGLHDTRRINFY  449

Query  296  KSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWF  117
            + YL QLKKAIDDG NV+GY AWSL+D FEWRLGYT+RFG+VY+D+KTLKR PK SA WF
Sbjct  450  RGYLTQLKKAIDDGVNVVGYFAWSLIDTFEWRLGYTTRFGIVYIDFKTLKRYPKMSAYWF  509

Query  116  QYMIRRNKH  90
            + ++ R KH
Sbjct  510  RELLHRKKH  518



>ref|XP_010257433.1| PREDICTED: beta-glucosidase 44-like isoform X1 [Nelumbo nucifera]
Length=539

 Score =   368 bits (944),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 202/249 (81%), Gaps = 5/249 (2%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDF+WYEPLTR KAD YAAQRA DF+LGWFLHPIVYGEYPKTMQN VGKRLPKF
Sbjct  291  GRIGIVLDFIWYEPLTRRKADQYAAQRAIDFYLGWFLHPIVYGEYPKTMQNTVGKRLPKF  350

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPR--  468
            T + +KMVKGSID++GINQYT +Y Y  H  K   PGY+ D NVGFA+ K+GVPIGPR  
Sbjct  351  TKENIKMVKGSIDFLGINQYTAHYAYALHQTKKHAPGYEKDLNVGFAFAKSGVPIGPRVI  410

Query  467  ---AHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYY  297
               A+S WLY VPW +YK ++Y+KE YGNPT+I++ENGMD  GN+T  +  HDT+RIN+Y
Sbjct  411  KITANSAWLYDVPWSLYKVLTYIKEYYGNPTVIITENGMDEPGNVTLPKGLHDTRRINFY  470

Query  296  KSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWF  117
            + YL QLKKAIDDG NV+GY AWSL+D FEWRLGYT+RFG+VY+D+KTLKR PK SA WF
Sbjct  471  RGYLTQLKKAIDDGVNVVGYFAWSLIDTFEWRLGYTTRFGIVYIDFKTLKRYPKMSAYWF  530

Query  116  QYMIRRNKH  90
            + ++ R KH
Sbjct  531  RELLHRKKH  539



>ref|XP_010034459.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=507

 Score =   367 bits (941),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/242 (71%), Positives = 200/242 (83%), Gaps = 0/242 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLT S  DNYAAQRARDFH+GWFLHP+VYGEYPKTMQNIVG+RLPKF
Sbjct  266  GRIGILLDFVWYEPLTSSLEDNYAAQRARDFHIGWFLHPLVYGEYPKTMQNIVGERLPKF  325

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T  EV +VKG  D+VG+N YT+YYMY P+  +   PGYQ DWNVGFA+EKNGVPIGPRA+
Sbjct  326  TKREVNIVKGGFDFVGVNHYTSYYMYNPNWTETSPPGYQADWNVGFAFEKNGVPIGPRAN  385

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+ KAV+YVKE YGNP M LSENGMD  GN+T+ E  HD+ RINYY+SYL 
Sbjct  386  SGWLYIVPWGVNKAVTYVKENYGNPYMFLSENGMDDPGNVTYLEGLHDSTRINYYRSYLQ  445

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK AID+GANV GY AWSLLDNFEW LGYT+RFG+VY+D+  L R PK SA WF+ ++ 
Sbjct  446  ELKAAIDNGANVNGYFAWSLLDNFEWLLGYTARFGIVYMDFNDLSRHPKMSAYWFKQLLE  505

Query  101  RN  96
            +N
Sbjct  506  KN  507



>ref|XP_007033096.1| B-S glucosidase 44 [Theobroma cacao]
 gb|EOY04022.1| B-S glucosidase 44 [Theobroma cacao]
Length=514

 Score =   366 bits (939),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 197/243 (81%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDF WYEPLTRSKAD YAAQRARDFH+GWFLHPI YGEYP+TMQ IVG+RLPKF
Sbjct  272  GRIGILLDFNWYEPLTRSKADEYAAQRARDFHVGWFLHPIRYGEYPRTMQEIVGERLPKF  331

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T DE+KMV GS+DYVGIN YT+ Y+Y+P   KP V GYQ DWN GFA  KNGV IGP+A+
Sbjct  332  TKDEIKMVNGSMDYVGINHYTSTYIYDPKQPKPNVTGYQADWNAGFANAKNGVQIGPKAN  391

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S+WLY+VPWGMYK V+YVKE YGN  + +SENGMD  GN T   + +DT RIN++K Y+ 
Sbjct  392  SWWLYIVPWGMYKTVTYVKEHYGNLNIFISENGMDDPGNGTLPNALNDTTRINFFKDYMT  451

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAIDDGANV GY AWSLLDNFEW  GYTSRFG+VYVDY TL+R PK SA WFQ ++ 
Sbjct  452  QLKKAIDDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYTTLRRYPKMSANWFQKILE  511

Query  101  RNK  93
            + K
Sbjct  512  KKK  514



>emb|CBI33559.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   363 bits (933),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 207/245 (84%), Gaps = 1/245 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LD VWYEPLTRSK D  AAQRA DFHLGWFLHPI++G+YPK MQ+IVG+RLPKF
Sbjct  207  GKIGILLDTVWYEPLTRSKDDQQAAQRAIDFHLGWFLHPIIWGKYPKNMQDIVGERLPKF  266

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + +E+K+VKGS+D+VGINQYT++YM++PH  KP V GYQ +WN GFAY++NGVPIGPRA+
Sbjct  267  SEEEIKLVKGSVDFVGINQYTSFYMFDPHKPKPKVTGYQEEWNAGFAYDRNGVPIGPRAN  326

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S+WLY+VPWGMYK V+YVKE+YGNP +I+SENGMD  GN+T   + HDT R+ Y++ YLI
Sbjct  327  SFWLYIVPWGMYKTVTYVKEQYGNPPIIISENGMDDPGNVTLPMALHDTTRVKYFQDYLI  386

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT-LKRAPKESAKWFQYMI  105
            +LKK ID+GANV GY AWS++DNFEW+ GYTSRFG+V++DYK  LKR PK SA WF+ ++
Sbjct  387  ELKKGIDEGANVHGYFAWSIVDNFEWKSGYTSRFGMVFIDYKNQLKRHPKMSAFWFKKLL  446

Query  104  RRNKH  90
            +R K 
Sbjct  447  QRKKQ  451



>gb|ABR17739.1| unknown [Picea sitchensis]
Length=505

 Score =   365 bits (937),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 199/242 (82%), Gaps = 0/242 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEPLT S  D  AAQR+RDFH+GWFLHPIVYG+YP +M  IVGKRLPKF
Sbjct  264  GKIGILLDFVWYEPLTNSSEDQAAAQRSRDFHIGWFLHPIVYGKYPDSMVEIVGKRLPKF  323

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T ++ +MVKGSIDY+G+NQYT YYMY+P   K  V GYQ DWNVGFAY +NGVPIGP+A+
Sbjct  324  TKEQYQMVKGSIDYLGVNQYTAYYMYDPKQPKQNVTGYQMDWNVGFAYARNGVPIGPKAN  383

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY+VPWG+YKAV+Y+KE YGNPTMILSENGMD  GN+T     HDT R+NYYKSYL 
Sbjct  384  SYWLYIVPWGLYKAVTYIKEHYGNPTMILSENGMDDPGNVTLPAGLHDTTRVNYYKSYLQ  443

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
             L  A++DGANV+GY AWSLLDNFEW+ GYTSRFG+VYVD+  LKR PK SA WF  +++
Sbjct  444  NLIGAMNDGANVVGYFAWSLLDNFEWKSGYTSRFGVVYVDFTNLKRYPKMSAYWFSKLLQ  503

Query  101  RN  96
            R+
Sbjct  504  RH  505



>ref|XP_006644213.1| PREDICTED: beta-glucosidase 1-like [Oryza brachyantha]
Length=511

 Score =   365 bits (937),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 165/239 (69%), Positives = 201/239 (84%), Gaps = 0/239 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYE LT S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLP+F
Sbjct  269  GRIGILLDFVWYEGLTNSTADQDAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPRF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T DE++MVKGSIDYVGINQYT YY+ +   N   +P Y +DW+  FAYE+NGVPIGPRA+
Sbjct  329  TADEIQMVKGSIDYVGINQYTAYYVRDQQPNATTIPSYSSDWHAAFAYERNGVPIGPRAN  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKAV+YVKE+YGNPTM+LSENGMD  GN+T A+  HDT R+ YY+SY+ 
Sbjct  389  SDWLYIVPWGLYKAVTYVKEKYGNPTMLLSENGMDDPGNVTVAQGVHDTARVAYYRSYIT  448

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
            +LK+AIDDGAN +GY AWS+LDNFEW+LGYTSRFGLVYVD+ TL+R PK SA WF+ ++
Sbjct  449  KLKEAIDDGANCVGYFAWSMLDNFEWKLGYTSRFGLVYVDFATLRRYPKASAYWFRDVV  507



>ref|XP_010922562.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=509

 Score =   363 bits (933),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 206/242 (85%), Gaps = 1/242 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYE LT S AD  AAQRARDFH+GWFLHPI+YGEYPKT+Q IV +RLPKF
Sbjct  266  GRIGILLDFVWYEALTSSTADQAAAQRARDFHVGWFLHPIIYGEYPKTIQEIVKERLPKF  325

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVP-GYQNDWNVGFAYEKNGVPIGPRA  465
            T +EVKMVKGSIDYVGINQYTTYYMY+PH  +P  P  Y NDW+VG+AYE++GVPIGPRA
Sbjct  326  TEEEVKMVKGSIDYVGINQYTTYYMYDPHQPEPQKPTSYANDWHVGYAYERDGVPIGPRA  385

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY+VPWGMYKAVSYVKE Y NPT+ILSENGMD  GN+T  +  HDT RINYYKSY+
Sbjct  386  HSNWLYIVPWGMYKAVSYVKEHYCNPTVILSENGMDDPGNITLPKGLHDTTRINYYKSYI  445

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAIDDGANVIGY AWSLLDNFEW+ GYTSRFG+VYVD+  LKR PK SA WF+ M+
Sbjct  446  TELKKAIDDGANVIGYFAWSLLDNFEWKSGYTSRFGIVYVDFTNLKRYPKMSAYWFRDML  505

Query  104  RR  99
            +R
Sbjct  506  KR  507



>ref|XP_006430656.1| hypothetical protein CICLE_v10013386mg [Citrus clementina]
 gb|ESR43896.1| hypothetical protein CICLE_v10013386mg [Citrus clementina]
Length=520

 Score =   363 bits (933),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEP +RSKADNYAAQRARDFH+GWFLHP+ YGEYP+TMQ  VG+RLPKF
Sbjct  278  GKIGILLDFVWYEPHSRSKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKF  337

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP+EV MVKGS DY+G+NQYT+YYM++P   +  +  Y NDW+VG+AY++NGVPIG RA+
Sbjct  338  TPEEVAMVKGSYDYLGVNQYTSYYMFDPPWPQSNISSYANDWDVGYAYDRNGVPIGRRAN  397

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+Y A+ YVKERYGNPT++LSENGMD   N T     HDT RINYY+ Y+ 
Sbjct  398  SEWLYIVPWGLYNALMYVKERYGNPTVMLSENGMDNPSNYTLTHLLHDTTRINYYRDYIS  457

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAIDDGANV GY AWSLLDNFEW LGYT+RFG+ YVD+ TL+R PK SA WF+ +++
Sbjct  458  QLKKAIDDGANVTGYFAWSLLDNFEWLLGYTARFGITYVDFDTLQRIPKMSAYWFKQLLQ  517

Query  101  RNK  93
            R++
Sbjct  518  RDQ  520



>ref|XP_002272413.2| PREDICTED: beta-glucosidase 44-like [Vitis vinifera]
Length=552

 Score =   365 bits (936),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 207/245 (84%), Gaps = 1/245 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LD VWYEPLTRSK D  AAQRA DFHLGWFLHPI++G+YPK MQ+IVG+RLPKF
Sbjct  307  GKIGILLDTVWYEPLTRSKDDQQAAQRAIDFHLGWFLHPIIWGKYPKNMQDIVGERLPKF  366

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + +E+K+VKGS+D+VGINQYT++YM++PH  KP V GYQ +WN GFAY++NGVPIGPRA+
Sbjct  367  SEEEIKLVKGSVDFVGINQYTSFYMFDPHKPKPKVTGYQEEWNAGFAYDRNGVPIGPRAN  426

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S+WLY+VPWGMYK V+YVKE+YGNP +I+SENGMD  GN+T   + HDT R+ Y++ YLI
Sbjct  427  SFWLYIVPWGMYKTVTYVKEQYGNPPIIISENGMDDPGNVTLPMALHDTTRVKYFQDYLI  486

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT-LKRAPKESAKWFQYMI  105
            +LKK ID+GANV GY AWS++DNFEW+ GYTSRFG+V++DYK  LKR PK SA WF+ ++
Sbjct  487  ELKKGIDEGANVHGYFAWSIVDNFEWKSGYTSRFGMVFIDYKNQLKRHPKMSAFWFKKLL  546

Query  104  RRNKH  90
            +R K 
Sbjct  547  QRKKQ  551



>ref|XP_008811965.1| PREDICTED: beta-glucosidase 1-like isoform X1 [Phoenix dactylifera]
Length=505

 Score =   363 bits (931),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/241 (72%), Positives = 202/241 (84%), Gaps = 2/241 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI  DFVWYEPLT S  D  AAQRARDFH+GWFLHPI+YGEYPKTMQ IV +RLPKF
Sbjct  260  GKIGILCDFVWYEPLTNSIRDQEAAQRARDFHIGWFLHPIIYGEYPKTMQEIVKERLPKF  319

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMY-EPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            T +EV+MVKGSIDYVGINQYT+YYM  +P  ++ PV  Y  DW+  FAY+++GVPIGPRA
Sbjct  320  TREEVEMVKGSIDYVGINQYTSYYMEDQPTYSQTPV-SYSADWHTQFAYDRDGVPIGPRA  378

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY+VPWGMYKA +YVKE YGNPT+IL+ENGMD  GN+T   +  DT+R+NYYKSY+
Sbjct  379  HSEWLYIVPWGMYKAATYVKETYGNPTVILAENGMDQPGNVTLPGALRDTQRVNYYKSYI  438

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAIDDGANV+GY AWSLLDNFEW+LGYTSRFGLVYVDY TLKR PK SA WF+ M+
Sbjct  439  TELKKAIDDGANVMGYFAWSLLDNFEWKLGYTSRFGLVYVDYSTLKRYPKNSAYWFRNML  498

Query  104  R  102
            +
Sbjct  499  K  499



>gb|KDO63132.1| hypothetical protein CISIN_1g046891mg [Citrus sinensis]
Length=520

 Score =   363 bits (932),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEP +RSKADNYAAQRARDFH+GWFLHP+ YGEYP+TMQ  VG+RLPKF
Sbjct  278  GKIGILLDFVWYEPHSRSKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKF  337

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP+EV MVKGS DY+G+NQYT+YYM++P   +  +  Y NDW+VG+AY++NGVPIG RA+
Sbjct  338  TPEEVAMVKGSYDYLGVNQYTSYYMFDPPWPQSNISSYANDWDVGYAYDRNGVPIGRRAN  397

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+Y A+ YVKERYGNPT++LSENGMD   N T     HDT RINYY+ Y+ 
Sbjct  398  SGWLYIVPWGLYNALMYVKERYGNPTVMLSENGMDNPSNYTLTHLLHDTTRINYYRDYIS  457

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAIDDGANV GY AWSLLDNFEW LGYT+RFG+ YVD+ TL+R PK SA WF+ +++
Sbjct  458  QLKKAIDDGANVTGYFAWSLLDNFEWLLGYTARFGITYVDFDTLQRIPKMSAYWFKQLLQ  517

Query  101  RNK  93
            R++
Sbjct  518  RDQ  520



>ref|XP_006482391.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=520

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEP +RSKADNYAAQRARDFH+GWFLHP+ YGEYP+TMQ  VG+RLPKF
Sbjct  278  GKIGILLDFVWYEPHSRSKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKF  337

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP+EV MVKGS DY+G+NQYT+YYM++P   +  +  Y NDW+VG+AY++NGVPIG RA+
Sbjct  338  TPEEVAMVKGSYDYLGVNQYTSYYMFDPPWPQSNISSYANDWDVGYAYDRNGVPIGRRAN  397

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+Y A+ YVKERYGNPT++LSENGMD   N T     HDT RINYY+ Y+ 
Sbjct  398  SGWLYIVPWGLYNALMYVKERYGNPTVMLSENGMDDPSNYTLTHLLHDTTRINYYRDYIS  457

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAIDDGANV GY AWSLLDNFEW LGYT+RFG+ YVD+ TL+R PK SA WF+ +++
Sbjct  458  QLKKAIDDGANVTGYFAWSLLDNFEWLLGYTARFGITYVDFDTLQRIPKMSAYWFKQLLQ  517

Query  101  RNK  93
            R++
Sbjct  518  RDQ  520



>ref|XP_006495386.1| PREDICTED: beta-glucosidase 44-like, partial [Citrus sinensis]
Length=422

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 198/243 (81%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEP TRSKADN AAQRARDFH+GWFLHP+ YGEYP+TMQ  VG RLPKF
Sbjct  180  GKIGILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKF  239

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP+EV MV+GS DY+G+NQYT+YYM++P   K  +  Y NDW+ G+AY++NGVPIGPRA+
Sbjct  240  TPEEVLMVQGSFDYLGVNQYTSYYMFDPPWPKSNISSYANDWDAGYAYDRNGVPIGPRAN  299

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+Y A+ YVKERYGNP ++LSENGMD   N T     HDT R+NYY+ Y+ 
Sbjct  300  SGWLYIVPWGLYNALMYVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYIS  359

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA DDGANV GY AWSLLDNFEW LGY+SRFG+ YVD+ TLKR PK SA WF+ +++
Sbjct  360  QLKKAADDGANVTGYFAWSLLDNFEWLLGYSSRFGITYVDFDTLKRTPKMSAYWFKQLLQ  419

Query  101  RNK  93
            R++
Sbjct  420  RDQ  422



>ref|XP_006832849.1| hypothetical protein AMTR_s00095p00053110 [Amborella trichopoda]
 gb|ERM98127.1| hypothetical protein AMTR_s00095p00053110 [Amborella trichopoda]
Length=509

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/240 (71%), Positives = 201/240 (84%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLT +KAD  AAQR+RDFH+GWFLHPIVYG YP++M  IVG RLPKF
Sbjct  266  GRIGILLDFVWYEPLTAAKADVRAAQRSRDFHVGWFLHPIVYGTYPRSMVRIVGDRLPKF  325

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EV+MVKGSID+VGIN YTTYYMY+ H  K  V  YQ +W+ GFA+ ++G PIGPRA+
Sbjct  326  TNEEVEMVKGSIDFVGINHYTTYYMYDQHIRKGTVMDYQMEWHAGFAFARDGKPIGPRAY  385

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S  LYMVPWG+YKAV+ +KE Y NPT+ILSENGMDY GN+T   S HDTKRI+YY+SYLI
Sbjct  386  SPGLYMVPWGIYKAVTCIKENYKNPTIILSENGMDYPGNVTLLASVHDTKRIDYYRSYLI  445

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
             LKKAIDDGANV+GY AWSLLDNFEW  GYTSRFGLVYV+Y+TLKR PK SA WF+++++
Sbjct  446  NLKKAIDDGANVVGYFAWSLLDNFEWLSGYTSRFGLVYVNYQTLKRYPKMSASWFRHLLQ  505



>gb|EEE54664.1| hypothetical protein OsJ_01954 [Oryza sativa Japonica Group]
Length=427

 Score =   357 bits (917),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/239 (69%), Positives = 198/239 (83%), Gaps = 0/239 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYE LT S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLPKF
Sbjct  185  GKIGILLDFVWYEGLTNSTADQAAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPKF  244

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T DEV MVKGSIDYVGINQYT YY+ +   N   +P Y +DW+    YE++GVPIGPRA+
Sbjct  245  TADEVHMVKGSIDYVGINQYTAYYVRDQQPNATTLPSYSSDWHAAPIYERDGVPIGPRAN  304

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKAV+YVKE+YGNPTM LSENGMD  GN+T A+  HDT R+ YY+SY+ 
Sbjct  305  SDWLYIVPWGLYKAVTYVKEKYGNPTMFLSENGMDDPGNVTIAQGVHDTTRVAYYRSYIT  364

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
            +LK+AIDDGAN IGY AWSLLDNFEW+LGYTSRFGLVYVD++TL+R PK SA WF+ ++
Sbjct  365  KLKEAIDDGANCIGYFAWSLLDNFEWKLGYTSRFGLVYVDFRTLRRYPKMSAYWFRDLV  423



>ref|XP_004140826.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN57432.1| hypothetical protein Csa_3G185120 [Cucumis sativus]
Length=515

 Score =   360 bits (924),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 198/242 (82%), Gaps = 2/242 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDF +YEPLTR K DNYAAQRARDFHLGWFLHPI YGEYP+TMQ IV +RLPKF
Sbjct  273  GRIGILLDFAYYEPLTRGKQDNYAAQRARDFHLGWFLHPITYGEYPRTMQEIVKERLPKF  332

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + +EV +VKGSID++GINQYTT+YM+ P + +   PGYQNDWNVGFA+EKNGVPIGPRAH
Sbjct  333  SEEEVSLVKGSIDFLGINQYTTFYMFNPKSTQLDAPGYQNDWNVGFAFEKNGVPIGPRAH  392

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWGMYKA+ YVKERYGNP +ILSENG D   ++   E+  D +RI Y+K Y+ 
Sbjct  393  STWLYQVPWGMYKALMYVKERYGNPNVILSENGRD-TPDIQLPEALFDLERIEYFKLYIQ  451

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT-LKRAPKESAKWFQYMI  105
             +K+AIDDGANV GY AWSLLDNFEW  GYTSRFG+VYVDYK  LKR PK SA WF+ M+
Sbjct  452  NMKRAIDDGANVSGYFAWSLLDNFEWLSGYTSRFGIVYVDYKNGLKRYPKMSAHWFKQML  511

Query  104  RR  99
            +R
Sbjct  512  QR  513



>gb|KDO63131.1| hypothetical protein CISIN_1g036937mg, partial [Citrus sinensis]
Length=497

 Score =   359 bits (922),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 198/243 (81%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LDFVWYEP TRSKADN AAQRARDFH+GWFLHP+ YGEYP+TMQ  VG RLPKF
Sbjct  255  GNIGILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKF  314

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP+EV MV+GS DY+G+NQYT+YYM++P   K  +  Y NDW+ G+AY++NGVPIGPRA+
Sbjct  315  TPEEVLMVQGSFDYLGVNQYTSYYMFDPPWPKSNISSYANDWDAGYAYDRNGVPIGPRAN  374

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+Y A+ YVKERYGNP ++LSENGMD   N T     HDT R+NYY+ Y+ 
Sbjct  375  SGWLYIVPWGLYNALMYVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYIS  434

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV GY AWSLLDNFEW LGY+SRFG+ YVD+ TLKR PK SA WF+ +++
Sbjct  435  QLKKAVDDGANVTGYFAWSLLDNFEWLLGYSSRFGITYVDFDTLKRTPKMSAYWFKQLLQ  494

Query  101  RNK  93
            R++
Sbjct  495  RDQ  497



>gb|EAY74244.1| hypothetical protein OsI_02124 [Oryza sativa Indica Group]
Length=516

 Score =   360 bits (924),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 199/240 (83%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYE LT S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLPKF
Sbjct  274  GKIGILLDFVWYEGLTNSTADQAAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPKF  333

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T DEV MVKGSIDYVGINQYT YY+ +   N   +P Y +DW+    YE++GVPIGPRA+
Sbjct  334  TADEVHMVKGSIDYVGINQYTAYYVRDQQPNATTLPSYSSDWHAAPIYERDGVPIGPRAN  393

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKAV+YVKE+YGNPTM LSENGMD  GN+T A+  HDT R+ YY+SY+ 
Sbjct  394  SDWLYIVPWGLYKAVTYVKEKYGNPTMFLSENGMDDPGNVTIAQGVHDTTRVAYYRSYIT  453

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+AIDDGAN IGY AWSLLDNFEW+LGYTSRFGLVYVD++TL+R PK SA WF+ ++R
Sbjct  454  KLKEAIDDGANCIGYFAWSLLDNFEWKLGYTSRFGLVYVDFRTLRRYPKMSAYWFRDLVR  513



