BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF041G05

Length=687
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610927.1|  PREDICTED: endoglucanase 2-like                    291   5e-92   Nicotiana tomentosiformis
ref|XP_009783020.1|  PREDICTED: endoglucanase 2                         289   5e-91   Nicotiana sylvestris
ref|XP_011074667.1|  PREDICTED: endoglucanase 10-like                   286   8e-90   Sesamum indicum [beniseed]
emb|CDP07412.1|  unnamed protein product                                283   9e-89   Coffea canephora [robusta coffee]
gb|KHF97947.1|  hypothetical protein F383_10892                         281   8e-88   Gossypium arboreum [tree cotton]
ref|XP_006342034.1|  PREDICTED: endoglucanase 10-like                   280   1e-87   Solanum tuberosum [potatoes]
gb|AID55377.1|  glycoside hydrolase family 9 B5                         280   2e-87   Gossypium hirsutum [American cotton]
ref|XP_010667385.1|  PREDICTED: endoglucanase 2-like                    279   3e-87   Beta vulgaris subsp. vulgaris [field beet]
gb|ADU15552.1|  EG                                                      280   3e-87   Gossypium hirsutum [American cotton]
ref|XP_010061046.1|  PREDICTED: endoglucanase 10-like                   280   3e-87   Eucalyptus grandis [rose gum]
gb|KJB58121.1|  hypothetical protein B456_009G195400                    275   4e-87   Gossypium raimondii
gb|EYU36779.1|  hypothetical protein MIMGU_mgv1a004472mg                278   5e-87   Erythranthe guttata [common monkey flower]
gb|KJB58119.1|  hypothetical protein B456_009G195400                    275   1e-86   Gossypium raimondii
ref|XP_004238345.1|  PREDICTED: endoglucanase 2-like                    275   1e-85   Solanum lycopersicum
ref|XP_006435157.1|  hypothetical protein CICLE_v10000849mg             275   1e-85   Citrus clementina [clementine]
ref|XP_006473639.1|  PREDICTED: endoglucanase 10-like                   275   1e-85   Citrus sinensis [apfelsine]
gb|KDO84820.1|  hypothetical protein CISIN_1g009846mg                   275   1e-85   Citrus sinensis [apfelsine]
gb|KJB58118.1|  hypothetical protein B456_009G195400                    275   2e-85   Gossypium raimondii
gb|KJB58120.1|  hypothetical protein B456_009G195400                    274   2e-85   Gossypium raimondii
ref|XP_010104437.1|  Endoglucanase 24                                   273   5e-85   Morus notabilis
ref|XP_007017776.1|  EG isoform 2                                       273   6e-85   Theobroma cacao [chocolate]
ref|XP_002510516.1|  endo-1,4-beta-glucanase, putative                  273   8e-85   Ricinus communis
ref|XP_007017775.1|  EG isoform 1                                       273   9e-85   
ref|XP_010244092.1|  PREDICTED: endoglucanase 24-like                   272   2e-84   Nelumbo nucifera [Indian lotus]
ref|XP_002276739.1|  PREDICTED: endoglucanase 10                        270   1e-83   Vitis vinifera
ref|XP_004136389.1|  PREDICTED: endoglucanase 2-like                    270   1e-83   Cucumis sativus [cucumbers]
ref|XP_008466493.1|  PREDICTED: endoglucanase 10                        270   1e-83   Cucumis melo [Oriental melon]
ref|XP_002300715.1|  glycosyl hydrolase family 9 family protein         268   7e-83   Populus trichocarpa [western balsam poplar]
ref|XP_011045112.1|  PREDICTED: endoglucanase 2                         268   7e-83   Populus euphratica
gb|KDP36939.1|  hypothetical protein JCGZ_08230                         268   8e-83   Jatropha curcas
ref|XP_003527686.1|  PREDICTED: endoglucanase 10-like                   268   1e-82   Glycine max [soybeans]
dbj|BAF42037.1|  cellulase2                                             266   3e-82   Pyrus communis
ref|XP_007136082.1|  hypothetical protein PHAVU_009G016100g             265   8e-82   Phaseolus vulgaris [French bean]
gb|EYU38839.1|  hypothetical protein MIMGU_mgv1a004578mg                265   9e-82   Erythranthe guttata [common monkey flower]
ref|XP_011028991.1|  PREDICTED: endoglucanase 2-like                    265   1e-81   Populus euphratica
ref|XP_008364934.1|  PREDICTED: endoglucanase 10-like                   265   1e-81   
ref|XP_003523541.1|  PREDICTED: endoglucanase 10                        265   2e-81   Glycine max [soybeans]
gb|KHN45917.1|  Endoglucanase 2                                         265   5e-81   Glycine soja [wild soybean]
ref|XP_004500948.1|  PREDICTED: endoglucanase 10-like                   263   7e-81   Cicer arietinum [garbanzo]
ref|XP_002307711.1|  glycosyl hydrolase family 9 family protein         262   1e-80   Populus trichocarpa [western balsam poplar]
gb|AFZ78647.1|  korrigan                                                262   2e-80   Populus tomentosa [Chinese white poplar]
gb|AGV22125.1|  endo-1,4-beta-glucanase 3                               261   2e-80   Betula luminifera [liang ye hua]
ref|XP_010536354.1|  PREDICTED: endoglucanase 10-like                   261   3e-80   Tarenaya hassleriana [spider flower]
gb|KJB14408.1|  hypothetical protein B456_002G123700                    260   7e-80   Gossypium raimondii
ref|XP_008241905.1|  PREDICTED: endoglucanase 24-like                   260   9e-80   Prunus mume [ume]
ref|XP_009378180.1|  PREDICTED: endoglucanase 2-like                    259   1e-79   Pyrus x bretschneideri [bai li]
ref|XP_006840111.1|  hypothetical protein AMTR_s00224p00023160          250   2e-79   
gb|EPS64495.1|  hypothetical protein M569_10284                         258   3e-79   Genlisea aurea
ref|XP_008372790.1|  PREDICTED: endoglucanase 24-like                   258   7e-79   
ref|XP_009335173.1|  PREDICTED: endoglucanase 2-like                    258   7e-79   
ref|XP_008387935.1|  PREDICTED: endoglucanase 2                         256   3e-78   Malus domestica [apple tree]
gb|AES73992.2|  glycosyl hydrolase family 9 protein                     254   2e-77   Medicago truncatula
ref|XP_004291374.1|  PREDICTED: endoglucanase 10-like                   254   2e-77   Fragaria vesca subsp. vesca
ref|XP_003603741.1|  Endoglucanase                                      254   2e-77   
ref|XP_008221286.1|  PREDICTED: endoglucanase 10-like                   253   4e-77   Prunus mume [ume]
ref|XP_010539853.1|  PREDICTED: endoglucanase 10                        252   8e-77   Tarenaya hassleriana [spider flower]
ref|XP_010477219.1|  PREDICTED: endoglucanase 2-like                    252   1e-76   Camelina sativa [gold-of-pleasure]
ref|XP_009398708.1|  PREDICTED: endoglucanase 24-like                   251   1e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010501531.1|  PREDICTED: endoglucanase 2                         251   3e-76   
