BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF041I08

Length=629
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO51889.1|  hypothetical protein CISIN_1g003205mg                   169   4e-46   Citrus sinensis [apfelsine]
ref|XP_007214933.1|  hypothetical protein PRUPE_ppa001364mg             171   1e-45   Prunus persica
ref|XP_006387719.1|  hypothetical protein POPTR_0647s00230g             161   2e-45   
ref|XP_007048987.1|  Vacuoleless1 (VCL1) isoform 3                      171   2e-45   
ref|XP_008229565.1|  PREDICTED: protein VACUOLELESS1                    171   2e-45   Prunus mume [ume]
ref|XP_007048986.1|  Vacuoleless1 (VCL1) isoform 2                      171   3e-45   
gb|KDO51888.1|  hypothetical protein CISIN_1g003205mg                   169   3e-45   Citrus sinensis [apfelsine]
emb|CDP06151.1|  unnamed protein product                                170   3e-45   Coffea canephora [robusta coffee]
ref|XP_007048985.1|  Vacuoleless1 (VCL1) isoform 1                      171   3e-45   
ref|XP_006437140.1|  hypothetical protein CICLE_v10030701mg             169   1e-44   Citrus clementina [clementine]
gb|AFK37940.1|  unknown                                                 163   1e-44   Lotus japonicus
gb|KDO51887.1|  hypothetical protein CISIN_1g003205mg                   169   1e-44   Citrus sinensis [apfelsine]
ref|XP_011082899.1|  PREDICTED: protein VACUOLELESS1                    168   2e-44   Sesamum indicum [beniseed]
ref|XP_011026233.1|  PREDICTED: protein VACUOLELESS1-like isoform X2    165   4e-44   Populus euphratica
ref|XP_002526647.1|  vacuolar protein sorting vps16, putative           167   7e-44   Ricinus communis
gb|EYU33990.1|  hypothetical protein MIMGU_mgv1a001320mg                166   1e-43   Erythranthe guttata [common monkey flower]
gb|KHN35900.1|  Vacuolar protein sorting-associated protein 16 like     163   2e-43   Glycine soja [wild soybean]
gb|KHG27227.1|  Vacuolar sorting-associated protein 16                  164   3e-43   Gossypium arboreum [tree cotton]
gb|KDP24238.1|  hypothetical protein JCGZ_26643                         165   3e-43   Jatropha curcas
gb|KJB10618.1|  hypothetical protein B456_001G211500                    165   3e-43   Gossypium raimondii
ref|XP_011026232.1|  PREDICTED: protein VACUOLELESS1-like isoform X1    164   4e-43   Populus euphratica
ref|XP_002302135.2|  MANGLED family protein                             163   1e-42   
ref|XP_010053830.1|  PREDICTED: protein VACUOLELESS1                    163   1e-42   Eucalyptus grandis [rose gum]
gb|KEH16900.1|  vacuolar protein sorting-associated-like protein        162   2e-42   Medicago truncatula
ref|XP_006348963.1|  PREDICTED: vacuolar protein sorting-associat...    162   2e-42   
ref|XP_003599782.1|  Vacuolar protein sorting-associated protein-...    162   2e-42   
gb|AES70033.2|  vacuolar protein sorting-associated-like protein        162   2e-42   Medicago truncatula
ref|XP_003532091.1|  PREDICTED: vacuolar protein sorting-associat...    162   2e-42   Glycine max [soybeans]
ref|XP_003551927.1|  PREDICTED: vacuolar protein sorting-associat...    162   2e-42   
gb|KJB10616.1|  hypothetical protein B456_001G211500                    162   3e-42   Gossypium raimondii
ref|XP_004243213.1|  PREDICTED: protein VACUOLELESS1                    162   3e-42   Solanum lycopersicum
ref|XP_004499978.1|  PREDICTED: vacuolar protein sorting-associat...    161   5e-42   Cicer arietinum [garbanzo]
ref|XP_009625096.1|  PREDICTED: protein VACUOLELESS1                    161   6e-42   Nicotiana tomentosiformis
ref|XP_009790374.1|  PREDICTED: protein VACUOLELESS1                    160   1e-41   Nicotiana sylvestris
ref|XP_002306748.1|  MANGLED family protein                             160   1e-41   
ref|XP_011044765.1|  PREDICTED: protein VACUOLELESS1-like               160   1e-41   Populus euphratica
ref|XP_008465445.1|  PREDICTED: protein VACUOLELESS1                    160   2e-41   Cucumis melo [Oriental melon]
ref|XP_004144632.1|  PREDICTED: vacuolar protein sorting-associat...    160   2e-41   Cucumis sativus [cucumbers]
ref|XP_002283428.1|  PREDICTED: protein VACUOLELESS1                    159   3e-41   Vitis vinifera
ref|XP_009377216.1|  PREDICTED: LOW QUALITY PROTEIN: protein VACU...    159   5e-41   Pyrus x bretschneideri [bai li]
ref|XP_010271337.1|  PREDICTED: protein VACUOLELESS1 isoform X1         159   5e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008342344.1|  PREDICTED: protein VACUOLELESS1                    158   6e-41   Malus domestica [apple tree]
ref|XP_008811095.1|  PREDICTED: protein VACUOLELESS1                    157   2e-40   Phoenix dactylifera
ref|XP_007146219.1|  hypothetical protein PHAVU_006G022400g             156   4e-40   Phaseolus vulgaris [French bean]
ref|XP_010087860.1|  Vacuolar protein sorting-associated protein ...    155   6e-40   Morus notabilis
ref|XP_010918871.1|  PREDICTED: protein VACUOLELESS1                    154   2e-39   Elaeis guineensis
ref|XP_010557595.1|  PREDICTED: protein VACUOLELESS1                    154   3e-39   Tarenaya hassleriana [spider flower]
ref|XP_009416537.1|  PREDICTED: protein VACUOLELESS1                    153   6e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006854657.1|  hypothetical protein AMTR_s00030p00200210          152   1e-38   Amborella trichopoda
ref|XP_004303883.1|  PREDICTED: protein VACUOLELESS1 isoform X2         150   7e-38   Fragaria vesca subsp. vesca
ref|XP_011467591.1|  PREDICTED: protein VACUOLELESS1 isoform X1         150   7e-38   Fragaria vesca subsp. vesca
gb|AFW83495.1|  hypothetical protein ZEAMMB73_843554                    137   2e-36   
ref|XP_010681470.1|  PREDICTED: protein VACUOLELESS1                    143   2e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004969467.1|  PREDICTED: vacuolar protein sorting-associat...    140   3e-34   Setaria italica
ref|XP_006646183.1|  PREDICTED: vacuolar protein sorting-associat...    139   4e-34   Oryza brachyantha
dbj|BAB90498.1|  vacuolar protein sorting-associated protein VPS1...    139   5e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456108.1|  hypothetical protein SORBIDRAFT_03g030590          139   6e-34   
gb|EEE55144.1|  hypothetical protein OsJ_02938                          139   8e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008656726.1|  PREDICTED: protein VACUOLELESS1                    136   5e-33   Zea mays [maize]
ref|XP_002963395.1|  hypothetical protein SELMODRAFT_80688              132   1e-31   
ref|XP_002974680.1|  hypothetical protein SELMODRAFT_101752             132   1e-31   
ref|XP_001777594.1|  predicted protein                                  129   1e-30   
ref|XP_010232114.1|  PREDICTED: protein VACUOLELESS1                    129   2e-30   Brachypodium distachyon [annual false brome]
dbj|BAJ97322.1|  predicted protein                                      120   2e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010505412.1|  PREDICTED: protein VACUOLELESS1-like               118   1e-26   Camelina sativa [gold-of-pleasure]
emb|CDY07756.1|  BnaA03g17550D                                          117   2e-26   Brassica napus [oilseed rape]
emb|CDY14496.1|  BnaC03g20990D                                          117   2e-26   Brassica napus [oilseed rape]
ref|XP_009133226.1|  PREDICTED: protein VACUOLELESS1                    117   2e-26   Brassica rapa
dbj|BAJ33734.1|  unnamed protein product                                117   3e-26   Eutrema halophilum
ref|XP_006411003.1|  hypothetical protein EUTSA_v10016232mg             117   3e-26   Eutrema salsugineum [saltwater cress]
ref|XP_002883710.1|  predicted protein                                  115   4e-26   
ref|XP_010517084.1|  PREDICTED: protein VACUOLELESS1-like               116   5e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010509236.1|  PREDICTED: protein VACUOLELESS1                    116   5e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006296131.1|  hypothetical protein CARUB_v10025283mg             116   5e-26   Capsella rubella
ref|XP_002881559.1|  hypothetical protein ARALYDRAFT_321506             114   2e-25   Arabidopsis lyrata subsp. lyrata
ref|NP_565879.1|  vacuoleless1                                          114   4e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KJB10617.1|  hypothetical protein B456_001G211500                  97.8    1e-19   Gossypium raimondii
gb|EMS54442.1|  Vacuolar protein sorting-associated protein 16-li...  89.0    3e-17   Triticum urartu
dbj|BAD95263.1|  hypothetical protein                                 84.7    4e-16   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19612.1|  AT2G38020                                            84.7    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078020.1|  vacuoleless1                                     85.1    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|EFA85317.1|  hypothetical protein PPL_02318                        73.2    2e-11   Heterostelium album PN500
ref|XP_004367009.1|  hypothetical protein DFA_07142                   71.6    6e-11   Cavenderia fasciculata
ref|XP_646623.2|  hypothetical protein DDB_G0270754                   69.7    2e-10   Dictyostelium discoideum AX4
ref|XP_002678979.1|  predicted protein                                67.0    2e-09   Naegleria gruberi strain NEG-M
ref|XP_003287306.1|  hypothetical protein DICPUDRAFT_32286            65.5    5e-09   Dictyostelium purpureum
ref|XP_001943896.1|  PREDICTED: vacuolar protein sorting-associat...  64.7    8e-09   Acyrthosiphon pisum
ref|XP_008200104.1|  PREDICTED: vacuolar protein sorting-associat...  63.9    1e-08   Tribolium castaneum [rust-red flour beetle]
gb|EFA13302.1|  hypothetical protein TcasGA2_TC001384                 63.9    2e-08   
ref|XP_010862318.1|  PREDICTED: vacuolar protein sorting-associat...  63.9    2e-08   Esox lucius
dbj|GAM26637.1|  hypothetical protein SAMD00019534_098120             63.5    2e-08   Acytostelium subglobosum LB1
gb|ABC94505.1|  hypothetical protein                                  60.5    2e-08   Ictalurus punctatus
ref|XP_007898277.1|  PREDICTED: vacuolar protein sorting-associat...  63.5    2e-08   Callorhinchus milii [Australian ghost shark]
ref|XP_002072009.1|  GK22550                                          62.8    3e-08   Drosophila willistoni
emb|CEJ04542.1|  Putative Vacuolar protein sorting protein vps16      58.9    3e-08   Rhizopus microsporus
ref|NP_001091659.1|  vacuolar protein sorting-associated protein ...  62.4    5e-08   Danio rerio [leopard danio]
emb|CEG84393.1|  hypothetical protein RMATCC62417_18202               60.1    6e-08   Rhizopus microsporus
ref|XP_006636484.1|  PREDICTED: vacuolar protein sorting-associat...  61.6    9e-08   Lepisosteus oculatus
ref|XP_004345413.1|  vacuolar assembling/sorting protein VPS16        61.2    1e-07   Capsaspora owczarzaki ATCC 30864
ref|XP_008121385.1|  PREDICTED: vacuolar protein sorting-associat...  60.8    1e-07   
ref|XP_007248949.1|  PREDICTED: vacuolar protein sorting-associat...  60.8    1e-07   
dbj|GAN01171.1|  vacuolar protein sorting vps16 protein               60.8    2e-07   Mucor ambiguus
gb|EPB85961.1|  hypothetical protein HMPREF1544_07293                 60.5    2e-07   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_004340672.1|  vacuolar protein sorting 16, putative            60.5    2e-07   Acanthamoeba castellanii str. Neff
emb|CEG71651.1|  hypothetical protein RMATCC62417_07353               60.5    2e-07   Rhizopus microsporus
ref|XP_002096919.1|  GE25939                                          60.1    2e-07   Drosophila yakuba
emb|CEP18375.1|  hypothetical protein                                 60.1    2e-07   Parasitella parasitica
ref|XP_002598771.1|  hypothetical protein BRAFLDRAFT_212848           60.1    3e-07   Branchiostoma floridae
ref|XP_002591465.1|  hypothetical protein BRAFLDRAFT_105238           59.7    3e-07   Branchiostoma floridae
gb|ERZ97236.1|  hypothetical protein GLOINDRAFT_334475                59.7    4e-07   
ref|XP_005735068.1|  PREDICTED: vacuolar protein sorting-associat...  59.3    4e-07   
ref|XP_005735067.1|  PREDICTED: vacuolar protein sorting-associat...  59.7    4e-07   Pundamilia nyererei
ref|XP_005735066.1|  PREDICTED: vacuolar protein sorting-associat...  59.7    4e-07   Pundamilia nyererei
ref|XP_004575656.1|  PREDICTED: vacuolar protein sorting-associat...  59.7    4e-07   Maylandia zebra
ref|XP_005951516.1|  PREDICTED: vacuolar protein sorting-associat...  59.3    4e-07   Haplochromis burtoni
ref|XP_005951515.1|  PREDICTED: vacuolar protein sorting-associat...  59.3    4e-07   Haplochromis burtoni
ref|XP_005951517.1|  PREDICTED: vacuolar protein sorting-associat...  59.3    4e-07   
ref|XP_005463829.1|  PREDICTED: vacuolar protein sorting-associat...  59.3    5e-07   
ref|XP_003458681.1|  PREDICTED: vacuolar protein sorting-associat...  59.3    5e-07   Oreochromis niloticus
ref|XP_002110165.1|  hypothetical protein TRIADDRAFT_20725            59.3    5e-07   Trichoplax adhaerens
emb|CEI87038.1|  hypothetical protein RMCBS344292_01458               59.3    5e-07   Rhizopus microsporus
ref|XP_001641101.1|  predicted protein                                59.3    5e-07   Nematostella vectensis
ref|XP_005176360.1|  PREDICTED: vacuolar protein sorting-associat...  59.3    5e-07   Musca domestica
ref|XP_004661526.1|  PREDICTED: vacuolar protein sorting-associat...  59.3    5e-07   Jaculus jaculus
ref|XP_004661527.1|  PREDICTED: vacuolar protein sorting-associat...  59.3    5e-07   Jaculus jaculus
ref|XP_001996143.1|  GH14334                                          59.3    5e-07   Drosophila grimshawi
ref|XP_006038082.1|  PREDICTED: vacuolar protein sorting-associat...  58.9    7e-07   
ref|XP_003488666.1|  PREDICTED: vacuolar protein sorting-associat...  58.5    9e-07   
ref|XP_003394905.1|  PREDICTED: vacuolar protein sorting-associat...  58.5    9e-07   
ref|XP_009462172.1|  PREDICTED: vacuolar protein sorting-associat...  58.2    1e-06   Nipponia nippon
ref|XP_009098195.1|  PREDICTED: vacuolar protein sorting-associat...  58.5    1e-06   
ref|XP_010566769.1|  PREDICTED: vacuolar protein sorting-associat...  58.2    1e-06   Haliaeetus leucocephalus
ref|XP_005239614.1|  PREDICTED: vacuolar protein sorting-associat...  58.2    1e-06   
ref|XP_009883933.1|  PREDICTED: vacuolar protein sorting-associat...  58.2    1e-06   Charadrius vociferus
ref|XP_007497007.1|  PREDICTED: vacuolar protein sorting-associat...  58.2    1e-06   Monodelphis domestica
ref|XP_005435468.1|  PREDICTED: vacuolar protein sorting-associat...  58.2    1e-06   
ref|XP_011238156.1|  PREDICTED: vacuolar protein sorting-associat...  57.8    1e-06   
ref|XP_009052918.1|  hypothetical protein LOTGIDRAFT_115951           57.8    2e-06   Lottia gigantea
ref|XP_011191448.1|  PREDICTED: vacuolar protein sorting-associat...  57.8    2e-06   Zeugodacus cucurbitae [melon fruit fly]
gb|AAH03944.1|  Vps16 protein                                         57.4    2e-06   Mus musculus [mouse]
gb|EDL80192.1|  vacuolar protein sorting 16 (yeast), isoform CRA_b    55.1    2e-06   Rattus norvegicus [brown rat]
ref|XP_005518015.1|  PREDICTED: vacuolar protein sorting-associat...  57.4    2e-06   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_004210014.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    2e-06   Hydra vulgaris
ref|XP_010726024.1|  PREDICTED: vacuolar protein sorting-associat...  57.8    2e-06   Meleagris gallopavo [common turkey]
ref|XP_002000799.1|  GI10429                                          57.4    2e-06   Drosophila mojavensis
ref|NP_001258079.1|  vacuolar protein sorting-associated protein ...  57.4    2e-06   Gallus gallus [bantam]
ref|XP_005431022.1|  PREDICTED: vacuolar protein sorting-associat...  57.4    2e-06   
gb|AAH64406.1|  VPS16 protein                                         56.6    2e-06   Homo sapiens [man]
ref|XP_006272323.1|  PREDICTED: vacuolar protein sorting-associat...  57.4    2e-06   Alligator mississippiensis
gb|ETN68096.1|  vacuolar protein sorting vps16                        57.4    2e-06   Anopheles darlingi [American malaria mosquito]
ref|XP_001980849.1|  GG16085                                          57.0    2e-06   Drosophila erecta
ref|XP_002020368.1|  GL13948                                          57.0    2e-06   
ref|XP_001357562.2|  GA21090                                          57.0    3e-06   Drosophila pseudoobscura pseudoobscura
emb|CDH59927.1|  vacuolar protein sorting vps16                       57.0    3e-06   Lichtheimia corymbifera JMRC:FSU:9682
gb|AAI26432.1|  VPS16 protein                                         56.6    3e-06   Homo sapiens [man]
ref|XP_004687407.1|  PREDICTED: vacuolar protein sorting-associat...  57.0    3e-06   
ref|XP_002679841.1|  predicted protein                                57.0    3e-06   Naegleria gruberi strain NEG-M
gb|EAX10565.1|  hCG2039972, isoform CRA_b                             56.6    3e-06   Homo sapiens [man]
ref|XP_004687406.1|  PREDICTED: vacuolar protein sorting-associat...  57.0    3e-06   Condylura cristata
ref|XP_004433876.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    3e-06   
gb|AAH12422.1|  VPS16 protein                                         56.6    3e-06   Homo sapiens [man]
ref|XP_007636110.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    3e-06   
ref|XP_008469959.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    3e-06   
ref|XP_004433875.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    3e-06   
gb|AAH21291.2|  VPS16 protein                                         56.2    4e-06   Homo sapiens [man]
ref|XP_002055907.1|  GJ10645                                          56.6    4e-06   Drosophila virilis
ref|XP_004611017.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    4e-06   Sorex araneus [Eurasian shrew]
ref|XP_003499087.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    4e-06   Cricetulus griseus [Chinese hamsters]
ref|XP_011173487.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    4e-06   Solenopsis invicta [imported red fire ant]
ref|XP_005604575.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    4e-06   
gb|AAH25626.1|  Vacuolar protein sorting 16 (yeast)                   56.6    4e-06   synthetic construct
ref|XP_004611016.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    4e-06   Sorex araneus [Eurasian shrew]
ref|XP_005062211.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    4e-06   
dbj|BAB64892.1|  Vps16                                                56.6    4e-06   Mus musculus [mouse]
ref|XP_003941102.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    4e-06   Saimiri boliviensis boliviensis
ref|XP_011212493.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    4e-06   Bactrocera dorsalis [papaya fruit fly]
gb|ELU17286.1|  hypothetical protein CAPTEDRAFT_168734                56.6    4e-06   Capitella teleta
gb|ERE69810.1|  putative vacuolar protein sorting-associated prot...  56.6    4e-06   Cricetulus griseus [Chinese hamsters]
ref|XP_006500493.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    4e-06   Mus musculus [mouse]
ref|XP_002806793.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  56.6    4e-06   
dbj|BAC33966.1|  unnamed protein product                              56.6    4e-06   Mus musculus [mouse]
ref|NP_085036.3|  vacuolar protein sorting-associated protein 16 ...  56.6    4e-06   Mus musculus [mouse]
ref|XP_003774363.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    4e-06   
sp|Q920Q4.3|VPS16_MOUSE  RecName: Full=Vacuolar protein sorting-a...  56.6    4e-06   Mus musculus [mouse]