>ref|XP_010916341.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=503

 Score =   360 bits (923),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 203/241 (84%), Gaps = 2/241 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLT S +D  AA R+RDFH+GWFLHPI YGEYPKTMQ IV +RLPKF
Sbjct  260  GRIGILLDFVWYEPLTNSISDQEAAHRSRDFHIGWFLHPITYGEYPKTMQEIVKERLPKF  319

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYE-PHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            T +EV+MVKGSIDYVG+NQYT+YY+ + P  ++ PV  Y  DW+V FAY+++GVPIGPRA
Sbjct  320  TREEVEMVKGSIDYVGVNQYTSYYIKDHPTTSQTPV-SYSADWHVTFAYDRDGVPIGPRA  378

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            HS WLY+VPWGMYKAV+YVKE YGNPT+ILSENGMD  GN+T   +  DT RINYY+SY+
Sbjct  379  HSDWLYIVPWGMYKAVTYVKETYGNPTIILSENGMDQPGNVTLPGALWDTVRINYYRSYI  438

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LK+AIDDGANV+GY AWSLLDNFEW+LGYTSRFGLVYVDY TL+R PK SA WF+ M+
Sbjct  439  AKLKEAIDDGANVVGYFAWSLLDNFEWKLGYTSRFGLVYVDYSTLERYPKNSAYWFRNML  498

Query  104  R  102
            +
Sbjct  499  K  499



>ref|XP_004157213.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=515

 Score =   359 bits (922),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 170/242 (70%), Positives = 198/242 (82%), Gaps = 2/242 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDF +YEPLTR K DNYAAQRARDFHLGWFLHPI YGEYP+TMQ IV +RLPKF
Sbjct  273  GRIGILLDFAYYEPLTRGKQDNYAAQRARDFHLGWFLHPITYGEYPRTMQEIVKERLPKF  332

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + +EV +VKGSID++GINQYTT+YM+ P + +   PGYQNDWNVGFA+EKNGVPIGPRAH
Sbjct  333  SEEEVSLVKGSIDFLGINQYTTFYMFNPKSTQLDAPGYQNDWNVGFAFEKNGVPIGPRAH  392

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWGMYKA+ YVKERYGNP +ILSENG D   ++   E+  D +RI Y+K Y+ 
Sbjct  393  STWLYQVPWGMYKALMYVKERYGNPNVILSENGRD-TPDIQLPEALFDLERIEYFKLYIQ  451

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT-LKRAPKESAKWFQYMI  105
             +K+AIDDGANV GY AWSLLDNFEW  GYTSRFG+VYVDY+  LKR PK SA WF+ M+
Sbjct  452  NMKRAIDDGANVSGYFAWSLLDNFEWLSGYTSRFGIVYVDYRNGLKRYPKMSAHWFKQML  511

Query  104  RR  99
            +R
Sbjct  512  QR  513



>ref|XP_006482389.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=520

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 198/243 (81%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEP TRSKADN AAQRARDFH+GWFLHP+ YGEYP+TMQ  VG RLPKF
Sbjct  278  GKIGILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKF  337

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP+EV MV+GS DY+G+NQYT+YYM++P   K  +  Y NDW+ G+AY++NGVPIGPRA+
Sbjct  338  TPEEVLMVQGSFDYLGVNQYTSYYMFDPPWPKSNISSYANDWDAGYAYDRNGVPIGPRAN  397

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+Y A+ YVKERYGNP ++LSENGMD   N T     HDT R+NYY+ Y+ 
Sbjct  398  SGWLYIVPWGLYNALMYVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYIS  457

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA DDGANV GY AWSLLDNFEW LGY+SRFG+ YVD+ TLKR PK SA WF+ +++
Sbjct  458  QLKKAADDGANVTGYFAWSLLDNFEWLLGYSSRFGITYVDFDTLKRTPKMSAYWFKQLLQ  517

Query  101  RNK  93
            R++
Sbjct  518  RDQ  520



>ref|XP_006482390.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=518

 Score =   359 bits (921),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 198/243 (81%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEP TRSKADN AAQRARDFH+GWFLHP+ YGEYP+TMQ  VG RLPKF
Sbjct  276  GKIGILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKF  335

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP+EV MV+GS DY+G+NQYT+YYM++P   K  +  Y NDW+ G+AY++NGVPIGPRA+
Sbjct  336  TPEEVLMVQGSFDYLGVNQYTSYYMFDPPWPKSNISSYANDWDAGYAYDRNGVPIGPRAN  395

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+Y A+ YVKERYGNP ++LSENGMD   N T     HDT R+NYY+ Y+ 
Sbjct  396  SGWLYIVPWGLYNALMYVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYIS  455

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA DDGANV GY AWSLLDNFEW LGY+SRFG+ YVD+ TLKR PK SA WF+ +++
Sbjct  456  QLKKAADDGANVTGYFAWSLLDNFEWLLGYSSRFGITYVDFDTLKRTPKMSAYWFKQLLQ  515

Query  101  RNK  93
            R++
Sbjct  516  RDQ  518



>ref|XP_006430655.1| hypothetical protein CICLE_v10013521mg [Citrus clementina]
 gb|ESR43895.1| hypothetical protein CICLE_v10013521mg [Citrus clementina]
Length=520

 Score =   359 bits (921),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/243 (67%), Positives = 199/243 (82%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEP TRSKADN AAQRARDFH+GWFLHP+ YGEYP+TMQ  VG RLPKF
Sbjct  278  GKIGILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKF  337

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP+EV MV+GS DY+G+NQYT+YYM++P   K  +  Y NDW+ G+AY++NGVPIG RA+
Sbjct  338  TPEEVLMVQGSFDYLGVNQYTSYYMFDPPWPKSNISSYANDWDAGYAYDRNGVPIGQRAN  397

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+Y A+ YVKERYGNPT++LSENGMD   N T     HDT R+NYY+ Y+ 
Sbjct  398  SGWLYIVPWGLYNALMYVKERYGNPTVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYIS  457

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV GY AWSLLDNFEW LGY++RFG+ YVD+ TLKR PK SA WF+ +++
Sbjct  458  QLKKAVDDGANVTGYFAWSLLDNFEWLLGYSARFGITYVDFDTLKRTPKMSAYWFKQLLQ  517

Query  101  RNK  93
            R++
Sbjct  518  RDQ  520



>ref|NP_001043156.1| Os01g0508000 [Oryza sativa Japonica Group]
 sp|Q5QMT0.1|BGL01_ORYSJ RecName: Full=Beta-glucosidase 1; Short=Os1bglu1; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD73293.1| putative beta-glucosidase [Oryza sativa Japonica Group]
 dbj|BAF05070.1| Os01g0508000 [Oryza sativa Japonica Group]
Length=516

 Score =   358 bits (920),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/239 (69%), Positives = 198/239 (83%), Gaps = 0/239 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYE LT S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLPKF
Sbjct  274  GKIGILLDFVWYEGLTNSTADQAAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPKF  333

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T DEV MVKGSIDYVGINQYT YY+ +   N   +P Y +DW+    YE++GVPIGPRA+
Sbjct  334  TADEVHMVKGSIDYVGINQYTAYYVRDQQPNATTLPSYSSDWHAAPIYERDGVPIGPRAN  393

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKAV+YVKE+YGNPTM LSENGMD  GN+T A+  HDT R+ YY+SY+ 
Sbjct  394  SDWLYIVPWGLYKAVTYVKEKYGNPTMFLSENGMDDPGNVTIAQGVHDTTRVAYYRSYIT  453

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
            +LK+AIDDGAN IGY AWSLLDNFEW+LGYTSRFGLVYVD++TL+R PK SA WF+ ++
Sbjct  454  KLKEAIDDGANCIGYFAWSLLDNFEWKLGYTSRFGLVYVDFRTLRRYPKMSAYWFRDLV  512



>ref|XP_008457084.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=517

 Score =   358 bits (918),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 198/242 (82%), Gaps = 2/242 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFV+YEPLTR K DNYAAQRARDFH+GWFLHPI YGEYP+TMQ IV +RLPKF
Sbjct  275  GRIGILLDFVYYEPLTRGKQDNYAAQRARDFHIGWFLHPITYGEYPRTMQEIVKERLPKF  334

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + +E+ +VKGSID++GINQYTT+YM+ P + +   PGYQNDWNVGFA+EK GVPIGPRAH
Sbjct  335  SEEEISLVKGSIDFLGINQYTTFYMFNPQSTQLDAPGYQNDWNVGFAFEKKGVPIGPRAH  394

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWGMYKA+ YVKERYGNP +ILSENG D   ++   E+  D +RI Y+K Y+ 
Sbjct  395  SAWLYQVPWGMYKALMYVKERYGNPNVILSENGRD-TPDIQLPEALFDLERIEYFKLYIQ  453

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT-LKRAPKESAKWFQYMI  105
             +K+AIDDGANV GY AWSLLDNFEW  GYTSRFG+VYVDYK  LKR PK SA WF+ M+
Sbjct  454  SMKRAIDDGANVSGYFAWSLLDNFEWLSGYTSRFGIVYVDYKNGLKRYPKMSAHWFKQML  513

Query  104  RR  99
            +R
Sbjct  514  QR  515



>ref|XP_006430653.1| hypothetical protein CICLE_v10013421mg, partial [Citrus clementina]
 gb|ESR43893.1| hypothetical protein CICLE_v10013421mg, partial [Citrus clementina]
Length=528

 Score =   357 bits (915),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/243 (67%), Positives = 198/243 (81%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEP TRSKADN AAQRARDFH+GWFLHP+ YGEYP+TMQ  VG RLPKF
Sbjct  286  GKIGILLDFVWYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKF  345

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP+EV MV+GS DY+G+NQYT+YYM++P   K  +  Y NDW+ G+AY++NGVPIG RA+
Sbjct  346  TPEEVLMVQGSFDYLGVNQYTSYYMFDPPWPKSNISSYANDWDAGYAYDRNGVPIGQRAN  405

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+Y A+ YVKERYGNP ++LSENGMD   N T     HDT R+NYY+ Y+ 
Sbjct  406  SGWLYIVPWGLYNALMYVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYIS  465

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKA+DDGANV GY AWSL+DNFEW LGY+SRFG+ YVD+ TLKR PK SA WF+ +++
Sbjct  466  QLKKAVDDGANVTGYFAWSLVDNFEWLLGYSSRFGITYVDFDTLKRTPKMSAYWFKQLLQ  525

Query  101  RNK  93
            R++
Sbjct  526  RDQ  528



>ref|XP_008811966.1| PREDICTED: beta-glucosidase 1-like isoform X2 [Phoenix dactylifera]
Length=525

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/261 (67%), Positives = 203/261 (78%), Gaps = 22/261 (8%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI  DFVWYEPLT S  D  AAQRARDFH+GWFLHPI+YGEYPKTMQ IV +RLPKF
Sbjct  260  GKIGILCDFVWYEPLTNSIRDQEAAQRARDFHIGWFLHPIIYGEYPKTMQEIVKERLPKF  319

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMY-EPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPR-  468
            T +EV+MVKGSIDYVGINQYT+YYM  +P  ++ PV  Y  DW+  FAY+++GVPIGPR 
Sbjct  320  TREEVEMVKGSIDYVGINQYTSYYMEDQPTYSQTPV-SYSADWHTQFAYDRDGVPIGPRV  378

Query  467  -------------------AHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN  345
                               AHS WLY+VPWGMYKAV+YVKE YGNPT+IL+ENGMD  GN
Sbjct  379  NFCIFSVEELILDCFSCMQAHSEWLYIVPWGMYKAVTYVKETYGNPTVILAENGMDQPGN  438

Query  344  LTFAESYHDTKRINYYKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYV  165
            +T   +  DT+R+NYYKSY+ +LKKAIDDGANV+GY AWSLLDNFEW+LGYTSRFGLVYV
Sbjct  439  VTLPGALRDTQRVNYYKSYITELKKAIDDGANVMGYFAWSLLDNFEWKLGYTSRFGLVYV  498

Query  164  DYKTLKRAPKESAKWFQYMIR  102
            DY TLKR PK SA WF+ M++
Sbjct  499  DYSTLKRYPKNSAYWFRNMLK  519



>gb|KHG12317.1| Beta-glucosidase 44 -like protein [Gossypium arboreum]
Length=497

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 192/243 (79%), Gaps = 1/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LDF WYEPLTRSKADNYAAQRARDFH+GWFLHPI YGEYP+TMQ IVGKRLPKF
Sbjct  256  GSIGILLDFNWYEPLTRSKADNYAAQRARDFHVGWFLHPIRYGEYPRTMQEIVGKRLPKF  315

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMV GS DYVGINQYTT Y+  P  +   V  YQ+DWN  FA  KNGV IGPRA+
Sbjct  316  TEEEVKMVNGSFDYVGINQYTTSYISNP-TSPSNVTSYQSDWNAAFANAKNGVQIGPRAN  374

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S+WLY+VPWGMYK V+Y+KERYG+  +I+SENGMD  GN T      DT RI ++K Y+ 
Sbjct  375  SWWLYIVPWGMYKTVTYIKERYGDMNVIISENGMDDPGNATLPNGLKDTTRIKFFKDYMT  434

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSLLDNFEW LGYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  435  QLKKAIDEGANVTGYFAWSLLDNFEWLLGYTSRFGIVYVDYNNLKRYPKMSAYWFKQLLE  494

Query  101  RNK  93
            + +
Sbjct  495  KKQ  497



>ref|XP_009394053.1| PREDICTED: beta-glucosidase 26-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   350 bits (898),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/241 (68%), Positives = 195/241 (81%), Gaps = 0/241 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEP T S  D  AAQRARDFHLGWFLHP+ YG YPK++Q IV  RLPKF
Sbjct  260  GKIGIILDFVWYEPHTHSANDEAAAQRARDFHLGWFLHPLTYGYYPKSIQEIVKDRLPKF  319

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T D+VKMVKGS DYVG+NQYT YYM +     P    YQ+DW+V F Y+++GVPIGPRA+
Sbjct  320  TDDQVKMVKGSYDYVGVNQYTAYYMKDNGVTNPKPVSYQDDWHVEFKYDQDGVPIGPRAN  379

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY+VPWGMYKAV+YVKE YG+P +IL+ENGMD  GN+T  E   D +RINY+KSY+ 
Sbjct  380  SYWLYIVPWGMYKAVTYVKENYGDPIIILAENGMDQPGNVTLPEGLRDAERINYFKSYIT  439

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+AIDDGA VIGY AWSLLDNFEWR+GYTSRFGLVYVD+KT  R PK+SA WF+ M++
Sbjct  440  ELKRAIDDGATVIGYFAWSLLDNFEWRIGYTSRFGLVYVDFKTNIRYPKQSAYWFKNMLK  499

Query  101  R  99
            R
Sbjct  500  R  500



>gb|AEV76986.1| beta-glucosidase 4, partial [Triticum aestivum]
Length=501

 Score =   350 bits (897),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 196/244 (80%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + S AD  AAQRARDFH+GWFL PI  G YP +M  IVG RLP F
Sbjct  257  GRIGILLDFVWYEPHSNSNADQGAAQRARDFHIGWFLDPITNGRYPSSMLKIVGNRLPGF  316

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN-NKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            + +E +MVKGSIDYVGINQYT+YYM +P   N  PV  YQ+DW+VGF YE+NGVPIGPRA
Sbjct  317  STNESRMVKGSIDYVGINQYTSYYMKDPGAWNLTPV-SYQDDWHVGFVYERNGVPIGPRA  375

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +S WLY+VPWGM KAV+YVKERYGNPTMILSENGMD  GN++ A+  HDT RI YY+ Y+
Sbjct  376  NSDWLYIVPWGMNKAVTYVKERYGNPTMILSENGMDQPGNVSIADGVHDTIRIRYYRDYI  435

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAID+GA V+GY AWSLLDNFEWRLGYT+RFG+ YVD+ TLKR PK+SA WF+ M+
Sbjct  436  TELKKAIDNGARVVGYFAWSLLDNFEWRLGYTARFGIAYVDFNTLKRYPKDSALWFKNML  495

Query  104  RRNK  93
               K
Sbjct  496  SEKK  499



>gb|KHG17589.1| Beta-glucosidase 44 -like protein [Gossypium arboreum]
Length=381

 Score =   345 bits (886),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 189/243 (78%), Gaps = 1/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDF W EPLTRSK DNYAAQRARDFH+GWFLHPI YGEYP+TMQ IVG+RLPKF
Sbjct  140  GRIGILLDFNWCEPLTRSKIDNYAAQRARDFHVGWFLHPIRYGEYPRTMQEIVGERLPKF  199

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMV GS DYVGINQYTT Y+  P      +  YQ DWN  FA  KNGV IG RA+
Sbjct  200  TEEEVKMVNGSFDYVGINQYTTRYISSPET-PSNITSYQIDWNATFATTKNGVQIGLRAN  258

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMYKAV+YVKERYGN  +I+SENGMD  GN T      DT RI ++K Y+ 
Sbjct  259  SGWLYIVPWGMYKAVTYVKERYGNLNIIISENGMDNPGNATLPNGLKDTTRIKFFKDYMT  318

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSL+DNFEW LGYTSRFG++YVDYK LKR PK SA WF+ ++ 
Sbjct  319  QLKKAIDEGANVTGYFAWSLVDNFEWSLGYTSRFGIIYVDYKNLKRYPKMSAYWFKQLLE  378

Query  101  RNK  93
            + +
Sbjct  379  KKQ  381



>gb|KJB08522.1| hypothetical protein B456_001G086300 [Gossypium raimondii]
Length=497

 Score =   346 bits (888),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 190/243 (78%), Gaps = 1/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LDF WYEPLTRSKADNYAAQRARDFH+GWFLHPI YGEYP+TMQ IVGKRLPKF
Sbjct  256  GSIGILLDFNWYEPLTRSKADNYAAQRARDFHVGWFLHPIRYGEYPRTMQEIVGKRLPKF  315

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMV GS DYVGINQYTT Y+  P      V  YQ+DWN  FA  K GV IGPRA+
Sbjct  316  TEEEVKMVNGSFDYVGINQYTTSYISNP-TTPSNVTSYQSDWNAAFANAKYGVQIGPRAN  374

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S+WLY+VPWGMYK V+Y+KERYG+  +I+SENGMD  GN T      DT RI ++K Y+ 
Sbjct  375  SWWLYIVPWGMYKTVTYIKERYGDMNVIISENGMDDPGNATLPNGLKDTTRIKFFKDYMT  434

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSLLDNFEW LGYTSRFG+VYVDY  LKR PK SA WF+ ++ 
Sbjct  435  QLKKAIDEGANVTGYFAWSLLDNFEWLLGYTSRFGIVYVDYNNLKRYPKMSAYWFKQLLE  494

Query  101  RNK  93
            + +
Sbjct  495  KKQ  497



>ref|XP_004149144.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN53236.1| hypothetical protein Csa_4G031070 [Cucumis sativus]
Length=506

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/243 (67%), Positives = 191/243 (79%), Gaps = 2/243 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDF +YEPLT  K D  AAQRARDFH+GWFLHP  YGEYP+ MQ IV +RLPKF
Sbjct  265  GRVGILLDFTYYEPLTNEKEDRDAAQRARDFHIGWFLHPFTYGEYPRRMQEIVKERLPKF  324

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + +EVK VKGS+D+VGINQYTT+YM+ P   KP  PGYQ+DW+VG+AYEKNG PIG RAH
Sbjct  325  SEEEVKKVKGSVDFVGINQYTTFYMFNPTWPKPTTPGYQSDWHVGYAYEKNGKPIGQRAH  384

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            + WLY VPWGMYKA+ YVK+ Y NP +I+SENGMD   ++   E  +D +RINYYK+YL 
Sbjct  385  TGWLYEVPWGMYKALMYVKQHYRNPNVIVSENGMD-TSDIPLPEGLNDRERINYYKTYLQ  443

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKESAKWFQYMI  105
             +KKAIDDGANV GY AWSLLDNFEW  GYTSRFG++YVDYK  L R PK SA WF+ MI
Sbjct  444  NMKKAIDDGANVSGYFAWSLLDNFEWLSGYTSRFGIIYVDYKHNLNRIPKMSAYWFKQMI  503

Query  104  RRN  96
             +N
Sbjct  504  SKN  506



>ref|XP_003562544.1| PREDICTED: beta-glucosidase 26 [Brachypodium distachyon]
 ref|XP_010234616.1| PREDICTED: beta-glucosidase 26 [Brachypodium distachyon]
Length=500

 Score =   335 bits (858),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/244 (69%), Positives = 201/244 (82%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEPL++SKAD  AAQRARDFHLGWFL PIV+G+YP++M  IV  RLP F
Sbjct  257  GKIGILLDFVWYEPLSKSKADQAAAQRARDFHLGWFLDPIVHGQYPESMLKIVEGRLPTF  316

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN-NKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            + +E +MVKGS+DYVGIN YT+YYM +P   N  PV  YQ+DW+VGF YE+NGVPIG RA
Sbjct  317  SHEESRMVKGSMDYVGINHYTSYYMKDPGAWNLTPV-SYQDDWHVGFVYERNGVPIGARA  375

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +SYWLY+VPWG+ KAV+YVKERYGNPTM LSENGMD  GN++  E  HDT R+ YY+ Y+
Sbjct  376  NSYWLYIVPWGINKAVTYVKERYGNPTMFLSENGMDQPGNVSITEGVHDTVRVRYYREYI  435

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKK IDDGA VIGY AWSLLDNFEWRLGYTSRFG+VYVDYKTLKR PK+SA WF+ M+
Sbjct  436  TELKKVIDDGARVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYKTLKRYPKDSAFWFKNML  495

Query  104  RRNK  93
             + +
Sbjct  496  SKKR  499



>ref|XP_008453769.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=506

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 190/242 (79%), Gaps = 2/242 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDF +YEPLT  K D  AAQRARDF +GWFLHP  YGEYP+ MQ IV +RLPKF
Sbjct  265  GRVGILLDFTYYEPLTNGKEDRDAAQRARDFTIGWFLHPFTYGEYPRRMQEIVKERLPKF  324

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + +EV MVKGS+D+VGINQYTT+YM+ P   KP  PGYQ+DW+VG+AYEKNG PIG RAH
Sbjct  325  SEEEVTMVKGSVDFVGINQYTTFYMFNPTWPKPTTPGYQSDWHVGYAYEKNGKPIGKRAH  384

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            + WLY VPWGM+KA+ YVKE YGNP +I+SENGMD   ++   E  +D +RINYYK+YL 
Sbjct  385  TGWLYEVPWGMHKALMYVKEHYGNPNVIVSENGMD-TSDIPLPEGLNDRERINYYKTYLQ  443

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKESAKWFQYMI  105
             +KKAIDDGANV GY AWSLLDNFEW  GYTSRFG++YVDYK  L R PK SA WF+ MI
Sbjct  444  NMKKAIDDGANVSGYFAWSLLDNFEWLSGYTSRFGIIYVDYKHNLNRIPKMSAYWFKQMI  503

Query  104  RR  99
             +
Sbjct  504  HK  505



>ref|XP_004163493.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=506

 Score =   333 bits (854),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/243 (67%), Positives = 189/243 (78%), Gaps = 2/243 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDF +YEPLT  K D  AAQRARDFH+GWFLHP  YGEYP+ MQ IV +RLPKF
Sbjct  265  GRVGILLDFTYYEPLTNEKEDRDAAQRARDFHIGWFLHPFTYGEYPRRMQEIVKERLPKF  324

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + +EVK VKGS+D+VGINQYTT+YM  P   KP  P YQ+DW+VG+AYEKNG PIG RAH
Sbjct  325  SEEEVKKVKGSVDFVGINQYTTFYMLNPTWPKPTTPDYQSDWHVGYAYEKNGKPIGQRAH  384

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            + WLY VPWGMYKA+ YVK+ Y NP +I+SENGMD   ++   E  +D +RINYYK+YL 
Sbjct  385  TGWLYEVPWGMYKALMYVKQHYRNPNVIVSENGMD-TSDIPLPEGLNDRERINYYKTYLQ  443

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKESAKWFQYMI  105
             +KKAIDDGANV GY AWSLLDNFEW  GYTSRFG++YVDYK  L R PK SA WF+ MI
Sbjct  444  NMKKAIDDGANVSGYFAWSLLDNFEWLSGYTSRFGIIYVDYKHNLNRIPKMSAYWFKQMI  503

Query  104  RRN  96
             +N
Sbjct  504  SKN  506



>gb|ACF07998.1| beta-glucosidase [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 197/244 (81%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + S AD  AAQRARDFH+GWFL PI  G YP +M  IVG RLP F
Sbjct  265  GRIGILLDFVWYEPHSDSNADQAAAQRARDFHIGWFLDPITNGRYPSSMLKIVGNRLPGF  324