ref|XP_011100152.1|  PREDICTED: endoglucanase 24-like                   251   3e-76   
ref|XP_010941260.1|  PREDICTED: endoglucanase 24-like                   251   3e-76   Elaeis guineensis
ref|XP_009386441.1|  PREDICTED: endoglucanase 24-like                   251   3e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN00484.1|  Endoglucanase 24                                        250   4e-76   Glycine soja [wild soybean]
ref|XP_010029690.1|  PREDICTED: endoglucanase 2-like                    250   5e-76   Eucalyptus grandis [rose gum]
gb|KCW56649.1|  hypothetical protein EUGRSUZ_I02356                     250   5e-76   Eucalyptus grandis [rose gum]
ref|XP_003519870.1|  PREDICTED: endoglucanase 24-like                   250   7e-76   Glycine max [soybeans]
ref|XP_009103373.1|  PREDICTED: endoglucanase 2                         249   1e-75   Brassica rapa
emb|CDY66396.1|  BnaAnng22170D                                          249   1e-75   Brassica napus [oilseed rape]
emb|CDY43425.1|  BnaC07g14920D                                          249   1e-75   Brassica napus [oilseed rape]
ref|XP_007046716.1|  EG                                                 248   2e-75   
gb|KJB63540.1|  hypothetical protein B456_010G005200                    247   8e-75   Gossypium raimondii
gb|AID55379.1|  glycoside hydrolase family 9 B7                         247   9e-75   Gossypium hirsutum [American cotton]
gb|KDO78852.1|  hypothetical protein CISIN_1g048736mg                   247   1e-74   Citrus sinensis [apfelsine]
ref|XP_006426144.1|  hypothetical protein CICLE_v10025306mg             247   1e-74   
ref|NP_173423.1|  glycosyl hydrolase 9B5                                246   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935039.1|  PREDICTED: endoglucanase 24-like                   246   1e-74   Elaeis guineensis
ref|XP_008799407.1|  PREDICTED: endoglucanase 24-like                   246   1e-74   Phoenix dactylifera
ref|XP_006435158.1|  hypothetical protein CICLE_v10003402mg             245   2e-74   
ref|XP_003629333.1|  Endoglucanase                                      246   2e-74   Medicago truncatula
ref|XP_010649048.1|  PREDICTED: endoglucanase 24-like                   245   3e-74   Vitis vinifera
gb|KDO84821.1|  hypothetical protein CISIN_1g036398mg                   245   4e-74   Citrus sinensis [apfelsine]
ref|XP_006466419.1|  PREDICTED: endoglucanase 2-like                    246   5e-74   Citrus sinensis [apfelsine]
ref|XP_009149490.1|  PREDICTED: endoglucanase 2                         244   6e-74   Brassica rapa
ref|XP_010459672.1|  PREDICTED: endoglucanase 2                         244   7e-74   Camelina sativa [gold-of-pleasure]
ref|XP_011462352.1|  PREDICTED: endoglucanase 2-like                    244   7e-74   Fragaria vesca subsp. vesca
ref|XP_006307252.1|  hypothetical protein CARUB_v10008868mg             244   1e-73   Capsella rubella
ref|XP_007156152.1|  hypothetical protein PHAVU_003G262600g             244   1e-73   Phaseolus vulgaris [French bean]
emb|CDY29381.1|  BnaA06g14150D                                          244   1e-73   Brassica napus [oilseed rape]
ref|XP_006416450.1|  hypothetical protein EUTSA_v10007364mg             243   2e-73   Eutrema salsugineum [saltwater cress]
ref|XP_008788648.1|  PREDICTED: endoglucanase 24                        243   4e-73   Phoenix dactylifera
gb|KFK44119.1|  hypothetical protein AALP_AA1G218000                    243   4e-73   Arabis alpina [alpine rockcress]
ref|XP_011083520.1|  PREDICTED: endoglucanase 10                        242   5e-73   Sesamum indicum [beniseed]
ref|XP_002893081.1|  glycosyl hydrolase family 9 protein                242   5e-73   Arabidopsis lyrata subsp. lyrata
ref|XP_011043209.1|  PREDICTED: endoglucanase 2-like                    242   6e-73   Populus euphratica
ref|XP_004509346.1|  PREDICTED: endoglucanase 10-like                   242   7e-73   Cicer arietinum [garbanzo]
ref|XP_002462729.1|  hypothetical protein SORBIDRAFT_02g030990          237   7e-71   Sorghum bicolor [broomcorn]
ref|XP_010113364.1|  Endoglucanase 24                                   237   8e-71   
gb|KJB43353.1|  hypothetical protein B456_007G195700                    236   8e-71   Gossypium raimondii
ref|XP_006340729.1|  PREDICTED: endoglucanase 2-like                    236   1e-70   Solanum tuberosum [potatoes]
gb|EEC84946.1|  hypothetical protein OsI_32163                          236   1e-70   Oryza sativa Indica Group [Indian rice]
ref|NP_001063771.1|  Os09g0533900                                       236   1e-70   
gb|EEE70113.1|  hypothetical protein OsJ_30126                          236   1e-70   Oryza sativa Japonica Group [Japonica rice]
emb|CDY44194.1|  BnaC05g15510D                                          243   2e-70   Brassica napus [oilseed rape]
gb|AEO97190.1|  endo-1,4-beta-glucanase                                 235   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_006383120.1|  hypothetical protein POPTR_0005s11750g             235   3e-70   
gb|KDP46724.1|  hypothetical protein JCGZ_06512                         235   4e-70   Jatropha curcas
ref|NP_001145749.1|  hypothetical protein                               234   8e-70   Zea mays [maize]
ref|XP_006661478.1|  PREDICTED: endoglucanase 24-like                   232   3e-69   
gb|AFZ78646.1|  korrigan                                                232   6e-69   Populus tomentosa [Chinese white poplar]
ref|XP_004232483.1|  PREDICTED: endoglucanase 2-like                    230   2e-68   Solanum lycopersicum
ref|XP_004957464.1|  PREDICTED: endoglucanase 24-like                   230   2e-68   Setaria italica
gb|EMT32027.1|  Endoglucanase 24                                        228   1e-67   
ref|XP_009624009.1|  PREDICTED: endoglucanase 2-like                    228   1e-67   Nicotiana tomentosiformis
dbj|BAJ93299.1|  predicted protein                                      228   1e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003578508.1|  PREDICTED: endoglucanase 24                        227   5e-67   Brachypodium distachyon [annual false brome]
gb|EAZ38281.1|  hypothetical protein OsJ_22659                          226   5e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003563568.1|  PREDICTED: endoglucanase 18-like                   226   5e-67   Brachypodium distachyon [annual false brome]
ref|XP_009128120.1|  PREDICTED: endoglucanase 10                        226   7e-67   Brassica rapa
ref|XP_006390284.1|  hypothetical protein EUTSA_v10018397mg             226   8e-67   Eutrema salsugineum [saltwater cress]