ref|XP_004523432.1|  PREDICTED: vacuolar protein sorting-associat...  56.2    4e-06   Ceratitis capitata [medfly]
gb|AAH73959.1|  VPS16 protein                                         56.2    4e-06   Homo sapiens [man]
gb|EGU11808.1|  Vacuolar assembling/sorting protein VPS16             56.2    5e-06   Rhodotorula toruloides ATCC 204091
gb|KFM68340.1|  hypothetical protein X975_12661                       56.2    5e-06   Stegodyphus mimosarum
ref|XP_008525819.1|  PREDICTED: vacuolar protein sorting-associat...  56.2    5e-06   Equus przewalskii [Przewalski horse]
ref|XP_004930556.1|  PREDICTED: vacuolar protein sorting-associat...  56.2    5e-06   Bombyx mori [silk moth]
ref|XP_001496814.1|  PREDICTED: vacuolar protein sorting-associat...  56.2    5e-06   
ref|NP_649877.1|  vacuolar protein sorting 16A                        56.2    5e-06   Drosophila melanogaster
gb|EHB04285.1|  Vacuolar protein sorting-associated protein 16-li...  56.2    5e-06   Heterocephalus glaber [naked mole rat]
gb|KFO20539.1|  Vacuolar protein sorting-associated protein 16 li...  56.2    5e-06   Fukomys damarensis [Damara mole rat]
ref|XP_001660915.1|  AAEL010559-PA                                    56.2    5e-06   Aedes aegypti
emb|CAD39063.1|  hypothetical protein                                 55.8    6e-06   Homo sapiens [man]
ref|XP_006207386.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    6e-06   
ref|XP_008852713.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    6e-06   Nannospalax galili
ref|XP_005365673.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    6e-06   
ref|XP_005320597.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    6e-06   
ref|XP_005365672.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    6e-06   Microtus ochrogaster [prairie voles]
ref|XP_003639899.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    6e-06   
ref|XP_003134377.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    6e-06   
ref|XP_005068684.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    6e-06   
ref|XP_011056171.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    6e-06   Acromyrmex echinatior
ref|XP_006894253.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    6e-06   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004886773.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    6e-06   
ref|XP_006187202.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    6e-06   Camelus ferus
ref|XP_006758181.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    6e-06   Myotis davidii
ref|XP_005380824.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    6e-06   
ref|XP_005874819.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Myotis brandtii
ref|XP_004886769.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   
ref|XP_008017290.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Chlorocebus sabaeus
ref|XP_005068683.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Mesocricetus auratus [Syrian golden hamster]
ref|XP_006164053.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   
ref|XP_004772965.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   
ref|XP_004634302.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   
ref|XP_009214732.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   
ref|XP_010971081.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Camelus bactrianus [camel]
ref|XP_003639898.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Canis lupus familiaris [dogs]
ref|XP_003134376.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Sus scrofa [pigs]
gb|EPQ13004.1|  Vacuolar protein sorting-associated protein 16 li...  55.8    7e-06   Myotis brandtii
ref|XP_011367811.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Pteropus vampyrus
ref|XP_002710925.2|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Oryctolagus cuniculus [domestic rabbit]
ref|XP_004634301.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Octodon degus
ref|XP_004398209.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Odobenus rosmarus divergens
ref|XP_007195890.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Balaenoptera acutorostrata scammoni
ref|XP_010609327.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Fukomys damarensis [Damara mole rat]
gb|ELK34510.1|  Vacuolar protein sorting-associated protein 16 li...  55.8    7e-06   Myotis davidii
ref|XP_006207385.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Vicugna pacos
ref|XP_798591.3|  PREDICTED: vacuolar protein sorting-associated ...  55.8    7e-06   
ref|XP_008568870.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Galeopterus variegatus [Malayan flying lemur]
ref|XP_008568868.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005320596.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Ictidomys tridecemlineatus
ref|XP_008139241.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   
ref|XP_006732343.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Leptonychotes weddellii
ref|XP_007073325.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Panthera tigris altaica
ref|XP_006894252.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008568869.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Galeopterus variegatus [Malayan flying lemur]
ref|XP_011279227.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Felis catus [cat]
ref|XP_010377297.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Rhinopithecus roxellana
ref|XP_006984591.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Peromyscus maniculatus bairdii
ref|XP_007958199.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Orycteropus afer afer
ref|XP_010609328.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Fukomys damarensis [Damara mole rat]
ref|XP_008495020.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Calypte anna
ref|XP_004383068.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   
ref|XP_003788109.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   
ref|XP_011251370.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Camponotus floridanus
ref|XP_007958197.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Orycteropus afer afer
ref|XP_005380823.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Chinchilla lanigera
ref|NP_536338.1|  vacuolar protein sorting-associated protein 16 ...  55.8    7e-06   Homo sapiens [man]
ref|XP_006042780.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   
ref|XP_006096450.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  55.8    7e-06   Myotis lucifugus
gb|EHH65496.1|  Vacuolar protein sorting-associated protein 16-li...  55.8    7e-06   Macaca fascicularis [crab eating macaque]
ref|XP_005894002.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Bos mutus
ref|XP_004061764.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   
dbj|BAB71013.1|  unnamed protein product                              55.8    7e-06   Homo sapiens [man]
ref|XP_003476674.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   
gb|EFB15467.1|  hypothetical protein PANDA_007366                     55.8    7e-06   Ailuropoda melanoleuca
ref|XP_006042778.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   
ref|XP_007195886.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Balaenoptera acutorostrata scammoni
ref|XP_004772964.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Mustela putorius furo [black ferret]
ref|XP_002918844.2|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Ailuropoda melanoleuca
ref|XP_007195891.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Balaenoptera acutorostrata scammoni
ref|XP_005568560.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   
ref|XP_004285369.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   
ref|XP_006921721.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Pteropus alecto
ref|XP_004061763.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Gorilla gorilla gorilla [lowland gorilla]
ref|NP_072097.2|  vacuolar protein sorting-associated protein 16 ...  55.8    7e-06   Homo sapiens [man]
ref|XP_009231696.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Pongo abelii [orang utan]
ref|XP_004585724.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Ochotona princeps [southern American pika]
ref|NP_001253119.1|  vacuolar protein sorting-associated protein ...  55.8    7e-06   Macaca mulatta [rhesus macaque]
ref|XP_004317401.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    7e-06   
ref|XP_008139240.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Eptesicus fuscus
ref|XP_008017280.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Chlorocebus sabaeus
ref|XP_003788108.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    7e-06   Otolemur garnettii
gb|ELK04019.1|  Vacuolar protein sorting-associated protein 16 li...  55.8    8e-06   Pteropus alecto
ref|XP_007465456.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    8e-06   Lipotes vexillifer [baiji]
ref|XP_004014429.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    8e-06   
ref|XP_006732342.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    8e-06   
ref|XP_003905036.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    8e-06   
ref|XP_004317400.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    8e-06   
ref|XP_007195888.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    8e-06   
ref|XP_004383066.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    8e-06   
ref|XP_009434986.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    8e-06   
ref|XP_007195887.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    8e-06   
ref|XP_006042777.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    8e-06   
ref|XP_004285368.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    8e-06   
ref|XP_003476673.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    8e-06   
ref|XP_010971080.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    8e-06   
ref|XP_004398208.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    8e-06   
tpg|DAA23165.1|  TPA: vacuolar protein sorting-associated protein...  55.5    8e-06   
ref|XP_005006664.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    8e-06   
ref|XP_010834814.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    8e-06   
ref|NP_001015522.1|  vacuolar protein sorting-associated protein ...  55.5    8e-06   
ref|XP_005894001.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    8e-06   
ref|XP_781126.3|  PREDICTED: vacuolar protein sorting-associated ...  55.5    8e-06   
ref|XP_003411664.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  55.5    8e-06   
ref|XP_004585723.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    8e-06   
ref|XP_009231695.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    8e-06   
ref|XP_005974817.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    8e-06   
ref|XP_011500724.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    8e-06   
ref|XP_005688275.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    8e-06   
ref|XP_004014428.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    8e-06   
ref|XP_009434988.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    8e-06   
ref|XP_007465455.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    9e-06   
ref|XP_008701652.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    9e-06   
ref|XP_007539586.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    9e-06   
ref|XP_007539587.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    9e-06   
gb|EPY79196.1|  vacuolar protein sorting-associated protein 16 is...  55.5    9e-06   
ref|XP_002428971.1|  vacuolar protein sorting, putative               55.5    9e-06   
gb|KDR24089.1|  Vacuolar protein sorting-associated protein 16-li...  55.5    9e-06   
ref|XP_011305829.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    9e-06   
ref|XP_008046183.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    1e-05   
gb|ENN73876.1|  hypothetical protein YQE_09530                        55.1    1e-05   
gb|ENN73877.1|  hypothetical protein YQE_09530                        55.1    1e-05   
ref|XP_005839798.1|  hypothetical protein GUITHDRAFT_161084           55.1    1e-05   
ref|XP_005812181.1|  PREDICTED: vacuolar protein sorting-associat...  55.1    1e-05   
ref|XP_005278471.1|  PREDICTED: vacuolar protein sorting-associat...  55.1    1e-05   
ref|XP_002104149.1|  GD18603                                          55.1    1e-05   
ref|NP_001004976.1|  vacuolar protein sorting 16 homolog              55.1    1e-05   
ref|XP_005812180.1|  PREDICTED: vacuolar protein sorting-associat...  55.1    1e-05   
gb|EZA48287.1|  Vacuolar protein sorting-associated protein 16-li...  55.1    1e-05   
ref|XP_002031925.1|  GM23792                                          55.1    1e-05   
ref|XP_001842734.1|  vacuolar protein sorting vps16                   55.1    1e-05   
emb|CDS07252.1|  hypothetical protein LRAMOSA01201                    55.1    1e-05   
ref|XP_007540621.1|  PREDICTED: vacuolar protein sorting-associat...  55.1    1e-05   
ref|XP_011348407.1|  PREDICTED: vacuolar protein sorting-associat...  55.1    1e-05   
ref|XP_008434411.1|  PREDICTED: vacuolar protein sorting-associat...  54.7    1e-05   
gb|EHJ78397.1|  putative vacuolar protein sorting vps16               54.7    1e-05   
ref|XP_011154335.1|  PREDICTED: vacuolar protein sorting-associat...  54.7    2e-05   
gb|AAG34678.1|AF308801_1  vacuolar protein sorting protein 16         54.7    2e-05   
ref|XP_001954740.1|  GF16588                                          54.7    2e-05   
ref|XP_004697934.1|  PREDICTED: vacuolar protein sorting-associat...  54.7    2e-05   
ref|NP_001005541.1|  vacuolar protein sorting-associated protein ...  54.7    2e-05   
ref|XP_004697935.1|  PREDICTED: vacuolar protein sorting-associat...  54.7    2e-05   
gb|ERL93903.1|  hypothetical protein D910_11189                       54.3    2e-05   
gb|KFH65750.1|  hypothetical protein MVEG_07854                       54.3    2e-05   
gb|EMS22549.1|  vacuolar protein sorting VPS16                        54.3    3e-05   
dbj|GAA99834.1|  hypothetical protein E5Q_06537                       53.9    3e-05   
ref|XP_003030158.1|  hypothetical protein SCHCODRAFT_69044            53.9    3e-05   
gb|ELU41202.1|  vacuolar assembling/sorting protein VPS16             53.9    3e-05   
gb|KFB37904.1|  AGAP000529-PA-like protein                            53.9    3e-05   
ref|XP_006874899.1|  PREDICTED: vacuolar protein sorting-associat...  53.5    4e-05   
gb|KGL93811.1|  Vacuolar protein sorting-associated protein 16        53.5    4e-05   
ref|XP_006874900.1|  PREDICTED: vacuolar protein sorting-associat...  53.5    4e-05   
gb|EFX68012.1|  hypothetical protein DAPPUDRAFT_63503                 53.5    4e-05   
ref|XP_011403010.1|  PREDICTED: vacuolar protein sorting-associat...  53.5    4e-05   
ref|XP_007127204.1|  PREDICTED: vacuolar protein sorting-associat...  53.5    4e-05   
ref|XP_011500721.1|  PREDICTED: vacuolar protein sorting-associat...  52.8    4e-05   
ref|XP_003706212.1|  PREDICTED: vacuolar protein sorting-associat...  53.5    5e-05   
ref|XP_003706213.1|  PREDICTED: vacuolar protein sorting-associat...  53.5    5e-05   
gb|KFG27752.1|  Vps16, amine-terminal domain protein                  50.4    5e-05   
ref|XP_007850547.1|  vacuolar protein sorting vps16                   53.1    5e-05   
emb|CBK22798.2|  unnamed protein product                              50.4    5e-05   
ref|XP_006010586.1|  PREDICTED: vacuolar protein sorting-associat...  53.1    6e-05   
ref|NP_001153367.1|  vacuolar protein sorting 16 homolog A            52.8    6e-05   
ref|XP_003690002.1|  PREDICTED: vacuolar protein sorting-associat...  52.8    7e-05   
gb|KIK56666.1|  hypothetical protein GYMLUDRAFT_230051                52.8    8e-05   
emb|CCO31224.1|  putative vacuolar protein sorting-associated pro...  52.8    8e-05   
emb|CCJ28605.1|  unnamed protein product                              52.8    8e-05   
ref|XP_002401625.1|  vacuolar protein-sorting protein, putative       52.8    8e-05   
ref|XP_009565616.1|  PREDICTED: vacuolar protein sorting-associat...  52.4    9e-05   
gb|KFQ96045.1|  Vacuolar protein sorting-associated protein 16        52.4    9e-05   
gb|EST04654.1|  hypothetical protein PSEUBRA_SCAF9g01385              52.4    1e-04   
ref|XP_006617477.1|  PREDICTED: vacuolar protein sorting-associat...  52.0    1e-04   
ref|XP_006567258.1|  PREDICTED: vacuolar protein sorting-associat...  52.0    1e-04   
ref|XP_006617475.1|  PREDICTED: vacuolar protein sorting-associat...  52.0    1e-04   
ref|XP_392642.2|  PREDICTED: vacuolar protein sorting-associated ...  52.0    1e-04   
ref|XP_006617476.1|  PREDICTED: vacuolar protein sorting-associat...  52.0    1e-04   
ref|XP_006567257.1|  PREDICTED: vacuolar protein sorting-associat...  52.0    1e-04   
dbj|GAC75011.1|  predicted metalloprotease with chaperone activity    52.0    1e-04   
gb|EPS95124.1|  hypothetical protein FOMPIDRAFT_1043679               52.0    1e-04   
gb|EPR58066.1|  putative vacuolar protein sorting 16                  52.0    1e-04   
dbj|GAK67926.1|  vacuolar assembling/sorting protein VPS16            52.0    1e-04   
gb|ETS65113.1|  hypothetical protein PaG_00571                        52.0    1e-04   
gb|ESS29871.1|  putative vacuolar protein sorting 16                  52.0    1e-04   
dbj|GAC99770.1|  hypothetical protein PHSY_007373                     52.0    1e-04   
ref|XP_002369923.1|  hypothetical protein, conserved                  51.6    2e-04   
gb|KFH03825.1|  Vps16, N-terminal region protein                      51.6    2e-04   
ref|XP_004469198.1|  PREDICTED: vacuolar protein sorting-associat...  51.6    2e-04   
gb|KIY70700.1|  vacuolar assembling/sorting protein VPS16             51.6    2e-04   
emb|CBQ68702.1|  related to vacuolar protein sorting 16               51.6    2e-04   
gb|KFG58808.1|  Vps16, N-terminal region protein                      51.2    2e-04   
ref|XP_008606140.1|  hypothetical protein SDRG_02337                  51.2    2e-04   
gb|EKD04193.1|  vacuole organization and biogenesis-related protein   51.2    2e-04   
gb|KFG43286.1|  Vps16, N-terminal region protein                      51.2    2e-04   
gb|KDO30335.1|  hypothetical protein SPRG_05046                       51.2    2e-04   
ref|XP_008887993.1|  vacuolar protein sorting 16, putative            50.8    3e-04   
ref|XP_011390572.1|  hypothetical protein UMAG_11636                  50.8    3e-04   
ref|XP_008558295.1|  PREDICTED: vacuolar protein sorting-associat...  50.4    4e-04   
gb|KFP03155.1|  Vacuolar protein sorting-associated protein 16        50.4    4e-04   
gb|KIP07308.1|  hypothetical protein PHLGIDRAFT_426170                50.4    4e-04   
ref|XP_008866355.1|  hypothetical protein H310_04019                  50.1    5e-04   
emb|CDJ38705.1|  hypothetical protein, conserved                      49.7    6e-04   
ref|XP_005650736.1|  vacuolar protein sorting-associated protein 16   50.1    6e-04   
ref|XP_007371512.1|  vacuolar protein sorting-associated protein 16   50.1    6e-04   
ref|XP_005713227.1|  unnamed protein product                          47.4    7e-04   
gb|KDQ31847.1|  hypothetical protein PLEOSDRAFT_48878                 49.7    7e-04   
gb|KIK24542.1|  hypothetical protein PISMIDRAFT_645755                49.7    8e-04   
ref|XP_009823468.1|  hypothetical protein H257_01794                  49.7    8e-04   
gb|KIM91586.1|  hypothetical protein PILCRDRAFT_133551                49.7    8e-04   
ref|XP_008323608.1|  PREDICTED: vacuolar protein sorting-associat...  49.3    0.001   