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN-NKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            + DE +MVKGSIDYVGINQYT+YYM +P   N+ PV  YQ+DW+VGF YE+NGVPIGPRA
Sbjct  325  SADESRMVKGSIDYVGINQYTSYYMKDPGAWNQTPV-SYQDDWHVGFVYERNGVPIGPRA  383

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +S WLY+VPWGM KAV+YVKERYGNPTMILSENGMD  GN++ A+  HDT RI YY+ Y+
Sbjct  384  NSDWLYIVPWGMNKAVTYVKERYGNPTMILSENGMDQPGNVSIADGVHDTVRIRYYRDYI  443

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAID+GA V GY AWSLLDNFEWRLGYT+RFG+VYVD+ TLKR PK+SA WF+ M+
Sbjct  444  TELKKAIDNGARVAGYFAWSLLDNFEWRLGYTARFGIVYVDFNTLKRYPKDSALWFKNML  503

Query  104  RRNK  93
               K
Sbjct  504  SEKK  507



>gb|AAA87339.1| beta-glucosidase [Hordeum vulgare]
Length=509

 Score =   332 bits (850),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 169/244 (69%), Positives = 197/244 (81%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + + AD  AAQRARDFH+GWFL PI  G YP +M  IVG RLP F
Sbjct  265  GRIGILLDFVWYEPHSDTDADQAAAQRARDFHIGWFLDPITNGRYPSSMLKIVGNRLPGF  324

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN-NKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            + DE +MVKGSIDYVGINQYT+YYM +P   N+ PV  YQ+DW+VGF YE+NGVPIGPRA
Sbjct  325  SADESRMVKGSIDYVGINQYTSYYMKDPGAWNQTPV-SYQDDWHVGFVYERNGVPIGPRA  383

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +S WLY+VPWGM KAV+YVKERYGNPTMILSENGMD  GN++ A+  HDT RI YY+ Y+
Sbjct  384  NSDWLYIVPWGMNKAVTYVKERYGNPTMILSENGMDQPGNVSIADGVHDTVRIRYYRDYI  443

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAID+GA V GY AWSLLDNFEWRLGYT+RFG+VYVD+ TLKR PK+SA WF+ M+
Sbjct  444  TELKKAIDNGARVAGYFAWSLLDNFEWRLGYTARFGIVYVDFNTLKRYPKDSALWFKNML  503

Query  104  RRNK  93
               K
Sbjct  504  SEKK  507



>gb|EMT08337.1| Beta-glucosidase 44 [Aegilops tauschii]
Length=507

 Score =   330 bits (847),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 197/244 (81%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + S AD  AAQRARDFH+GWFL PI  G YP +M  IV  RLP F
Sbjct  263  GRIGILLDFVWYEPHSDSNADQAAAQRARDFHIGWFLDPITNGRYPSSMLKIVSNRLPGF  322

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN-NKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            + DE +MVKGSIDYVGINQYT+YYM +P   N+ PV  YQ+DW+VGF YE+NGVPIGPRA
Sbjct  323  SADESRMVKGSIDYVGINQYTSYYMKDPGAWNQTPV-SYQDDWHVGFVYERNGVPIGPRA  381

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +S WLY+VPWGM KAV+YVKERYGNPTMILSENGMD  GN++ A+  HDT RI +Y+ Y+
Sbjct  382  NSDWLYIVPWGMNKAVTYVKERYGNPTMILSENGMDQPGNVSIADGVHDTVRIRFYRDYI  441

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAID+GA V+GY AWSLLDNFEWRLGYT+RFG+VYVD+ TLKR PK+SA WF+ M+
Sbjct  442  TELKKAIDNGARVVGYFAWSLLDNFEWRLGYTARFGIVYVDFNTLKRYPKDSALWFKNML  501

Query  104  RRNK  93
               K
Sbjct  502  SEKK  505



>ref|NP_001060502.1| Os07g0656200 [Oryza sativa Japonica Group]
 dbj|BAF22416.1| Os07g0656200, partial [Oryza sativa Japonica Group]
Length=331

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 194/243 (80%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + S AD  AAQRARDFHLGWFL PI++G YP +M  IV  R+P F
Sbjct  87   GRIGILLDFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIIHGRYPYSMLEIVKDRMPTF  146

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + +E +MVK SIDYVGIN YT++YM +P         YQ+DW+VGFAYE+NGVPIG +A+
Sbjct  147  SDEESRMVKDSIDYVGINHYTSFYMKDPGPWNLTPTSYQDDWHVGFAYERNGVPIGAQAN  206

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY+VPWG+ KAV+YVKE YGNPTMILSENGMD  GN++  +  HDT RI YY++Y+ 
Sbjct  207  SYWLYIVPWGINKAVTYVKETYGNPTMILSENGMDQPGNVSITQGVHDTVRIRYYRNYIT  266

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAIDDGA VIGY AWSLLDNFEWRLGYTSRFG+VYVDYKTLKR PK+SA WF+ M+ 
Sbjct  267  ELKKAIDDGAKVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYKTLKRYPKDSAFWFKNMLS  326

Query  101  RNK  93
              K
Sbjct  327  SKK  329



>ref|XP_006658055.1| PREDICTED: beta-glucosidase 26-like [Oryza brachyantha]
Length=511

 Score =   328 bits (840),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 196/244 (80%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + S AD  AAQRARDFHLGWFL PI++G YP +M  IV  RLP F
Sbjct  267  GRIGILLDFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIIHGRYPYSMLEIVKDRLPTF  326

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN-NKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            + +E +MVKGSIDYVGIN YT++YM +P   N  PV  YQ+DW+VGF YE+NGVPIG  A
Sbjct  327  SDEESRMVKGSIDYVGINHYTSFYMKDPGPWNLTPV-SYQDDWHVGFVYERNGVPIGAHA  385

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +SYWLY+VPWG+ KAV+YVKE YGNPTMILSENGMD  GN++  +  HDT R+ YY+ Y+
Sbjct  386  NSYWLYIVPWGINKAVTYVKETYGNPTMILSENGMDQPGNVSITQGVHDTVRVRYYRDYI  445

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAIDDGA VIGY AWSLLDNFEWRLGYTSRFG++YVDYKTLKR PK+SA WF+ M+
Sbjct  446  TELKKAIDDGAKVIGYFAWSLLDNFEWRLGYTSRFGIIYVDYKTLKRYPKDSAFWFKNML  505

Query  104  RRNK  93
             R K
Sbjct  506  SRKK  509



>gb|ACL52625.1| unknown [Zea mays]
 tpg|DAA63940.1| TPA: non-cyanogenic beta-glucosidase [Zea mays]
Length=512

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/244 (68%), Positives = 196/244 (80%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEP + S AD  AAQRARDFHLGWFL PIV+G YP +MQ I   RLP F
Sbjct  269  GKIGILLDFVWYEPFSDSNADQAAAQRARDFHLGWFLDPIVHGRYPYSMQEIAKDRLPLF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN-NKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            + +E +MVKGSIDYVGIN YT++YM +P   N  PV  YQ+DW+VGF YE+NGVPIG  A
Sbjct  329  SDEEARMVKGSIDYVGINHYTSFYMKDPGTWNLTPV-SYQDDWHVGFVYERNGVPIGAHA  387

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +SYWLY+VPWG+ KAVSYVKE Y NPTMIL+ENGMD  G+++  +  HDT RI YY+ Y+
Sbjct  388  NSYWLYIVPWGINKAVSYVKETYKNPTMILAENGMDQPGDVSITQGVHDTVRIRYYRDYI  447

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAIDDGA VIGY AWSLLDNFEWRLGYTSRFGLVYVDYKTLKR PK+SA WF++M+
Sbjct  448  TELKKAIDDGARVIGYFAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRYPKDSAFWFKHML  507

Query  104  RRNK  93
             + +
Sbjct  508  SKKR  511



>emb|CDM80087.1| unnamed protein product [Triticum aestivum]
Length=507

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 196/244 (80%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPL+ S AD  AAQRARDFHLGWFL PI++G YP TM  IV  RLP+F
Sbjct  263  GRIGILLDFVWYEPLSNSNADQAAAQRARDFHLGWFLDPIIHGRYPFTMLEIVKDRLPRF  322

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN-NKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            + DE  MVKGSIDYVGINQYT++YM +    N  P+  YQ+DW+V F YE+NGVPIG  A
Sbjct  323  SADESTMVKGSIDYVGINQYTSFYMKDNGTWNLTPI-SYQDDWHVEFVYERNGVPIGAHA  381

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +SYWLY+VPWG+ KAV+YVKERYGNPTMIL+ENGMD  GN++ A+   DT RI YY+ Y+
Sbjct  382  NSYWLYIVPWGINKAVTYVKERYGNPTMILAENGMDQPGNVSIADGVRDTVRIRYYRDYI  441

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAI+DGA VIGY AWSLLDNFEWRLGYT+RFG+VYVDYKTLKR PK+SA WF+ M+
Sbjct  442  TELKKAINDGAQVIGYFAWSLLDNFEWRLGYTARFGIVYVDYKTLKRYPKDSALWFKNML  501

Query  104  RRNK  93
               K
Sbjct  502  SEKK  505



>gb|EEC76023.1| hypothetical protein OsI_13187 [Oryza sativa Indica Group]
Length=568

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 189/240 (79%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYEPLT S  D  AAQRARDFH+GWFL P++ G+YPK M++IV +RLP F
Sbjct  271  GKIGIVLDFNWYEPLTNSTEDQAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKERLPTF  330

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ K+VKGS DY GINQYT  YM +    +     Y +DW+V F +++NGVPIG +A+
Sbjct  331  TPEQAKLVKGSADYFGINQYTANYMADQPAPQQAATSYSSDWHVSFIFQRNGVPIGQQAN  390

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY AV+Y+KE+Y NPT+I+SENGMD +GNLT  E  HDT+RI +YK+YL 
Sbjct  391  SNWLYIVPTGMYGAVNYIKEKYNNPTIIISENGMDQSGNLTREEFLHDTERIEFYKNYLT  450

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAIDDGANV+ Y AWSLLDNFEW  GYTS+FG+VYVD+ TLKR PK+SA WF+ M++
Sbjct  451  ELKKAIDDGANVVAYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLKRYPKDSANWFKNMLQ  510



>gb|ACF35791.1| beta-mannosidase/beta-glucosidase [Oryza sativa Indica Group]
Length=483

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 194/243 (80%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + S AD  AAQRARDFHLGWFL PI++G YP +M  IV  R+P F
Sbjct  239  GRIGILLDFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIIHGRYPYSMLEIVKDRMPTF  298

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + +E +MVK SIDYVGIN YT++YM +P         YQ+DW+VGFAYE+NGVPIG +A+
Sbjct  299  SDEESRMVKDSIDYVGINHYTSFYMKDPGPWNLTPTSYQDDWHVGFAYERNGVPIGAQAN  358

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY+VPWG+ KAV+YVKE YGNPTMILSENGMD  GN++  +  HDT RI YY++Y+ 
Sbjct  359  SYWLYIVPWGINKAVTYVKETYGNPTMILSENGMDQPGNVSITQGVHDTVRIRYYRNYIT  418

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAIDDGA VIGY AWSLLDNFEWRLGYTSRFG+VYVDYKTLKR PK+SA WF+ M+ 
Sbjct  419  ELKKAIDDGAKVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYKTLKRYPKDSAFWFKNMLS  478

Query  101  RNK  93
              K
Sbjct  479  SKK  481



>pdb|4JIE|A Chain A, Structural Analysis And Insights Into Glycon Specificity 
Of The Rice Gh1 Os7bglu26 Beta-d-mannosidase
 pdb|4JHO|A Chain A, Structural Analysis And Insights Into Glycon Specificity 
Of The Rice Gh1 Os7bglu26 Beta-d-mannosidase
Length=503

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 194/243 (80%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + S AD  AAQRARDFHLGWFL PI++G YP +M  IV  R+P F
Sbjct  259  GRIGILLDFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIIHGRYPYSMLEIVKDRMPTF  318

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + +E +MVK SIDYVGIN YT++YM +P         YQ+DW+VGFAYE+NGVPIG +A+
Sbjct  319  SDEESRMVKDSIDYVGINHYTSFYMKDPGPWNLTPTSYQDDWHVGFAYERNGVPIGAQAN  378

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY+VPWG+ KAV+YVKE YGNPTMILSENGMD  GN++  +  HDT RI YY++Y+ 
Sbjct  379  SYWLYIVPWGINKAVTYVKETYGNPTMILSENGMDQPGNVSITQGVHDTVRIRYYRNYIT  438

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAIDDGA VIGY AWSLLDNFEWRLGYTSRFG+VYVDYKTLKR PK+SA WF+ M+ 
Sbjct  439  ELKKAIDDGAKVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYKTLKRYPKDSAFWFKNMLS  498

Query  101  RNK  93
              K
Sbjct  499  SKK  501



>ref|NP_001051014.1| Os03g0703100 [Oryza sativa Japonica Group]
 sp|Q75I94.1|BGL08_ORYSJ RecName: Full=Beta-glucosidase 8; Short=Os3bglu8; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAS07251.1| putative beta-glucosidase [Oryza sativa Japonica Group]
 gb|ABF98427.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12928.1| Os03g0703100 [Oryza sativa Japonica Group]
 dbj|BAH00173.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59768.1| hypothetical protein OsJ_12263 [Oryza sativa Japonica Group]
Length=568

 Score =   326 bits (836),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 189/240 (79%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYEPLT S  D  AAQRARDFH+GWFL P++ G+YPK M++IV +RLP F
Sbjct  271  GKIGIVLDFNWYEPLTNSTEDQAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKERLPTF  330

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ K+VKGS DY GINQYT  YM +    +     Y +DW+V F +++NGVPIG +A+
Sbjct  331  TPEQAKLVKGSADYFGINQYTANYMADQPAPQQAATSYSSDWHVSFIFQRNGVPIGQQAN  390

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY AV+Y+KE+Y NPT+I+SENGMD +GNLT  E  HDT+RI +YK+YL 
Sbjct  391  SNWLYIVPTGMYGAVNYIKEKYNNPTIIISENGMDQSGNLTREEFLHDTERIEFYKNYLT  450

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAIDDGANV+ Y AWSLLDNFEW  GYTS+FG+VYVD+ TLKR PK+SA WF+ M++
Sbjct  451  ELKKAIDDGANVVAYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLKRYPKDSANWFKNMLQ  510



>sp|A3BMZ5.1|BGL26_ORYSJ RecName: Full=Beta-glucosidase 26; Short=Os7bglu26; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|EAZ04982.1| hypothetical protein OsI_27163 [Oryza sativa Indica Group]
 gb|EAZ40934.1| hypothetical protein OsJ_25416 [Oryza sativa Japonica Group]
Length=510

 Score =   324 bits (830),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 194/243 (80%), Gaps = 0/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + S AD  AAQRARDFHLGWFL PI++G YP +M  IV  R+P F
Sbjct  266  GRIGILLDFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIIHGRYPYSMLEIVKDRMPTF  325

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + +E +MVK SIDYVGIN YT++YM +P         YQ+DW+VGFAYE+NGVPIG +A+
Sbjct  326  SDEESRMVKDSIDYVGINHYTSFYMKDPGPWNLTPTSYQDDWHVGFAYERNGVPIGAQAN  385

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            SYWLY+VPWG+ KAV+YVKE YGNPTMILSENGMD  GN++  +  HDT RI YY++Y+ 
Sbjct  386  SYWLYIVPWGINKAVTYVKETYGNPTMILSENGMDQPGNVSITQGVHDTVRIRYYRNYIT  445

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAIDDGA VIGY AWSLLDNFEWRLGYTSRFG+VYVDYKTLKR PK+SA WF+ M+ 
Sbjct  446  ELKKAIDDGAKVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYKTLKRYPKDSAFWFKNMLS  505

Query  101  RNK  93
              K
Sbjct  506  SKK  508



>gb|EMS60983.1| Beta-glucosidase 26 [Triticum urartu]
Length=525

 Score =   324 bits (830),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 170/260 (65%), Positives = 198/260 (76%), Gaps = 18/260 (7%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + S AD  AAQRARDFH+GWFL PI  G YP +M  IVG RLP F
Sbjct  265  GRIGILLDFVWYEPHSDSNADQAAAQRARDFHIGWFLDPITNGCYPSSMLKIVGNRLPGF  324

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN-NKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            + DE +MVKGSIDYVGINQYT+YYM +P   N+ PV  YQ+DW+VGF YE+NGVPIGPRA
Sbjct  325  SADEARMVKGSIDYVGINQYTSYYMKDPGAWNQTPV-SYQDDWHVGFVYERNGVPIGPRA  383

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSEN----------------GMDYAGNLTFA  333
            +S WLY+VPWGM KAV+YVKERYGNPTMILSEN                GMD  GN++ A
Sbjct  384  NSDWLYIVPWGMNKAVTYVKERYGNPTMILSENGVLTDKETNDQCYDLTGMDQPGNVSIA  443

Query  332  ESYHDTKRINYYKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT  153
            +  HDT RI YY+ Y+ +LKKAID+GA V+GY AWSLLDNFEWRLGYT+RFG+VYVD+ T
Sbjct  444  DGVHDTIRIRYYRDYITELKKAIDNGARVVGYFAWSLLDNFEWRLGYTARFGIVYVDFNT  503

Query  152  LKRAPKESAKWFQYMIRRNK  93
            LKR PK+SA WF+ M+   K
Sbjct  504  LKRYPKDSALWFKNMLSEKK  523



>gb|AAX95520.1| Putative Glycosyl hydrolase family 1 protein [Oryza sativa Japonica 
Group]
Length=603

 Score =   326 bits (836),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 189/240 (79%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYEPLT S  D  AAQRARDFH+GWFL P++ G+YPK M++IV +RLP F
Sbjct  306  GKIGIVLDFNWYEPLTNSTEDQAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKERLPTF  365

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ K+VKGS DY GINQYT  YM +    +     Y +DW+V F +++NGVPIG +A+
Sbjct  366  TPEQAKLVKGSADYFGINQYTANYMADQPAPQQAATSYSSDWHVSFIFQRNGVPIGQQAN  425

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY AV+Y+KE+Y NPT+I+SENGMD +GNLT  E  HDT+RI +YK+YL 
Sbjct  426  SNWLYIVPTGMYGAVNYIKEKYNNPTIIISENGMDQSGNLTREEFLHDTERIEFYKNYLT  485

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAIDDGANV+ Y AWSLLDNFEW  GYTS+FG+VYVD+ TLKR PK+SA WF+ M++
Sbjct  486  ELKKAIDDGANVVAYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLKRYPKDSANWFKNMLQ  545



>dbj|BAK07108.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=465

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/240 (61%), Positives = 188/240 (78%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WY+  T S AD  AAQRARDFH+GWFL P++ G+YPKTMQ+IV +RLP F
Sbjct  167  GKVGIVLDFNWYDAATDSPADKAAAQRARDFHVGWFLDPLLNGQYPKTMQDIVKERLPSF  226

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ K+VKGS+DY+GINQYT  YM +    + P   Y +DW+V + +++NGVPIG +A+
Sbjct  227  TPEQSKLVKGSVDYIGINQYTATYMADQPTLQQPPTSYSSDWHVQYIFQRNGVPIGQKAN  286

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V+Y++E+Y NPT+I+SENGMD   NLT  E  HD  R+ +YK+YL 
Sbjct  287  SNWLYIVPTGMYGCVNYIREKYNNPTIIISENGMDQPANLTREEFLHDASRVEFYKTYLA  346

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAIDDGANV+GY AWSLLDNFEW  GYTS+FG+VYVD+ TLKR PK+SA WF+ M++
Sbjct  347  ELKKAIDDGANVVGYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLKRYPKDSAYWFKNMLQ  406



>ref|XP_006650460.1| PREDICTED: beta-glucosidase 8-like [Oryza brachyantha]
Length=568

 Score =   324 bits (830),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/240 (62%), Positives = 188/240 (78%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYEPLT S  D  AAQRARDFH+GWFL P++ G+YPK M++IV +RLP F
Sbjct  271  GKIGIVLDFNWYEPLTNSTEDQAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKERLPTF  330

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ K+VKGS DY GINQYT  YM +    +     Y +DW+V F +++NG+PIG +A+
Sbjct  331  TPEQAKLVKGSADYFGINQYTASYMSDQPAPQQAPTSYSSDWHVSFIFQRNGIPIGQQAN  390

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V+Y+KE+Y NPT+I+SENGMD +GNLT  E  HDT+RI +YK+YL 
Sbjct  391  SNWLYIVPTGMYGCVNYLKEKYNNPTIIISENGMDQSGNLTREEFLHDTERIEFYKNYLT  450

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LKKAIDDGANV+ Y AWSLLDNFEW  GYTS+FG+VYVD+ TLKR PK+SA WF+ M++
Sbjct  451  ELKKAIDDGANVVAYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLKRYPKDSANWFKDMLQ  510



>ref|XP_002464026.1| hypothetical protein SORBIDRAFT_01g010825 [Sorghum bicolor]
 gb|EER91024.1| hypothetical protein SORBIDRAFT_01g010825 [Sorghum bicolor]
Length=567

 Score =   323 bits (829),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 184/239 (77%), Gaps = 0/239 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYEPLT S  D  AAQRARDFH+GWFL P++ G+YPKTMQ+IV  RLP F
Sbjct  276  GKVGIVLDFNWYEPLTNSTEDQAAAQRARDFHIGWFLDPLINGQYPKTMQDIVKDRLPSF  335

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ K+VKGS DY GINQYTT Y+      +   P Y +DW V + +E+NGV IG  AH
Sbjct  336  TPEQAKLVKGSSDYFGINQYTTNYISNQQTTQQGPPSYSSDWGVQYNFERNGVQIGQLAH  395

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V+Y+KE+Y NPT+I+SENGMD  G+LT  E  HDT RI++YK+YL 
Sbjct  396  SVWLYIVPTGMYGVVTYLKEKYQNPTIIISENGMDQPGDLTREEYLHDTVRIDFYKNYLT  455

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
            +LKK IDDGANV+GY AWSLLDNFEW  GYTS+FG+VYVD+ TLKR PK+SA WF+ M+
Sbjct  456  ELKKGIDDGANVVGYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLKRYPKDSAYWFRDML  514



>ref|NP_001148821.1| LOC100282438 precursor [Zea mays]
 gb|ACG33023.1| non-cyanogenic beta-glucosidase precursor [Zea mays]
Length=512

 Score =   322 bits (824),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 195/244 (80%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEP + S AD  AAQRARDFHLGWFL PIV+G YP +MQ I   RLP F
Sbjct  269  GKIGILLDFVWYEPFSDSNADQAAAQRARDFHLGWFLDPIVHGRYPYSMQEIAKDRLPLF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN-NKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            + +E +MVKGSIDYVGIN YT++YM +P   N  PV  YQ+DW+VGF YE+NGVPIG  A
Sbjct  329  SDEEARMVKGSIDYVGINHYTSFYMKDPGTWNLTPV-SYQDDWHVGFVYERNGVPIGAHA  387

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +SYWLY+VPWG+ KAVSYVKE Y N TMIL+ENGMD  G+++  +  HDT RI YY+ Y+
Sbjct  388  NSYWLYIVPWGINKAVSYVKETYKNLTMILAENGMDQPGDVSITQGVHDTVRIRYYRDYI  447

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAIDDGA VIGY AWSLLDNFEWRLGYTSRFGLVYVDYKTLKR PK+SA WF++M+
Sbjct  448  TELKKAIDDGARVIGYFAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRYPKDSAFWFKHML  507

Query  104  RRNK  93
             + +
Sbjct  508  SKKR  511



>ref|XP_002461141.1| hypothetical protein SORBIDRAFT_02g041550 [Sorghum bicolor]
 gb|EER97662.1| hypothetical protein SORBIDRAFT_02g041550 [Sorghum bicolor]
Length=512

 Score =   322 bits (824),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/244 (67%), Positives = 195/244 (80%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + S AD  AAQRARDFHLGWFL PI+ G YP +MQ IV  RLP F
Sbjct  269  GRIGILLDFVWYEPFSDSNADQAAAQRARDFHLGWFLDPIINGRYPYSMQEIVKDRLPLF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN-NKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            + +E +MVKGSIDYVGIN YT++YM +P   N  PV  YQ+DW+VGF YE+N +PIG  A
Sbjct  329  SDEESRMVKGSIDYVGINHYTSFYMKDPGTWNLTPV-SYQDDWHVGFVYERNSIPIGAHA  387