ref|NP_001058583.1|  Os06g0715300                                       226   9e-67   
gb|EAZ02358.1|  hypothetical protein OsI_24462                          226   1e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_010416457.1|  PREDICTED: endoglucanase 10-like                   225   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_009803640.1|  PREDICTED: endoglucanase 2-like                    225   3e-66   Nicotiana sylvestris
gb|ABK24648.1|  unknown                                                 224   4e-66   Picea sitchensis
ref|XP_006302134.1|  hypothetical protein CARUB_v10020139mg             224   4e-66   Capsella rubella
ref|XP_010471690.1|  PREDICTED: endoglucanase 10                        224   5e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010428595.1|  PREDICTED: endoglucanase 10-like                   224   5e-66   Camelina sativa [gold-of-pleasure]
emb|CDY39048.1|  BnaA02g17370D                                          223   9e-66   Brassica napus [oilseed rape]
ref|NP_177697.1|  glycosyl hydrolase 9B7                                223   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889037.1|  hypothetical protein ARALYDRAFT_895440             223   1e-65   Arabidopsis lyrata subsp. lyrata
gb|AAM63477.1|  endo-beta-1,4-glucanase, putative                       223   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530451.1|  PREDICTED: endoglucanase 2-like                    222   1e-65   
dbj|BAK04397.1|  predicted protein                                      221   4e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006656489.1|  PREDICTED: endoglucanase 18-like                   220   1e-64   Oryza brachyantha
gb|EMS54236.1|  Endoglucanase 18                                        219   2e-64   Triticum urartu
ref|XP_002530743.1|  endo-1,4-beta-glucanase, putative                  216   4e-64   
emb|CDP04111.1|  unnamed protein product                                206   2e-63   Coffea canephora [robusta coffee]
ref|XP_002439027.1|  hypothetical protein SORBIDRAFT_10g030140          217   2e-63   Sorghum bicolor [broomcorn]
ref|XP_004966453.1|  PREDICTED: endoglucanase 18-like                   216   5e-63   Setaria italica
ref|NP_001066668.2|  Os12g0428200                                       214   1e-62   
emb|CDY47506.1|  BnaAnng09040D                                          213   6e-62   Brassica napus [oilseed rape]
gb|ABA97969.1|  Glycosyl hydrolase family 9 protein, expressed          213   1e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009106216.1|  PREDICTED: endoglucanase 10-like                   209   1e-60   Brassica rapa
ref|NP_001288527.1|  uncharacterized protein LOC103626453 precursor     209   3e-60   Zea mays [maize]
emb|CDX73186.1|  BnaC06g36340D                                          208   5e-60   
gb|EAZ20312.1|  hypothetical protein OsJ_35923                          203   2e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002961546.1|  hypothetical protein SELMODRAFT_77612              205   1e-58   
ref|XP_002971269.1|  hypothetical protein SELMODRAFT_94888              205   1e-58   
ref|XP_001763275.1|  predicted protein                                  187   1e-52   
ref|XP_001781646.1|  predicted protein                                  185   1e-51   
ref|XP_002966695.1|  hypothetical protein SELMODRAFT_144066             181   3e-50   
ref|XP_002978046.1|  hypothetical protein SELMODRAFT_417952             181   1e-49   Selaginella moellendorffii
gb|KHN34290.1|  Endoglucanase 24                                        177   2e-48   Glycine soja [wild soybean]
gb|EPS65630.1|  hypothetical protein M569_09145                         160   3e-42   Genlisea aurea
gb|AFN16945.1|  cellulase-like protein                                  145   2e-40   Panicum virgatum
gb|AFN16938.1|  cellulase-like protein                                  145   3e-40   Panicum virgatum
gb|AFN16911.1|  cellulase-like protein                                  144   5e-40   Panicum racemosum
gb|AFN16859.1|  cellulase-like protein                                  144   5e-40   Panicum amarum [bitter panic grass]
gb|AFN16906.1|  cellulase-like protein                                  144   6e-40   Panicum mystasipum
gb|AFN16888.1|  cellulase-like protein                                  144   6e-40   Panicum chloroleucum
gb|AFN16885.1|  cellulase-like protein                                  144   6e-40   Panicum chloroleucum
gb|AFN16884.1|  cellulase-like protein                                  143   1e-39   Panicum cervicatum
ref|XP_006847867.1|  hypothetical protein AMTR_s00029p00087270          153   2e-39   
ref|XP_010058568.1|  PREDICTED: endoglucanase 14-like                   152   2e-39   Eucalyptus grandis [rose gum]
gb|KCW73256.1|  hypothetical protein EUGRSUZ_E01717                     152   2e-39   Eucalyptus grandis [rose gum]
gb|AFN16894.1|  cellulase-like protein                                  143   2e-39   Panicum chloroleucum
ref|XP_003519454.1|  PREDICTED: endoglucanase 11                        152   2e-39   
gb|AFN16886.1|  cellulase-like protein                                  142   2e-39   Panicum chloroleucum
gb|KHN38485.1|  Endoglucanase 11                                        152   3e-39   Glycine soja [wild soybean]
gb|AFN16879.1|  cellulase-like protein                                  142   3e-39   Panicum aquaticum
gb|AFN16877.1|  cellulase-like protein                                  142   3e-39   Panicum amarum var. amarulum [coastal panic grass]
gb|AFN16922.1|  cellulase-like protein                                  142   4e-39   Panicum stramineum
ref|XP_010264780.1|  PREDICTED: endoglucanase 12-like                   152   4e-39   Nelumbo nucifera [Indian lotus]
ref|XP_003616918.1|  Endoglucanase                                      152   4e-39   Medicago truncatula
gb|AFK38997.1|  unknown                                                 151   4e-39   Medicago truncatula
gb|AFN16946.1|  cellulase-like protein                                  142   5e-39   Panicum virgatum
ref|XP_010666165.1|  PREDICTED: endoglucanase 14-like                   151   6e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|AFN16920.1|  cellulase-like protein                                  142   6e-39   Setaria palmifolia [highland pitpit]
gb|AFN16904.1|  cellulase-like protein                                  141   7e-39   Panicum miliaceum [broom millet]
gb|AFN16944.1|  cellulase-like protein                                  141   7e-39   Panicum virgatum