>gb|KDO51889.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=449

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMake  446
            RDWDALE+FSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKE
Sbjct  346  RDWDALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKE  405

Query  445  aadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            AADAASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  406  AADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGVS  449



>ref|XP_007214933.1| hypothetical protein PRUPE_ppa001364mg [Prunus persica]
 gb|EMJ16132.1| hypothetical protein PRUPE_ppa001364mg [Prunus persica]
Length=844

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEAC+EA++KGEALKYIPKL DPRERAE+YA IGMAK
Sbjct  740  IRDWDALEKFSKEKRPPIGYRPFVEACIEADEKGEALKYIPKLTDPRERAESYARIGMAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKLTFSQNAAA+SIFDTLRDRL+FQG S
Sbjct  800  EAADAASQAKDGELLGRLKLTFSQNAAASSIFDTLRDRLSFQGVS  844



>ref|XP_006387719.1| hypothetical protein POPTR_0647s00230g, partial [Populus trichocarpa]
 gb|ERP46633.1| hypothetical protein POPTR_0647s00230g, partial [Populus trichocarpa]
Length=201

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDW+ALEKFSKEKRPP+G++PFVEAC++ ++K EALKYIPKLADPRERAEAYA IGMAK
Sbjct  97   IRDWEALEKFSKEKRPPMGFRPFVEACIDVDEKAEALKYIPKLADPRERAEAYARIGMAK  156

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG S
Sbjct  157  EAADAASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGVS  201



>ref|XP_007048987.1| Vacuoleless1 (VCL1) isoform 3 [Theobroma cacao]
 gb|EOX93144.1| Vacuoleless1 (VCL1) isoform 3 [Theobroma cacao]
Length=809

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKLADPRERAEAYA IGMAK
Sbjct  705  IRDWDALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLADPRERAEAYARIGMAK  764

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKLTF+QNAAA+S+FDTLRDRL+FQG S
Sbjct  765  EAADAASQAKDGELLGRLKLTFAQNAAASSLFDTLRDRLSFQGVS  809



>ref|XP_008229565.1| PREDICTED: protein VACUOLELESS1 [Prunus mume]
Length=841

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWD LEKFSKEKRPPIGY+PFVEACVEA++KGEALKYIPKL DPRERAE+YA IGMAK
Sbjct  737  IRDWDVLEKFSKEKRPPIGYRPFVEACVEADEKGEALKYIPKLTDPRERAESYARIGMAK  796

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKLTFSQNAAA+SIFDTLRDRL+FQG S
Sbjct  797  EAADAASQAKDGELLGRLKLTFSQNAAASSIFDTLRDRLSFQGVS  841



>ref|XP_007048986.1| Vacuoleless1 (VCL1) isoform 2 [Theobroma cacao]
 gb|EOX93143.1| Vacuoleless1 (VCL1) isoform 2 [Theobroma cacao]
Length=844

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKLADPRERAEAYA IGMAK
Sbjct  740  IRDWDALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLADPRERAEAYARIGMAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKLTF+QNAAA+S+FDTLRDRL+FQG S
Sbjct  800  EAADAASQAKDGELLGRLKLTFAQNAAASSLFDTLRDRLSFQGVS  844



>gb|KDO51888.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=618

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMake  446
            RDWDALE+FSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKE
Sbjct  515  RDWDALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKE  574

Query  445  aadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            AADAASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  575  AADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGVS  618



>emb|CDP06151.1| unnamed protein product [Coffea canephora]
Length=840

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEAC++A++KGEALKYIPKL+DPRERAEAYA IGMAK
Sbjct  736  IRDWDALEKFSKEKRPPIGYRPFVEACIDADEKGEALKYIPKLSDPRERAEAYARIGMAK  795

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKD ELLGRLKLTFSQNAAA+SIFDTLRDRL+FQG S
Sbjct  796  EAADAASQAKDNELLGRLKLTFSQNAAASSIFDTLRDRLSFQGVS  840



>ref|XP_007048985.1| Vacuoleless1 (VCL1) isoform 1 [Theobroma cacao]
 gb|EOX93142.1| Vacuoleless1 (VCL1) isoform 1 [Theobroma cacao]
Length=874

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKLADPRERAEAYA IGMAK
Sbjct  770  IRDWDALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLADPRERAEAYARIGMAK  829

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKLTF+QNAAA+S+FDTLRDRL+FQG S
Sbjct  830  EAADAASQAKDGELLGRLKLTFAQNAAASSLFDTLRDRLSFQGVS  874



>ref|XP_006437140.1| hypothetical protein CICLE_v10030701mg [Citrus clementina]
 ref|XP_006484899.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Citrus sinensis]
 gb|ESR50380.1| hypothetical protein CICLE_v10030701mg [Citrus clementina]
Length=839

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMake  446
            RDWDALE+FSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKE
Sbjct  736  RDWDALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKE  795

Query  445  aadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            AADAASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  796  AADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGVS  839



>gb|AFK37940.1| unknown [Lotus japonicus]
Length=375

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEK+PPIGY+PFVEAC+EA +KGEA+KYIPKLADPRERAE+YA IGMAK
Sbjct  271  IKDWVALEKFSKEKKPPIGYRPFVEACIEANEKGEAIKYIPKLADPRERAESYARIGMAK  330

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKLTFSQNAAA+SIFDTLRDRL+F G S
Sbjct  331  EAADAASQAKDGELLGRLKLTFSQNAAASSIFDTLRDRLSFPGAS  375



>gb|KDO51887.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=839

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMake  446
            RDWDALE+FSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKE
Sbjct  736  RDWDALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKE  795

Query  445  aadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            AADAASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  796  AADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGVS  839



>ref|XP_011082899.1| PREDICTED: protein VACUOLELESS1 [Sesamum indicum]
Length=840

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEACV+A +K +ALKYIPKLADPRERAEAYA IGMAK
Sbjct  736  IRDWDALEKFSKEKRPPIGYRPFVEACVDAGEKDQALKYIPKLADPRERAEAYAKIGMAK  795

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKLTF+QNAAAASIFDTLRDRL+FQG S
Sbjct  796  EAADAASQAKDGELLGRLKLTFAQNAAAASIFDTLRDRLSFQGVS  840



>ref|XP_011026233.1| PREDICTED: protein VACUOLELESS1-like isoform X2 [Populus euphratica]
Length=575

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPP G++PFVEAC++A++KGEALKYIPKLADPRERAEAYA IGMAK
Sbjct  471  IRDWDALEKFSKEKRPPNGFRPFVEACIDADEKGEALKYIPKLADPRERAEAYARIGMAK  530