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +SYWLY+VPWG+ KAV+YVKE Y NPTMIL+ENGMD  G+++  +  HDT RI YY+ Y+
Sbjct  388  NSYWLYIVPWGINKAVNYVKETYENPTMILAENGMDQPGDISITQGVHDTIRIRYYRDYI  447

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAIDDGA VIGY AWSLLDNFEWRLGYTSRFGLVYVDYKTLKR PK+SA WF++M+
Sbjct  448  TELKKAIDDGARVIGYFAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRYPKDSAFWFKHML  507

Query  104  RRNK  93
             + +
Sbjct  508  SKKR  511



>ref|XP_002974513.1| hypothetical protein SELMODRAFT_149851 [Selaginella moellendorffii]
 gb|EFJ24735.1| hypothetical protein SELMODRAFT_149851 [Selaginella moellendorffii]
Length=494

 Score =   320 bits (821),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/244 (61%), Positives = 185/244 (76%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LDFV+YEP + S  D  AAQR RDFH+GWFL PI+ G YPKTMQ  VG RLPKF
Sbjct  251  GSIGILLDFVYYEPFSNSTEDIDAAQRGRDFHVGWFLEPIINGSYPKTMQQYVGSRLPKF  310

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + D+++MVKGS+D+VGIN YTTYY  +  +       Y  D N+   ++++GV IGPRAH
Sbjct  311  SKDDIEMVKGSVDFVGINHYTTYYAKDAGSQNRNTTDYFQDMNIQMLHDRDGVSIGPRAH  370

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMYKA+SY+KE YGNP ++LSENGMD   NLT ++S HDT RINYY+SY+ 
Sbjct  371  STWLYIVPWGMYKALSYIKEHYGNPKVVLSENGMDDPANLTLSQSLHDTTRINYYQSYIE  430

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDY--KTLKRAPKESAKWFQYM  108
             L  A+ DGANV GY AWSL+DNFEW  GYTSRFGLVY+D+  K LKR PKESAKWF+ +
Sbjct  431  NLVAAMRDGANVHGYFAWSLVDNFEWLSGYTSRFGLVYIDFKHKALKRIPKESAKWFKTL  490

Query  107  IRRN  96
            ++R+
Sbjct  491  LKRD  494



>ref|XP_002990785.1| hypothetical protein SELMODRAFT_185578 [Selaginella moellendorffii]
 gb|EFJ08058.1| hypothetical protein SELMODRAFT_185578 [Selaginella moellendorffii]
Length=495

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/244 (61%), Positives = 185/244 (76%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LDFV+YEP + S  D  AAQR RDFH+GWFL PI+ G YPKTMQ  VG RLPKF
Sbjct  252  GSIGILLDFVYYEPFSNSTEDIDAAQRGRDFHVGWFLEPIINGSYPKTMQQYVGSRLPKF  311

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + D+++MVKGS+D+VGIN YTTYY  +  +       Y  D N+   ++++GV IGPRAH
Sbjct  312  SKDDIEMVKGSVDFVGINHYTTYYAKDAGSQNRNTTDYFQDMNIQMLHDRDGVSIGPRAH  371

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMYKA+SY+K+ YGNP ++LSENGMD   NLT  +S HDT RINYY+SY+ 
Sbjct  372  STWLYIVPWGMYKALSYIKDHYGNPKVVLSENGMDDPANLTLFQSLHDTTRINYYQSYIE  431

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDY--KTLKRAPKESAKWFQYM  108
             L  A+ DGANV GY AWSL+DNFEW  GYTSRFGLVY+D+  KTLKR PKESAKWF+ +
Sbjct  432  NLVAAMKDGANVHGYFAWSLVDNFEWLSGYTSRFGLVYIDFKHKTLKRIPKESAKWFKTL  491

Query  107  IRRN  96
            ++R+
Sbjct  492  LKRD  495



>ref|XP_004958541.1| PREDICTED: beta-glucosidase 26-like [Setaria italica]
Length=539

 Score =   319 bits (817),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 164/244 (67%), Positives = 193/244 (79%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEP + S AD  AAQRARDFHLGWFL PIV G YP +MQ IV  RLP F
Sbjct  296  GRIGILLDFVWYEPFSDSNADRAAAQRARDFHLGWFLDPIVNGRYPYSMQEIVEDRLPLF  355

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN-NKPPVPGYQNDWNVGFAYEKNGVPIGPRA  465
            + +E +MVKGSIDYVGIN YT++YM +P   N  P+  YQ DW+  F YE+NGVPIG  A
Sbjct  356  SDEESRMVKGSIDYVGINHYTSFYMKDPGTWNLMPI-SYQYDWHASFVYERNGVPIGAHA  414

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYL  285
            +SYWLY+VPWG+ KAV+YVKE Y NP MIL+ENGMD  GN++ ++  HDT RI YY+ Y+
Sbjct  415  NSYWLYIVPWGINKAVNYVKETYENPIMILAENGMDQPGNISISQGVHDTIRIRYYRDYI  474

Query  284  IQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
             +LKKAIDDGA VIGY AWSLLDNFEWRLGYTSRFGLVYVDYKTLKR PK+SA WF++M+
Sbjct  475  TELKKAIDDGARVIGYFAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRYPKDSAFWFKHML  534

Query  104  RRNK  93
             + +
Sbjct  535  SKKR  538



>ref|XP_003559510.1| PREDICTED: beta-glucosidase 8-like [Brachypodium distachyon]
Length=570

 Score =   319 bits (817),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 184/239 (77%), Gaps = 0/239 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYEPLT S  D  AAQRARDFH+GWFL P+V G+YPKTMQ+IV +RLP F
Sbjct  269  GKIGIVLDFNWYEPLTNSTEDQAAAQRARDFHVGWFLDPLVNGQYPKTMQDIVKERLPSF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T ++ K+VKGS DY GINQYT  YM +    +     Y +DW+V F +++NG PIGP A+
Sbjct  329  TSEQSKLVKGSADYFGINQYTASYMADQPTPQQAPTSYSSDWHVSFIFQRNGKPIGPLAN  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V+Y+KE+Y NPT+I+SENGMD  GNLT  E  HDT R+ +YK+YL 
Sbjct  389  SNWLYIVPTGMYGCVNYIKEKYKNPTIIISENGMDQPGNLTREEFLHDTVRVEFYKNYLS  448

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
            +LKKAIDDGANV+ Y AWSLLDNFEW  GYTS+FG+VYVD+ TLKR PK+SA WF+ M+
Sbjct  449  ELKKAIDDGANVVAYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLKRYPKDSAYWFKDML  507



>ref|XP_008655551.1| PREDICTED: beta-glucosidase 1-like [Zea mays]
Length=570

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 190/242 (79%), Gaps = 4/242 (2%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRAR-DFHLGWFLHPIVYGEYPKTMQNIVGKRLPK  645
            GR GI LDFVWYEPLT   A + AA +   DFH+GWFLHPIVYGEYPK+++  V  RLPK
Sbjct  326  GRVGILLDFVWYEPLTADSAADRAAAQRSRDFHVGWFLHPIVYGEYPKSVRRSVKGRLPK  385

Query  644  FTPDEVKMVKGSIDYVGINQYTTYYMYE--PHNNKPPVPGYQNDWNVGFAYEKNGVPIGP  471
            FT +E  +V+GSIDYVG+NQYT YY+ +  P+    P P Y +DW+  F YE++GVPIGP
Sbjct  386  FTAEEAGLVRGSIDYVGVNQYTAYYVRDRRPNATAAP-PSYSSDWHAEFVYERDGVPIGP  444

Query  470  RAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKS  291
            RA+S WLY+VPWG+YKAV+YVKE+YGNPTM+LSENGMD  GN+T  +   D  R+ YY+S
Sbjct  445  RANSDWLYIVPWGLYKAVTYVKEKYGNPTMLLSENGMDDPGNVTVGQGVRDAARVAYYRS  504

Query  290  YLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQY  111
            Y+ +LK AID GAN +GY AWSLLDNFEW+LGYTSRFGLVYVD++TL+R PK SA WF+ 
Sbjct  505  YVAELKAAIDGGANCVGYFAWSLLDNFEWKLGYTSRFGLVYVDFRTLRRYPKSSAYWFRD  564

Query  110  MI  105
            +I
Sbjct  565  VI  566



>gb|ABF98424.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
Length=400

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 181/240 (75%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE L+ S  D  AAQRARDFH+GW+L P++ G YP+ MQ++V  RLPKF
Sbjct  160  GKVGIVLDFNWYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKF  219

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ ++VKGS DY+GINQYT  YM      +     Y  DW V + + KNG PIGP+A+
Sbjct  220  TPEQARLVKGSADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQAN  279

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMY  V+Y+K++YGNPT++++ENGMD   NL+  +   DT R+++Y+SYL 
Sbjct  280  SNWLYIVPWGMYGCVNYIKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLT  339

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSLLDNFEW  GYTS+FG+VYVD+ TL+R PK SA WF+ M++
Sbjct  340  QLKKAIDEGANVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLK  399



>ref|NP_001151026.1| LOC100284659 precursor [Zea mays]
 gb|ACG41348.1| beta-glucosidase precursor [Zea mays]
 tpg|DAA50884.1| TPA: hypothetical protein ZEAMMB73_397657 [Zea mays]
Length=564

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 180/239 (75%), Gaps = 0/239 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYEP T S  D  AAQRARDFH+GWFL P++ G+YPK MQ+IV  RLP F
Sbjct  274  GKVGIVLDFNWYEPFTNSTEDQKAAQRARDFHIGWFLDPLINGQYPKIMQDIVKDRLPSF  333

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ K+VKGS DY GINQYTTYY+ +        P Y +DW V + +++NGV IG  AH
Sbjct  334  TPEQAKLVKGSSDYFGINQYTTYYIADQQTPPQGPPSYSSDWGVQYYFQRNGVQIGQMAH  393

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V+Y+KE+Y NP +I+SENGMD  GNLT  E  HD  RI++YK+YL 
Sbjct  394  SIWLYIVPSGMYGVVNYLKEKYHNPIIIISENGMDQPGNLTREEYVHDAVRIDFYKNYLT  453

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
            +LK+ ID GANVIGY AWSLLDNFEW  GYTS+FG+VYVD+ TLKR PK+SA WF+ M+
Sbjct  454  ELKRGIDGGANVIGYFAWSLLDNFEWLSGYTSKFGIVYVDFATLKRYPKDSAYWFRDML  512



>ref|XP_006651730.1| PREDICTED: beta-glucosidase 7-like, partial [Oryza brachyantha]
Length=467

 Score =   306 bits (785),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 139/241 (58%), Positives = 182/241 (76%), Gaps = 0/241 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE L+ S  D  AAQRARDFH+GW+L P++ G YP+ MQ++V  RLPKF
Sbjct  227  GKVGIVLDFNWYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKF  286

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ ++VKGS DY+GINQYT  YM      +     Y  DW V + + KNG PIGP+A+
Sbjct  287  TPEQARLVKGSADYIGINQYTASYMKGQQLIQQTPTSYSADWQVSYVFAKNGKPIGPQAN  346

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMY  V+Y+K++YGNPT++++ENGMD   NL+  +   DT R+++Y+SYL 
Sbjct  347  SNWLYIVPWGMYGCVNYIKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLS  406

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSLLDNFEW  GY S+FG+VYVD+KTL+R PK SA WF+ M++
Sbjct  407  QLKKAIDEGANVAGYFAWSLLDNFEWLSGYNSKFGIVYVDFKTLERHPKASAYWFRDMLK  466

Query  101  R  99
            +
Sbjct  467  Q  467



>gb|EAY86111.1| hypothetical protein OsI_07481 [Oryza sativa Indica Group]
Length=527

 Score =   308 bits (790),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 181/240 (75%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE L+ S  D  AAQRARDFH+GW+L P++ G YP+ MQ++V  RLPKF
Sbjct  287  GKVGIVLDFNWYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKF  346

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ ++VKGS DY+GINQYT  YM      +     Y  DW V + + KNG PIGP+A+
Sbjct  347  TPEQARLVKGSADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQAN  406

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMY  V+Y+K++YGNPT++++ENGMD   NL+  +   DT R+++Y+SYL 
Sbjct  407  SNWLYIVPWGMYGCVNYIKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLT  466

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSLLDNFEW  GYTS+FG+VYVD+ TL+R PK SA WF+ M++
Sbjct  467  QLKKAIDEGANVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLK  526



>gb|EMT23872.1| Beta-glucosidase 44 [Aegilops tauschii]
Length=537

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 165/264 (63%), Positives = 196/264 (74%), Gaps = 22/264 (8%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPL+ S AD  AAQRARDFHLGWFL PI++G YP TM  IV  RLP+F
Sbjct  273  GRIGILLDFVWYEPLSNSNADQAAAQRARDFHLGWFLDPIIHGHYPFTMLEIVKDRLPRF  332

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN-NKPPVPGYQNDWNVGFAYEKNGVPIGP--  471
            + DE +MVKGSIDYVGINQYT++YM +    N  PV  YQ+DW+V F +++NGV IG   
Sbjct  333  SDDESRMVKGSIDYVGINQYTSFYMKDNGTWNLTPV-SYQDDWHVEFVFKRNGVLIGAHM  391

Query  470  ------------------RAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN  345
                              +A+SYWLY+VPWG+ KAV+YVKERYGNP MIL+ENGMD  GN
Sbjct  392  DKCRFSVEHCNCKLVEFMQANSYWLYIVPWGINKAVTYVKERYGNPIMILAENGMDQPGN  451

Query  344  LTFAESYHDTKRINYYKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYV  165
            ++ A+   DT RI YY+ Y+ +LKKAIDDGA VIGY AWSLLDNFEWRLGYT+RFG+VYV
Sbjct  452  ISIADGVRDTVRIRYYRDYITELKKAIDDGARVIGYFAWSLLDNFEWRLGYTARFGIVYV  511

Query  164  DYKTLKRAPKESAKWFQYMIRRNK  93
            DYKTLKR PK+SA WF+ M+   K
Sbjct  512  DYKTLKRYPKDSALWFKNMLSEKK  535



>ref|XP_002464027.1| hypothetical protein SORBIDRAFT_01g010830 [Sorghum bicolor]
 gb|EER91025.1| hypothetical protein SORBIDRAFT_01g010830 [Sorghum bicolor]
Length=514

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/244 (59%), Positives = 185/244 (76%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYEPLT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ+IV +RLPKF
Sbjct  271  GKVGIVLDFNWYEPLTNSTEDQAAAQRARDFHVGWFVDPLINGHYPQMMQDIVKERLPKF  330

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP + K+VKGS DY+GINQYT  Y+      +     Y  DW V +A E+NG PIGP+A+
Sbjct  331  TPGQAKLVKGSADYIGINQYTASYIKGQKLLQQKPTSYSADWQVQYALERNGKPIGPQAN  390

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V+Y+K++YGNPT+ ++ENGMD  GNLT  +  HDT R+ +YK YL 
Sbjct  391  SNWLYIVPSGMYGCVNYLKQKYGNPTVFITENGMDQPGNLTREQYLHDTTRVQFYKGYLA  450

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT--LKRAPKESAKWFQYM  108
            +LKKAIDDGANV GY AWSLLDNFEW+ GYTS+FG+VYVD+ T  L+R PK+SA WF+ M
Sbjct  451  ELKKAIDDGANVAGYFAWSLLDNFEWQSGYTSKFGIVYVDFSTPKLERHPKDSAYWFRDM  510

Query  107  IRRN  96
            ++++
Sbjct  511  LQKH  514



>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F4V|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5J|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5J|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5K|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5K|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5L|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5L|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3AHT|A Chain A, Crystal Structure Of Rice Bglu1 E176q Mutant In Complex 
With Laminaribiose
 pdb|3AHT|B Chain B, Crystal Structure Of Rice Bglu1 E176q Mutant In Complex 
With Laminaribiose
 pdb|3AHV|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1 Covalent Complex 
With 2-Deoxy- 2-Fluoroglucoside
 pdb|3AHV|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1 Covalent Complex 
With 2-Deoxy- 2-Fluoroglucoside
Length=481

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 181/240 (75%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE L+ S  D  AAQRARDFH+GW+L P++ G YP+ MQ++V  RLPKF
Sbjct  241  GKVGIVLDFNWYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKF  300

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ ++VKGS DY+GINQYT  YM      +     Y  DW V + + KNG PIGP+A+
Sbjct  301  TPEQARLVKGSADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQAN  360

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMY  V+Y+K++YGNPT++++ENGMD   NL+  +   DT R+++Y+SYL 
Sbjct  361  SNWLYIVPWGMYGCVNYIKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLT  420

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSLLDNFEW  GYTS+FG+VYVD+ TL+R PK SA WF+ M++
Sbjct  421  QLKKAIDEGANVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLK  480



>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGL|B Chain B, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGM|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGM|B Chain B, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
Length=481

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 181/240 (75%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE L+ S  D  AAQRARDFH+GW+L P++ G YP+ MQ++V  RLPKF
Sbjct  241  GKVGIVLDFNWYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKF  300

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ ++VKGS DY+GINQYT  YM      +     Y  DW V + + KNG PIGP+A+
Sbjct  301  TPEQARLVKGSADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQAN  360

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMY  V+Y+K++YGNPT++++ENGMD   NL+  +   DT R+++Y+SYL 
Sbjct  361  SNWLYIVPWGMYGCVNYIKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLT  420

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSLLDNFEW  GYTS+FG+VYVD+ TL+R PK SA WF+ M++
Sbjct  421  QLKKAIDEGANVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLK  480



>gb|AFW79802.1| hypothetical protein ZEAMMB73_091278 [Zea mays]
Length=539

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/254 (61%), Positives = 190/254 (75%), Gaps = 16/254 (6%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRAR-DFHLGWFLHPIVYGEYPKTMQNIVGKRLPK  645
            GR GI LDFVWYEPLT   A + AA +   DFH+GWFLHPIVYGEYPK+++  V  RLPK
Sbjct  283  GRVGILLDFVWYEPLTADSAADRAAAQRSRDFHVGWFLHPIVYGEYPKSVRRSVKGRLPK  342

Query  644  FTPDEVKMVKGSIDYVGINQYTTYYMYE--PHNNKPPVPGYQNDWNVGF-----------  504
            FT +E  +V+GSIDYVG+NQYT YY+ +  P+    P P Y +DW+  F           
Sbjct  343  FTAEEAGLVRGSIDYVGVNQYTAYYVRDRRPNATAAP-PSYSSDWHAEFVSSLTPIHATL  401

Query  503  -AYEKNGVPIGPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAES  327
             A E++GVPIGPRA+S WLY+VPWG+YKAV+YVKE+YGNPTM+LSENGMD  GN+T  + 
Sbjct  402  HADERDGVPIGPRANSDWLYIVPWGLYKAVTYVKEKYGNPTMLLSENGMDDPGNVTVGQG  461

Query  326  YHDTKRINYYKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLK  147
              D  R+ YY+SY+ +LK AID GAN +GY AWSLLDNFEW+LGYTSRFGLVYVD++TL+
Sbjct  462  VRDAARVAYYRSYVAELKAAIDGGANCVGYFAWSLLDNFEWKLGYTSRFGLVYVDFRTLR  521

Query  146  RAPKESAKWFQYMI  105
            R PK SA WF+ +I
Sbjct  522  RYPKSSAYWFRDVI  535



>ref|NP_001051013.1| Os03g0703000 [Oryza sativa Japonica Group]
 sp|Q75I93.1|BGL07_ORYSJ RecName: Full=Beta-glucosidase 7; Short=Os3bglu7; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAS07254.1| beta-glucosidase (with alternative splicing) [Oryza sativa Japonica 
Group]
 gb|AAX95519.1| Putative Glycosyl hydrolase family 1 protein [Oryza sativa Japonica 
Group]
 gb|ABF98423.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12927.1| Os03g0703000 [Oryza sativa Japonica Group]
 dbj|BAG94472.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGW30396.1| beta-glucosidase [Oryza sativa]
Length=504

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 181/240 (75%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE L+ S  D  AAQRARDFH+GW+L P++ G YP+ MQ++V  RLPKF
Sbjct  264  GKVGIVLDFNWYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKF  323

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ ++VKGS DY+GINQYT  YM      +     Y  DW V + + KNG PIGP+A+
Sbjct  324  TPEQARLVKGSADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQAN  383

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMY  V+Y+K++YGNPT++++ENGMD   NL+  +   DT R+++Y+SYL 
Sbjct  384  SNWLYIVPWGMYGCVNYIKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLT  443

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSLLDNFEW  GYTS+FG+VYVD+ TL+R PK SA WF+ M++
Sbjct  444  QLKKAIDEGANVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLK  503



>gb|AAA84906.3| beta-glucosidase [Oryza sativa Japonica Group]
Length=504

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 181/240 (75%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE L+ S  D  AAQRARDFH+GW+L P++ G YP+ MQ++V  RLPKF
Sbjct  264  GKVGIVLDFNWYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKF  323

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ ++VKGS DY+GINQYT  YM      +     Y  DW V + + KNG PIGP+A+
Sbjct  324  TPEQARLVKGSADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQAN  383

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMY  V+Y+K++YGNPT++++ENGMD   NL+  +   DT R+++Y+SYL 
Sbjct  384  SNWLYIVPWGMYGCVNYIKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLT  443

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSLLDNFEW  GYTS+FG+VYVD+ TL+R PK SA WF+ M++
Sbjct  444  QLKKAIDEGANVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLK  503



>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant
 pdb|3SCR|B Chain B, Crystal Structure Of Rice Bglu1 E386s Mutant
 pdb|3SCS|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCS|B Chain B, Crystal Structure Of Rice Bglu1 E386s Mutant Complexed 
With Alpha- Glucosyl Fluoride
Length=481

 Score =   304 bits (779),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 180/240 (75%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE L+ S  D  AAQRARDFH+GW+L P++ G YP+ MQ++V  RLPKF
Sbjct  241  GKVGIVLDFNWYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKF  300

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ ++VKGS DY+GINQYT  YM      +     Y  DW V + + KNG PIGP+A+
Sbjct  301  TPEQARLVKGSADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQAN  360

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMY  V+Y+K++YGNPT++++ NGMD   NL+  +   DT R+++Y+SYL 
Sbjct  361  SNWLYIVPWGMYGCVNYIKQKYGNPTVVITSNGMDQPANLSRDQYLRDTTRVHFYRSYLT  420

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSLLDNFEW  GYTS+FG+VYVD+ TL+R PK SA WF+ M++
Sbjct  421  QLKKAIDEGANVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLK  480



>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant
 pdb|3SCP|B Chain B, Crystal Structure Of Rice Bglu1 E386a Mutant
 pdb|3SCQ|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCQ|B Chain B, Crystal Structure Of Rice Bglu1 E386a Mutant Complexed 
With Alpha- Glucosyl Fluoride
Length=481

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 180/240 (75%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE L+ S  D  AAQRARDFH+GW+L P++ G YP+ MQ++V  RLPKF
Sbjct  241  GKVGIVLDFNWYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKF  300

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ ++VKGS DY+GINQYT  YM      +     Y  DW V + + KNG PIGP+A+
Sbjct  301  TPEQARLVKGSADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQAN  360

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMY  V+Y+K++YGNPT++++ NGMD   NL+  +   DT R+++Y+SYL 
Sbjct  361  SNWLYIVPWGMYGCVNYIKQKYGNPTVVITANGMDQPANLSRDQYLRDTTRVHFYRSYLT  420

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSLLDNFEW  GYTS+FG+VYVD+ TL+R PK SA WF+ M++
Sbjct  421  QLKKAIDEGANVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLK  480



>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant
 pdb|3SCN|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant
 pdb|3SCO|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCO|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCT|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellotetraose
 pdb|3SCT|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellotetraose
 pdb|3SCU|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellopentaose
 pdb|3SCU|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellopentaose
Length=481

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 180/240 (75%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE L+ S  D  AAQRARDFH+GW+L P++ G YP+ MQ++V  RLPKF
Sbjct  241  GKVGIVLDFNWYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKF  300

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ ++VKGS DY+GINQYT  YM      +     Y  DW V + + KNG PIGP+A+
Sbjct  301  TPEQARLVKGSADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQAN  360

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMY  V+Y+K++YGNPT++++ NGMD   NL+  +   DT R+++Y+SYL 
Sbjct  361  SNWLYIVPWGMYGCVNYIKQKYGNPTVVITGNGMDQPANLSRDQYLRDTTRVHFYRSYLT  420

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSLLDNFEW  GYTS+FG+VYVD+ TL+R PK SA WF+ M++
Sbjct  421  QLKKAIDEGANVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLK  480



>ref|XP_009388049.1| PREDICTED: beta-glucosidase 26-like [Musa acuminata subsp. malaccensis]
Length=256