gb|AFN16891.1|  cellulase-like protein                                  141   7e-39   Panicum chloroleucum
gb|AFN16881.1|  cellulase-like protein                                  141   8e-39   Panicum bergii
gb|AFN16880.1|  cellulase-like protein                                  141   9e-39   Panicum aquaticum
gb|EYU29517.1|  hypothetical protein MIMGU_mgv1a003302mg                151   9e-39   Erythranthe guttata [common monkey flower]
ref|XP_011047209.1|  PREDICTED: endoglucanase 11-like                   150   1e-38   Populus euphratica
gb|AFN16917.1|  cellulase-like protein                                  140   1e-38   Panicum racemosum
gb|AFN16932.1|  cellulase-like protein                                  140   1e-38   Urochloa plantaginea
ref|XP_010252537.1|  PREDICTED: endoglucanase 11-like                   150   2e-38   Nelumbo nucifera [Indian lotus]
ref|XP_007215908.1|  hypothetical protein PRUPE_ppa004172mg             150   2e-38   Prunus persica
gb|EYU26799.1|  hypothetical protein MIMGU_mgv1a020424mg                149   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_008230008.1|  PREDICTED: endoglucanase 11                        149   3e-38   Prunus mume [ume]
gb|KJB13746.1|  hypothetical protein B456_002G092400                    149   3e-38   Gossypium raimondii
gb|KHM99090.1|  Endoglucanase 11                                        149   3e-38   Glycine soja [wild soybean]
gb|AID55385.1|  glycoside hydrolase family 9 B8                         149   4e-38   Gossypium hirsutum [American cotton]
ref|XP_010110634.1|  Endoglucanase 11                                   149   4e-38   
gb|KJB13747.1|  hypothetical protein B456_002G092400                    149   4e-38   Gossypium raimondii
ref|XP_008385953.1|  PREDICTED: endoglucanase 11-like                   145   4e-38   
gb|AFN16900.1|  cellulase-like protein                                  139   5e-38   Panicum elephantipes
ref|XP_004304093.1|  PREDICTED: endoglucanase 11                        149   5e-38   Fragaria vesca subsp. vesca
gb|EAY82930.1|  hypothetical protein OsI_38148                          146   5e-38   Oryza sativa Indica Group [Indian rice]
gb|AFN16943.1|  cellulase-like protein                                  139   6e-38   Panicum virgatum
ref|XP_009334150.1|  PREDICTED: endoglucanase 11-like                   148   6e-38   Pyrus x bretschneideri [bai li]
gb|KDP39180.1|  hypothetical protein JCGZ_00937                         148   7e-38   Jatropha curcas
gb|EYU26800.1|  hypothetical protein MIMGU_mgv1a019325mg                148   7e-38   Erythranthe guttata [common monkey flower]
gb|AFN16902.1|  cellulase-like protein                                  139   8e-38   Panicum gouinii
gb|KDP30800.1|  hypothetical protein JCGZ_13743                         148   8e-38   Jatropha curcas
ref|XP_010688721.1|  PREDICTED: endoglucanase 5                         149   9e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002529469.1|  endo-1,4-beta-glucanase, putative                  147   1e-37   
ref|XP_011046752.1|  PREDICTED: endoglucanase 11-like                   147   1e-37   Populus euphratica
ref|NP_001142480.1|  uncharacterized protein LOC100274698               141   1e-37   
ref|XP_009804981.1|  PREDICTED: endoglucanase 5                         148   1e-37   Nicotiana sylvestris
ref|XP_002321149.2|  hypothetical protein POPTR_0014s15590g             147   1e-37   Populus trichocarpa [western balsam poplar]
gb|AFZ78643.1|  korrigan                                                147   2e-37   Populus tomentosa [Chinese white poplar]
gb|AEO97204.1|  endo-1,4-beta-glucanase                                 147   2e-37   Populus trichocarpa [western balsam poplar]
ref|XP_008460200.1|  PREDICTED: endoglucanase 13-like                   147   2e-37   Cucumis melo [Oriental melon]
emb|CAF18445.1|  endo-1,4-beta-D-glucanase KORRIGAN                     142   2e-37   Pisum sativum [garden pea]
ref|XP_003617621.1|  Endoglucanase                                      147   2e-37   
gb|AET00580.2|  glycosyl hydrolase family 9 protein                     147   2e-37   Medicago truncatula
ref|XP_011072104.1|  PREDICTED: endoglucanase 5-like                    147   2e-37   
gb|AFZ78645.1|  korrigan                                                147   2e-37   Populus tomentosa [Chinese white poplar]
ref|XP_002300328.1|  hypothetical protein POPTR_0001s36600g             147   3e-37   
ref|XP_008366459.1|  PREDICTED: endoglucanase 11-like                   144   3e-37   
gb|ABF98747.1|  endo-1,4-beta-glucanase Cel1, putative, expressed       146   3e-37   Oryza sativa Japonica Group [Japonica rice]
gb|AFW74700.1|  hypothetical protein ZEAMMB73_090741                    145   3e-37   
ref|NP_001051192.1|  Os03g0736300                                       147   3e-37   
gb|KHN38252.1|  Endoglucanase 11                                        146   4e-37   Glycine soja [wild soybean]
gb|AEO97205.1|  endo-1,4-beta-glucanase                                 146   4e-37   Populus trichocarpa [western balsam poplar]
ref|XP_007212600.1|  hypothetical protein PRUPE_ppa016852mg             146   4e-37   Prunus persica
ref|XP_003518530.1|  PREDICTED: endoglucanase 11-like                   146   4e-37   Glycine max [soybeans]
ref|XP_006596588.1|  PREDICTED: endoglucanase 11-like                   146   4e-37   
ref|XP_010457267.1|  PREDICTED: endoglucanase 1-like                    138   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002277177.2|  PREDICTED: LOW QUALITY PROTEIN: endoglucanase 5    146   5e-37   
ref|XP_003579470.1|  PREDICTED: endoglucanase 13                        146   5e-37   
emb|CBI27137.3|  unnamed protein product                                146   5e-37   Vitis vinifera
gb|AGG19097.1|  cellulase                                               144   5e-37   Zea mays [maize]
ref|XP_004491112.1|  PREDICTED: endoglucanase 11-like                   145   6e-37   Cicer arietinum [garbanzo]
ref|XP_008364782.1|  PREDICTED: endoglucanase 11-like                   145   6e-37   
ref|XP_009351718.1|  PREDICTED: endoglucanase 5                         146   7e-37   Pyrus x bretschneideri [bai li]
gb|KHG28140.1|  hypothetical protein F383_15365                         145   7e-37   Gossypium arboreum [tree cotton]
gb|KDP25211.1|  hypothetical protein JCGZ_20367                         145   7e-37   Jatropha curcas
ref|XP_008342129.1|  PREDICTED: endoglucanase 11-like                   145   8e-37   
ref|XP_008379665.1|  PREDICTED: endoglucanase 11-like isoform X1        145   8e-37   Malus domestica [apple tree]