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG S
Sbjct  531  EAADAASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGVS  575



>ref|XP_002526647.1| vacuolar protein sorting vps16, putative [Ricinus communis]
 gb|EEF35735.1| vacuolar protein sorting vps16, putative [Ricinus communis]
Length=851

 Score =   167 bits (422),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEAC++A++KGEALKYIPKLADPRERAEAYA +GMAK
Sbjct  748  IRDWDALEKFSKEKRPPIGYRPFVEACIDADEKGEALKYIPKLADPRERAEAYARVGMAK  807

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  317
            EAADAASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG 
Sbjct  808  EAADAASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGV  851



>gb|EYU33990.1| hypothetical protein MIMGU_mgv1a001320mg [Erythranthe guttata]
Length=840

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEACV+A +K EALKYIPKLADPRE+AEAYA IGMAK
Sbjct  736  IRDWDALEKFSKEKRPPIGYRPFVEACVDAGEKDEALKYIPKLADPREKAEAYARIGMAK  795

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKL+F+QNAAA+SIFDTLRDRL+FQG S
Sbjct  796  EAADAASQAKDGELLGRLKLSFAQNAAASSIFDTLRDRLSFQGVS  840



>gb|KHN35900.1| Vacuolar protein sorting-associated protein 16 like [Glycine 
soja]
Length=613

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEK+PPIGY+PFVEAC+EA++KGEA+KYIPKLADPRERAE+YA IGMAK
Sbjct  510  IKDWVALEKFSKEKKPPIGYRPFVEACIEADEKGEAIKYIPKLADPRERAESYARIGMAK  569

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  320
            EAADAASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG
Sbjct  570  EAADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQG  612



>gb|KHG27227.1| Vacuolar sorting-associated protein 16 [Gossypium arboreum]
Length=789

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDW+ALEKFSKEKRPPIGY+PFVEAC++A++KGEALKYIPKLAD RERAEAYA IGMAK
Sbjct  685  IRDWEALEKFSKEKRPPIGYRPFVEACIDADEKGEALKYIPKLADLRERAEAYARIGMAK  744

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKLTF+QNAAA+S+FDTLRDRL+FQG S
Sbjct  745  EAADAASQAKDGELLGRLKLTFAQNAAASSLFDTLRDRLSFQGVS  789



>gb|KDP24238.1| hypothetical protein JCGZ_26643 [Jatropha curcas]
Length=847

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMake  446
            RDWDALEKFSKEKRPPIGY+PFVEAC++A++K EALKYIPKLADPRERAEAYA IGMAKE
Sbjct  744  RDWDALEKFSKEKRPPIGYRPFVEACIDADEKSEALKYIPKLADPRERAEAYARIGMAKE  803

Query  445  aadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            AADAASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG S
Sbjct  804  AADAASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGVS  847



>gb|KJB10618.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=844

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDW+ALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKLAD RERAEAYA IGMAK
Sbjct  740  IRDWEALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLADLRERAEAYARIGMAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKLTF+QNAAA+S+FDTLRDRL+FQG S
Sbjct  800  EAADAASQAKDGELLGRLKLTFAQNAAASSLFDTLRDRLSFQGVS  844



>ref|XP_011026232.1| PREDICTED: protein VACUOLELESS1-like isoform X1 [Populus euphratica]
Length=844

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPP G++PFVEAC++A++KGEALKYIPKLADPRERAEAYA IGMAK
Sbjct  740  IRDWDALEKFSKEKRPPNGFRPFVEACIDADEKGEALKYIPKLADPRERAEAYARIGMAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG S
Sbjct  800  EAADAASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGVS  844



>ref|XP_002302135.2| MANGLED family protein [Populus trichocarpa]
 gb|EEE81408.2| MANGLED family protein [Populus trichocarpa]
Length=844

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPP G++PFVEAC++A +KGEALKYIPKLADPRERAEAYA IGMAK
Sbjct  740  IRDWDALEKFSKEKRPPNGFRPFVEACIDAAEKGEALKYIPKLADPRERAEAYARIGMAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG S
Sbjct  800  EAADAASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGVS  844



>ref|XP_010053830.1| PREDICTED: protein VACUOLELESS1 [Eucalyptus grandis]
Length=843

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/99 (94%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKLADPRERAEAYA IGMAK
Sbjct  742  IRDWDALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLADPRERAEAYARIGMAK  801

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRL  332
            EAADAASQAKDGELLGRLKLTFSQNAAA+SIFDTLRDRL
Sbjct  802  EAADAASQAKDGELLGRLKLTFSQNAAASSIFDTLRDRL  840



>gb|KEH16900.1| vacuolar protein sorting-associated-like protein [Medicago truncatula]
Length=850

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEK+PPIGY+PFVEAC+EA++KGEA+KYIPKLADPRE+AE+YA IGMAK
Sbjct  746  IKDWAALEKFSKEKKPPIGYRPFVEACIEADEKGEAIKYIPKLADPREKAESYARIGMAK  805

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+Q+KDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  806  EAADAAAQSKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGAS  850



>ref|XP_006348963.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Solanum tuberosum]
Length=844

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAK
Sbjct  740  IRDWDALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLTDPRERAEAYARIGMAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+QAKD ELLGRLK TFSQNAAA+SIFDTLRDRL+F   S
Sbjct  800  EAADAATQAKDNELLGRLKQTFSQNAAASSIFDTLRDRLSFPSVS  844



>ref|XP_003599782.1| Vacuolar protein sorting-associated protein-like protein [Medicago 
truncatula]
Length=856

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEK+PPIGY+PFVEAC+EA++KGEA+KYIPKLADPRE+AE+YA IGMAK
Sbjct  752  IKDWAALEKFSKEKKPPIGYRPFVEACIEADEKGEAIKYIPKLADPREKAESYARIGMAK  811

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+Q+KDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  812  EAADAAAQSKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGAS  856



>gb|AES70033.2| vacuolar protein sorting-associated-like protein [Medicago truncatula]
Length=850

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEK+PPIGY+PFVEAC+EA++KGEA+KYIPKLADPRE+AE+YA IGMAK
Sbjct  746  IKDWAALEKFSKEKKPPIGYRPFVEACIEADEKGEAIKYIPKLADPREKAESYARIGMAK  805

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+Q+KDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  806  EAADAAAQSKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGAS  850



>ref|XP_003532091.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Glycine max]
Length=843

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEK+PPIGY+PFVEAC+EA++KGEA+KYIPKLADPRERAE+YA IGMAK
Sbjct  740  IKDWVALEKFSKEKKPPIGYRPFVEACIEADEKGEAIKYIPKLADPRERAESYARIGMAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  320
            EAADAASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG
Sbjct  800  EAADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQG  842



>ref|XP_003551927.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Glycine max]
Length=843

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEK+PPIGY+PFVEAC+EA++KGEA+KYIPKLADPRERAE+YA IGMAK
Sbjct  740  IKDWVALEKFSKEKKPPIGYRPFVEACIEADEKGEAIKYIPKLADPRERAESYARIGMAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  320
            EAADAASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG
Sbjct  800  EAADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQG  842



>gb|KJB10616.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=888

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDW+ALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKLAD RERAEAYA IGMAK
Sbjct  740  IRDWEALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLADLRERAEAYARIGMAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  320
            EAADAASQAKDGELLGRLKLTF+QNAAA+S+FDTLRDRL+FQG
Sbjct  800  EAADAASQAKDGELLGRLKLTFAQNAAASSLFDTLRDRLSFQG  842



>ref|XP_004243213.1| PREDICTED: protein VACUOLELESS1 [Solanum lycopersicum]
Length=843

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEACV+A +KGEALKYIPKL DPRERAEAYA IGMAK
Sbjct  739  IRDWDALEKFSKEKRPPIGYRPFVEACVDANEKGEALKYIPKLTDPRERAEAYARIGMAK  798

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+QAKD ELLGRLK TFSQNAAA+SIFDTLRDRL+F   S
Sbjct  799  EAADAATQAKDNELLGRLKQTFSQNAAASSIFDTLRDRLSFPSVS  843



>ref|XP_004499978.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cicer arietinum]
Length=850

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEK+PPIGY+PFVEAC+EA++KGEA+KYIPKLADPRE+AE+YA IGMAK
Sbjct  746  IKDWAALEKFSKEKKPPIGYRPFVEACIEADEKGEAIKYIPKLADPREKAESYARIGMAK  805

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKLTF+QNA A+SIFDTLRDRL+FQG S
Sbjct  806  EAADAASQAKDGELLGRLKLTFAQNAGASSIFDTLRDRLSFQGAS  850



>ref|XP_009625096.1| PREDICTED: protein VACUOLELESS1 [Nicotiana tomentosiformis]
Length=843

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAK
Sbjct  739  IRDWDALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLTDPRERAEAYARIGMAK  798

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKD ELLGRLK TF+QNAAA+SIFDTLRDRL+F   S
Sbjct  799  EAADAASQAKDNELLGRLKQTFAQNAAASSIFDTLRDRLSFPSVS  843



>ref|XP_009790374.1| PREDICTED: protein VACUOLELESS1 [Nicotiana sylvestris]
Length=843

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAEAYA +GMAK
Sbjct  739  IRDWDALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLTDPRERAEAYARVGMAK  798

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKD ELLGRLK TF+QNAAA+SIFDTLRDRL+F   S
Sbjct  799  EAADAASQAKDNELLGRLKQTFAQNAAASSIFDTLRDRLSFPSVS  843



>ref|XP_002306748.1| MANGLED family protein [Populus trichocarpa]
 gb|EEE93744.1| MANGLED family protein [Populus trichocarpa]
Length=844

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDW+ALEKFSKEKRPP+G++PFVEAC++ ++K EALKYIPKLADPRERAEAYA IGMAK
Sbjct  740  IRDWEALEKFSKEKRPPMGFRPFVEACIDVDEKAEALKYIPKLADPRERAEAYARIGMAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG S
Sbjct  800  EAADAASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGVS  844



>ref|XP_011044765.1| PREDICTED: protein VACUOLELESS1-like [Populus euphratica]
Length=844

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDW+ALEKFSKEKRPP+G++PFVEAC++ ++K EALKYIPKLADPRERAEAYA IGMAK
Sbjct  740  IRDWEALEKFSKEKRPPMGFRPFVEACIDVDEKAEALKYIPKLADPRERAEAYARIGMAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG S
Sbjct  800  EAADAASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGVS  844



>ref|XP_008465445.1| PREDICTED: protein VACUOLELESS1 [Cucumis melo]
 ref|XP_008465446.1| PREDICTED: protein VACUOLELESS1 [Cucumis melo]
Length=844

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMake  446
            RDW ALE FSKEKRPPIGYKPFVEACVEA++K EA+KYIPKLADPRERAEAYA IGMAKE
Sbjct  741  RDWVALETFSKEKRPPIGYKPFVEACVEADEKAEAVKYIPKLADPRERAEAYARIGMAKE  800

Query  445  aadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            AADAASQAKDGELLGRLKLTF+QN+AA+SIFDTLRDRL+F G S
Sbjct  801  AADAASQAKDGELLGRLKLTFAQNSAASSIFDTLRDRLSFPGVS  844



>ref|XP_004144632.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cucumis sativus]
 ref|XP_004166595.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cucumis sativus]
 gb|KGN54934.1| hypothetical protein Csa_4G608100 [Cucumis sativus]
Length=844

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMake  446
            RDW ALE FSKEKRPPIGYKPFVEACVEA++K EA+KYIPKLADPRERAEAYA IGMAKE
Sbjct  741  RDWVALETFSKEKRPPIGYKPFVEACVEADEKAEAVKYIPKLADPRERAEAYARIGMAKE  800

Query  445  aadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            AADAASQAKDGELLGRLKLTF+QN+AA+SIFDTLRDRL+F G S
Sbjct  801  AADAASQAKDGELLGRLKLTFAQNSAASSIFDTLRDRLSFPGVS  844



>ref|XP_002283428.1| PREDICTED: protein VACUOLELESS1 [Vitis vinifera]
 emb|CBI22093.3| unnamed protein product [Vitis vinifera]
Length=838

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEAC++A++KGEALKYIPKL DPRERAE+YA IGMAK
Sbjct  737  IRDWDALEKFSKEKRPPIGYRPFVEACIDADEKGEALKYIPKLTDPRERAESYARIGMAK  796

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRL  332
            EAADAASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL
Sbjct  797  EAADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRL  835



>ref|XP_009377216.1| PREDICTED: LOW QUALITY PROTEIN: protein VACUOLELESS1 [Pyrus x 
bretschneideri]
Length=831

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAE+YA IGMAK
Sbjct  731  IRDWDALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLTDPRERAESYARIGMAK  790

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLT  329
            EAADAASQAKDGELLGRLK+TFSQNAAA+SIFDTLRDR  
Sbjct  791  EAADAASQAKDGELLGRLKMTFSQNAAASSIFDTLRDRFV  830



>ref|XP_010271337.1| PREDICTED: protein VACUOLELESS1 isoform X1 [Nelumbo nucifera]
Length=841

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMake  446
            RDWDALEKFSKEKRPP GYKPFVEACV+A +K EA+KYIPKLADPRE+AEAYA +GMAKE
Sbjct  738  RDWDALEKFSKEKRPPTGYKPFVEACVDAGEKDEAIKYIPKLADPREKAEAYARLGMAKE  797

Query  445  aadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            AADAASQ+KD ELLG+LKLTF+QNAAA+SIFDTLRDRLTFQG S
Sbjct  798  AADAASQSKDNELLGKLKLTFAQNAAASSIFDTLRDRLTFQGGS  841



>ref|XP_008342344.1| PREDICTED: protein VACUOLELESS1 [Malus domestica]
Length=840

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAE+YA IGMAK
Sbjct  740  IRDWDALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLTDPRERAESYARIGMAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLT  329
            EAADAASQAKDGELLGRLK+TFSQNAAA+SIFDTLRDR  
Sbjct  800  EAADAASQAKDGELLGRLKMTFSQNAAASSIFDTLRDRFV  839



>ref|XP_008811095.1| PREDICTED: protein VACUOLELESS1 [Phoenix dactylifera]
Length=844

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            +RDWDALEKFSKEKRPP GYKPFVEAC++A++K EALKYIPKLA+PRER+EAYA IGMAK
Sbjct  740  VRDWDALEKFSKEKRPPGGYKPFVEACIDADEKAEALKYIPKLAEPRERSEAYARIGMAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  317
            EAADAASQAKDGEL GRLKLT +QNAAA+SIFDTLRDRL+FQG 
Sbjct  800  EAADAASQAKDGELFGRLKLTLAQNAAASSIFDTLRDRLSFQGV  843