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 178/229 (78%), Gaps = 0/229 (0%)
 Frame = -2

Query  776  TRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKFTPDEVKMVKGSIDYV  597
            T+ +A    A   R + L  FLHP+ YG YPK+++ IV  RLPKFT D+VKMVKGS DYV
Sbjct  27   TKLRAWRSRATEDRAYGLHSFLHPLTYGYYPKSIREIVKDRLPKFTADQVKMVKGSYDYV  86

Query  596  GINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAHSYWLYMVPWGMYKAV  417
            G+NQYT+YYM +     P    YQ+DW+V F ++++GVPIGP+A+S WLY+VPWGMYKAV
Sbjct  87   GVNQYTSYYMKDNGVTNPKPVSYQDDWHVEFKFDRDGVPIGPQAYSGWLYIVPWGMYKAV  146

Query  416  SYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLIQLKKAIDDGANVIGY  237
            +YVK  YG+P +IL+ENGMD  GN+T  E   DTKRIN+YKSY+ +LK+A+DDGA VIGY
Sbjct  147  TYVKVNYGDPVIILAENGMDQPGNVTLPEGLRDTKRINFYKSYITELKRAMDDGATVIGY  206

Query  236  HAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIRRNKH  90
             AWSLLDNFEWRLGYTSRFGLVYVD+KT  R PKESA WF+ M++R K+
Sbjct  207  FAWSLLDNFEWRLGYTSRFGLVYVDFKTNMRYPKESAYWFKNMLKRKKN  255



>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED 
WITH Cellotetraose
 pdb|3SCV|B Chain B, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED 
WITH Cellotetraose
Length=481

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 180/240 (75%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE L+ S  D  AAQRARDFH+GW+L P++ G YP+ MQ++V  RLPKF
Sbjct  241  GKVGIVLDFNWYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKF  300

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ ++VKGS DY+GINQYT  YM      +     Y  DW V + + KNG PIGP+A+
Sbjct  301  TPEQARLVKGSADYIGINQYTASYMKGQQLMQQTPTSYAADWQVTYVFAKNGKPIGPQAN  360

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMY  V+Y+K++YGNPT++++ NGMD   NL+  +   DT R+++Y+SYL 
Sbjct  361  SNWLYIVPWGMYGCVNYIKQKYGNPTVVITGNGMDQPANLSRDQYLRDTTRVHFYRSYLT  420

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSLLDNFEW  GYTS+FG+VYVD+ TL+R PK SA WF+ M++
Sbjct  421  QLKKAIDEGANVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLK  480



>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED 
WITH Cellotetraose
 pdb|3SCW|B Chain B, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED 
WITH Cellotetraose
Length=481

 Score =   302 bits (773),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 179/240 (75%), Gaps = 0/240 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE L+ S  D  AAQRARDFH+GW+L P++ G YP+ MQ++V  RLPKF
Sbjct  241  GKVGIVLDFNWYEALSNSTEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKF  300

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ ++VKGS DY+GINQYT  YM      +     Y  DW V   + KNG PIGP+A+
Sbjct  301  TPEQARLVKGSADYIGINQYTASYMKGQQLMQQTPTSYSADWQVTAVFAKNGKPIGPQAN  360

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMY  V+Y+K++YGNPT++++ NGMD   NL+  +   DT R+++Y+SYL 
Sbjct  361  SNWLYIVPWGMYGCVNYIKQKYGNPTVVITGNGMDQPANLSRDQYLRDTTRVHFYRSYLT  420

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID+GANV GY AWSLLDNFEW  GYTS+FG+VYVD+ TL+R PK SA WF+ M++
Sbjct  421  QLKKAIDEGANVAGYFAWSLLDNFEWLSGYTSKFGIVYVDFNTLERHPKASAYWFRDMLK  480



>ref|XP_006664007.1| PREDICTED: beta-glucosidase 38-like [Oryza brachyantha]
Length=498

 Score =   302 bits (774),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 183/240 (76%), Gaps = 2/240 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEPLT  + D  AA RAR+F LGWFLHPI YG YP+TMQNIV +RLP F
Sbjct  258  GKIGILLDFVWYEPLTDREEDRAAAHRAREFTLGWFLHPITYGHYPETMQNIVMRRLPNF  317

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T ++ +M+KGS DY+GIN YTTYY+   H+       Y NDW+V  +YE++GVPIG +A+
Sbjct  318  TREQSEMIKGSADYIGINHYTTYYV--SHHVNKTFMSYLNDWDVKISYERDGVPIGKQAY  375

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKAV +VKE+Y +P +I+ ENG+D  GN T   + +D+ RI Y+  YL 
Sbjct  376  SNWLYVVPWGIYKAVMHVKEKYKDPIIIIGENGIDQPGNDTLPGALYDSFRIEYFDQYLH  435

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+AI DGA VIGY AWSLLDNFEWRLG+TS+FG+VYVD +T  R PK+S +WF+ +I+
Sbjct  436  ELKRAITDGAKVIGYFAWSLLDNFEWRLGFTSKFGIVYVDRQTFTRYPKDSTRWFRKVIK  495



>ref|XP_004982055.1| PREDICTED: beta-glucosidase 7-like isoform X1 [Setaria italica]
Length=503

 Score =   302 bits (774),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 180/243 (74%), Gaps = 1/243 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYEPLT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLP+F
Sbjct  261  GKIGIVLDFNWYEPLTNSTDDQAAAQRARDFHIGWFVDPLINGHYPQIMQDLVKERLPRF  320

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ K+VKGS DY+GINQYT  YM      +     Y  DW V +   +NG PIGP+A+
Sbjct  321  TPEQAKLVKGSADYIGINQYTASYMKGQKLLQQTPTSYSADWQVQYVLARNGKPIGPQAN  380

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMY  V+Y+KE+YGNPT+ ++ENGMD  GNLT  +   D  R+ +YKSYL 
Sbjct  381  SNWLYIVPWGMYGCVNYLKEKYGNPTVYITENGMDQPGNLTRDQYLRDVTRVRFYKSYLA  440

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT-LKRAPKESAKWFQYMI  105
            QLKKAID GANV GY AWSLLDNFEW  GY+S+FG+VYVD+   L+R PK SA WF+ M+
Sbjct  441  QLKKAIDQGANVAGYFAWSLLDNFEWLSGYSSKFGIVYVDFNNKLERHPKASAYWFRDML  500

Query  104  RRN  96
            ++N
Sbjct  501  KKN  503



>gb|EEC69164.1| hypothetical protein OsI_38122 [Oryza sativa Indica Group]
Length=492

 Score =   300 bits (768),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 182/240 (76%), Gaps = 2/240 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEPLT  + D+ AA RAR+F LGW+LHPI+YG YP+TMQN V +RLP F
Sbjct  252  GKIGILLDFVWYEPLTDKEEDHAAAHRAREFTLGWYLHPIIYGHYPETMQNAVKERLPNF  311

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T ++ +M+KGS DY+ IN YTTYY+   H NK  +  Y NDW+V  +YE+NGVPIG +A+
Sbjct  312  TREQSEMIKGSADYIAINHYTTYYVSH-HVNKTSI-SYLNDWDVKISYERNGVPIGKQAY  369

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKAV +VKE+Y +P +I+ ENG+D  GN T   + +D  RI Y+  YL 
Sbjct  370  SNWLYVVPWGIYKAVMHVKEKYKDPIIIIGENGIDQPGNETLPGALYDFFRIQYFDQYLH  429

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+AI DGA V GY AWSLLDNFEWRLG+TS+FG+VYVD  T  R PK+S +WF+ MI+
Sbjct  430  ELKRAIKDGARVTGYFAWSLLDNFEWRLGFTSKFGIVYVDRSTFTRYPKDSTRWFRKMIK  489



>ref|XP_004982054.1| PREDICTED: beta-glucosidase 8-like [Setaria italica]
Length=566

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/239 (62%), Positives = 186/239 (78%), Gaps = 0/239 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYEPLT S AD  AAQRARDFH+GWF+ P++ G+YPKTMQ+IV  RLP F
Sbjct  273  GKVGIVLDFNWYEPLTNSTADQAAAQRARDFHVGWFMDPLINGQYPKTMQDIVKDRLPSF  332

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ K+VKGS D  GINQYTTYY+ +    +   P Y +DW V + +E+NG+PIG  A+
Sbjct  333  TPEQAKLVKGSSDCFGINQYTTYYISDEQTPQQATPSYSSDWGVQYNFERNGLPIGQLAN  392

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V+Y+KE+Y NPT+I+SENGMD +GNLT  E  HDT R+ +YK+YL 
Sbjct  393  SVWLYIVPTGMYGVVNYLKEKYQNPTIIISENGMDQSGNLTRDEYLHDTVRVEFYKNYLT  452

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMI  105
            +LKK ID+GANV+ Y AWSLLDNFEW  GYTS+FG+VYVD+ TLKR PK+SA WF+ M+
Sbjct  453  ELKKGIDEGANVVAYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLKRYPKDSAYWFRDML  511



>ref|NP_001066656.1| Os12g0420100 [Oryza sativa Japonica Group]
 sp|Q2QSR8.2|BGL38_ORYSJ RecName: Full=Beta-glucosidase 38; Short=Os12bglu38; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABA97621.2| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29675.1| Os12g0420100 [Oryza sativa Japonica Group]
 dbj|BAG92285.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53109.1| hypothetical protein OsJ_35886 [Oryza sativa Japonica Group]
Length=492

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 181/240 (75%), Gaps = 2/240 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEPLT  + D+ AA RAR+F LGW+LHPI YG YP+TMQN V +RLP F
Sbjct  252  GKIGILLDFVWYEPLTDKEEDHAAAHRAREFTLGWYLHPITYGHYPETMQNAVKERLPNF  311

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T ++ +M+KGS DY+ IN YTTYY+   H NK  +  Y NDW+V  +YE+NGVPIG +A+
Sbjct  312  TREQSEMIKGSADYIAINHYTTYYVSH-HVNKTSI-SYLNDWDVKISYERNGVPIGKQAY  369

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKAV +VKE+Y +P +I+ ENG+D  GN T   + +D  RI Y+  YL 
Sbjct  370  SNWLYVVPWGIYKAVMHVKEKYKDPIIIIGENGIDQPGNETLPGALYDFFRIQYFDQYLH  429

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+AI DGA V GY AWSLLDNFEWRLG+TS+FG+VYVD  T  R PK+S +WF+ MI+
Sbjct  430  ELKRAIKDGARVTGYFAWSLLDNFEWRLGFTSKFGIVYVDRSTFTRYPKDSTRWFRKMIK  489



>ref|XP_008665263.1| PREDICTED: beta-glucosidase 7-like [Zea mays]
 tpg|DAA50883.1| TPA: hypothetical protein ZEAMMB73_196159 [Zea mays]
Length=506

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/244 (58%), Positives = 181/244 (74%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE LT S  D  AAQRARDFH+GWF  P++ G YP+ MQ+IV +RLPKF
Sbjct  262  GKVGIVLDFNWYEALTNSTEDQAAAQRARDFHVGWFADPLINGHYPQIMQDIVKERLPKF  321

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ K+VKGS DY+GINQYT  Y+      +     Y  DW V +  E+NG PIGP+A+
Sbjct  322  TPEQAKLVKGSADYIGINQYTASYVKGQKLLQQKPTSYSADWQVQYVLERNGKPIGPQAN  381

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V+Y+K +YGNPT+ ++ENGMD  GNLT  +  HDT R+ +YK YL 
Sbjct  382  SKWLYIVPEGMYGCVNYLKHKYGNPTVFITENGMDQPGNLTRGQYLHDTTRVQFYKGYLA  441

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT--LKRAPKESAKWFQYM  108
            +L+KAIDDGA+V GY AWSLLDNFEW+ GYTS+FG+VYVD+ T  L+R PK SA WF+ M
Sbjct  442  ELRKAIDDGADVAGYFAWSLLDNFEWQSGYTSKFGIVYVDFSTPKLERHPKASAYWFRDM  501

Query  107  IRRN  96
            ++++
Sbjct  502  LQKH  505



>ref|XP_004982056.1| PREDICTED: beta-glucosidase 7-like isoform X2 [Setaria italica]
Length=502

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 180/243 (74%), Gaps = 2/243 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYEPLT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLP+F
Sbjct  261  GKIGIVLDFNWYEPLTNSTDDQAAAQRARDFHIGWFVDPLINGHYPQIMQDLVKERLPRF  320

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ K+VKGS DY+GINQYT  YM      +     Y  DW V +   +NG PIGP+A+
Sbjct  321  TPEQAKLVKGSADYIGINQYTASYMKGQKLLQQTPTSYSADWQVQYV-SRNGKPIGPQAN  379

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWGMY  V+Y+KE+YGNPT+ ++ENGMD  GNLT  +   D  R+ +YKSYL 
Sbjct  380  SNWLYIVPWGMYGCVNYLKEKYGNPTVYITENGMDQPGNLTRDQYLRDVTRVRFYKSYLA  439

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT-LKRAPKESAKWFQYMI  105
            QLKKAID GANV GY AWSLLDNFEW  GY+S+FG+VYVD+   L+R PK SA WF+ M+
Sbjct  440  QLKKAIDQGANVAGYFAWSLLDNFEWLSGYSSKFGIVYVDFNNKLERHPKASAYWFRDML  499

Query  104  RRN  96
            ++N
Sbjct  500  KKN  502



>ref|XP_003559508.1| PREDICTED: beta-glucosidase 7-like [Brachypodium distachyon]
Length=511

 Score =   297 bits (761),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/242 (58%), Positives = 180/242 (74%), Gaps = 2/242 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLP+F
Sbjct  269  GKVGIVLDFNWYEALTNSTDDEAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRF  328

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TPDE K+V GS DY+GINQYT  Y+            Y  DW V +A ++NG+PIGP+A+
Sbjct  329  TPDETKLVNGSADYIGINQYTANYIKGQKLVPQKPTSYSADWQVTYASDRNGIPIGPKAN  388

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V+Y++E+YGNP ++++ENGMD  GNLT  E  HD  RI YY+SYL 
Sbjct  389  SNWLYIVPTGMYGCVNYLREKYGNPAVVITENGMDQPGNLTRDEYLHDITRIRYYRSYLA  448

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT--LKRAPKESAKWFQYM  108
            +LK+AID GANV+GY AWSLLDNFEW  GYTS+FG+VYVD+ +  L+R PK SA WF+ M
Sbjct  449  ELKRAIDGGANVLGYFAWSLLDNFEWISGYTSKFGIVYVDFNSTKLERHPKASAYWFRDM  508

Query  107  IR  102
            ++
Sbjct  509  LK  510



>ref|NP_001142124.1| uncharacterized protein LOC100274288 precursor [Zea mays]
 gb|ACF87697.1| unknown [Zea mays]
 gb|ACF87698.1| unknown [Zea mays]
 gb|ACR38603.1| unknown [Zea mays]
 tpg|DAA50881.1| TPA: hypothetical protein ZEAMMB73_806821 [Zea mays]
Length=502

 Score =   296 bits (758),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/242 (56%), Positives = 180/242 (74%), Gaps = 0/242 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLP+F
Sbjct  261  GKVGIVLDFNWYEALTNSPDDQAAAQRARDFHIGWFVDPLINGHYPQIMQDLVKERLPRF  320

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ K+VKGS DY+GIN+YT+ YM      +     Y  DW V + + +NG PIGP+A+
Sbjct  321  TPEQAKLVKGSADYIGINEYTSSYMKGQKLVQLAPSSYSADWQVQYVFARNGKPIGPQAN  380

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+ P GMY  V+Y+KE+YGNPT+ ++ENGMD  GNLT  +   D  R+ +Y+SY+ 
Sbjct  381  SKWLYIAPTGMYGCVNYLKEKYGNPTIYITENGMDQPGNLTRDQYLRDATRVRFYRSYIG  440

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            QLKKAID GANV GY AWSLLDNFEW  GY+S+FG+VYVD+ TL+R PK SA WF+ M++
Sbjct  441  QLKKAIDQGANVAGYFAWSLLDNFEWLAGYSSKFGIVYVDFNTLERHPKASAYWFRDMLQ  500

Query  101  RN  96
            ++
Sbjct  501  KH  502



>ref|XP_010237292.1| PREDICTED: beta-glucosidase 38-like [Brachypodium distachyon]
Length=494

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/243 (57%), Positives = 178/243 (73%), Gaps = 2/243 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEP   +  D YAA RAR+F LGWFLHPI YG YP+TMQ IVG RLP F
Sbjct  254  GKIGILLDFVWYEPYNYTIEDEYAAHRAREFTLGWFLHPITYGHYPETMQKIVGDRLPSF  313

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            +P++  +V+GS DY+GIN YT+YY+   H        Y NDW    +Y++NGV IG +A 
Sbjct  314  SPEQTALVQGSADYIGINHYTSYYV--KHYVNLTHMSYANDWQAKISYDRNGVLIGKQAF  371

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG YKAV +VK+++ NP +++ ENG+D AGN T   + +D  RI+Y+  YL 
Sbjct  372  SNWLYVVPWGFYKAVMHVKDKFRNPVIVIGENGIDQAGNDTLPHALYDHFRIDYFDQYLH  431

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+AIDDGA V+GY AWSLLDNFEWR+G+TS+FGLVYVD KT  R PK+S +WF+ MI+
Sbjct  432  ELKRAIDDGARVVGYFAWSLLDNFEWRMGFTSKFGLVYVDRKTFTRYPKDSTRWFRKMIK  491

Query  101  RNK  93
              +
Sbjct  492  NEE  494



>gb|AFW69221.1| hypothetical protein ZEAMMB73_365784 [Zea mays]
Length=502

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 177/240 (74%), Gaps = 2/240 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEPLT+S  D YAA RAR F LGWFLHPI YG YP+TMQ IV  RLP F
Sbjct  262  GKIGILLDFVWYEPLTKSVEDEYAAHRARMFTLGWFLHPITYGHYPETMQKIVMGRLPNF  321

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T ++  MVKGS DYV IN YTTYY     N       Y+NDWN   +YE++GVPIG RA+
Sbjct  322  TFEQSAMVKGSADYVAINHYTTYYASNFVNATET--NYRNDWNAKISYERDGVPIGKRAY  379

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKA+ + KE++ +P M++ ENG+D  GN T   + +D  RI+Y++ YL 
Sbjct  380  SDWLYVVPWGLYKALIWTKEKFNSPVMLIGENGIDQPGNETLPFALYDKFRIDYFEKYLY  439

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +L+ AI DGANV GY AWSLLDNFEWRLG+TS+FG+VYVD  T  R PK+SA+WF+ +I+
Sbjct  440  ELQCAIRDGANVFGYFAWSLLDNFEWRLGFTSKFGIVYVDRNTFVRYPKDSARWFRKVIK  499



>ref|XP_008644990.1| PREDICTED: beta-glucosidase 38-like [Zea mays]
Length=552

 Score =   294 bits (753),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 177/240 (74%), Gaps = 2/240 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEPLT+S  D YAA RAR F LGWFLHPI YG YP+TMQ IV  RLP F
Sbjct  312  GKIGILLDFVWYEPLTKSVEDEYAAHRARMFTLGWFLHPITYGHYPETMQKIVMGRLPNF  371

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T ++  MVKGS DYV IN YTTYY     N       Y+NDWN   +YE++GVPIG RA+
Sbjct  372  TFEQSAMVKGSADYVAINHYTTYYASNFVNATET--NYRNDWNAKISYERDGVPIGKRAY  429

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKA+ + KE++ +P M++ ENG+D  GN T   + +D  RI+Y++ YL 
Sbjct  430  SDWLYVVPWGLYKALIWTKEKFNSPVMLIGENGIDQPGNETLPFALYDKFRIDYFEKYLY  489

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +L+ AI DGANV GY AWSLLDNFEWRLG+TS+FG+VYVD  T  R PK+SA+WF+ +I+
Sbjct  490  ELQCAIRDGANVFGYFAWSLLDNFEWRLGFTSKFGIVYVDRNTFVRYPKDSARWFRKVIK  549



>ref|XP_004963948.1| PREDICTED: beta-glucosidase 38-like [Setaria italica]
Length=499

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 177/240 (74%), Gaps = 2/240 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEPLT S  D +AA RAR F LGWFLHPI +G YP+TM+ IV  RLP F
Sbjct  260  GKIGILLDFVWYEPLTPSMDDEFAAHRARMFTLGWFLHPITFGHYPETMEKIVMGRLPNF  319

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T ++  MVKGS DY+ IN YTTYY     N       Y NDW+V  +YE+NGVPIG + +
Sbjct  320  TFEQSAMVKGSADYIAINHYTTYYASNFANETHT--SYVNDWHVKLSYERNGVPIGKKGY  377

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKA+ + KE++ NP M++ ENG+D +GN +   + +D  RI+Y++ YL 
Sbjct  378  SDWLYVVPWGLYKALLWTKEKFNNPVMLIGENGIDQSGNDSLPGALYDKFRIDYFEKYLY  437

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +L+ AI DGANVIGY AWSLLDNFEWRLG+TS+FG+VYVD  T  R PK+SA+WF+ MI+
Sbjct  438  ELQCAIHDGANVIGYFAWSLLDNFEWRLGFTSKFGIVYVDRTTFARYPKDSARWFRKMIK  497



>gb|EMT00720.1| Beta-glucosidase 1 [Aegilops tauschii]
Length=545

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 188/255 (74%), Gaps = 15/255 (6%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE  T S AD  AAQRARDFH+GWFL P++ G+YPKTMQ+IV +RLP F
Sbjct  230  GKVGIVLDFNWYEAATNSPADQAAAQRARDFHVGWFLDPLLNGQYPKTMQDIVKERLPSF  289

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGF--------------  504
            TP++ K+VKGS+DY+GINQYT  YM +    + P   Y +DW+V +              
Sbjct  290  TPEQSKLVKGSVDYIGINQYTATYMADQPTPQQPPTSYSSDWHVQYIFTQDTSLLTLSFK  349

Query  503  -AYEKNGVPIGPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAES  327
             A ++NGVPIG +A+S WLY+VP GMY  V+Y++E+Y NPT+I+SENGMD   NLT  E 
Sbjct  350  RAVQRNGVPIGQKANSNWLYIVPTGMYGCVNYIREKYNNPTIIISENGMDQPANLTREEF  409

Query  326  YHDTKRINYYKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLK  147
             HD  R+ +YK+YL +LKKAIDDGANV+GY AWSLLDNFEW  GYTS+FG+VYVD+ TLK
Sbjct  410  LHDASRVEFYKTYLAELKKAIDDGANVVGYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLK  469

Query  146  RAPKESAKWFQYMIR  102
            R PK+SA WF+ M++
Sbjct  470  RYPKDSAYWFKNMLQ  484



>ref|XP_003559509.1| PREDICTED: beta-glucosidase 7-like isoform X1 [Brachypodium distachyon]
 ref|XP_010230912.1| PREDICTED: beta-glucosidase 7-like isoform X2 [Brachypodium distachyon]
Length=510

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/242 (57%), Positives = 178/242 (74%), Gaps = 2/242 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLP+F
Sbjct  268  GKIGIVLDFNWYEALTNSAEDEAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRF  327

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T DEVK+VKGS DY+GINQYT  Y+      +     Y  DW V +A  +NG PIGP+A+
Sbjct  328  TSDEVKIVKGSADYIGINQYTASYIKGQKLVQQAPTSYSADWQVTYASLRNGKPIGPKAN  387

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V+Y++ +YGNP ++++ENGMD  GNLT  E   D  R+ +Y+SYL 
Sbjct  388  SDWLYIVPTGMYGCVNYLRVKYGNPAIVITENGMDQPGNLTRDEYLRDVTRVRFYRSYLA  447

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT--LKRAPKESAKWFQYM  108
            +LKKAID GANV+GY AWSLLDNFEW  GYTS+FG+VYVD+ +  L+R PK SA WF+ M
Sbjct  448  ELKKAIDGGANVLGYFAWSLLDNFEWGSGYTSKFGIVYVDFNSTKLERHPKASAYWFRDM  507

Query  107  IR  102
            ++
Sbjct  508  LK  509



>gb|EMS62098.1| Beta-glucosidase 8 [Triticum urartu]
Length=554

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 188/255 (74%), Gaps = 15/255 (6%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE  T S AD  AAQRARDFH+GWFL P++ G+YPKTMQ+IV +RLP F
Sbjct  238  GKVGIVLDFNWYEAATNSPADQAAAQRARDFHVGWFLDPLLNGQYPKTMQDIVKERLPSF  297