ref|XP_008227038.1|  PREDICTED: endoglucanase 11-like                   145   9e-37   Prunus mume [ume]
ref|XP_008437388.1|  PREDICTED: endoglucanase 6-like isoform X1         145   9e-37   Cucumis melo [Oriental melon]
ref|XP_009365103.1|  PREDICTED: endoglucanase 11 isoform X1             145   9e-37   Pyrus x bretschneideri [bai li]
gb|AID55384.1|  glycoside hydrolase family 9 B11                        145   9e-37   Gossypium hirsutum [American cotton]
ref|XP_004491466.1|  PREDICTED: endoglucanase 11-like                   145   1e-36   Cicer arietinum [garbanzo]
ref|XP_007043305.1|  Glycosyl hydrolase 9C1 isoform 1                   145   1e-36   
ref|XP_007043306.1|  Glycosyl hydrolase 9C1 isoform 2                   145   1e-36   
ref|XP_007142327.1|  hypothetical protein PHAVU_008G270900g             145   1e-36   Phaseolus vulgaris [French bean]
ref|XP_008650181.1|  PREDICTED: endoglucanase 14-like                   144   1e-36   
ref|XP_004149748.1|  PREDICTED: endoglucanase 6-like                    145   1e-36   Cucumis sativus [cucumbers]
ref|XP_004301501.1|  PREDICTED: endoglucanase 5                         145   1e-36   Fragaria vesca subsp. vesca
ref|XP_009405235.1|  PREDICTED: endoglucanase 13-like                   144   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009618623.1|  PREDICTED: endoglucanase 5                         145   1e-36   Nicotiana tomentosiformis
ref|XP_010682188.1|  PREDICTED: endoglucanase 25                        145   2e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008801082.1|  PREDICTED: endoglucanase 12-like                   145   2e-36   Phoenix dactylifera
ref|XP_004143869.1|  PREDICTED: endoglucanase 6-like                    145   2e-36   Cucumis sativus [cucumbers]
ref|XP_009376856.1|  PREDICTED: endoglucanase 14-like                   144   2e-36   
ref|XP_008805594.1|  PREDICTED: endoglucanase 11-like                   143   2e-36   
ref|XP_011085126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    144   2e-36   Sesamum indicum [beniseed]
ref|XP_003607242.1|  Glycosyl hydrolase family                          145   2e-36   
ref|XP_011087276.1|  PREDICTED: endoglucanase 5-like                    144   2e-36   Sesamum indicum [beniseed]
gb|AES89439.2|  endo-1,4-beta-glucanase                                 144   2e-36   Medicago truncatula
gb|ADQ73896.1|  endo-1,4-beta-glucanase                                 141   2e-36   Avena strigosa
ref|XP_007226370.1|  hypothetical protein PRUPE_ppa022524mg             144   2e-36   
emb|CBG76271.1|  OO_Ba0005L10-OO_Ba0081K17.22                           144   2e-36   Oryza officinalis
ref|XP_006452448.1|  hypothetical protein CICLE_v10007984mg             144   2e-36   Citrus clementina [clementine]
ref|XP_008366122.1|  PREDICTED: endoglucanase 14-like                   144   2e-36   
ref|XP_006843615.1|  hypothetical protein AMTR_s00007p00145080          138   2e-36   
ref|XP_002977531.1|  hypothetical protein SELMODRAFT_417347             143   2e-36   
ref|XP_006837249.1|  hypothetical protein AMTR_s00112p00047400          144   3e-36   Amborella trichopoda
ref|XP_008340449.1|  PREDICTED: endoglucanase 5                         144   3e-36   Malus domestica [apple tree]
ref|XP_009802592.1|  PREDICTED: endoglucanase 11-like                   144   3e-36   Nicotiana sylvestris
ref|XP_008805729.1|  PREDICTED: endoglucanase 13                        144   3e-36   
ref|XP_004981854.1|  PREDICTED: endoglucanase 10-like                   144   3e-36   Setaria italica
ref|XP_002271094.2|  PREDICTED: endoglucanase 11                        143   4e-36   Vitis vinifera
gb|AFK45497.1|  unknown                                                 144   4e-36   Lotus japonicus
ref|XP_004168441.1|  PREDICTED: endoglucanase 13-like                   143   4e-36   
ref|XP_007020721.1|  Glycosyl hydrolase 9B8                             143   4e-36   
gb|KJB08652.1|  hypothetical protein B456_001G095700                    143   5e-36   
ref|XP_003601390.1|  Endoglucanase                                      143   5e-36   
ref|XP_010531476.1|  PREDICTED: endoglucanase 23-like                   143   5e-36   
gb|KEH24407.1|  glycosyl hydrolase family 9 protein                     137   5e-36   
ref|XP_009589429.1|  PREDICTED: endoglucanase 11-like                   143   5e-36   
ref|XP_010094075.1|  Endoglucanase 5                                    143   6e-36   
gb|KGN46280.1|  hypothetical protein Csa_6G079740                       142   6e-36   
ref|XP_007049160.1|  Glycosyl hydrolase 9B8                             143   6e-36   
ref|XP_004153697.1|  PREDICTED: endoglucanase 12-like                   142   6e-36   
ref|XP_010536683.1|  PREDICTED: endoglucanase 11-like                   142   7e-36   
gb|AAZ08321.1|  putative endo-1,4-beta-glucanase                        142   7e-36   
ref|XP_004500768.1|  PREDICTED: endoglucanase 24-like isoform X3        140   7e-36   
ref|XP_010935663.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    143   7e-36   
ref|XP_006447630.1|  hypothetical protein CICLE_v10014884mg             142   7e-36   
ref|XP_010244161.1|  PREDICTED: endoglucanase 11-like                   142   9e-36   
gb|EMS52550.1|  Endoglucanase 10                                        142   9e-36   
gb|EMT00674.1|  Endoglucanase 10                                        142   9e-36   
ref|XP_010533226.1|  PREDICTED: endoglucanase 25                        143   9e-36   
ref|XP_002527135.1|  endo-1,4-beta-glucanase, putative                  143   9e-36   
dbj|BAJ94336.1|  predicted protein                                      142   1e-35   
gb|AFZ78644.1|  korrigan                                                142   1e-35   
dbj|BAA94257.1|  endo-1,4-beta-glucanase Cel1                           142   1e-35   
ref|XP_002510937.1|  endo-1,4-beta-glucanase, putative                  142   1e-35   
gb|KDO62113.1|  hypothetical protein CISIN_1g036785mg                   142   1e-35   
ref|XP_009361039.1|  PREDICTED: endoglucanase 11-like                   142   1e-35   
dbj|BAA21111.1|  endo-1,4-beta-glucanase                                139   1e-35   
ref|XP_006475127.1|  PREDICTED: endoglucanase 11-like                   142   1e-35   
ref|XP_009400506.1|  PREDICTED: endoglucanase 10-like                   142   1e-35   
ref|XP_006837247.1|  hypothetical protein AMTR_s00112p00038750          141   1e-35   
gb|EYU35397.1|  hypothetical protein MIMGU_mgv1a003033mg                142   2e-35   
ref|XP_006590804.1|  PREDICTED: endoglucanase 5-like                    142   2e-35   