>ref|XP_007146219.1| hypothetical protein PHAVU_006G022400g [Phaseolus vulgaris]
 gb|ESW18213.1| hypothetical protein PHAVU_006G022400g [Phaseolus vulgaris]
Length=843

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEK+PP+G++PFVEAC+EA++K EA+KYIPKLADPRERAE+YA IG+AK
Sbjct  740  IKDWVALEKFSKEKKPPMGFRPFVEACIEADEKAEAIKYIPKLADPRERAESYARIGLAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  320
            EAADAASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG
Sbjct  800  EAADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQG  842



>ref|XP_010087860.1| Vacuolar protein sorting-associated protein 16-like protein [Morus 
notabilis]
 gb|EXB30296.1| Vacuolar protein sorting-associated protein 16-like protein [Morus 
notabilis]
Length=842

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 98/105 (93%), Gaps = 2/105 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDWDALEKFS+EKRPPIG++PFVEAC+EA++KGEALKYIPKL DPRERAE+YA IGMAK
Sbjct  740  IRDWDALEKFSREKRPPIGFRPFVEACIEADEKGEALKYIPKLTDPRERAESYARIGMAK  799

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLK TFSQNAAA+SIFDTLR   +FQG S
Sbjct  800  EAADAASQAKDGELLGRLKSTFSQNAAASSIFDTLRS--SFQGVS  842



>ref|XP_010918871.1| PREDICTED: protein VACUOLELESS1 [Elaeis guineensis]
Length=846

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            +RDWDALEKFSKEKRPP GYKPFVEAC++A +K EALKYIPKLA+PRER+EAYA IGMAK
Sbjct  742  VRDWDALEKFSKEKRPPGGYKPFVEACIDANEKAEALKYIPKLAEPRERSEAYARIGMAK  801

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  317
            EAADAASQAKD EL GRLKLT +QNAAA+SIFDTLRDRL+FQG 
Sbjct  802  EAADAASQAKDSELFGRLKLTLAQNAAASSIFDTLRDRLSFQGV  845



>ref|XP_010557595.1| PREDICTED: protein VACUOLELESS1 [Tarenaya hassleriana]
Length=861

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 98/105 (93%), Gaps = 2/105 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDW+ALEKFSKEKRPPIGY+PFVEAC++A++K EALKYIPKL+DPRERAEAYA IGMAK
Sbjct  759  IRDWEALEKFSKEKRPPIGYRPFVEACIDADEKAEALKYIPKLSDPRERAEAYARIGMAK  818

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAASQAKDGELLGRLK+TFSQNA+  SIFDTL  R++FQG S
Sbjct  819  EAADAASQAKDGELLGRLKMTFSQNASTTSIFDTL--RMSFQGMS  861



>ref|XP_009416537.1| PREDICTED: protein VACUOLELESS1 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            +RDWDALEKFSKEKRPP GYKPFVEAC++A++K EA+KYIPKL +PRER+EAYA IGMAK
Sbjct  738  VRDWDALEKFSKEKRPPGGYKPFVEACIDADEKAEAIKYIPKLTEPRERSEAYARIGMAK  797

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  317
            EAADAASQAKD EL GRLKLT +QNAAA+SIFDTLRDRL+FQG 
Sbjct  798  EAADAASQAKDSELFGRLKLTLAQNAAASSIFDTLRDRLSFQGV  841



>ref|XP_006854657.1| hypothetical protein AMTR_s00030p00200210 [Amborella trichopoda]
 gb|ERN16124.1| hypothetical protein AMTR_s00030p00200210 [Amborella trichopoda]
Length=855

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakea  443
            DWD LEKFSKEKRPPIGYKPFVEAC++A+ KGEALKYIPKL DPRE+AE YA IGMAKEA
Sbjct  753  DWDGLEKFSKEKRPPIGYKPFVEACIDADAKGEALKYIPKLTDPREKAEFYARIGMAKEA  812

Query  442  adaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            ADAASQAKDGELL RLK TFSQNAAA +IFDTLRDRL+ QG S
Sbjct  813  ADAASQAKDGELLIRLKQTFSQNAAATAIFDTLRDRLSLQGVS  855



>ref|XP_004303883.1| PREDICTED: protein VACUOLELESS1 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=857

 Score =   150 bits (378),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            +RDWD LEKFSKEKRPPIG++PFVEAC+EA++KGEALKYIPKL DPRERAEAY  IGMAK
Sbjct  756  VRDWDTLEKFSKEKRPPIGFRPFVEACIEADEKGEALKYIPKLTDPRERAEAYGRIGMAK  815

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRL  332
            EAADAASQA DGELLGRL+ TFSQN AA+SIFDT+RD+L
Sbjct  816  EAADAASQANDGELLGRLRSTFSQNPAASSIFDTIRDKL  854



>ref|XP_011467591.1| PREDICTED: protein VACUOLELESS1 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=891

 Score =   150 bits (378),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            +RDWD LEKFSKEKRPPIG++PFVEAC+EA++KGEALKYIPKL DPRERAEAY  IGMAK
Sbjct  790  VRDWDTLEKFSKEKRPPIGFRPFVEACIEADEKGEALKYIPKLTDPRERAEAYGRIGMAK  849

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRL  332
            EAADAASQA DGELLGRL+ TFSQN AA+SIFDT+RD+L
Sbjct  850  EAADAASQANDGELLGRLRSTFSQNPAASSIFDTIRDKL  888



>gb|AFW83495.1| hypothetical protein ZEAMMB73_843554 [Zea mays]
Length=197

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            + +WD LEKFS+EKRPP GYKPFVEAC++A  K EA+KYIPKL DPRER+EAYA +GMAK
Sbjct  92   VGNWDGLEKFSREKRPPGGYKPFVEACIDAGQKNEAVKYIPKLTDPRERSEAYARMGMAK  151

Query  448  eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  320
            EA DAASQAKD  EL GRLK+T +Q++AAASIFDTLRDRL+FQG
Sbjct  152  EAQDAASQAKDSDELFGRLKITLAQSSAAASIFDTLRDRLSFQG  195



>ref|XP_010681470.1| PREDICTED: protein VACUOLELESS1 [Beta vulgaris subsp. vulgaris]
Length=844

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            IRDW+ALEKFSKEK+PPIGYKPFVEAC++A+++ EALKYIPKL DP ERAEAYA IGMAK
Sbjct  743  IRDWEALEKFSKEKKPPIGYKPFVEACIDADERNEALKYIPKLTDPGERAEAYARIGMAK  802

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRL  332
            EAADAASQAKD ELLGRL+L+FSQN AA SIFDT+R+RL
Sbjct  803  EAADAASQAKDSELLGRLRLSFSQNTAATSIFDTIRERL  841



>ref|XP_004969467.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Setaria italica]
Length=874

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 1/104 (1%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            + +WDALEKFS+E+RPP GYKPFVEAC++A  K EALKYIPKL DPRER+EAYA +GMAK
Sbjct  769  VGNWDALEKFSRERRPPGGYKPFVEACIDAGQKTEALKYIPKLTDPRERSEAYARMGMAK  828

Query  448  eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  320
            EAADAASQAKD  EL GRLK+T +QN+AAASIFDTLRDRL+FQG
Sbjct  829  EAADAASQAKDSDELFGRLKITLAQNSAAASIFDTLRDRLSFQG  872



>ref|XP_006646183.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog, 
partial [Oryza brachyantha]
Length=825

 Score =   139 bits (350),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 82/105 (78%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            + +WDALEKFSKEKRPP GYKPFVEAC++A  K EA+KYIPKL DPRER+EAYA I MAK
Sbjct  720  VGNWDALEKFSKEKRPPGGYKPFVEACIDAGQKTEAVKYIPKLTDPRERSEAYARIKMAK  779

Query  448  eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  317
            EAA+AASQ KD  EL GRLKLT +QN AAASIFDTLRDRL+FQGT
Sbjct  780  EAAEAASQVKDSDELFGRLKLTLAQNTAAASIFDTLRDRLSFQGT  824



>dbj|BAB90498.1| vacuolar protein sorting-associated protein VPS16-like [Oryza 
sativa Japonica Group]
Length=892

 Score =   139 bits (350),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 82/105 (78%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            + +WDALEKFSKE+RPP GYKPFVEAC++A  K EALKYIPKL DPRER+EAYA I MAK
Sbjct  787  VGNWDALEKFSKERRPPGGYKPFVEACIDAGQKTEALKYIPKLTDPRERSEAYARIKMAK  846

Query  448  eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  317
            EAA+AASQ KD  EL GRLKLT +QN AAASIFDTLRDRL+FQGT
Sbjct  847  EAAEAASQVKDSDELFGRLKLTLAQNTAAASIFDTLRDRLSFQGT  891



>ref|XP_002456108.1| hypothetical protein SORBIDRAFT_03g030590 [Sorghum bicolor]
 gb|EES01228.1| hypothetical protein SORBIDRAFT_03g030590 [Sorghum bicolor]
Length=825

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 93/104 (89%), Gaps = 1/104 (1%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            + +WDALEKFS+EKRPP GYKPFVEAC++A  K EA+KYIPKLADPRER+EAYA +GMA+
Sbjct  720  VGNWDALEKFSREKRPPGGYKPFVEACIDAGQKNEAVKYIPKLADPRERSEAYARMGMAR  779

Query  448  eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  320
            EA +AASQAKD  EL GRLK+T +Q++AAASIFDTLRDRL+FQG
Sbjct  780  EAEEAASQAKDSDELFGRLKITLAQSSAAASIFDTLRDRLSFQG  823



>gb|EEE55144.1| hypothetical protein OsJ_02938 [Oryza sativa Japonica Group]
Length=988

 Score =   139 bits (349),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 82/105 (78%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            + +WDALEKFSKE+RPP GYKPFVEAC++A  K EALKYIPKL DPRER+EAYA I MAK
Sbjct  883  VGNWDALEKFSKERRPPGGYKPFVEACIDAGQKTEALKYIPKLTDPRERSEAYARIKMAK  942

Query  448  eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  317
            EAA+AASQ KD  EL GRLKLT +QN AAASIFDTLRDRL+FQGT
Sbjct  943  EAAEAASQVKDSDELFGRLKLTLAQNTAAASIFDTLRDRLSFQGT  987



>ref|XP_008656726.1| PREDICTED: protein VACUOLELESS1 [Zea mays]
Length=877

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            + +WD LEKFS+EKRPP GYKPFVEAC++A  K EA+KYIPKL DPRER+EAYA +GMAK
Sbjct  772  VGNWDGLEKFSREKRPPGGYKPFVEACIDAGQKNEAVKYIPKLTDPRERSEAYARMGMAK  831

Query  448  eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  320
            EA DAASQAKD  EL GRLK+T +Q++AAASIFDTLRDRL+FQG
Sbjct  832  EAQDAASQAKDSDELFGRLKITLAQSSAAASIFDTLRDRLSFQG  875



>ref|XP_002963395.1| hypothetical protein SELMODRAFT_80688 [Selaginella moellendorffii]
 gb|EFJ35266.1| hypothetical protein SELMODRAFT_80688 [Selaginella moellendorffii]
Length=839

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DWDALEKFSKE+RPP+G+KPFVEAC++     EALKYI KL+DP E+AEAYA  GMAK
Sbjct  736  IKDWDALEKFSKERRPPVGFKPFVEACLQEGQTSEALKYIQKLSDPEEKAEAYAQAGMAK  795

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  320
            EAA+ A+QAKD E+LGRLKLTF Q+  AA++FD++RDRL+ QG
Sbjct  796  EAAEVAAQAKDSEILGRLKLTFGQSTTAAALFDSIRDRLSLQG  838



>ref|XP_002974680.1| hypothetical protein SELMODRAFT_101752 [Selaginella moellendorffii]
 gb|EFJ24200.1| hypothetical protein SELMODRAFT_101752 [Selaginella moellendorffii]
Length=839

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DWDALEKFSKE+RPP+G+KPFVEAC++     EALKYI KL+DP E+AEAYA  GMAK
Sbjct  736  IKDWDALEKFSKERRPPVGFKPFVEACLQEGQTSEALKYIQKLSDPEEKAEAYAQAGMAK  795

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  320
            EAA+ A+QAKD E+LGRLKLTF Q+  AA++FD++RDRL+ QG
Sbjct  796  EAAEVAAQAKDSEILGRLKLTFGQSTTAAALFDSIRDRLSLQG  838



>ref|XP_001777594.1| predicted protein [Physcomitrella patens]
 gb|EDQ57637.1| predicted protein [Physcomitrella patens]
Length=837

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMake  446
            + WDALEKFSKE++PPIGYKPFVEAC+E E+  EALKYI KL +P ERAEAYA IGM KE
Sbjct  737  KQWDALEKFSKERKPPIGYKPFVEACIEEEENQEALKYIVKLTNPEERAEAYARIGMVKE  796

Query  445  aadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTF  326
            A +AA+QAKD ELLGRL+ TF QN  A ++FD+LRDRL+ 
Sbjct  797  ATEAAAQAKDNELLGRLRSTFGQNTPAGALFDSLRDRLSL  836



>ref|XP_010232114.1| PREDICTED: protein VACUOLELESS1 [Brachypodium distachyon]
Length=877

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 90/107 (84%), Gaps = 3/107 (3%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            + +WDALE FSKE++PP G+KPFVEAC++A  K EALKY+PKL DP ER+EAYA + M K
Sbjct  770  VGNWDALETFSKERKPPGGFKPFVEACIDAGKKTEALKYVPKLTDPGERSEAYARLKMDK  829

Query  448  eaadaasqakDG-ELLGRLKLTFSQ--NAAAASIFDTLRDRLTFQGT  317
            EAA+AASQAKDG EL GRLKLT +Q  N AAASIFDTLRDRL+FQGT
Sbjct  830  EAAEAASQAKDGDELFGRLKLTLAQNTNTAAASIFDTLRDRLSFQGT  876



>dbj|BAJ97322.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=899

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 81/105 (77%), Gaps = 5/105 (5%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            + +WDALE FS+EKRPP GYKPFVEAC++A  K EA+KYIPKL DP ER+EAYA + M  
Sbjct  798  VGNWDALETFSREKRPPGGYKPFVEACIDAGQKMEAIKYIPKLTDPGERSEAYARLNMTD  857

Query  448  eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  317
            EA  AAS+A +G EL GRLK T +QN    ++ DTLRDRL+FQGT
Sbjct  858  EAEKAASEANNGDELFGRLKSTLAQN----TLIDTLRDRLSFQGT  898



>ref|XP_010505412.1| PREDICTED: protein VACUOLELESS1-like [Camelina sativa]
Length=858

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 88/106 (83%), Gaps = 7/106 (7%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAK
Sbjct  759  IKDWAALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAK  818

Query  448  eaadaasqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+QA D GELL R + TFSQNA    IFDTL  ++ FQGTS
Sbjct  819  EAADAAAQANDGGELLERFRKTFSQNA----IFDTL--KIPFQGTS  858