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGF--------------  504
            TP++ K+VKGS+DY+GINQYT  YM +    + P   Y +DW+V +              
Sbjct  298  TPEQSKLVKGSVDYIGINQYTATYMADQPTPQQPPTSYSSDWHVQYIFTQDTSLLTLSFT  357

Query  503  -AYEKNGVPIGPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAES  327
             A ++NGVPIG +A+S WLY+VP GMY  V+Y++E+Y NPT+I+SENGMD   NLT  E 
Sbjct  358  HAVQRNGVPIGQKANSNWLYIVPTGMYGCVNYIREKYNNPTIIISENGMDQPANLTREEF  417

Query  326  YHDTKRINYYKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLK  147
             HD  R+ +YK+YL +LKKAIDDGANV+GY AWSLLDNFEW  GYTS+FG+VYVD+ TLK
Sbjct  418  LHDASRVEFYKTYLAELKKAIDDGANVVGYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLK  477

Query  146  RAPKESAKWFQYMIR  102
            R PK+SA WF+ M++
Sbjct  478  RYPKDSAYWFKKMLQ  492



>gb|ADP02192.1| putative non-cyanogenic beta-glucosidase [Triticum aestivum]
Length=507

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/242 (56%), Positives = 176/242 (73%), Gaps = 2/242 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLP+F
Sbjct  265  GKVGIVLDFNWYEALTNSTEDQAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRF  324

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TPDE K+VKGS DY+GINQYT   M      +     Y  DW V +A+E+NG PIGP+A+
Sbjct  325  TPDEAKLVKGSADYIGINQYTASLMKGQKLTQQTPTSYSADWQVTYAFERNGKPIGPKAN  384

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V Y+ ++YGNP ++++ENGMD  G LT  +   D  R+ +Y+SYL 
Sbjct  385  SNWLYIVPSGMYGCVHYLSQKYGNPAIVITENGMDQPGGLTRDQYLRDATRVRFYRSYLS  444

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK--TLKRAPKESAKWFQYM  108
            +LKKAID GANV+GY AWSLLDNFEW  GY+S+FG+VYVD+   TL R PK SA WF+ +
Sbjct  445  ELKKAIDGGANVLGYFAWSLLDNFEWISGYSSKFGIVYVDFNSPTLDRHPKASAYWFRDL  504

Query  107  IR  102
            ++
Sbjct  505  LQ  506



>gb|EMS62097.1| Beta-glucosidase 7 [Triticum urartu]
Length=531

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/242 (56%), Positives = 176/242 (73%), Gaps = 2/242 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLP+F
Sbjct  289  GKVGIVLDFNWYEALTNSTEDQAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRF  348

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TPDE K+VKGS DY+GINQYT   M      +     Y  DW V +A+E+NG PIGP+A+
Sbjct  349  TPDEAKLVKGSADYIGINQYTASLMKGQKLTQQTPTSYSADWQVTYAFERNGKPIGPKAN  408

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V Y+ ++YGNP ++++ENGMD  G LT  +   D  R+ YY+SYL 
Sbjct  409  SNWLYIVPSGMYGCVHYLSQKYGNPAIVITENGMDQPGGLTRDQYLRDATRVRYYRSYLG  468

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT--LKRAPKESAKWFQYM  108
            +LKKAID GANV+GY AWSLLDNFEW  GY+S+FG+VYVD+ +  L R PK SA WF+ +
Sbjct  469  ELKKAIDGGANVLGYFAWSLLDNFEWISGYSSKFGIVYVDFNSPNLDRHPKASAYWFRDL  528

Query  107  IR  102
            ++
Sbjct  529  LQ  530



>gb|ADP02193.1| Glyco_hydro_1 domain-containing protein [Triticum aestivum]
Length=587

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 188/255 (74%), Gaps = 15/255 (6%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE  T S AD  AAQRARDFH+GWFL P++ G+YPKTMQ+IV +RLP F
Sbjct  272  GKVGIVLDFNWYEAATNSPADQAAAQRARDFHVGWFLDPLLNGQYPKTMQDIVKERLPSF  331

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGF--------------  504
            TP++ K+VKGS+DY+GINQYT  YM +    + P   Y +DW+V +              
Sbjct  332  TPEQSKLVKGSVDYIGINQYTATYMADQPTPQQPPTSYSSDWHVQYIFTQDTSLLTLSFK  391

Query  503  -AYEKNGVPIGPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAES  327
             A ++NGVPIG +A+S WLY+VP GMY  V+Y++E+Y NPT+I+SENGMD   NLT  E 
Sbjct  392  RAVQRNGVPIGQKANSNWLYIVPTGMYGCVNYIREKYNNPTIIISENGMDQPANLTREEF  451

Query  326  YHDTKRINYYKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLK  147
             HD  R+ +Y++YL +LKKAIDDGANV+GY AWSLLDNFEW  GYTS+FG+VYVD+ TLK
Sbjct  452  LHDASRVEFYETYLAELKKAIDDGANVVGYFAWSLLDNFEWLSGYTSKFGIVYVDFTTLK  511

Query  146  RAPKESAKWFQYMIR  102
            R PK+SA WF+ M++
Sbjct  512  RYPKDSAYWFKNMLQ  526



>gb|EMT31426.1| Beta-glucosidase 1 [Aegilops tauschii]
Length=509

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/242 (56%), Positives = 175/242 (72%), Gaps = 2/242 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLP+F
Sbjct  267  GKVGIVLDFNWYEALTNSTEDQAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRF  326

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP E K+VKGS DY+GINQYT   M      +     Y  DW V +A+E+NG PIGP+A+
Sbjct  327  TPSEAKLVKGSADYIGINQYTASLMKGQKLTQQTPTSYSADWQVTYAFERNGKPIGPKAN  386

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V Y+ ++YGNP ++++ENGMD  G LT  +   D  R+ +Y+SYL 
Sbjct  387  SNWLYIVPSGMYGCVHYLSQKYGNPAIVITENGMDQPGGLTRDQYLRDATRVRFYRSYLS  446

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK--TLKRAPKESAKWFQYM  108
            +LKKAID GANV+GY AWSLLDNFEW  GY+S+FG+VYVD+   TL R PK SA WF+ +
Sbjct  447  ELKKAIDGGANVLGYFAWSLLDNFEWISGYSSKFGIVYVDFNSPTLDRHPKASAYWFRDL  506

Query  107  IR  102
            ++
Sbjct  507  LQ  508



>dbj|BAJ90056.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=501

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/242 (57%), Positives = 175/242 (72%), Gaps = 2/242 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE LT S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLPKF
Sbjct  259  GKVGIVLDFNWYEALTNSTEDQAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPKF  318

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP E KMV GS DY+GINQYT   M      +     Y  DW V +A+E+NG PIGP+A+
Sbjct  319  TPAEAKMVMGSADYIGINQYTASLMKGQKLLQQTPTSYSADWQVTYAFERNGKPIGPKAN  378

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V Y+ ++YGNP ++++ENGMD  G LT  +   DT R+ +Y+SYL 
Sbjct  379  SNWLYIVPSGMYGCVHYLSQKYGNPPIVITENGMDQPGGLTRDQYLRDTTRVRFYRSYLS  438

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT--LKRAPKESAKWFQYM  108
            +LKKAID GANV+GY AWSLLDNFEW  GY+S+FG+VYVD+ +  L R PK SA WF+ +
Sbjct  439  ELKKAIDGGANVLGYFAWSLLDNFEWMSGYSSKFGIVYVDFNSPNLDRHPKASAYWFRDL  498

Query  107  IR  102
            +R
Sbjct  499  LR  500



>gb|KJB16882.1| hypothetical protein B456_002G252800, partial [Gossypium raimondii]
Length=457

 Score =   281 bits (718),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 171/254 (67%), Gaps = 15/254 (6%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GIFLDFVWY+PLTRSKADNYAAQRARDFH+GWFLHP+VYG++ +TMQ IVG+RLPKF
Sbjct  203  GRIGIFLDFVWYKPLTRSKADNYAAQRARDFHIGWFLHPLVYGKHSRTMQKIVGERLPKF  262

Query  641  TPDEVKMVKGSI----------DYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEK  492
            T  EV                 D + +N YT YY+Y+PH  +PP         +      
Sbjct  263  TKSEVFTFYYIYFYFLLLLFTFDVLCLNHYTFYYIYDPH--RPPSINAIMSITLSTFLNP  320

Query  491  NGVPIGP---RAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYH  321
              V       R HS WLY VPW MYK V+YVKE Y NP ++L ENG+D  GNLTF ES +
Sbjct  321  TSVNTNAQEMRTHSEWLYEVPWDMYKVVTYVKECYDNPNIVLFENGIDDPGNLTFPESLY  380

Query  320  DTKRINYYKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRA  141
            D+ R+  Y+SYL  LK+A+DDGAN  GY AWS+LDNFEW LGYTSRFGLVYVD+  LKR 
Sbjct  381  DSNRVIIYRSYLKGLKRAMDDGANASGYFAWSVLDNFEWLLGYTSRFGLVYVDHNDLKRY  440

Query  140  PKESAKWFQYMIRR  99
             K SA WF+  + R
Sbjct  441  SKLSAYWFKQTLER  454



>gb|EMS63424.1| Beta-glucosidase 38 [Triticum urartu]
Length=490

 Score =   280 bits (715),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 175/244 (72%), Gaps = 2/244 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LDFVWYEPLT ++ D YAA RAR+F LGW++HPI +G YP+TMQ +VG RLP F
Sbjct  249  GTIGILLDFVWYEPLTYTEEDEYAAHRAREFTLGWYMHPITFGHYPETMQKLVGTRLPNF  308

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T ++ K+++GS D +GIN YTTYY+   H           DW     +E+NGVP+  +A 
Sbjct  309  TAEQSKLLQGSADIIGINHYTTYYV--RHQENLTRMSSATDWQAELLFERNGVPLRRQAF  366

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG YKAV +VK ++ +P +++ ENG+D +G+ T   + +DT RI+Y+  YL 
Sbjct  367  SKWLYVVPWGFYKAVMHVKNKFRDPLILIGENGIDQSGSDTLPHALYDTFRIDYFDQYLH  426

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +LK+AI DGA V GY AWSLLDNFEWR+G+TS+FGLVYVD KT  R PK+S +WF+ +I+
Sbjct  427  ELKRAIADGARVTGYFAWSLLDNFEWRMGFTSKFGLVYVDRKTFTRYPKDSTRWFRKVIK  486

Query  101  RNKH  90
              ++
Sbjct  487  SEEY  490



>emb|CDM83785.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 175/242 (72%), Gaps = 2/242 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LD  WYE L+ S  D  AAQRA DF +GWFL P++ G+YP+ MQ++V +RLP+F
Sbjct  261  GKVGIVLDVSWYEALSNSTEDQAAAQRAMDFLVGWFLDPLINGQYPQIMQDLVKERLPRF  320

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TPDE K+VKGS D++G+NQYTT ++            Y  D  V +++E+NG PIGPRA 
Sbjct  321  TPDEAKVVKGSADWIGVNQYTTEFVKGQKLVLQRPTSYSADLQVTYSFERNGKPIGPRAS  380

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V Y+ ++YGNP M++++NGMD  GNLT  +   D  R+ YY+SYL 
Sbjct  381  SKWLYIVPRGMYGCVHYISQKYGNPPMLITKNGMDQPGNLTRDQYLRDATRVRYYRSYLC  440

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK--TLKRAPKESAKWFQYM  108
            +LKKAID GANV+GY AWSLLDNFEW  GYTS+FG+VYV++   TL+R PK SA WF+ +
Sbjct  441  ELKKAIDGGANVLGYFAWSLLDNFEWMYGYTSKFGIVYVNFNSPTLERHPKASAYWFRDL  500

Query  107  IR  102
            ++
Sbjct  501  LQ  502



>gb|KJB16934.1| hypothetical protein B456_002G255400 [Gossypium raimondii]
Length=282

 Score =   270 bits (690),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 156/205 (76%), Gaps = 10/205 (5%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR  IFLDFVWYEPLTRSKAD YAAQRA+DFH+GWF HP+VYG+YP+TMQ IV +RL KF
Sbjct  88   GRIDIFLDFVWYEPLTRSKADYYAAQRAKDFHVGWFWHPLVYGKYPRTMQKIVRERLSKF  147

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T  EV+ VK S D + +N YT+Y++Y+PH     V  YQ DWNVGF YE+NGVPI  +AH
Sbjct  148  TKSEVEKVKNSFDILCLNHYTSYHIYDPHRPPSNVTDYQQDWNVGFVYERNGVPID-QAH  206

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY VPWGMYKAV+YVKERYG          MD   NLTF +S HD+ R+N+YKSYL 
Sbjct  207  SKWLYEVPWGMYKAVTYVKERYGR---------MDDPDNLTFPKSLHDSNRVNFYKSYLK  257

Query  281  QLKKAIDDGANVIGYHAWSLLDNFE  207
             LK+A+DDGAN+ GY AWS+L NFE
Sbjct  258  DLKRAMDDGANITGYFAWSILVNFE  282



>gb|KDO62881.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=430

 Score =   275 bits (702),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            GR GI LDFVWYEPLTRSKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLPKF
Sbjct  276  GRIGILLDFVWYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKF  335

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T +EVKMVKGSID+VGINQYT YYMY+PH  +P   GYQ DWN GFAYEKNGVPIGPRA+
Sbjct  336  TKEEVKMVKGSIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGPRAN  395

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENG  363
            SYWLY VPWGMYKA+ Y+K  YGNPT+ILSENG
Sbjct  396  SYWLYNVPWGMYKALMYIKGHYGNPTVILSENG  428



>gb|AFK37966.1| unknown [Medicago truncatula]
Length=159

 Score =   258 bits (658),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  569  MYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAHSYWLYMVPWGMYKAVSYVKERYGN  390
            MY+PHN KP VPGYQ+DWN GFAY KNGVP+GPRA+SYWLY VPWG+YK++ Y+KE Y N
Sbjct  1    MYDPHNQKPKVPGYQSDWNAGFAYAKNGVPVGPRAYSYWLYNVPWGLYKSIMYIKEHYKN  60

Query  389  PTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLIQLKKAIDDGANVIGYHAWSLLDNF  210
            PTM LSENGMD  GN+TF++  HDT RINYYK YL QL+KAIDDGANV GYHAWSLLDNF
Sbjct  61   PTMFLSENGMDDPGNVTFSKGLHDTARINYYKGYLTQLEKAIDDGANVFGYHAWSLLDNF  120

Query  209  EWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIRRNK  93
            EWRLGYTSRFG+VYVD+KTLKR PK SA WF+ ++ + K
Sbjct  121  EWRLGYTSRFGIVYVDFKTLKRTPKMSAYWFEQLLTKKK  159



>ref|XP_002438912.1| hypothetical protein SORBIDRAFT_10g028060 [Sorghum bicolor]
 gb|EER90279.1| hypothetical protein SORBIDRAFT_10g028060 [Sorghum bicolor]
Length=480

 Score =   253 bits (646),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 127/240 (53%), Positives = 160/240 (67%), Gaps = 30/240 (13%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDFVWYEPLT+S  D +AA RAR F LGWFLHPI YG YP+TM+ IV  RLP F
Sbjct  268  GKIGILLDFVWYEPLTKSIEDEFAAHRARMFTLGWFLHPITYGHYPETMEKIVMGRLPNF  327

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T ++  MVKGS DY+ IN YTTYY                  N G+              
Sbjct  328  TFEQSAMVKGSADYIAINHYTTYYAS----------------NFGY--------------  357

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VPWG+YKA+ + KE++ NP M++ ENG+D +GN T   + +D  RI+Y++ YL 
Sbjct  358  SDWLYVVPWGLYKALIWTKEKFNNPVMLIGENGIDQSGNETLPHALYDKFRIDYFQKYLQ  417

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYMIR  102
            +L+ AI DGANV GY  WSLLDNFEWRLGYTSRFG+V+VD  T  R PK+SA+WF+ +I+
Sbjct  418  ELQYAIRDGANVFGYFVWSLLDNFEWRLGYTSRFGIVHVDRSTFVRYPKDSARWFRKVIK  477



>gb|EMS48652.1| Beta-glucosidase 7 [Triticum urartu]
Length=498

 Score =   253 bits (647),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 165/242 (68%), Gaps = 17/242 (7%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LD  WYE L+ S  D  AAQRA DF +GWFL P++ G+YP+ MQ++V +RLP+F
Sbjct  271  GKVGIVLDVSWYEALSNSTEDQAAAQRAMDFLVGWFLDPLINGQYPQIMQDLVKERLPRF  330

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TPDE K+VKGS D++G+NQYTT ++      +     Y  D                +A+
Sbjct  331  TPDEAKVVKGSADWIGVNQYTTEFVKGQKLVQQRPTSYSADL---------------QAN  375

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V Y+ ++YGNP M+++ENGMD  GNLT  +   D  R+ YY+SYL 
Sbjct  376  SKWLYVVPRGMYGCVHYISQKYGNPAMLITENGMDQPGNLTRDQYLRDATRVRYYRSYLR  435

Query  281  QLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK--TLKRAPKESAKWFQYM  108
            +LKKAID GANV+GY AWSLLDNFEW  GYTS+FG+VYVD+   TL+R PK SA WF+ +
Sbjct  436  ELKKAIDGGANVLGYFAWSLLDNFEWMYGYTSKFGIVYVDFNSPTLERHPKASAYWFRDL  495

Query  107  IR  102
            ++
Sbjct  496  LQ  497



>gb|ACN26454.1| unknown [Zea mays]
Length=243

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 144/191 (75%), Gaps = 0/191 (0%)
 Frame = -2

Query  677  MQNIVGKRLPKFTPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAY  498
            MQ+IV  RLP FTP++ K+VKGS DY GINQYTTYY+ +        P Y +DW V + +
Sbjct  1    MQDIVKDRLPSFTPEQAKLVKGSSDYFGINQYTTYYIADQQTPPQGPPSYSSDWGVQYYF  60

Query  497  EKNGVPIGPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHD  318
            ++NGV IG  AHS WLY+VP GMY  V+Y+KE+Y NP +I+SENGMD  GNLT  E  HD
Sbjct  61   QRNGVQIGQMAHSIWLYIVPSGMYGVVNYLKEKYHNPIIIISENGMDQPGNLTREEYVHD  120

Query  317  TKRINYYKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAP  138
              RI++YK+YL +LK+ ID GANVIGY AWSLLDNFEW  GYTS+FG+VYVD+ TLKR P
Sbjct  121  AVRIDFYKNYLTELKRGIDGGANVIGYFAWSLLDNFEWLSGYTSKFGIVYVDFATLKRYP  180

Query  137  KESAKWFQYMI  105
            K+SA WF+ M+
Sbjct  181  KDSAYWFRDML  191



>tpg|DAA44054.1| TPA: hypothetical protein ZEAMMB73_095768 [Zea mays]
Length=468

 Score =   240 bits (613),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 166/249 (67%), Gaps = 13/249 (5%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI  D +WYEP+T S  D  A +RA++F LGWF  P  +G+YP TM+  VG+RLPKF
Sbjct  220  GELGIAFDVIWYEPMTNSTIDIEATKRAQEFQLGWFADPFFFGDYPATMRARVGERLPKF  279

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDW-----NVGFAYEKNGVPI  477
            T DE  +VKG++D++GIN YTT+Y    HN+   +    ND       +   ++KNG PI
Sbjct  280  TADEAALVKGALDFMGINHYTTFYTR--HNDTNIIGRLLNDTLADTGTISLPFDKNGKPI  337

Query  476  GPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAE---SYHDTKRI  306
            G RA+S WLY+VP G+ K ++YVKERY +PT+ ++ENGMD  GN  F     +  D+KRI
Sbjct  338  GDRANSIWLYIVPSGIRKLMNYVKERYNSPTVYITENGMD-DGNSPFTSLQNALKDSKRI  396

Query  305  NYYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKE  132
             Y+  YL  +  +I +DG +V GY AWSLLDN+EW  GYTSRFGL +VDYK  LKR PK 
Sbjct  397  KYHNGYLNNVAASIKEDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYFVDYKDNLKRHPKN  456

Query  131  SAKWFQYMI  105
            S +WF+ ++
Sbjct  457  SVQWFKTLL  465



>ref|XP_004985213.1| PREDICTED: beta-glucosidase 6-like [Setaria italica]
Length=520

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 166/248 (67%), Gaps = 11/248 (4%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI  D +WYEP+T S  D  A +RA++F LGWF  P  +G+YP TM+  V +RLPKF
Sbjct  272  GQLGIAFDVIWYEPMTNSTIDIEATKRAQEFQLGWFADPFFFGDYPATMRTRVAERLPKF  331

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDW-----NVGFAYEKNGVPI  477
            T +E  +VKG++D+VGIN YTT+Y    HN+   +    ND       +   ++KNG PI
Sbjct  332  TAEEAALVKGALDFVGINHYTTFYTR--HNDTNIIGVLLNDTLADTGTISLPFDKNGKPI  389

Query  476  GPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRIN  303
            G RA+S WLY+VP GM K ++YVKERY +P + ++ENGMD + N   +  ++  D+KRI 
Sbjct  390  GDRANSIWLYIVPSGMRKLMNYVKERYNSPPVYITENGMDDSNNPFTSIKDALKDSKRIK  449

Query  302  YYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKES  129
            Y+  YL  L  +I +DG +V GY AWSLLDN+EW  GYTSRFGL +VDY+  LKR PK S
Sbjct  450  YHNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYFVDYRDNLKRYPKNS  509

Query  128  AKWFQYMI  105
             +WF+ ++
Sbjct  510  VQWFKSLL  517



>ref|XP_007133703.1| hypothetical protein PHAVU_011G201700g [Phaseolus vulgaris]
 gb|ESW05697.1| hypothetical protein PHAVU_011G201700g [Phaseolus vulgaris]
Length=530

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/242 (47%), Positives = 159/242 (66%), Gaps = 2/242 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI L   W  PL  +++D +AA+RA DF  GWF+ P+  GEYPK+MQ++VG RLPKF
Sbjct  281  GVIGISLSCHWIVPLYDTESDQFAAERALDFMFGWFMEPLTIGEYPKSMQSLVGSRLPKF  340

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            + DE+K+V+GS D++GIN YT+YY  +        P Y  D  V    E+NG+PIG    
Sbjct  341  SADEIKLVRGSFDFIGINYYTSYYASDTPELSEARPSYLTDSLVILTSERNGIPIGKMTT  400

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRINYYKSY  288
            S WLY+ P G++  + Y+K +Y NP + ++ENG+D   +  L+  E+  DT RI+Y+  +
Sbjct  401  SKWLYVCPKGIHDLLLYIKTKYNNPLIYITENGIDEFNDHTLSLEEALADTSRIDYFYDH  460

Query  287  LIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYM  108
            L  L+ AI++G NV GY AWSL D+FEW LGY SRFG ++VDY  LKR PK SA WF+  
Sbjct  461  LYYLQSAIENGVNVKGYFAWSLTDSFEWNLGYISRFGTIFVDYHNLKRYPKSSAIWFRDF  520

Query  107  IR  102
            ++
Sbjct  521  LQ  522



>ref|NP_001268161.1| beta-glucosidase precursor [Vitis vinifera]
 gb|ADD17684.1| beta-glucosidase [Vitis vinifera]
Length=505

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 163/243 (67%), Gaps = 7/243 (3%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  G+  D +W+EP T S  D  A QRA+DF LGWF+ P++YG+YPK++++ VG RLP F
Sbjct  257  GSLGVAFDVIWFEPKTNSTEDIEATQRAQDFQLGWFIDPLMYGDYPKSLKDGVGSRLPNF  316

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPV---PGYQNDWNVGFAYEKNGVPIGP  471
            T DE  ++KGS+D+VGIN YTT+Y     NN   +       +   +   + K+G PIG 
Sbjct  317  TRDESALLKGSLDFVGINHYTTFYAEYDANNLTGMLLNDSLADSRAITLPFSKDGQPIGD  376

Query  470  RAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRINYY  297
            RA+S WLY+VP GM + ++Y+K++YGNP +I++ENGMD A N  +   ++  D KRI Y+
Sbjct  377  RANSIWLYIVPRGMRRLMNYIKQKYGNPPIIITENGMDDANNPFIPIKDALKDEKRIKYH  436

Query  296  KSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT-LKRAPKESAK  123
              YL  L  +I +DG NV GY  WSLLDN+EW  G+TSRFGL +VDYK  LKR PK S +
Sbjct  437  NDYLQSLLASIKEDGCNVKGYFVWSLLDNWEWGAGFTSRFGLFFVDYKDKLKRYPKNSVQ  496