gb|KHN32282.1|  Endoglucanase 5                                         142   2e-35   
ref|XP_004238641.1|  PREDICTED: endoglucanase 25-like                   142   2e-35   
ref|XP_006843611.1|  hypothetical protein AMTR_s00007p00143890          134   2e-35   
ref|XP_008449473.1|  PREDICTED: endoglucanase 11                        142   2e-35   
ref|XP_004295846.1|  PREDICTED: endoglucanase 11-like                   141   2e-35   
ref|XP_010522359.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    141   2e-35   
gb|KHG02199.1|  hypothetical protein F383_00334                         141   2e-35   
ref|XP_009414123.1|  PREDICTED: endoglucanase 7-like                    141   2e-35   
gb|AAM13693.1|  endo-1,4-beta-glucanase                                 142   2e-35   
ref|XP_002463915.1|  hypothetical protein SORBIDRAFT_01g008860          142   2e-35   
gb|AFK41115.1|  unknown                                                 134   2e-35   
dbj|BAD95336.1|  cellulase homolog OR16pep precursor                    137   2e-35   
gb|AID55393.1|  glycoside hydrolase family 9 C1                         141   3e-35   
ref|XP_007040506.1|  Glycosyl hydrolase 9C2                             142   3e-35   
ref|XP_006437568.1|  hypothetical protein CICLE_v10033912mg             142   3e-35   
gb|KHN05445.1|  Endoglucanase 5                                         141   3e-35   
ref|XP_009627045.1|  PREDICTED: endoglucanase 11-like                   141   3e-35   
gb|KDO52762.1|  hypothetical protein CISIN_1g043219mg                   141   3e-35   
gb|KJB31835.1|  hypothetical protein B456_005G210200                    140   3e-35   
emb|CDI66528.1|  Endoglucanase 10                                       141   3e-35   
ref|XP_003560035.1|  PREDICTED: endoglucanase 10                        141   3e-35   
ref|NP_001054543.1|  Os05g0129200                                       140   3e-35   
ref|XP_002310080.1|  endo-1 family protein                              141   3e-35   
emb|CDI66602.1|  Endoglucanase 10                                       141   3e-35   
ref|XP_002975128.1|  hypothetical protein SELMODRAFT_415162             140   3e-35   
emb|CDY19174.1|  BnaA04g19140D                                          140   3e-35   
emb|CBB36505.1|  Hordeum vulgare protein similar to endo-1,4-b-gl...    141   4e-35   
ref|XP_004503629.1|  PREDICTED: endoglucanase 6-like                    141   4e-35   
gb|ACN28577.1|  unknown                                                 141   4e-35   
ref|XP_009141285.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    140   4e-35   
ref|XP_002525326.1|  endo-1,4-beta-glucanase, putative                  140   4e-35   
emb|CDY59895.1|  BnaC06g40900D                                          140   4e-35   
ref|XP_004500767.1|  PREDICTED: endoglucanase 24-like isoform X2        140   4e-35   
ref|XP_006356407.1|  PREDICTED: endoglucanase 25-like                   141   4e-35   
gb|KJB31836.1|  hypothetical protein B456_005G210200                    141   4e-35   
gb|KHN23901.1|  Endoglucanase 11                                        140   4e-35   
gb|ABR16291.1|  unknown                                                 141   4e-35   
ref|XP_006650552.1|  PREDICTED: endoglucanase 10-like                   141   4e-35   
gb|AEL88496.1|  membrane-bound endo-1,4-beta-glucanase                  141   5e-35   
ref|XP_003540637.2|  PREDICTED: endoglucanase 5                         141   5e-35   
ref|XP_004505716.1|  PREDICTED: endoglucanase 5-like                    141   5e-35   
emb|CDY41954.1|  BnaA01g05260D                                          140   5e-35   
emb|CDY17123.1|  BnaA05g10650D                                          140   5e-35   
ref|XP_009797971.1|  PREDICTED: endoglucanase 6-like isoform X2         140   5e-35   
ref|XP_006653871.1|  PREDICTED: endoglucanase 13-like                   140   6e-35   
ref|XP_003594425.1|  Endoglucanase                                      140   6e-35   
ref|XP_006388089.1|  hypothetical protein POPTR_0347s002202g            134   6e-35   
ref|XP_009797970.1|  PREDICTED: endoglucanase 6-like isoform X1         140   6e-35   
ref|XP_011076830.1|  PREDICTED: endoglucanase 12-like                   140   6e-35   
tpg|DAA51201.1|  TPA: endo-1,4-beta-glucanase Cel1                      140   6e-35   
emb|CDI66566.1|  Endoglucanase 10                                       140   6e-35   
ref|NP_001151770.1|  endo-1,4-beta-glucanase Cel1                       140   6e-35   
ref|XP_006411695.1|  hypothetical protein EUTSA_v10025010mg             140   7e-35   
ref|XP_010413920.1|  PREDICTED: endoglucanase 11                        140   7e-35   
ref|XP_006357959.1|  PREDICTED: endoglucanase 11-like                   140   7e-35   
ref|XP_006359861.1|  PREDICTED: endoglucanase 17-like                   140   7e-35   
gb|KFK36055.1|  hypothetical protein AALP_AA4G071900                    140   7e-35   
ref|XP_008451938.1|  PREDICTED: endoglucanase 6-like                    140   7e-35   
gb|KFK31096.1|  hypothetical protein AALP_AA6G067600                    140   7e-35   
gb|EPS69947.1|  hypothetical protein M569_04812                         139   7e-35   
gb|KEH27425.1|  endo-1,4-beta-glucanase                                 137   7e-35   
ref|XP_009144504.1|  PREDICTED: endoglucanase 23                        140   7e-35   
ref|XP_006283596.1|  hypothetical protein CARUB_v10004652mg             139   7e-35   
ref|XP_004500766.1|  PREDICTED: endoglucanase 24-like isoform X1        139   7e-35   
ref|XP_010436996.1|  PREDICTED: endoglucanase 23-like                   139   8e-35   
ref|XP_006410437.1|  hypothetical protein EUTSA_v10016495mg             139   8e-35   
ref|XP_002299405.1|  endo-1 family protein                              140   8e-35   
ref|XP_010549156.1|  PREDICTED: endoglucanase 5                         140   8e-35   
emb|CDY22400.1|  BnaA06g37220D                                          139   9e-35   
ref|XP_003604007.1|  Endo-1 4-beta-glucanase                            139   9e-35   
gb|AGV22124.1|  endo-1,4-beta-glucanase 2                               139   9e-35   
ref|XP_008232258.1|  PREDICTED: endoglucanase 14-like                   139   1e-34   
ref|XP_004298897.1|  PREDICTED: endoglucanase 6                         140   1e-34   
ref|XP_003611061.1|  Cellulase                                          139   1e-34   
gb|AAC78298.2|  cellulase                                               140   1e-34   
ref|XP_002448763.1|  hypothetical protein SORBIDRAFT_06g032760          140   1e-34   