>emb|CDY07756.1| BnaA03g17550D [Brassica napus]
Length=858

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 7/106 (7%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW+ALEKFSKEKRPP G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAK
Sbjct  759  IKDWEALEKFSKEKRPPTGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAK  818

Query  448  eaadaasqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  819  EAADAAAQANDGGELLERFRKTFSQNA----IFDTL--KMPFQGVS  858



>emb|CDY14496.1| BnaC03g20990D [Brassica napus]
Length=858

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 7/106 (7%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW+ALEKFSKEKRPP G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAK
Sbjct  759  IKDWEALEKFSKEKRPPTGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAK  818

Query  448  eaadaasqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  819  EAADAAAQANDGGELLERFRKTFSQNA----IFDTL--KMPFQGVS  858



>ref|XP_009133226.1| PREDICTED: protein VACUOLELESS1 [Brassica rapa]
Length=858

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 7/106 (7%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW+ALEKFSKEKRPP G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAK
Sbjct  759  IKDWEALEKFSKEKRPPTGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAK  818

Query  448  eaadaasqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  819  EAADAAAQANDGGELLERFRKTFSQNA----IFDTL--KMPFQGVS  858



>dbj|BAJ33734.1| unnamed protein product [Thellungiella halophila]
Length=833

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 7/106 (7%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW+ALEKFSKEKRPP G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAK
Sbjct  734  IKDWEALEKFSKEKRPPTGFRPFVEACIDADEKAEALKYIPKLSDLGERGEAYARIGMAK  793

Query  448  eaadaasqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  794  EAADAAAQANDGGELLERFRKTFSQNA----IFDTL--KMPFQGVS  833



>ref|XP_006411003.1| hypothetical protein EUTSA_v10016232mg [Eutrema salsugineum]
 gb|ESQ52456.1| hypothetical protein EUTSA_v10016232mg [Eutrema salsugineum]
Length=858

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 7/106 (7%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW+ALEKFSKEKRPP G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAK
Sbjct  759  IKDWEALEKFSKEKRPPTGFRPFVEACIDADEKAEALKYIPKLSDLGERGEAYARIGMAK  818

Query  448  eaadaasqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  819  EAADAAAQANDGGELLERFRKTFSQNA----IFDTL--KMPFQGVS  858



>ref|XP_002883710.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59969.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=636

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 7/106 (7%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAK
Sbjct  537  IKDWAALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAK  596

Query  448  eaadaasqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAAD A+QA D GELL R + TF QNA    IFDTL  ++ FQG S
Sbjct  597  EAADCAAQANDGGELLERFRKTFVQNA----IFDTL--KMPFQGAS  636



>ref|XP_010517084.1| PREDICTED: protein VACUOLELESS1-like [Camelina sativa]
Length=858

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 7/106 (7%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAK
Sbjct  759  IKDWAALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAK  818

Query  448  eaadaasqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  819  EAADAAAQANDGGELLERFRKTFSQNA----IFDTL--KMPFQGAS  858



>ref|XP_010509236.1| PREDICTED: protein VACUOLELESS1 [Camelina sativa]
Length=858

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 7/106 (7%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAK
Sbjct  759  IKDWAALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAK  818

Query  448  eaadaasqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  819  EAADAAAQANDGGELLERFRKTFSQNA----IFDTL--KIPFQGAS  858



>ref|XP_006296131.1| hypothetical protein CARUB_v10025283mg [Capsella rubella]
 gb|EOA29029.1| hypothetical protein CARUB_v10025283mg [Capsella rubella]
Length=858

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 7/106 (7%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAK
Sbjct  759  IKDWAALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAK  818

Query  448  eaadaasqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  819  EAADAAAQANDGGELLERFRKTFSQNA----IFDTL--KMPFQGAS  858



>ref|XP_002881559.1| hypothetical protein ARALYDRAFT_321506 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57818.1| hypothetical protein ARALYDRAFT_321506 [Arabidopsis lyrata subsp. 
lyrata]
Length=858

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 86/106 (81%), Gaps = 7/106 (7%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAK
Sbjct  759  IKDWAALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAK  818

Query  448  eaadaasqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAADAA+QA D GELL R + TF QNA    IFDTL  ++ FQG S
Sbjct  819  EAADAAAQANDGGELLERFRKTFVQNA----IFDTL--KMPFQGAS  858



>ref|NP_565879.1| vacuoleless1 [Arabidopsis thaliana]
 sp|Q93VQ0.1|VCL1_ARATH RecName: Full=Protein VACUOLELESS1; AltName: Full=Vacuolar protein 
sorting-associated protein 16 homolog [Arabidopsis thaliana]
 gb|AAK43713.1|AF359240_1 VCL1 [Arabidopsis thaliana]
 gb|AAK82510.1| At2g38020/T8P21.7 [Arabidopsis thaliana]
 gb|AAM98105.1| At2g38020/T8P21.7 [Arabidopsis thaliana]
 gb|AEC09479.1| vacuoleless1 [Arabidopsis thaliana]
Length=858

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 84/106 (79%), Gaps = 7/106 (7%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            I+DW ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAK
Sbjct  759  IKDWAALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAK  818

Query  448  eaadaasqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  314
            EAAD A+QA D GELL R + TF QNA    IFDTL   + FQG S
Sbjct  819  EAADCAAQANDGGELLERFRKTFVQNA----IFDTL--LMPFQGAS  858



>gb|KJB10617.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=795

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGI  461
            IRDW+ALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKLAD RERAE    +
Sbjct  740  IRDWEALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLADLRERAEVTIHV  795



>gb|EMS54442.1| Vacuolar protein sorting-associated protein 16-like protein [Triticum 
urartu]
Length=419

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGM  455
            + +WDALE FS+EKRPP GYKPFVEAC++A  K EALKYIPKL DP ER+E YA I +
Sbjct  323  VGNWDALETFSREKRPPGGYKPFVEACIDAGQKTEALKYIPKLTDPGERSEGYAQISI  380



>dbj|BAD95263.1| hypothetical protein [Arabidopsis thaliana]
Length=346

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEA  473
            I+DW ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER E 
Sbjct  271  IKDWAALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEV  322



>dbj|BAH19612.1| AT2G38020 [Arabidopsis thaliana]
Length=526

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEA  473
            I+DW ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER E 
Sbjct  451  IKDWAALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEV  502



>ref|NP_001078020.1| vacuoleless1 [Arabidopsis thaliana]
 gb|AEC09480.1| vacuoleless1 [Arabidopsis thaliana]
Length=834

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEA  473
            I+DW ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER E 
Sbjct  759  IKDWAALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEV  810



>gb|EFA85317.1| hypothetical protein PPL_02318 [Polysphondylium pallidum PN500]
Length=860

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaa  440
            W+ L  FSKEK+ PIGY+PFVE C++   + EALKYIPK+ D   R ++Y  +G  +EAA
Sbjct  763  WEELNNFSKEKKSPIGYEPFVEVCLDQNQQVEALKYIPKIQDTVNRCQSYIQVGYFREAA  822

Query  439  daasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLT  329
            + A + K+ +LL  +    + N    ++ D +R +L+
Sbjct  823  ETAFKDKNLDLLNFVAKKCTNNEVVLNLIDQMRAQLS  859



>ref|XP_004367009.1| hypothetical protein DFA_07142 [Dictyostelium fasciculatum]
 gb|EGG20026.1| hypothetical protein DFA_07142 [Dictyostelium fasciculatum]
Length=835

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            + DW+ L  F+KEK+ P+GY+PFVE C++  +  EAL+YIPK+ D   RA+AY  I   +
Sbjct  736  VGDWEELHNFAKEKKSPVGYEPFVEVCMDFSNPVEALRYIPKIQDHVNRAQAYLQINYFR  795

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLT  329
            EAA+ A + K+ +LL  +    + N  A++I D +R +L+
Sbjct  796  EAAETAFKEKNLDLLNFIARKCT-NPEASNIIDQMRAQLS  834



>ref|XP_646623.2| hypothetical protein DDB_G0270754 [Dictyostelium discoideum AX4]
 sp|Q55C58.2|VPS16_DICDI RecName: Full=Vacuolar protein sorting-associated protein 16 
homolog [Dictyostelium discoideum]
 gb|EAL72727.2| hypothetical protein DDB_G0270754 [Dictyostelium discoideum AX4]
Length=832

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ L KFSKEK+ PIGY+PFVE C++ +++ EALKYIPK+ D   + + Y  IG
Sbjct  733  MNDWEELMKFSKEKKSPIGYEPFVEVCLDQKNQIEALKYIPKITDILPKIQFYIQIG  789



>ref|XP_002678979.1| predicted protein [Naegleria gruberi]
 gb|EFC46235.1| predicted protein [Naegleria gruberi]
Length=846

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  470
            W+ +EKFSK K+ PIGY+PFVEAC++ ++  EA KYIPK+ DP E+ E Y
Sbjct  753  WNKMEKFSK-KKSPIGYRPFVEACLQQKNTVEAHKYIPKVTDPWEKIELY  801



>ref|XP_003287306.1| hypothetical protein DICPUDRAFT_32286 [Dictyostelium purpureum]
 gb|EGC36173.1| hypothetical protein DICPUDRAFT_32286 [Dictyostelium purpureum]
Length=831

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGI  461
            DW+ L KFSK+K+ PIGY+PFVE C+E +++ EALKYIP++ +   + + Y  I
Sbjct  734  DWEELMKFSKDKKSPIGYEPFVEVCLEQKNQIEALKYIPRITESLPKVQFYIQI  787



>ref|XP_001943896.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Acyrthosiphon pisum]
Length=798

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  494
            +DW+ LEK SK K+ PIGY+PFV+ C+E  +K EALKY+PK+ D
Sbjct  741  QDWNELEKLSKVKKSPIGYEPFVDVCIEHGNKYEALKYLPKVRD  784



>ref|XP_008200104.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Tribolium castaneum]
Length=839

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  494
            + DW  LEKFSK K+ PIGY PFV+ C+E  ++ EALKY+P++ D
Sbjct  738  LEDWTELEKFSKAKKSPIGYAPFVDICLEKNNRHEALKYLPRVGD  782



>gb|EFA13302.1| hypothetical protein TcasGA2_TC001384 [Tribolium castaneum]
Length=840

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  494
            + DW  LEKFSK K+ PIGY PFV+ C+E  ++ EALKY+P++ D
Sbjct  739  LEDWTELEKFSKAKKSPIGYAPFVDICLEKNNRHEALKYLPRVGD  783



>ref|XP_010862318.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Esox lucius]
Length=835

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DWD LEKF+K K+ PIGY PFVE CV+  +K EA KY+ K+  P ++ +A+  IG
Sbjct  735  DWDELEKFAKSKKSPIGYLPFVEVCVKRHNKYEAKKYVSKVT-PEQKVKAHLAIG  788



>dbj|GAM26637.1| hypothetical protein SAMD00019534_098120 [Acytostelium subglobosum 
LB1]
Length=836

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGI  461
            R W+ L  F+ EK+ PIGY+PFVE C++     EALKYIPK+ D   R + Y  +
Sbjct  738  RQWEELSLFANEKKSPIGYEPFVEVCLDQSQHVEALKYIPKIQDVVNRCQCYVQV  792



>gb|ABC94505.1| hypothetical protein [Ictalurus punctatus]
Length=152

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ LEKF+K K+ PIGY PFVE CV+  +K EA KY+ K+  P ++ +A+  +G
Sbjct  82   DWEELEKFAKSKKSPIGYMPFVEECVKRNNKFEAQKYVSKVT-PEQKVKAHLAVG  135



>ref|XP_007898277.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Callorhinchus milii]
Length=838

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +DW+ LEKFSK K+ P+GY PFVE CV+  +K EA KY+ K++ P ++ +A+  +G
Sbjct  737  QDWEELEKFSKSKKSPVGYMPFVEICVKHHNKYEAKKYVTKVS-PEQKVKAFIMVG  791



>ref|XP_002072009.1| GK22550 [Drosophila willistoni]
 gb|EDW82995.1| GK22550 [Drosophila willistoni]
Length=832

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRE  485
            WD LEKF+K K+ PIGY+PFVE CV+ ++K EA KYIP+  + R+
Sbjct  734  WDQLEKFAKSKKSPIGYEPFVEVCVKHKNKVEAQKYIPRCRETRK  778



>emb|CEJ04542.1| Putative Vacuolar protein sorting protein vps16 [Rhizopus microsporus]
Length=97

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +RDWD LEK +K ++ PIGY+PFVE C++A+   EA KYI K  DP  R   +  IG
Sbjct  23   VRDWDNLEKLAKSRKSPIGYEPFVEECIKAKQYQEASKYILK-CDPPARPMLFIKIG  78



>ref|NP_001091659.1| vacuolar protein sorting-associated protein 16 homolog [Danio 
rerio]
 gb|AAI39871.1| MGC162584 protein [Danio rerio]
Length=835

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DWD LEKF+K K+ PIGY PFV+ C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  735  DWDELEKFAKSKKSPIGYLPFVDVCIKHHNKYEARKYVSKVT-PEQKVKAHLAVG  788



>emb|CEG84393.1| hypothetical protein RMATCC62417_18202 [Rhizopus microsporus]
Length=213

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +RDWD LEK +K ++ PIGY+PFVE C++A+   EA KYI K  DP  R   +  IG
Sbjct  139  VRDWDNLEKLAKSRKSPIGYEPFVEECIKAKQYQEASKYILK-CDPPARPMLFIKIG  194



>ref|XP_006636484.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Lepisosteus oculatus]
Length=835

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ LEKFS+ K+ PIGY PFVE CV+  +K EA KY+ K+  P ++ +A+  +G
Sbjct  735  DWEELEKFSRSKKSPIGYLPFVEICVKHHNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_004345413.1| vacuolar assembling/sorting protein VPS16 [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE95370.1| vacuolar assembling/sorting protein VPS16 [Capsaspora owczarzaki 
ATCC 30864]
Length=835

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +W  LEKF+K K+ PIGY PF++ C+E  + GEA KYI +LA P ER  AY  +G
Sbjct  736  NWIELEKFAKSKKSPIGYGPFIDVCMEKGNPGEAKKYIDRLA-PEERVAAYIRVG  789



>ref|XP_008121385.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Anolis carolinensis]
Length=866

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ +EKFSK K+ PIGY PFVE C++  ++ EA K+ P++A P +R +A+  +G
Sbjct  769  DWEEMEKFSKSKKSPIGYLPFVEICMKHHNRHEARKFAPRVA-PEQRVKAFLLVG  822



>ref|XP_007248949.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Astyanax mexicanus]
Length=835

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ LEKF+K K+ PIGY PFVE CV+  +K EA KY+ ++  P ++ +A+  +G
Sbjct  735  DWEELEKFAKSKKSPIGYLPFVEVCVKHHNKYEAKKYVSRVT-PEQKVKAHLAVG  788