Query  122  WFQ  114
            WF+
Sbjct  497  WFK  499



>gb|EAY94514.1| hypothetical protein OsI_16286 [Oryza sativa Indica Group]
Length=374

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 168/249 (67%), Gaps = 11/249 (4%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI L+  W+ PL++SK+ + AA+RA DF LGWF+ P++ G+YP +M+ +VG RLP+F
Sbjct  112  GKIGIILNADWFVPLSQSKSSSDAARRALDFMLGWFMDPLIRGDYPLSMRELVGNRLPEF  171

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVG----FAYEKNGVPIG  474
            + ++  MVKG+ D++G+N YT+ Y     +N PP  G+ N +N          +NG+PIG
Sbjct  172  SKEQSGMVKGAFDFIGLNYYTSSYA----DNDPPSHGHNNSYNTDSHAKITGSRNGIPIG  227

Query  473  PRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLT--FAESYHDTKRINY  300
            P+A S+W ++ P G+ + + YVKE YGNPT+ ++ENG+D   N T    E+  D  RI Y
Sbjct  228  PQAASFWFHIYPEGICEMLLYVKENYGNPTIYITENGVDEVNNKTMPLEEALKDDTRIEY  287

Query  299  YKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT-LKRAPKESAK  123
            Y  +L+ L  A+ DGANV GY AWSLLDNFEW  GYT RFG+ +VDY   +KR PK SA+
Sbjct  288  YHKHLLALLSAMRDGANVKGYFAWSLLDNFEWAEGYTVRFGINFVDYDDGMKRYPKNSAR  347

Query  122  WFQYMIRRN  96
            WF+  ++++
Sbjct  348  WFKKFLQKS  356



>ref|XP_008644530.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=523

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 166/249 (67%), Gaps = 13/249 (5%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI  D +WYEP+T S  D  A +RA++F LGWF  P  +G+YP TM+  VG+RLPKF
Sbjct  275  GELGIAFDVIWYEPMTNSTIDIEATKRAQEFQLGWFADPFFFGDYPATMRARVGERLPKF  334

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDW-----NVGFAYEKNGVPI  477
            T DE  +VKG++D++GIN YTT+Y    HN+   +    ND       +   ++KNG PI
Sbjct  335  TADEAALVKGALDFMGINHYTTFYTR--HNDTNIIGRLLNDTLADTGTISLPFDKNGKPI  392

Query  476  GPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAE---SYHDTKRI  306
            G RA+S WLY+VP G+ K ++YVKERY +PT+ ++ENGMD  GN  F     +  D+KRI
Sbjct  393  GDRANSIWLYIVPSGIRKLMNYVKERYNSPTVYITENGMD-DGNSPFTSLQNALKDSKRI  451

Query  305  NYYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKE  132
             Y+  YL  +  +I +DG +V GY AWSLLDN+EW  GYTSRFGL +VDYK  LKR PK 
Sbjct  452  KYHNGYLNNVAASIKEDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYFVDYKDNLKRHPKN  511

Query  131  SAKWFQYMI  105
            S +WF+ ++
Sbjct  512  SVQWFKTLL  520



>ref|XP_002987383.1| hypothetical protein SELMODRAFT_235275 [Selaginella moellendorffii]
 gb|EFJ11470.1| hypothetical protein SELMODRAFT_235275 [Selaginella moellendorffii]
Length=465

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 158/241 (66%), Gaps = 3/241 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI +D  W EP+T S  D  A+QR  +F LGWFL P  +G+YP TM+  VG RLPKF
Sbjct  218  GVVGITVDAEWAEPMTDSVDDKVASQRRLEFQLGWFLDPFFFGDYPATMREYVGDRLPKF  277

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP+E K V+GS+++VGIN Y++ ++  P     P   Y  D  +  +  +NG  IG +A 
Sbjct  278  TPEEQKSVRGSVEFVGINHYSSRFV-TPALYAKPSDNYHQDQRILTSAVRNGAVIGDKAA  336

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRINYYKSY  288
            S WLY+VPWG+++ + +V ERY  P + ++ENGMD   N  LT  E   D KRI++Y+ Y
Sbjct  337  SPWLYIVPWGLHRVLKWVSERYNRPPIYVTENGMDEENNSTLTLDEQLDDLKRIHFYQDY  396

Query  287  LIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYM  108
            L  + +A  +G ++ GY AWSL+DNFEW +GYT RFGL YVDY+TLKR PK SA WF+  
Sbjct  397  LTAVLQATREGMDIRGYFAWSLVDNFEWAMGYTKRFGLYYVDYETLKRYPKRSAHWFKRF  456

Query  107  I  105
            +
Sbjct  457  L  457



>ref|XP_002465651.1| hypothetical protein SORBIDRAFT_01g043030 [Sorghum bicolor]
 gb|EER92649.1| hypothetical protein SORBIDRAFT_01g043030 [Sorghum bicolor]
Length=508

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 165/249 (66%), Gaps = 13/249 (5%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI  D +WYEP+T S  D  A +RA++F LGWF  P  +G+YP TM+  VG+RLPKF
Sbjct  260  GELGIAFDVIWYEPMTNSTIDIEATKRAQEFQLGWFAEPFFFGDYPATMRTRVGERLPKF  319

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDW-----NVGFAYEKNGVPI  477
            T DE  +VKG++D++GIN YTT+Y    HN    +    ND       +   ++KNG PI
Sbjct  320  TADEATLVKGALDFMGINHYTTFYTR--HNETNIIGRLLNDTLADTGTISLPFDKNGKPI  377

Query  476  GPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFA---ESYHDTKRI  306
            G RA+S WLY+VP G+ K ++YVKERY +PT+ ++ENGMD  GN  F    ++  D KRI
Sbjct  378  GDRANSIWLYIVPSGIRKLMNYVKERYNSPTVYITENGMD-DGNSPFTSIQDALKDKKRI  436

Query  305  NYYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKE  132
             Y+  YL  +  +I +DG +V GY AWSLLDN+EW  GY+SRFGL +VDYK  LKR PK 
Sbjct  437  KYHNDYLSNVAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKN  496

Query  131  SAKWFQYMI  105
            S +WF+ ++
Sbjct  497  SVQWFKTLL  505



>ref|XP_002979904.1| hypothetical protein SELMODRAFT_268319 [Selaginella moellendorffii]
 gb|EFJ18774.1| hypothetical protein SELMODRAFT_268319 [Selaginella moellendorffii]
Length=497

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 159/241 (66%), Gaps = 3/241 (1%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI +D  W EP+T S  D  A+QR  +F LGWFL P  +G+YP TM+  VG RLPKF
Sbjct  250  GVVGITVDAEWAEPMTDSVDDKVASQRRLEFQLGWFLDPFFFGDYPATMREYVGDRLPKF  309

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP+E K V+GS+++VGIN Y++ ++  P     P   Y  D  +  +  +NG  IG +A 
Sbjct  310  TPEEQKSVRGSVEFVGINHYSSRFV-TPALYAKPSDNYHQDQRILTSAVRNGAVIGDKAA  368

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRINYYKSY  288
            S WLY+VPWG+++ + +V ERY  P + ++ENGMD   N  LT  E   D KRI++Y+ Y
Sbjct  369  SPWLYIVPWGLHRVLKWVSERYNRPPIYVTENGMDEENNSTLTLDEQLDDLKRIHFYQDY  428

Query  287  LIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWFQYM  108
            L  + +A  +G ++ GY AWSL+DNFEW +GYT RFGL YVDY+TLKR PK SA+WF+  
Sbjct  429  LTAVLQATREGMDIRGYFAWSLVDNFEWAMGYTKRFGLYYVDYETLKRYPKRSARWFKRF  488

Query  107  I  105
            +
Sbjct  489  L  489



>emb|CBI27264.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 162/243 (67%), Gaps = 7/243 (3%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  G+  D +W+EP T S  D  A QRA+DF LGWF+ P++YG+YPK++++ VG RLP F
Sbjct  317  GSLGVAFDVIWFEPKTNSTEDIEATQRAQDFQLGWFIDPLMYGDYPKSLKDGVGSRLPNF  376

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPV---PGYQNDWNVGFAYEKNGVPIGP  471
            T DE  ++KGS+D+VGIN YTT+Y     NN   +       +   +   + K+G PIG 
Sbjct  377  TRDESALLKGSLDFVGINHYTTFYAEYDANNLTGMLLNDSLADSRAITLPFSKDGQPIGD  436

Query  470  RAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRINYY  297
            RA+S WLY+VP GM   ++Y+K++YGNP +I++ENGMD A N  +   ++  D KRI Y+
Sbjct  437  RANSIWLYIVPRGMRSLMNYIKQKYGNPPIIITENGMDDANNPFIPIKDALKDEKRIKYH  496

Query  296  KSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKESAK  123
              YL  L  +I +DG NV GY  WSLLDN+EW  G+TSRFGL +VDYK  LKR PK S +
Sbjct  497  NDYLQSLLASIKEDGCNVKGYFVWSLLDNWEWGAGFTSRFGLFFVDYKDKLKRYPKNSVQ  556

Query  122  WFQ  114
            WF+
Sbjct  557  WFK  559



>gb|EMT02092.1| Beta-glucosidase 44 [Aegilops tauschii]
Length=370

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 151/209 (72%), Gaps = 2/209 (1%)
 Frame = -2

Query  716  FLHPIVYGEYPKTMQNIVGKRLPKFTPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPV  537
            ++HPI +G YP+TM+ +VG RLP FT ++ K+V+GS D +G+N YTTYY+   H+     
Sbjct  164  YMHPITFGHYPETMRKLVGSRLPNFTAEQSKLVQGSADIIGVNHYTTYYV--RHHENLTH  221

Query  536  PGYQNDWNVGFAYEKNGVPIGPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMD  357
              Y  DW     +E+NGVPIG +A S WLY+VPWG YKAV +VK ++ +P +++ ENG+D
Sbjct  222  MSYATDWQAELLFERNGVPIGRQAFSKWLYVVPWGFYKAVMHVKNKFRDPLILIGENGID  281

Query  356  YAGNLTFAESYHDTKRINYYKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFG  177
             +G+ T   + +DT RI+Y+  YL +LK+AI DGA V GY AWSLLDNFEWR+G+TS+FG
Sbjct  282  QSGSDTLPHALYDTFRIDYFDQYLHELKRAIADGARVTGYFAWSLLDNFEWRMGFTSKFG  341

Query  176  LVYVDYKTLKRAPKESAKWFQYMIRRNKH  90
            LVYVD KT  R PK+S +WF+ +I+  ++
Sbjct  342  LVYVDRKTFTRYPKDSTRWFRKVIKSEEY  370



>gb|KJB80348.1| hypothetical protein B456_013G093100 [Gossypium raimondii]
Length=498

 Score =   238 bits (606),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 159/242 (66%), Gaps = 6/242 (2%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LD  WYEP+T +  +  A QRA+DF LGWFL P+++G+YP +M++ VG RLP F
Sbjct  249  GSIGISLDVKWYEPVTNATENIEATQRAQDFQLGWFLDPLIFGDYPSSMRSRVGNRLPTF  308

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNK--PPVPGYQNDWNVGFAYEKNGVPIGPR  468
            T  E  ++KGS+D+VGIN YTTYY  E   N     +    +D N      ++G PIG +
Sbjct  309  TESESALLKGSLDFVGINHYTTYYASENATNSIFDLLNDCVSDANAFAIPFQDGKPIGDK  368

Query  467  AHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLT--FAESYHDTKRINYYK  294
            A+S WLY+VP+GM   + Y+KE+YGNP +I++ENGMD   NL     ++  D KRI Y+ 
Sbjct  369  ANSIWLYIVPYGMRSVMKYIKEKYGNPLVIITENGMDDPNNLLTPIKDALKDEKRIKYHT  428

Query  293  SYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKESAKW  120
             YL  L  AI +DG NV GY  WSLLDN+EW  G+TSRFGL +VDY   LKR PK S KW
Sbjct  429  DYLTNLLAAIEEDGCNVKGYFVWSLLDNWEWVAGFTSRFGLYFVDYNDNLKRYPKNSVKW  488

Query  119  FQ  114
            F+
Sbjct  489  FK  490



>gb|EEE62263.1| hypothetical protein OsJ_17050 [Oryza sativa Japonica Group]
Length=442

 Score =   236 bits (602),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 168/249 (67%), Gaps = 11/249 (4%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI L+  W+ PL++SK+ + AA+RA DF LGWF+ P++ G+YP +M+ +VG RLP+F
Sbjct  180  GKIGIILNADWFVPLSQSKSSSDAARRALDFMLGWFMDPLIRGDYPLSMRELVGNRLPEF  239

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVG----FAYEKNGVPIG  474
            + ++  MVKG+ D++G+N YT+ Y     +N PP  G+ N +N          +NG+PIG
Sbjct  240  SKEQSGMVKGAFDFIGLNYYTSSYA----DNDPPSHGHNNSYNTDAHAKITGSRNGIPIG  295

Query  473  PRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLT--FAESYHDTKRINY  300
            P+A S+W ++ P G+ + + YVKE YGNPT+ ++ENG+D   N T    E+  D  RI Y
Sbjct  296  PQAASFWFHIYPEGICEMLLYVKENYGNPTIYITENGVDEVNNKTMPLEEALKDDTRIEY  355

Query  299  YKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT-LKRAPKESAK  123
            Y  +L+ L  A+ DGANV GY AWSLLDNFEW  GYT RFG+ +VDY   +KR PK SA+
Sbjct  356  YHKHLLALLSAMRDGANVKGYFAWSLLDNFEWAEGYTVRFGINFVDYDDGMKRYPKNSAR  415

Query  122  WFQYMIRRN  96
            WF+  ++++
Sbjct  416  WFKKFLQKS  424



>ref|XP_010910030.1| PREDICTED: beta-glucosidase 25 isoform X2 [Elaeis guineensis]
Length=492

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 162/245 (66%), Gaps = 7/245 (3%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LD  WYEP++ +  D  AA RA DF LGWFL P+++G YP++MQNIVG RLP  
Sbjct  250  GAIGIALDSKWYEPISDADEDQDAAHRAMDFELGWFLDPLIFGHYPRSMQNIVGSRLPNI  309

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            T    K + G++D+VGIN YTT Y+    N++  +     D     A  ++G  IG RA 
Sbjct  310  TSKMSKSLAGTLDFVGINHYTTLYV---RNDRIRIWNLVLDDASTDAAFRHGEMIGERAA  366

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRINYYKSY  288
            S+WL++VPWG+ K + Y+KE+YGNP +I++ENGMD + N   T  ++  D KRI+Y+  Y
Sbjct  367  SHWLHIVPWGIRKLMRYIKEKYGNPLVIITENGMDDSNNPFATLDKALEDNKRIHYHNDY  426

Query  287  LIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKESAKWFQ  114
            L  L  A+ +DG NV GY  WSLLDN+EW  GYT RFGL +VDY+  LKR PK S KWF+
Sbjct  427  LSNLSAAVREDGCNVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYRDNLKRIPKASVKWFK  486

Query  113  YMIRR  99
            + ++R
Sbjct  487  HFLQR  491



>ref|XP_004505367.1| PREDICTED: beta-glucosidase 40-like [Cicer arietinum]
Length=499

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 162/247 (66%), Gaps = 4/247 (2%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI  + +WYEP T ++ D  AAQRA+DF LGWFL P+++G+YP +M++ VG RLPKF
Sbjct  253  GSLGIAFNVIWYEPATNTQKDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGNRLPKF  312

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGV-PIGPRA  465
            +P E  +VKGS+D+VGIN YTT+Y  +   N           +   A   NG  PIG +A
Sbjct  313  SPSEAALVKGSLDFVGINHYTTFYARDNSTNLLGALHSAIADSGTIALPFNGTKPIGEKA  372

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRINYYKS  291
            +S WLY+VP  M   ++Y+K++YGNP + ++ENGMD   +  +   ++  D KRI YY  
Sbjct  373  NSIWLYIVPQSMRTLMNYIKQKYGNPPVFITENGMDDPNSIYIPIKDALKDEKRIRYYNG  432

Query  290  YLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKESAKWFQ  114
            YL  L  +I DG NV GY AWSLLDN+EW  GYTSRFGL Y+DY+  LKR PK+S +WF+
Sbjct  433  YLSYLLASIKDGCNVKGYFAWSLLDNWEWSSGYTSRFGLFYIDYRDNLKRYPKQSVQWFK  492

Query  113  YMIRRNK  93
              ++  K
Sbjct  493  NFLKPTK  499



>ref|XP_011018314.1| PREDICTED: beta-glucosidase 40-like isoform X2 [Populus euphratica]
Length=442

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 163/246 (66%), Gaps = 10/246 (4%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LD +W+EP T S  D  AAQRA+DF LGWF+ P++ G+YP +M+N VG RLPKF
Sbjct  191  GSVGISLDVIWFEPATNSTKDIEAAQRAQDFQLGWFIEPLILGDYPISMRNRVGDRLPKF  250

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN------NKPPVPGYQNDWNVGFAYEKNGVP  480
            T ++  +VKGS+D+VGIN YTT+Y     +      +K       +   +   + +N  P
Sbjct  251  TKNDAALVKGSLDFVGINHYTTFYARSNDSLLGDVIDKVLNDSVADSGAITLPFGENKKP  310

Query  479  IGPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN-LT-FAESYHDTKRI  306
            IG RA+S WLY+VP GM   +++++++YGNP +I++ENGMD   N LT   ++  D KRI
Sbjct  311  IGDRANSIWLYIVPQGMRSLMNHIRQKYGNPPVIITENGMDDPNNALTPIKDALKDRKRI  370

Query  305  NYYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT-LKRAPKE  132
             Y+  YL  L  +I +DG NV GY  WSLLDN+EW  GYTSR GL +VDYK  LKR PK+
Sbjct  371  RYHNDYLTNLLASIKEDGCNVKGYFVWSLLDNWEWAAGYTSRLGLCFVDYKDKLKRYPKD  430

Query  131  SAKWFQ  114
            SA+WF+
Sbjct  431  SAQWFK  436



>ref|XP_002986009.1| hypothetical protein SELMODRAFT_271823 [Selaginella moellendorffii]
 gb|EFJ12828.1| hypothetical protein SELMODRAFT_271823 [Selaginella moellendorffii]
Length=505

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 159/248 (64%), Gaps = 10/248 (4%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI L+  WYEP T S AD  AAQR  DF LGWFL PIV G+YP++M+   G RLP F
Sbjct  258  GKIGITLNSNWYEPSTNSAADKEAAQRGLDFDLGWFLEPIVSGDYPRSMRTSAGTRLPVF  317

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYE----PHNNKPPVPGYQNDWNVGFAYEKNGVPIG  474
            TP++   +KGS+D++G+N YT+ Y       P N    V  Y  D  V  ++E NGV IG
Sbjct  318  TPEQAAAIKGSMDFLGLNHYTSNYAKAGQVVPRNQ---VTYYFQDSRVASSFENNGVAIG  374

Query  473  PRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRINY  300
            P+A S WLY+VPWG  K V+YV +RY NP +I++ENG+D   +   +  +S  DT R+ Y
Sbjct  375  PKAASDWLYIVPWGFQKLVTYVAQRYNNPVIIITENGVDEFNDPSRSLKQSLRDTTRVKY  434

Query  299  YKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDY-KTLKRAPKESAK  123
            Y  Y+  L +AI   A+V GY AWSLLDNFEW  GY+ RFGL +VD+   LKR PK SA 
Sbjct  435  YSDYISNLLQAIRSKADVRGYFAWSLLDNFEWNDGYSVRFGLHFVDFNNNLKRYPKHSAL  494

Query  122  WFQYMIRR  99
            WF+  + +
Sbjct  495  WFKRFLNQ  502



>ref|XP_004985214.1| PREDICTED: beta-glucosidase 6-like [Setaria italica]
Length=512

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/254 (47%), Positives = 166/254 (65%), Gaps = 15/254 (6%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI L+ VWYEP+T ++ D  AA+RA++F LGWF  P  +G+YP++M+  +G RLPKF
Sbjct  262  GQLGIALNVVWYEPMTNTRTDIEAAKRAQEFQLGWFADPFFFGDYPESMRARIGDRLPKF  321

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGV-------  483
            T DE  +VKGS+D+VGIN YTT+Y  + +       G   D   G   +   V       
Sbjct  322  TADEAALVKGSLDFVGINHYTTHYTMDSNTVSSTAMGLLLD---GTMADTGAVSVPFDIK  378

Query  482  -PIGPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTK  312
             P G RA+S WLY+VPWGM K ++YVKERY +P + ++ENGMD + N  +   E+  D+K
Sbjct  379  NPTGDRANSLWLYIVPWGMRKVMNYVKERYKSPPVYITENGMDDSNNPLIPKEEALKDSK  438

Query  311  RINYYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAP  138
            RI Y+  YL  L  +I +DG +V GY  WSLLDN+EW  GYTSRFGL +VDY+  L+R P
Sbjct  439  RIKYHHDYLTNLAASIKEDGCDVRGYFVWSLLDNWEWIAGYTSRFGLYFVDYENNLERCP  498

Query  137  KESAKWFQYMIRRN  96
            K S +WF+ ++R +
Sbjct  499  KSSVQWFKTLLRSS  512



>ref|XP_007153535.1| hypothetical protein PHAVU_003G043600g, partial [Phaseolus vulgaris]
 gb|ESW25529.1| hypothetical protein PHAVU_003G043600g, partial [Phaseolus vulgaris]
Length=453

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 165/245 (67%), Gaps = 9/245 (4%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LD +W EP T SK D  AAQRA DF LGWFL P+V+G+YP  M++ VG RLPKF
Sbjct  211  GSIGISLDVIWVEPATSSKEDIEAAQRALDFQLGWFLEPLVFGDYPVIMRSRVGNRLPKF  270

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVP-IGPRA  465
            +  +  ++KGS+D+VGIN YTT Y+Y   N    +  Y  D  V      NG   IG RA
Sbjct  271  SKSQANLLKGSLDFVGINHYTTLYVY---NVAVSLHDYIEDSGV-LTLPFNGTNVIGERA  326

Query  464  HSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAG--NLTFAESYHDTKRINYYKS  291
            +S WLY+VP GM   ++Y+K++YGNP +I++ENGMD     +++  ++  D KRI Y+  
Sbjct  327  NSLWLYIVPQGMRSTLNYIKQKYGNPLVIVTENGMDDPNEPSISIKDALKDEKRIKYHND  386

Query  290  YLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKESAKWF  117
            YLI L  +I +DG NV GY AWSLLDN+EW+ G+TSRFGL ++DYK  LKR PK+S +WF
Sbjct  387  YLINLLASIEEDGCNVKGYFAWSLLDNWEWQSGFTSRFGLYFIDYKDNLKRYPKQSVQWF  446

Query  116  QYMIR  102
            +  ++
Sbjct  447  KNFLK  451



>ref|XP_010910031.1| PREDICTED: beta-glucosidase 25 isoform X3 [Elaeis guineensis]
Length=411

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 162/250 (65%), Gaps = 12/250 (5%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LD  WYEP++ +  D  AA RA DF LGWFL P+++G YP++MQNIVG RLP  
Sbjct  164  GAIGIALDSKWYEPISDADEDQDAAHRAMDFELGWFLDPLIFGHYPRSMQNIVGSRLPNI  223

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPV-----PGYQNDWNVGFAYEKNGVPI  477
            T    K + G++D+VGIN YTT Y+    N++  +          D  V     ++G  I
Sbjct  224  TSKMSKSLAGTLDFVGINHYTTLYV---RNDRIRIWNLVLDDASTDAGVIATSFRHGEMI  280

Query  476  GPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRIN  303
            G RA S+WL++VPWG+ K + Y+KE+YGNP +I++ENGMD + N   T  ++  D KRI+
Sbjct  281  GERAASHWLHIVPWGIRKLMRYIKEKYGNPLVIITENGMDDSNNPFATLDKALEDNKRIH  340

Query  302  YYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKES  129
            Y+  YL  L  A+ +DG NV GY  WSLLDN+EW  GYT RFGL +VDY+  LKR PK S
Sbjct  341  YHNDYLSNLSAAVREDGCNVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYRDNLKRIPKAS  400

Query  128  AKWFQYMIRR  99
             KWF++ ++R
Sbjct  401  VKWFKHFLQR  410



>pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
 pdb|3GNP|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-Glucosidase 
With Octyl-Beta- D-Thio-Glucoside
 pdb|3GNR|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase 
With Covalently Bound 2-deoxy-2-fluoroglucoside To The Catalytic 
Nucleophile E396
Length=488

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/249 (49%), Positives = 168/249 (67%), Gaps = 12/249 (5%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI  D +W+EP++ +  D  AA+RA++F LGWF  P  +G+YP TM+  VG+RLP+F
Sbjct  242  GQLGIAFDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRF  301