emb|CAC94006.1|  endo-beta-1,4-glucanase                                140   1e-34   
gb|ABR15471.1|  endoglucanase                                           140   1e-34   
emb|CDY19428.1|  BnaC04g11710D                                          139   1e-34   
emb|CDX93707.1|  BnaA06g03410D                                          140   1e-34   
gb|KDP25379.1|  hypothetical protein JCGZ_20535                         139   1e-34   
ref|XP_009403727.1|  PREDICTED: endoglucanase 9-like isoform X2         138   1e-34   
ref|XP_006355746.1|  PREDICTED: endoglucanase 14-like                   139   1e-34   
ref|XP_002862860.1|  predicted protein                                  139   1e-34   
ref|XP_004502038.1|  PREDICTED: endoglucanase 11-like                   139   1e-34   
ref|NP_001234882.1|  endo-1,4-beta-glucanase precursor                  139   1e-34   
ref|XP_002277353.2|  PREDICTED: endoglucanase 11-like                   139   1e-34   
ref|XP_010521418.1|  PREDICTED: endoglucanase 25-like                   140   1e-34   
ref|XP_002961082.1|  hypothetical protein SELMODRAFT_75214              140   1e-34   
ref|XP_009403726.1|  PREDICTED: endoglucanase 9-like isoform X1         138   1e-34   
ref|XP_009601304.1|  PREDICTED: endoglucanase 6                         140   1e-34   
ref|XP_009143907.1|  PREDICTED: endoglucanase 11                        139   1e-34   
ref|XP_010431848.1|  PREDICTED: endoglucanase 23                        139   1e-34   
ref|XP_004486415.1|  PREDICTED: endoglucanase 25-like                   139   1e-34   
gb|ACF87544.1|  unknown                                                 138   1e-34   
gb|AAL30454.1|AF362949_1  endo-beta-1,4-glucanase precursor             140   1e-34   
ref|XP_009101916.1|  PREDICTED: endoglucanase 22-like                   139   1e-34   
ref|XP_010681760.1|  PREDICTED: endoglucanase 11-like                   139   1e-34   
gb|KHN33715.1|  Endoglucanase 23                                        138   1e-34   
ref|XP_004171003.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    139   1e-34   
ref|NP_001284449.1|  endoglucanase 25-like                              139   1e-34   
ref|XP_008221053.1|  PREDICTED: endoglucanase 5                         139   1e-34   
gb|AGC94751.1|  endoglucanase-1,4-beta glucanase 6                      139   1e-34   
ref|XP_004133745.1|  PREDICTED: endoglucanase 25-like                   139   1e-34   
ref|XP_008461371.1|  PREDICTED: endoglucanase 5                         139   1e-34   
gb|AFL65037.1|  endoglucanase                                           138   2e-34   
gb|ACZ82300.1|  beta-1,4 glycosidase                                    139   2e-34   
emb|CDY52780.1|  BnaCnng23250D                                          139   2e-34   
ref|XP_006354983.1|  PREDICTED: endoglucanase 5-like                    139   2e-34   
ref|XP_002966925.1|  hypothetical protein SELMODRAFT_408186             139   2e-34   
gb|KCW66948.1|  hypothetical protein EUGRSUZ_F00710                     139   2e-34   
tpg|DAA36812.1|  TPA: hypothetical protein ZEAMMB73_340402              139   2e-34   
ref|XP_010060286.1|  PREDICTED: endoglucanase 11-like                   139   2e-34   
gb|AID55375.1|  glycoside hydrolase family 9 C3                         139   2e-34   
ref|XP_009395086.1|  PREDICTED: endoglucanase 10-like                   139   2e-34   
gb|AEN70797.1|  endo-1,4-beta-glucanase                                 139   2e-34   
ref|XP_011088109.1|  PREDICTED: endoglucanase 25-like                   139   2e-34   
ref|XP_002465324.1|  hypothetical protein SORBIDRAFT_01g036480          139   2e-34   
ref|XP_007131339.1|  hypothetical protein PHAVU_011G005600g             137   2e-34   
gb|EMT22659.1|  Endoglucanase 12                                        139   2e-34   
ref|XP_002879427.1|  glycosyl hydrolase family 9 protein                138   2e-34   
gb|AEO97200.1|  endo-1,4-beta-glucanase                                 138   2e-34   
ref|XP_010035530.1|  PREDICTED: endoglucanase 11                        138   2e-34   
ref|XP_011008907.1|  PREDICTED: endoglucanase 5                         139   2e-34   
ref|XP_006393331.1|  hypothetical protein EUTSA_v10011318mg             139   2e-34   
ref|XP_006842476.1|  hypothetical protein AMTR_s00077p00078180          135   2e-34   
emb|CDY65179.1|  BnaCnng45930D                                          139   2e-34   
ref|NP_001147970.1|  glycoside transferase, six-hairpin, subgroup       139   2e-34   
ref|XP_009144994.1|  PREDICTED: endoglucanase 5-like                    139   2e-34   
emb|CDY60075.1|  BnaA05g36410D                                          139   2e-34   
ref|XP_007147545.1|  hypothetical protein PHAVU_006G133700g             139   2e-34   
ref|XP_009147931.1|  PREDICTED: endoglucanase 5                         139   2e-34   
ref|XP_002301487.1|  hypothetical protein POPTR_0002s20350g             138   2e-34   
ref|XP_011014628.1|  PREDICTED: endoglucanase 12-like isoform X3        138   2e-34   
gb|KJB52283.1|  hypothetical protein B456_008G254000                    138   2e-34   
ref|XP_010481246.1|  PREDICTED: endoglucanase 1                         138   3e-34   
gb|AAD28258.1|AF128404_1  cellulase homolog                             138   3e-34   
ref|XP_008813788.1|  PREDICTED: endoglucanase 12-like                   139   3e-34   
gb|KJB70736.1|  hypothetical protein B456_011G089500                    139   3e-34   
gb|AID55380.1|  glycoside hydrolase family 9 A2                         139   3e-34   
ref|XP_006484545.1|  PREDICTED: endoglucanase 5-like                    139   3e-34   
ref|XP_010509938.1|  PREDICTED: endoglucanase 11-like isoform X3        138   3e-34   
ref|XP_003611058.1|  Endo-1 4-beta-glucanase                            137   3e-34   
gb|KDP43311.1|  hypothetical protein JCGZ_24232                         139   3e-34   
ref|XP_010509936.1|  PREDICTED: endoglucanase 11-like isoform X1        138   3e-34   
gb|AAP83128.1|  endo-1,4-beta-glucanase                                 139   3e-34   
gb|KJB66548.1|  hypothetical protein B456_010G143300                    139   3e-34   
ref|XP_011014603.1|  PREDICTED: endoglucanase 12-like isoform X1        139   3e-34   
ref|XP_002519394.1|  endo-1,4-beta-glucanase, putative                  139   3e-34   
gb|ABP96983.1|  cellulase                                               139   3e-34   
gb|ADY68794.1|  membrane-anchored endo-1,4-beta-glucanase               139   3e-34   
gb|ADY68792.1|  membrane-anchored endo-1,4-beta-glucanase               139   3e-34   