>dbj|GAN01171.1| vacuolar protein sorting vps16 protein [Mucor ambiguus]
Length=820

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +RDW+ LEK SK K+ PIGY+PFVE C++A    EA KYI K  DP  R   +  IG
Sbjct  721  VRDWENLEKLSKSKKSPIGYEPFVEECIKARQYQEASKYILK-CDPPVRPMLFVKIG  776



>gb|EPB85961.1| hypothetical protein HMPREF1544_07293 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=760

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +RDW+ LEK SK K+ PIGY+PFVE C++A    EA KYI K  DP  R   +  IG
Sbjct  686  VRDWENLEKLSKSKKSPIGYEPFVEECIKARQYQEASKYILK-CDPPVRPMLFVKIG  741



>ref|XP_004340672.1| vacuolar protein sorting 16, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR18630.1| vacuolar protein sorting 16, putative [Acanthamoeba castellanii 
str. Neff]
Length=861

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  470
            RDW  LE+F+K K+ PIG++PF E C+E     EA KYI  L+D  ER + +
Sbjct  758  RDWATLEQFAKSKKSPIGFRPFAEVCIEQGAMDEAAKYIAMLSDSAERVQMF  809



>emb|CEG71651.1| hypothetical protein RMATCC62417_07353 [Rhizopus microsporus]
Length=820

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +RDWD LEK +K ++ PIGY+PFVE C++A+   EA KYI K  DP  R   +  IG
Sbjct  721  VRDWDNLEKLAKSRKSPIGYEPFVEECIKAKQYQEASKYILK-CDPPARPMLFIKIG  776



>ref|XP_002096919.1| GE25939 [Drosophila yakuba]
 gb|EDW96631.1| GE25939 [Drosophila yakuba]
Length=833

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPR  488
            WD LEKF+K K+ P+GY PFVE C++ ++  EA KYIP+  D R
Sbjct  734  WDELEKFAKSKKSPVGYDPFVEVCLKQDNTVEARKYIPRCRDNR  777



>emb|CEP18375.1| hypothetical protein [Parasitella parasitica]
Length=820

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +RDW+ LEK SK K+ PIGY+PFVE C+ A    EA KYI K  DP  R   +  IG
Sbjct  721  VRDWENLEKLSKSKKSPIGYEPFVEECIRARQYQEASKYILK-CDPPVRPMLFVKIG  776



>ref|XP_002598771.1| hypothetical protein BRAFLDRAFT_212848 [Branchiostoma floridae]
 gb|EEN54783.1| hypothetical protein BRAFLDRAFT_212848 [Branchiostoma floridae]
Length=761

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW  L++F+K K+ PIGY+PF++ C++ +++ EA KY+ ++ADP  + +AY  IG
Sbjct  661  DWAELDRFAKSKKSPIGYEPFIDVCLKHQNRYEANKYVGRIADP-AKVKAYIKIG  714



>ref|XP_002591465.1| hypothetical protein BRAFLDRAFT_105238 [Branchiostoma floridae]
 gb|EEN47476.1| hypothetical protein BRAFLDRAFT_105238 [Branchiostoma floridae]
Length=795

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW  L++F+K K+ PIGY+PF++ C++ +++ EA KY+ ++ADP  + +AY  IG
Sbjct  695  DWAELDRFAKSKKSPIGYEPFIDVCLKHQNRYEANKYVGRIADP-AKVKAYIKIG  748



>gb|ERZ97236.1| hypothetical protein GLOINDRAFT_334475 [Rhizophagus irregularis 
DAOM 181602]
Length=820

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +RDW  LE+ SK K+ PIGY+PFVE C++A    EA+KYI K  DP  R   +  IG
Sbjct  721  MRDWPELERLSKSKKSPIGYEPFVEECIKAIQHKEAIKYITK-CDPAVRPGLFIKIG  776



>ref|XP_005735068.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X3 [Pundamilia nyererei]
Length=690

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +WD LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  591  EWDELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  644



>ref|XP_005735067.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Pundamilia nyererei]
Length=811

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +WD LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  712  EWDELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  765



>ref|XP_005735066.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Pundamilia nyererei]
Length=834

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +WD LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  735  EWDELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_004575656.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Maylandia zebra]
Length=834

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +WD LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  735  EWDELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_005951516.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Haplochromis burtoni]
Length=811

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +WD LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  712  EWDELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  765



>ref|XP_005951515.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Haplochromis burtoni]
Length=834

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +WD LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  735  EWDELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_005951517.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X3 [Haplochromis burtoni]
Length=690

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +WD LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  591  EWDELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  644



>ref|XP_005463829.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Oreochromis niloticus]
Length=690

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +WD LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  591  EWDELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  644



>ref|XP_003458681.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Oreochromis niloticus]
Length=834

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +WD LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  735  EWDELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_002110165.1| hypothetical protein TRIADDRAFT_20725 [Trichoplax adhaerens]
 gb|EDV28331.1| hypothetical protein TRIADDRAFT_20725, partial [Trichoplax adhaerens]
Length=721

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEA-EDKGEALKYIPKLADPRERAEAYAGIGM  455
            R WD LE+FSK K+ PIGY+PFV+AC+ + ++  EA KYI ++   ++ A+ Y  IG+
Sbjct  653  RSWDELERFSKSKKSPIGYEPFVDACINSHKNATEACKYIERVPLSKQ-AKCYIKIGL  709



>emb|CEI87038.1| hypothetical protein RMCBS344292_01458 [Rhizopus microsporus]
Length=733

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            RDWD LEK +K ++ PIGY+PFVE C++A+   EA KYI K  DP  R   +  IG
Sbjct  660  RDWDNLEKLAKSRKSPIGYEPFVEECIKAKQYQEASKYILK-CDPPARPMLFIKIG  714



>ref|XP_001641101.1| predicted protein [Nematostella vectensis]
 gb|EDO49038.1| predicted protein [Nematostella vectensis]
Length=770

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            R+W  LEKFSK ++ PIGY+PFV+ C++   + EA KYI K+  P  +A+ Y  IG
Sbjct  716  RNWTELEKFSKSRKSPIGYEPFVDFCLQQNHRIEAEKYIAKV-QPENKAKYYLKIG  770



>ref|XP_005176360.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Musca domestica]
Length=841

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 5/55 (9%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRE-----RAEAY  470
            WD LEKF+K K+ PIGY+PFVE C++  +  EA KYI K  D R+     RAE Y
Sbjct  741  WDELEKFAKSKKSPIGYEPFVEVCLKQNNLTEARKYILKCRDDRKTHWYIRAELY  795



>ref|XP_004661526.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Jaculus jaculus]
Length=839

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE CV+  +K EA KY  ++A P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICVKQHNKYEAKKYTSRVA-PEQKVKALLLVG  792



>ref|XP_004661527.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Jaculus jaculus]
Length=695

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE CV+  +K EA KY  ++A P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICVKQHNKYEAKKYTSRVA-PEQKVKALLLVG  648



>ref|XP_001996143.1| GH14334 [Drosophila grimshawi]
 gb|EDV90801.1| GH14334 [Drosophila grimshawi]
Length=837

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRE  485
            +W  LEKFSK K+ PIGY+PFVE C++ ++K EA KYI +  D R+
Sbjct  736  NWLELEKFSKGKKSPIGYEPFVEVCLQQDNKDEARKYIARCPDKRK  781



>ref|XP_006038082.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Alligator sinensis]
Length=868

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ +EKFSK K+ PIGY PFVE CV+  ++ EA KY  ++  P +R +A+  +G
Sbjct  768  DWEEMEKFSKSKKSPIGYLPFVEICVKYHNRHEAKKYAARVT-PEQRVKAFILVG  821



>ref|XP_003488666.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Bombus impatiens]
Length=835

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  494
            W+ LEKFSK K+ PIGY+PF++ C++  ++ EA KY+PK+ D
Sbjct  738  WNELEKFSKSKKSPIGYEPFIDQCLKYNEEREAKKYLPKVRD  779



>ref|XP_003394905.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Bombus terrestris]
Length=835

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  494
            W+ LEKFSK K+ PIGY+PF++ C++  ++ EA KY+PK+ D
Sbjct  738  WNELEKFSKSKKSPIGYEPFIDQCLKYNEEREAKKYLPKVRD  779



>ref|XP_009462172.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Nipponia nippon]
Length=803

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  703  DWEEMEKFSKSKKSPIGYLPFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  756



>ref|XP_009098195.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Serinus canaria]
Length=1408

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622   DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
             DW+ +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  1308  DWEEMEKFSKSKKSPIGYLPFVEVAVKHHNRYEAKKYAPRVP-PEQRVKAFVLVG  1361



>ref|XP_010566769.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Haliaeetus leucocephalus]
Length=838

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  738  DWEEMEKFSKSKKSPIGYLPFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  791



>ref|XP_005239614.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Falco peregrinus]
Length=852

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  752  DWEEMEKFSKSKKSPIGYLPFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  805



>ref|XP_009883933.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Charadrius vociferus]
Length=859

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  759  DWEEMEKFSKSKKSPIGYLPFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  812



>ref|XP_007497007.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Monodelphis domestica]
Length=833

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ LEKFSK K+ PIGY PFVE C++  +K EA K+  +++ P +R +A+  IG
Sbjct  733  DWEELEKFSKSKKSPIGYLPFVEVCMKRHNKFEAKKFAARVS-PEQRVKAFLLIG  786



>ref|XP_005435468.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Falco cherrug]
Length=855

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  755  DWEEMEKFSKSKKSPIGYLPFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  808



>ref|XP_011238156.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Mus musculus]
 ref|XP_011238157.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Mus musculus]
Length=452

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  350  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  405



>ref|XP_009052918.1| hypothetical protein LOTGIDRAFT_115951 [Lottia gigantea]
 gb|ESO96565.1| hypothetical protein LOTGIDRAFT_115951 [Lottia gigantea]
Length=827

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 63/97 (65%), Gaps = 2/97 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakea  443
            DW  LEKFSK K+PP+G + FV  C++  ++ EA+KY+ ++  P ++ +A   IG AKEA
Sbjct  726  DWMELEKFSKTKKPPVGMEAFVNICMKYNNRSEAMKYLSRVL-PDQKVQALLNIGNAKEA  784

Query  442  adaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRL  332
            ADAA + +  E LG L LT + N+    + ++++D +
Sbjct  785  ADAAFEMRSEEGLG-LVLTKAINSNNKQLVESVKDMM  820



>ref|XP_011191448.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Bactrocera cucurbitae]
Length=841

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRE  485
            WD LEKF+K K+ PIGY+PFVE C+   +  EA KYI K  D R+
Sbjct  741  WDDLEKFAKSKKSPIGYEPFVEVCLRQNNLHEARKYISKCRDDRK  785



>gb|AAH03944.1| Vps16 protein [Mus musculus]
Length=419

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  317  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  372



>gb|EDL80192.1| vacuolar protein sorting 16 (yeast), isoform CRA_b [Rattus norvegicus]
Length=166

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + +W+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  64   LEEWEELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  119



>ref|XP_005518015.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Pseudopodoces humilis]
Length=693

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  593  DWEEVEKFSKSKKSPIGYLPFVEVAVKHHNRYEARKYAPRVP-PEQRVKAFVLVG  646



>ref|XP_004210014.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Hydra vulgaris]
Length=257

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = -2

Query  625  RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRE-RAEAYAGIG  458
            RDWD LE+FSK K+ PIGY+PF E C++  +  E  KYI K+  P E R + Y+  G
Sbjct  157  RDWDELERFSKSKKSPIGYEPFAEVCIKYGNSAEVEKYILKV--PLEKRVKIYSKSG  211



>ref|XP_010726024.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Meleagris gallopavo]
Length=980

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  880  DWEEMEKFSKSKKSPIGYLPFVEIAVKHHNRYEAKKYAPRVT-PEQRVKAFILVG  933



>ref|XP_002000799.1| GI10429 [Drosophila mojavensis]
 gb|EDW16260.1| GI10429 [Drosophila mojavensis]
Length=836

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRE  485
            +W  LEKFSK K+ PIGY+PFVE C++ E+  EA KYI +  D R+
Sbjct  735  NWVELEKFSKSKKSPIGYEPFVEVCLQRENVREAQKYIQRCPDKRK  780



>ref|NP_001258079.1| vacuolar protein sorting-associated protein 16 homolog [Gallus 
gallus]
Length=838

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  738  DWEEMEKFSKSKKSPIGYLPFVEIAVKHHNRYEAKKYAPRVT-PEQRVKAFILVG  791



>ref|XP_005431022.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Geospiza fortis]
Length=799

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  699  DWEEMEKFSKSKKSPIGYLPFVEVAVKHHNRYEAKKYAPRVP-PEQRVKAFVLVG  752



>gb|AAH64406.1| VPS16 protein, partial [Homo sapiens]
Length=283

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  181  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  236



>ref|XP_006272323.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Alligator mississippiensis]
Length=838

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ +EKFSK K+ PIGY PFVE CV+  ++ EA KY  ++  P ++ +A+  +G
Sbjct  738  DWEEMEKFSKSKKSPIGYLPFVEICVKYHNRHEAKKYAARVV-PEQKVKAFILVG  791



>gb|ETN68096.1| vacuolar protein sorting vps16 [Anopheles darlingi]
Length=836

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 5/56 (9%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRE-----RAEAYA  467
            W+ LE+FSK K+ PIGY+PFVE C+  ++  EA KY+P+ ++  +     RA  YA
Sbjct  738  WEDLERFSKAKKSPIGYEPFVEVCLRQQNIQEAKKYLPRCSEDTKLKWYLRASCYA  793



>ref|XP_001980849.1| GG16085 [Drosophila erecta]
 gb|EDV49807.1| GG16085 [Drosophila erecta]
Length=833

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPR  488
            W+ LEK +K K+ P+GY PFVE C++ ++  EA KYIP+  D R
Sbjct  734  WEELEKLAKSKKSPVGYDPFVEVCLKQDNASEARKYIPRCRDNR  777



>ref|XP_002020368.1| GL13948 [Drosophila persimilis]
 gb|EDW39180.1| GL13948 [Drosophila persimilis]
Length=832

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRE  485
            WD LEKFSK K+ PIGY+PFVE C++  +  EA KYIP+  + R+
Sbjct  732  WDELEKFSKSKKSPIGYEPFVEVCLKPGNAREARKYIPRCRENRK  776



>ref|XP_001357562.2| GA21090 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL26696.2| GA21090 [Drosophila pseudoobscura pseudoobscura]
Length=834

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRE  485
            WD LEKFSK K+ PIGY+PFVE C++  +  EA KYIP+  + R+
Sbjct  734  WDELEKFSKSKKSPIGYEPFVEVCLKPGNAREARKYIPRCRENRK  778



>emb|CDH59927.1| vacuolar protein sorting vps16 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=785