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDW-----NVGFAYEKNGVPI  477
            T DE  +VKG++D+VGIN YTTYY    HNN   +    N+       V   + KNG PI
Sbjct  302  TADEAAVVKGALDFVGINHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPI  358

Query  476  GPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRIN  303
            G RA+S WLY+VP GM   ++YVKERY +P + ++ENGMD + N  ++  ++  D+KRI 
Sbjct  359  GDRANSIWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIK  418

Query  302  YYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKES  129
            Y+  YL  L  +I +DG +V GY AWSLLDN+EW  GY+SRFGL +VDYK  LKR PK S
Sbjct  419  YHNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNS  478

Query  128  AKWFQYMIR  102
             +WF+ +++
Sbjct  479  VQWFKALLK  487



>sp|Q7XKV5.2|BGL11_ORYSJ RecName: Full=Beta-glucosidase 11; Short=Os4bglu11; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE05482.2| OSJNBa0022H21.2 [Oryza sativa Japonica Group]
Length=529

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 168/249 (67%), Gaps = 11/249 (4%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI L+  W+ PL++SK+ + AA+RA DF LGWF+ P++ G+YP +M+ +VG RLP+F
Sbjct  267  GKIGIILNADWFVPLSQSKSSSDAARRALDFMLGWFMDPLIRGDYPLSMRELVGNRLPEF  326

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVG----FAYEKNGVPIG  474
            + ++  MVKG+ D++G+N YT+ Y     +N PP  G+ N +N          +NG+PIG
Sbjct  327  SKEQSGMVKGAFDFIGLNYYTSSYA----DNDPPSHGHNNSYNTDAHAKITGSRNGIPIG  382

Query  473  PRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLT--FAESYHDTKRINY  300
            P+A S+W ++ P G+ + + YVKE YGNPT+ ++ENG+D   N T    E+  D  RI Y
Sbjct  383  PQAASFWFHIYPEGICEMLLYVKENYGNPTIYITENGVDEVNNKTMPLEEALKDDTRIEY  442

Query  299  YKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT-LKRAPKESAK  123
            Y  +L+ L  A+ DGANV GY AWSLLDNFEW  GYT RFG+ +VDY   +KR PK SA+
Sbjct  443  YHKHLLALLSAMRDGANVKGYFAWSLLDNFEWAEGYTVRFGINFVDYDDGMKRYPKNSAR  502

Query  122  WFQYMIRRN  96
            WF+  ++++
Sbjct  503  WFKKFLQKS  511



>emb|CAH66811.1| OSIGBa0135C13.6 [Oryza sativa Indica Group]
Length=529

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 168/249 (67%), Gaps = 11/249 (4%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI L+  W+ PL++SK+ + AA+RA DF LGWF+ P++ G+YP +M+ +VG RLP+F
Sbjct  267  GKIGIILNADWFVPLSQSKSSSDAARRALDFMLGWFMDPLIRGDYPLSMRELVGNRLPEF  326

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVG----FAYEKNGVPIG  474
            + ++  MVKG+ D++G+N YT+ Y     +N PP  G+ N +N          +NG+PIG
Sbjct  327  SKEQSGMVKGAFDFIGLNYYTSSYA----DNDPPSHGHNNSYNTDSHAKITGSRNGIPIG  382

Query  473  PRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLT--FAESYHDTKRINY  300
            P+A S+W ++ P G+ + + YVKE YGNPT+ ++ENG+D   N T    E+  D  RI Y
Sbjct  383  PQAASFWFHIYPEGICEMLLYVKENYGNPTIYITENGVDEVNNKTMPLEEALKDDTRIEY  442

Query  299  YKSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKT-LKRAPKESAK  123
            Y  +L+ L  A+ DGANV GY AWSLLDNFEW  GYT RFG+ +VDY   +KR PK SA+
Sbjct  443  YHKHLLALLSAMRDGANVKGYFAWSLLDNFEWAEGYTVRFGINFVDYDDGMKRYPKNSAR  502

Query  122  WFQYMIRRN  96
            WF+  ++++
Sbjct  503  WFKKFLQKS  511



>pdb|3WBE|A Chain A, Rice Os3bglu6 Beta-glucosidase E178q Mutant In A Covalent 
Complex With Glc From Ga4ge.
Length=489

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/249 (49%), Positives = 168/249 (67%), Gaps = 12/249 (5%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI  D +W+EP++ +  D  AA+RA++F LGWF  P  +G+YP TM+  VG+RLP+F
Sbjct  243  GQLGIAFDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRF  302

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDW-----NVGFAYEKNGVPI  477
            T DE  +VKG++D+VGIN YTTYY    HNN   +    N+       V   + KNG PI
Sbjct  303  TADEAAVVKGALDFVGINHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPI  359

Query  476  GPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRIN  303
            G RA+S WLY+VP GM   ++YVKERY +P + ++ENGMD + N  ++  ++  D+KRI 
Sbjct  360  GDRANSIWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIK  419

Query  302  YYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKES  129
            Y+  YL  L  +I +DG +V GY AWSLLDN+EW  GY+SRFGL +VDYK  LKR PK S
Sbjct  420  YHNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNS  479

Query  128  AKWFQYMIR  102
             +WF+ +++
Sbjct  480  VQWFKALLK  488



>pdb|3WBA|A Chain A, Rice Os3bglu6 E178q With Covalent Glucosyl Moiety From 
P-nitrophenyl Glucopyranoside.
Length=489

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/249 (49%), Positives = 168/249 (67%), Gaps = 12/249 (5%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI  D +W+EP++ +  D  AA+RA++F LGWF  P  +G+YP TM+  VG+RLP+F
Sbjct  243  GQLGIAFDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRF  302

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDW-----NVGFAYEKNGVPI  477
            T DE  +VKG++D+VGIN YTTYY    HNN   +    N+       V   + KNG PI
Sbjct  303  TADEAAVVKGALDFVGINHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPI  359

Query  476  GPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRIN  303
            G RA+S WLY+VP GM   ++YVKERY +P + ++ENGMD + N  ++  ++  D+KRI 
Sbjct  360  GDRANSIWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIK  419

Query  302  YYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKES  129
            Y+  YL  L  +I +DG +V GY AWSLLDN+EW  GY+SRFGL +VDYK  LKR PK S
Sbjct  420  YHNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNS  479

Query  128  AKWFQYMIR  102
             +WF+ +++
Sbjct  480  VQWFKALLK  488



>ref|NP_001049358.1| Os03g0212800 [Oryza sativa Japonica Group]
 sp|Q8L7J2.1|BGL06_ORYSJ RecName: Full=Beta-glucosidase 6; Short=Os3bglu6; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAN01354.1| beta-glucosidase [Oryza sativa Japonica Group]
 gb|ABF94615.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11272.1| Os03g0212800 [Oryza sativa Japonica Group]
 dbj|BAG99682.1| unnamed protein product [Oryza sativa Japonica Group]
Length=521

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/249 (49%), Positives = 168/249 (67%), Gaps = 12/249 (5%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI  D +W+EP++ +  D  AA+RA++F LGWF  P  +G+YP TM+  VG+RLP+F
Sbjct  275  GQLGIAFDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRF  334

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDW-----NVGFAYEKNGVPI  477
            T DE  +VKG++D+VGIN YTTYY    HNN   +    N+       V   + KNG PI
Sbjct  335  TADEAAVVKGALDFVGINHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPI  391

Query  476  GPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRIN  303
            G RA+S WLY+VP GM   ++YVKERY +P + ++ENGMD + N  ++  ++  D+KRI 
Sbjct  392  GDRANSIWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIK  451

Query  302  YYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKES  129
            Y+  YL  L  +I +DG +V GY AWSLLDN+EW  GY+SRFGL +VDYK  LKR PK S
Sbjct  452  YHNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNS  511

Query  128  AKWFQYMIR  102
             +WF+ +++
Sbjct  512  VQWFKALLK  520



>ref|XP_003607795.1| Beta-glucosidase [Medicago truncatula]
Length=406

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 163/248 (66%), Gaps = 5/248 (2%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI  D +WYEP T +K D  AAQRA+DF LGWFL P+++G+YP +M++ VG RLPKF
Sbjct  159  GSLGIAFDVIWYEPATNTKEDIAAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGNRLPKF  218

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVG-FAYEKNGV-PIGPR  468
            +  E  +VKGS+D+VGIN YTT+Y      N   +  + +  + G      NG   I  R
Sbjct  219  SSSEAALVKGSLDFVGINHYTTFYARNNSTNLIGILLHDSIADSGAITLPFNGTKAIAER  278

Query  467  AHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFA--ESYHDTKRINYYK  294
            A+S WLY+VP  M   ++Y+K++YGNP + ++ENGMD   N+  +  ++  D KRI Y+ 
Sbjct  279  ANSIWLYIVPQSMRTLMNYIKQKYGNPPVFITENGMDDPNNIFISKKDALKDEKRIRYFS  338

Query  293  SYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKESAKWF  117
             YL  L+ +I DG NV GY AWSLLDN+EW  GY+SRFGL +VDY+  LKR PK+S +WF
Sbjct  339  GYLSYLQASIKDGCNVKGYFAWSLLDNWEWAAGYSSRFGLYFVDYRDNLKRYPKQSVQWF  398

Query  116  QYMIRRNK  93
            +  ++  K
Sbjct  399  KNFLKPAK  406



>emb|CDP05824.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 158/244 (65%), Gaps = 4/244 (2%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LD  WYEP++    D  A+ RA DF LGWFL P++ G YP +MQ  V +RLP+ 
Sbjct  250  GQVGIVLDAKWYEPISDCDEDRDASNRAIDFSLGWFLDPLLLGNYPLSMQKSVAERLPEI  309

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMY--EPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPR  468
             P+  K +KG++D++GIN YTT Y      H  K  +    +D  V  +  ++G  IG R
Sbjct  310  NPEVSKFLKGTLDFIGINHYTTLYARNDRTHFRKLILRDASSDSAVITSAYRHGAAIGER  369

Query  467  AHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSY  288
            A S WL +VPWG+ K   Y+KERYGNP +I++ENGMD A +L+   + +D KRIN+++ Y
Sbjct  370  AASVWLRIVPWGIRKLARYIKERYGNPPVIITENGMDDASHLSLKNALNDQKRINFHRDY  429

Query  287  LIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKESAKWFQ  114
            L  L  AI  D  +V GY AWSLLDN+EW +GYT RFGL YVD+K  L R PK S +WF+
Sbjct  430  LSNLSAAIRQDNCDVRGYFAWSLLDNWEWNMGYTVRFGLYYVDFKNNLTRIPKSSVQWFK  489

Query  113  YMIR  102
             M+R
Sbjct  490  DMLR  493



>gb|AES89992.2| beta-glucosidase [Medicago truncatula]
Length=411

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 163/248 (66%), Gaps = 5/248 (2%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI  D +WYEP T +K D  AAQRA+DF LGWFL P+++G+YP +M++ VG RLPKF
Sbjct  164  GSLGIAFDVIWYEPATNTKEDIAAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGNRLPKF  223

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVG-FAYEKNGV-PIGPR  468
            +  E  +VKGS+D+VGIN YTT+Y      N   +  + +  + G      NG   I  R
Sbjct  224  SSSEAALVKGSLDFVGINHYTTFYARNNSTNLIGILLHDSIADSGAITLPFNGTKAIAER  283

Query  467  AHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFA--ESYHDTKRINYYK  294
            A+S WLY+VP  M   ++Y+K++YGNP + ++ENGMD   N+  +  ++  D KRI Y+ 
Sbjct  284  ANSIWLYIVPQSMRTLMNYIKQKYGNPPVFITENGMDDPNNIFISKKDALKDEKRIRYFS  343

Query  293  SYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKESAKWF  117
             YL  L+ +I DG NV GY AWSLLDN+EW  GY+SRFGL +VDY+  LKR PK+S +WF
Sbjct  344  GYLSYLQASIKDGCNVKGYFAWSLLDNWEWAAGYSSRFGLYFVDYRDNLKRYPKQSVQWF  403

Query  116  QYMIRRNK  93
            +  ++  K
Sbjct  404  KNFLKPAK  411



>ref|XP_008243590.1| PREDICTED: beta-glucosidase 12-like [Prunus mume]
Length=535

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 159/248 (64%), Gaps = 5/248 (2%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI L  +W+EPL+ +K D  AA RA DF LGWF+ P+  GEYPK MQ++ G RLPKF
Sbjct  272  GLIGITLVSLWFEPLSDTKQDKDAASRAVDFMLGWFMDPLAKGEYPKIMQSLAGNRLPKF  331

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYE--PHNNKPPVPGYQNDWNVGFAYEKNGVPIGPR  468
            T  + K VKGS D++G+N YTTYY  +  P  N    P Y  D    F  E+NG  IGP+
Sbjct  332  TKMQSKSVKGSFDFIGLNYYTTYYAADAPPLPNATTYPSYLTDARTQFLTERNGTSIGPK  391

Query  467  AHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRINYYK  294
            A S WLY+ P G+ + + +VKE Y NP + ++ENG+    N  L+  E+  D  RI+YY 
Sbjct  392  AGSSWLYVYPKGLQELLLHVKENYHNPLIYITENGVSEFANPKLSREEALVDYHRIDYYD  451

Query  293  SYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKESAKWF  117
            S+L  L  AI DG NV GY AWSLLDNFEW  GYT RFG+ YVDYK  LKR PK SA WF
Sbjct  452  SHLYYLHAAIKDGVNVKGYFAWSLLDNFEWNDGYTVRFGIYYVDYKDELKRYPKLSANWF  511

Query  116  QYMIRRNK  93
            +  +++ K
Sbjct  512  KNFLQKKK  519



>ref|XP_011018305.1| PREDICTED: beta-glucosidase 40-like isoform X1 [Populus euphratica]
Length=507

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 163/246 (66%), Gaps = 10/246 (4%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LD +W+EP T S  D  AAQRA+DF LGWF+ P++ G+YP +M+N VG RLPKF
Sbjct  256  GSVGISLDVIWFEPATNSTKDIEAAQRAQDFQLGWFIEPLILGDYPISMRNRVGDRLPKF  315

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHN------NKPPVPGYQNDWNVGFAYEKNGVP  480
            T ++  +VKGS+D+VGIN YTT+Y     +      +K       +   +   + +N  P
Sbjct  316  TKNDAALVKGSLDFVGINHYTTFYARSNDSLLGDVIDKVLNDSVADSGAITLPFGENKKP  375

Query  479  IGPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN-LT-FAESYHDTKRI  306
            IG RA+S WLY+VP GM   +++++++YGNP +I++ENGMD   N LT   ++  D KRI
Sbjct  376  IGDRANSIWLYIVPQGMRSLMNHIRQKYGNPPVIITENGMDDPNNALTPIKDALKDRKRI  435

Query  305  NYYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKE  132
             Y+  YL  L  +I +DG NV GY  WSLLDN+EW  GYTSR GL +VDYK  LKR PK+
Sbjct  436  RYHNDYLTNLLASIKEDGCNVKGYFVWSLLDNWEWAAGYTSRLGLCFVDYKDKLKRYPKD  495

Query  131  SAKWFQ  114
            SA+WF+
Sbjct  496  SAQWFK  501



>gb|EEC74750.1| hypothetical protein OsI_10506 [Oryza sativa Indica Group]
Length=521

 Score =   236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 168/249 (67%), Gaps = 12/249 (5%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI  D +W+EP++ +  D  AA+RA++F LGWF  P  +G+YP TM+  VG+RLP+F
Sbjct  275  GQLGIAFDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRF  334

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDW-----NVGFAYEKNGVPI  477
            T DE  +VKG++D+VG+N YTTYY    HNN   +    N+       V   + KNG PI
Sbjct  335  TADEAAVVKGALDFVGVNHYTTYYT--RHNNTNIIGTLLNNTLADTGTVSLPF-KNGKPI  391

Query  476  GPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRIN  303
            G RA+S WLY+VP GM   ++YVKERY +P + ++ENGMD + N  ++  ++  D+KRI 
Sbjct  392  GDRANSIWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIK  451

Query  302  YYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKES  129
            Y+  YL  L  +I +DG +V GY AWSLLDN+EW  GY+SRFGL +VDYK  LKR PK S
Sbjct  452  YHNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNS  511

Query  128  AKWFQYMIR  102
             +WF+ +++
Sbjct  512  VQWFKALLK  520



>ref|XP_010551390.1| PREDICTED: beta-glucosidase 40 [Tarenaya hassleriana]
 ref|XP_010551391.1| PREDICTED: beta-glucosidase 40 [Tarenaya hassleriana]
Length=515

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 161/248 (65%), Gaps = 12/248 (5%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LD VWYEP T +  D  AAQRA+DF LGWFL P+++G+YP +M+  VGKRLPKF
Sbjct  265  GSLGIALDVVWYEPETNTTEDIEAAQRAQDFQLGWFLDPLMFGDYPNSMRTRVGKRLPKF  324

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNG-----VPI  477
            T  +  ++KGS+D+VGIN YTT Y     NNK  + G   +  +  +    G      PI
Sbjct  325  TQSQTDLLKGSLDFVGINHYTTNY---ARNNKTNLIGTLLNDAIADSGTSTGPLKGLQPI  381

Query  476  GPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAE--SYHDTKRIN  303
            G RA+S WLY+VP GM   ++Y+K+RYGNP +I++ENGMD   ++  +   +  D KRI 
Sbjct  382  GDRANSIWLYIVPRGMRSLMNYIKQRYGNPLVIITENGMDDPNSILISRENALKDEKRIK  441

Query  302  YYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKES  129
            Y+  YL  L+ AI +DG NV GY AWSLLDN+EW  GYTSRFGL +VDY   LKR PK S
Sbjct  442  YHHDYLSSLQAAIKEDGCNVRGYFAWSLLDNWEWAAGYTSRFGLYFVDYNDNLKRYPKHS  501

Query  128  AKWFQYMI  105
              WF   +
Sbjct  502  VHWFTTFL  509



>gb|ACG44181.1| non-cyanogenic beta-glucosidase precursor [Zea mays]
Length=466

 Score =   235 bits (599),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 140/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G+ GI LDF WYE LT S  D  AAQRARDFH+GWF  P++ G YP+ MQ+IV +RLPKF
Sbjct  262  GKVGIVLDFNWYEALTNSTEDQAAAQRARDFHVGWFADPLINGHYPQIMQDIVKERLPKF  321

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPVPGYQNDWNVGFAYEKNGVPIGPRAH  462
            TP++ K+VKGS DY+GINQYT  Y+      +     Y  DW V +  E+NG PIGP+A+
Sbjct  322  TPEQAKLVKGSADYIGINQYTASYVKGQKLLQQKPTSYSADWQVQYVLERNGKPIGPQAN  381

Query  461  SYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGNLTFAESYHDTKRINYYKSYLI  282
            S WLY+VP GMY  V+Y+K +YGNPT+ ++ENGMD  GNLT  +  HDT R+ +YK YL 
Sbjct  382  SKWLYIVPEGMYGCVNYLKHKYGNPTVFITENGMDQPGNLTRGQYLHDTTRVQFYKGYLA  441

Query  281  QLKKAIDDGANVIGY  237
            +L+KAIDDGA+V  +
Sbjct  442  ELRKAIDDGADVAQF  456



>ref|XP_008789190.1| PREDICTED: putative beta-glucosidase 41 isoform X2 [Phoenix dactylifera]
Length=411

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/251 (48%), Positives = 164/251 (65%), Gaps = 12/251 (5%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LD  WYEP++ +  D+ AA RA DF LGWFL P+++G YP++MQNIVG RLPK 
Sbjct  164  GSIGIALDSKWYEPISDADEDHDAAHRAMDFELGWFLDPLIFGHYPRSMQNIVGSRLPKI  223

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPV-----PGYQNDWNVGFAYEKNGVPI  477
            T +  K + G++D+VGIN YTT Y+    N++  +          D  V     ++G  I
Sbjct  224  TSEMSKSLAGTLDFVGINHYTTLYV---RNDRIRIWNLVMDDASTDAGVITTSFRHGEMI  280

Query  476  GPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRIN  303
            G +A S+WL++VPWG  K + YVKE+YGNP +I++ENGMD   N   T  ++  D KRI+
Sbjct  281  GEKAASHWLHIVPWGFRKLMRYVKEKYGNPLVIITENGMDDLNNPFATLDKALEDNKRIH  340

Query  302  YYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKES  129
            Y++ YL  L   I +DG +V GY  WSLLDN+EW  GYT RFGL +VDY+  L R PK S
Sbjct  341  YHRDYLSNLSAVIREDGCDVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYRNNLTRIPKAS  400

Query  128  AKWFQYMIRRN  96
            AKWF++ ++R+
Sbjct  401  AKWFRHFLQRH  411



>ref|XP_010910029.1| PREDICTED: beta-glucosidase 25 isoform X1 [Elaeis guineensis]
Length=497

 Score =   235 bits (600),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 162/250 (65%), Gaps = 12/250 (5%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  GI LD  WYEP++ +  D  AA RA DF LGWFL P+++G YP++MQNIVG RLP  
Sbjct  250  GAIGIALDSKWYEPISDADEDQDAAHRAMDFELGWFLDPLIFGHYPRSMQNIVGSRLPNI  309

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYEPHNNKPPV-----PGYQNDWNVGFAYEKNGVPI  477
            T    K + G++D+VGIN YTT Y+    N++  +          D  V     ++G  I
Sbjct  310  TSKMSKSLAGTLDFVGINHYTTLYV---RNDRIRIWNLVLDDASTDAGVIATSFRHGEMI  366

Query  476  GPRAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGMDYAGN--LTFAESYHDTKRIN  303
            G RA S+WL++VPWG+ K + Y+KE+YGNP +I++ENGMD + N   T  ++  D KRI+
Sbjct  367  GERAASHWLHIVPWGIRKLMRYIKEKYGNPLVIITENGMDDSNNPFATLDKALEDNKRIH  426

Query  302  YYKSYLIQLKKAI-DDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYK-TLKRAPKES  129
            Y+  YL  L  A+ +DG NV GY  WSLLDN+EW  GYT RFGL +VDY+  LKR PK S
Sbjct  427  YHNDYLSNLSAAVREDGCNVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYRDNLKRIPKAS  486

Query  128  AKWFQYMIRR  99
             KWF++ ++R
Sbjct  487  VKWFKHFLQR  496



>ref|XP_002966845.1| hypothetical protein SELMODRAFT_144295 [Selaginella moellendorffii]
 gb|EFJ31444.1| hypothetical protein SELMODRAFT_144295 [Selaginella moellendorffii]
Length=500

 Score =   235 bits (600),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 169/248 (68%), Gaps = 9/248 (4%)
 Frame = -2

Query  821  GRFGIFLDFVWYEPLTRSKADNYAAQRARDFHLGWFLHPIVYGEYPKTMQNIVGKRLPKF  642
            G  G+ LD  WYEP +    D  AA+RA DF LGWFLHPI +G+YP++M+  VG RLP F
Sbjct  250  GVIGMTLDSFWYEPYSSLPRDIAAARRALDFELGWFLHPITFGDYPQSMRLYVGDRLPAF  309

Query  641  TPDEVKMVKGSIDYVGINQYTTYYMYE---PHNNKPPVPGYQNDWNVGFAYEKNGVPIGP  471
            T +E + ++ S+D+VG+N YT+ Y  +   P N +   PGY++D +  F  E+NG+ IG 
Sbjct  310  TVEESRDLRNSMDFVGLNHYTSRYTQDNPWPSNVR---PGYESDSHTHFLTERNGISIGG  366

Query  470  RAHSYWLYMVPWGMYKAVSYVKERYGNPTMILSENGM-DYAGNLTFAESY-HDTKRINYY  297
               + WLY+VPWG+Y  +++VKE Y NP +I++ENG+ D A + TF++ +  D  R+ +Y
Sbjct  367  TTGT-WLYVVPWGLYNILNHVKENYNNPPIIITENGLVDVADSNTFSDRFIKDDARVQFY  425

Query  296  KSYLIQLKKAIDDGANVIGYHAWSLLDNFEWRLGYTSRFGLVYVDYKTLKRAPKESAKWF  117
            +SYL  L++AI +G +V GY+AWSLLDN+EW  G++ RFGL YVDY TLKR PK SA WF
Sbjct  426  ESYLTSLQQAIANGVDVRGYYAWSLLDNWEWDSGFSQRFGLYYVDYTTLKRYPKHSALWF  485

Query  116  QYMIRRNK  93
            +  +   K
Sbjct  486  KQFLSNTK  493



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1686516490435