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +RDW+ LEK +K K  PIGY+PFVE C++A+   EA KYI K  D   R   +  IG
Sbjct  686  VRDWENLEKLAKTKNSPIGYEPFVEECIKAKQYQEASKYILK-CDTSVRPMLFVKIG  741



>gb|AAI26432.1| VPS16 protein, partial [Homo sapiens]
Length=315

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  213  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  268



>ref|XP_004687407.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Condylura cristata]
Length=694

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++A P ++ +A   +G
Sbjct  594  DWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVA-PEQKVKALLLVG  647



>ref|XP_002679841.1| predicted protein [Naegleria gruberi]
 gb|EFC47097.1| predicted protein [Naegleria gruberi]
Length=1043

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGI  461
            +W  LE F+  K+ PIGY PFVEAC+EA+   EALKYIP +     + E +  +
Sbjct  947  EWKKLETFATAKKSPIGYIPFVEACLEADRSDEALKYIPLIESLETKVEYWINL  1000



>gb|EAX10565.1| hCG2039972, isoform CRA_b [Homo sapiens]
Length=323

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  221  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  276



>ref|XP_004687406.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Condylura cristata]
Length=838

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++A P ++ +A   +G
Sbjct  738  DWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVA-PEQKVKALLLVG  791



>ref|XP_004433876.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 2 [Ceratotherium simum simum]
Length=695

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   IG
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYTSRVG-PEQKVKALLLIG  648



>gb|AAH12422.1| VPS16 protein, partial [Homo sapiens]
Length=415

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  313  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  368



>ref|XP_007636110.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Cricetulus griseus]
Length=778

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  +++ P ++ +A   +G
Sbjct  676  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVS-PEQKVKALLLVG  731



>ref|XP_008469959.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Diaphorina citri]
Length=542

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKL  500
            DW  L+KFSK K+ PIGY+PF++ C+E  +K EA KY+PK+
Sbjct  445  DWVGLDKFSKLKKSPIGYEPFIDVCLEFRNKFEAKKYLPKV  485



>ref|XP_004433875.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 1 [Ceratotherium simum simum]
Length=843

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   IG
Sbjct  741  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYTSRVG-PEQKVKALLLIG  796



>gb|AAH21291.2| VPS16 protein, partial [Homo sapiens]
Length=371

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  269  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  324



>ref|XP_002055907.1| GJ10645 [Drosophila virilis]
 gb|EDW59019.1| GJ10645 [Drosophila virilis]
Length=836

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRE  485
            +W  LE FSK K+ PIGY+PFVE C++ E+  EA KYI +  D R+
Sbjct  735  NWVELENFSKRKKSPIGYEPFVEVCLQQENTREARKYILRCPDKRK  780



>ref|XP_004611017.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Sorex araneus]
Length=695

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  +++ P ++ +A   +G
Sbjct  595  DWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYTSRVS-PEQKVKALLLVG  648



>ref|XP_003499087.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Cricetulus griseus]
 ref|XP_007636109.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Cricetulus griseus]
 gb|EGV92437.1| Vacuolar protein sorting-associated protein 16-like [Cricetulus 
griseus]
Length=839

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  +++ P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVS-PEQKVKALLLVG  792



>ref|XP_011173487.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Solenopsis invicta]
 gb|EFZ09129.1| hypothetical protein SINV_00468 [Solenopsis invicta]
Length=830

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  494
            W+ LEKFSK K+ PIGY+PF++ C++  +K EA KY+ K+ D
Sbjct  733  WNDLEKFSKSKKSPIGYEPFIDECLKYNEKLEARKYLAKVKD  774



>ref|XP_005604575.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Equus caballus]
Length=766

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  664  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYTSRVG-PEQKVKALLLVG  719



>gb|AAH25626.1| Vacuolar protein sorting 16 (yeast) [Mus musculus]
Length=839

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_004611016.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Sorex araneus]
Length=839

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  +++ P ++ +A   +G
Sbjct  739  DWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYTSRVS-PEQKVKALLLVG  792



>ref|XP_005062211.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Ficedula albicollis]
Length=857

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R  A+  +G
Sbjct  757  DWEEMEKFSKSKKSPIGYLPFVEVAVKHHNRYEAKKYAPRVP-PEQRVRAFVLVG  810



>dbj|BAB64892.1| Vps16 [Mus musculus]
Length=839

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_003941102.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Saimiri boliviensis boliviensis]
Length=839

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICIKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_011212493.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Bactrocera dorsalis]
Length=841

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRE  485
            WD LEKF+K K+ PIGY+PFVE C+   +  EA KYI K  D R+
Sbjct  741  WDDLEKFAKSKKSPIGYEPFVEVCIMQNNLHEARKYIIKCRDDRK  785



>gb|ELU17286.1| hypothetical protein CAPTEDRAFT_168734 [Capitella teleta]
Length=819

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            D+  LEKFSK K+ PIGY+PFVE C++  ++ EA KY+ +++ P  R + Y  +G
Sbjct  720  DFIELEKFSKSKKSPIGYEPFVEECMKQGNQTEAQKYLTRVS-PEHRVQCYVRVG  773



>gb|ERE69810.1| putative vacuolar protein sorting-associated protein 16 isoform 
1 [Cricetulus griseus]
Length=827

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  +++ P ++ +A   +G
Sbjct  725  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVS-PEQKVKALLLVG  780



>ref|XP_006500493.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Mus musculus]
Length=836

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  734  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  789



>ref|XP_002806793.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar protein sorting-associated 
protein 16 homolog [Callithrix jacchus]
Length=839

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICIKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>dbj|BAC33966.1| unnamed protein product [Mus musculus]
Length=839

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>ref|NP_085036.3| vacuolar protein sorting-associated protein 16 homolog [Mus musculus]
 gb|EDL28271.1| vacuolar protein sorting 16 (yeast) [Mus musculus]
Length=839

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_003774363.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Sarcophilus harrisii]
Length=862

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ LEKFSK K+ PIGY PFVE C++  +K EA K+  +++ P ++ +A+  IG
Sbjct  762  DWEELEKFSKSKKSPIGYLPFVEVCMKRHNKFEAKKFAARVS-PEQKVKAFLLIG  815



>sp|Q920Q4.3|VPS16_MOUSE RecName: Full=Vacuolar protein sorting-associated protein 16 
homolog; Short=mVPS16 [Mus musculus]
Length=839

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_004523432.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Ceratitis capitata]
Length=841

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRE  485
            WD LEKF+K K+ PIGY+PFVE C++  +  EA KYI K  D R+
Sbjct  741  WDDLEKFAKSKKSPIGYEPFVEVCLKQNNLHEARKYILKCRDDRK  785



>gb|AAH73959.1| VPS16 protein [Homo sapiens]
 gb|AIC60603.1| VPS16, partial [synthetic construct]
Length=524

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  422  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  477



>gb|EGU11808.1| Vacuolar assembling/sorting protein VPS16 [Rhodotorula glutinis 
ATCC 204091]
Length=956

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  449
            +RDWDAL+ F++ K+ PIGY+P+V+  + A    +A+KY+ K  D R R E Y   G   
Sbjct  856  LRDWDALDTFARSKKSPIGYEPWVDNLIRAGAHRQAVKYVEK-CDVRNRVELYVKCGEWV  914

Query  448  eaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRD  338
             A     +  +   L  LK     N  AA + + L+D
Sbjct  915  MAGQECVRRGESGRLHDLKARSPNNIIAAQLDELLQD  951



>gb|KFM68340.1| hypothetical protein X975_12661, partial [Stegodyphus mimosarum]
Length=827

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  494
            DW  LEKFS+ K+ PIGY+PFV+ CV+ ++  EA KY+PK+ +
Sbjct  744  DWLELEKFSRSKKSPIGYEPFVDVCVKHDNIYEAKKYLPKVKE  786



>ref|XP_008525819.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Equus przewalskii]
Length=825

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  723  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYTSRVG-PEQKVKALLLVG  778



>ref|XP_004930556.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Bombyx mori]
Length=827

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  494
            +W+ L+KFSK K+ P+GY+PFV+AC++     EALKY+P+  D
Sbjct  727  NWEELDKFSKSKKSPVGYEPFVDACLKYNKADEALKYLPRCRD  769



>ref|XP_001496814.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoformX1 [Equus caballus]
Length=839

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYTSRVG-PEQKVKALLLVG  792



>ref|NP_649877.1| vacuolar protein sorting 16A [Drosophila melanogaster]
 gb|AAF54353.1| vacuolar protein sorting 16A [Drosophila melanogaster]
 gb|AAL49233.1| RE66051p [Drosophila melanogaster]
 gb|ACL86909.1| Vps16A-PA, partial [synthetic construct]
Length=833

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPR  488
            W+ LEK +K K+ PIGY PFVE C++ ++  EA KYIP+  D R
Sbjct  734  WEELEKLAKSKKSPIGYDPFVEVCLKQDNVMEARKYIPRCRDNR  777



>gb|EHB04285.1| Vacuolar protein sorting-associated protein 16-like protein [Heterocephalus 
glaber]
Length=666

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  564  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  619



>gb|KFO20539.1| Vacuolar protein sorting-associated protein 16 like protein [Fukomys 
damarensis]
Length=686

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  584  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  639



>ref|XP_001660915.1| AAEL010559-PA [Aedes aegypti]
 gb|EAT37446.1| AAEL010559-PA [Aedes aegypti]
Length=841

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  494
            WD LEKF+K K+ PIGY+PFVE C++  +  +A KY+P+ ++
Sbjct  743  WDELEKFAKSKKSPIGYEPFVEVCLKQSNLEQAKKYLPRCSE  784



>emb|CAD39063.1| hypothetical protein [Homo sapiens]
Length=694

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  592  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  647



>ref|XP_006207386.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Vicugna pacos]
Length=695

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_008852713.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Nannospalax galili]
Length=839

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_005365673.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Microtus ochrogaster]
Length=695

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_005320597.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Ictidomys tridecemlineatus]
Length=695

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_005365672.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Microtus ochrogaster]
Length=839

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_003639899.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 2 [Canis lupus familiaris]
Length=695

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_003134377.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoformX2 [Sus scrofa]
Length=695

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_005068684.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Mesocricetus auratus]
Length=695

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_011056171.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Acromyrmex echinatior]
 gb|EGI64462.1| Vacuolar protein sorting-associated protein 16-like protein [Acromyrmex 
echinatior]
Length=830

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  494
            W+ LEKFSK K+ PIGY+PF++ C++  +K EA KY+ K+ D
Sbjct  733  WNDLEKFSKSKKSPIGYEPFIDECLKYNEKLEARKYLVKVKD  774



>ref|XP_006894253.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Elephantulus edwardii]
Length=695

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_004886773.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X5 [Heterocephalus glaber]
 ref|XP_004840740.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X5 [Heterocephalus glaber]
Length=695

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_006187202.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Camelus ferus]
Length=833

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  731  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  786



>ref|XP_006758181.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Myotis davidii]
Length=836

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  734  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  789



>ref|XP_005380824.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Chinchilla lanigera]
Length=695

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_005874819.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Myotis brandtii]
Length=836

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  734  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  789



>ref|XP_004886769.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Heterocephalus glaber]
 ref|XP_004840736.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Heterocephalus glaber]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_008017290.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Chlorocebus sabaeus]
Length=787

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  685  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  740



>ref|XP_005068683.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Mesocricetus auratus]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_006164053.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Tupaia chinensis]
Length=851

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  749  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  804



>ref|XP_004772965.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Mustela putorius furo]
 ref|XP_004792317.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Mustela putorius furo]
Length=695

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_004634302.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Octodon degus]
Length=695

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_009214732.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Papio anubis]
Length=787

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  685  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  740



>ref|XP_010971081.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Camelus bactrianus]
 ref|XP_010986579.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Camelus dromedarius]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_003639898.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 1 [Canis lupus familiaris]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_003134376.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoformX1 [Sus scrofa]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>gb|EPQ13004.1| Vacuolar protein sorting-associated protein 16 like protein [Myotis 
brandtii]
Length=815

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  713  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  768



>ref|XP_011367811.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Pteropus vampyrus]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_002710925.2| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Oryctolagus cuniculus]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_004634301.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Octodon degus]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_004398209.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 2 [Odobenus rosmarus divergens]
Length=695

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_007195890.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X5 [Balaenoptera acutorostrata scammoni]
Length=729

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  627  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  682



>ref|XP_010609327.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Fukomys damarensis]
Length=838

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  736  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  791



>gb|ELK34510.1| Vacuolar protein sorting-associated protein 16 like protein [Myotis 
davidii]
Length=838

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  736  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  791



>ref|XP_006207385.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Vicugna pacos]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_798591.3| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Strongylocentrotus purpuratus]
Length=887

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            +W  LE+F+K K+ PIGY+PFVE C++  +K EA KY  K+A P  R + Y  +G
Sbjct  789  EWIELERFAKSKKSPIGYEPFVELCMKHHNKYEANKYAAKVA-PEHRVKMYIRMG  842



>ref|XP_008568870.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X3 [Galeopterus variegatus]
Length=799

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_008568868.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Galeopterus variegatus]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_005320596.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Ictidomys tridecemlineatus]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_008139241.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Eptesicus fuscus]
Length=695

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_006732343.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Leptonychotes weddellii]
Length=695

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_007073325.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Panthera tigris altaica]
Length=834

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  732  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  787



>ref|XP_006894252.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Elephantulus edwardii]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_008568869.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Galeopterus variegatus]
Length=799

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_011279227.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Felis catus]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_010377297.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Rhinopithecus roxellana]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_006984591.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Peromyscus maniculatus bairdii]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_007958199.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Orycteropus afer afer]
Length=695

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_010609328.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Fukomys damarensis]
Length=794

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  692  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  747



>ref|XP_008495020.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Calypte anna]
Length=799

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -2

Query  622  DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            DW+ +EKFS+ K+ PIGY PFVE  V+  ++ EA KY P++  P +R  A+  +G
Sbjct  699  DWEEMEKFSRSKKSPIGYWPFVEISVKHHNRYEAKKYAPRVP-PEQRVRAFVLVG  752



>ref|XP_004383068.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 3 [Trichechus manatus latirostris]
Length=695

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_003788109.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 2 [Otolemur garnettii]
Length=695

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  593  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_011251370.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Camponotus floridanus]
 gb|EFN71766.1| Vacuolar protein sorting-associated protein 16-like protein [Camponotus 
floridanus]
Length=832

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  619  WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  494
            W+ LEKFSK K+ PIGY+PF++ C++  +K EA KY+ K+ D
Sbjct  735  WNDLEKFSKTKKSPIGYEPFIDECLKYNEKLEARKYLMKIKD  776



>ref|XP_007958197.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Orycteropus afer afer]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_005380823.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Chinchilla lanigera]
Length=839

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  628  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  458
            + DW+ LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  737  LEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250