emb|CDY23776.1|  BnaC04g43460D                                          138   3e-34   
gb|KHG21954.1|  hypothetical protein F383_28246                         138   3e-34   
gb|AAS87601.1|  membrane-anchored endo-1,4-beta-glucanase               139   3e-34   
gb|AEN70816.1|  endo-1,4-beta-glucanase                                 139   3e-34   
emb|CDP12150.1|  unnamed protein product                                139   3e-34   
gb|AEN70798.1|  endo-1,4-beta-glucanase                                 139   3e-34   
gb|KGN50329.1|  hypothetical protein Csa_5G167210                       137   3e-34   
gb|KDP25304.1|  hypothetical protein JCGZ_20460                         137   3e-34   
gb|AAQ08018.1|  endo-1,4-beta-glucanase                                 139   3e-34   
gb|KJB52282.1|  hypothetical protein B456_008G254000                    139   3e-34   
ref|XP_002278065.1|  PREDICTED: endoglucanase 25-like                   139   3e-34   
gb|AAZ08322.1|  endo-1,4-beta-glucanase                                 137   3e-34   
sp|A2XYW8.2|GUN13_ORYSI  RecName: Full=Endoglucanase 13; AltName:...    139   3e-34   
ref|XP_009787485.1|  PREDICTED: endoglucanase 11-like                   137   4e-34   
ref|XP_006293986.1|  hypothetical protein CARUB_v10022977mg             138   4e-34   
gb|EAY96028.1|  hypothetical protein OsI_17901                          138   4e-34   
ref|XP_010533225.1|  PREDICTED: endoglucanase 25-like                   138   4e-34   
ref|XP_007220712.1|  hypothetical protein PRUPE_ppa021556mg             137   4e-34   
ref|XP_004243521.1|  PREDICTED: endoglucanase 11                        137   4e-34   
dbj|BAL41418.1|  endo-1,4-beta-glucanase                                137   4e-34   
gb|AGV22123.1|  endo-1,4-beta-glucanase 1                               138   4e-34   
ref|XP_003523510.1|  PREDICTED: endoglucanase 24-like                   137   4e-34   
emb|CBI29606.3|  unnamed protein product                                137   4e-34   
ref|XP_007131340.1|  hypothetical protein PHAVU_011G005600g             137   4e-34   
ref|XP_010069895.1|  PREDICTED: endoglucanase 17                        137   4e-34   
ref|NP_001054243.1|  Os04g0674800                                       138   4e-34   
gb|EPS73295.1|  hypothetical protein M569_01458                         137   5e-34   
ref|XP_010913407.1|  PREDICTED: endoglucanase 11                        137   5e-34   
ref|XP_007131641.1|  hypothetical protein PHAVU_011G030300g             138   5e-34   
gb|ABD62083.1|  endo-1,4-beta-glucancase precursor                      138   5e-34   
gb|KDP32467.1|  hypothetical protein JCGZ_13392                         138   5e-34   
ref|XP_010446419.1|  PREDICTED: endoglucanase 23                        137   5e-34   
gb|ACT54548.1|  endo-1,4-beta-glucanase                                 137   5e-34   
ref|XP_003535026.1|  PREDICTED: endoglucanase 25                        138   5e-34   
gb|AEN70809.1|  endo-1,4-beta-glucanase                                 138   5e-34   
ref|XP_008374318.1|  PREDICTED: endoglucanase 6-like                    138   5e-34   
ref|XP_002865753.1|  hypothetical protein ARALYDRAFT_495032             138   5e-34   



>ref|XP_009610927.1| PREDICTED: endoglucanase 2-like [Nicotiana tomentosiformis]
Length=525

 Score =   291 bits (746),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS+WNALQHPVASAFLAV+YSDYML+SRTAKITC+G  YTPSDLRKFA+SQADYVLG
Sbjct  362  LIWISEWNALQHPVASAFLAVLYSDYMLTSRTAKITCNGDAYTPSDLRKFAISQADYVLG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNP KMSYLVGYGDNYP+YVHHRGASIP DA TGCKDG+KWL+ST+PNPNVA G LVGGP
Sbjct  422  DNPSKMSYLVGYGDNYPQYVHHRGASIPKDADTGCKDGWKWLDSTEPNPNVATGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNSMQAEPTTYNSA+IVGLLSGL
Sbjct  482  FLNETYIDSRNNSMQAEPTTYNSAVIVGLLSGL  514



>ref|XP_009783020.1| PREDICTED: endoglucanase 2 [Nicotiana sylvestris]
Length=525

 Score =   289 bits (739),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS+WNALQHPVASAFLAV+YSDYML+SRTAKITC+G  YTPSDLRKFA+SQADYVLG
Sbjct  362  LIWISEWNALQHPVASAFLAVLYSDYMLTSRTAKITCNGDAYTPSDLRKFAISQADYVLG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNP KMSYLVGYGDNYP+YVHHRGASIP DA T CKDG+KWL+ST+PNPNVA G LVGGP
Sbjct  422  DNPSKMSYLVGYGDNYPQYVHHRGASIPEDADTSCKDGWKWLDSTEPNPNVATGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNSMQAEPTTYNSA+IVGLLSGL
Sbjct  482  FLNETYIDSRNNSMQAEPTTYNSAVIVGLLSGL  514



>ref|XP_011074667.1| PREDICTED: endoglucanase 10-like [Sesamum indicum]
Length=525

 Score =   286 bits (731),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVW+SQWNALQHPVASA LAV+YSDYML+SRTAKI+CDG Y+ PSDLRKFAMSQADYVLG
Sbjct  362  LVWVSQWNALQHPVASALLAVIYSDYMLTSRTAKISCDGHYFRPSDLRKFAMSQADYVLG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMKMSYLVGYGD YP+YVHHRGASIP DATTGCKDGF+WL+S +PNPN+A+G LVGGP
Sbjct  422  DNPMKMSYLVGYGDKYPQYVHHRGASIPADATTGCKDGFQWLKSDKPNPNIAMGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNE+++DSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  482  FLNESFVDSRNNSMQTEPSTYNSAVIVGLLSSL  514



>emb|CDP07412.1| unnamed protein product [Coffea canephora]
Length=526

 Score =   283 bits (724),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS+WNALQHPVASAFLAVVYSDYMLSSRTA+I+CD   +TP+DLRKFAMSQADYVLG
Sbjct  363  LIWISEWNALQHPVASAFLAVVYSDYMLSSRTAEISCDSDSFTPADLRKFAMSQADYVLG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NP K+SYLVGYGDNYPK+VHHRGASIP DA TGCKDGF+WL+S +PNPNVAVG LVGGP
Sbjct  423  NNPAKLSYLVGYGDNYPKFVHHRGASIPMDAKTGCKDGFQWLDSDKPNPNVAVGALVGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F+NETYIDSRNNSMQAEP+TYNSA+IV LLSGL
Sbjct  483  FMNETYIDSRNNSMQAEPSTYNSAVIVALLSGL  515



>gb|KHF97947.1| hypothetical protein F383_10892 [Gossypium arboreum]
Length=526

 Score =   281 bits (718),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC    + PSDLRKFA SQADYVLG
Sbjct  363  LVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDHSFKPSDLRKFAKSQADYVLG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFKWL+STQPNPNVAVGGLVGGP
Sbjct  423  KNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFKWLDSTQPNPNVAVGGLVGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNSMQAEPTTYNSA+IVGLLS L
Sbjct  483  FLNETYIDSRNNSMQAEPTTYNSALIVGLLSSL  515



>ref|XP_006342034.1| PREDICTED: endoglucanase 10-like [Solanum tuberosum]
Length=519

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI+QWNALQHPVASAFLAVVYSDYML+S+T K+TCDG  YTPSDLRKFAMSQA+YVLG
Sbjct  356  LIWITQWNALQHPVASAFLAVVYSDYMLTSKTGKMTCDGNEYTPSDLRKFAMSQANYVLG  415

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNP KMSYLVGYGD YP+YVHHRGASIPTDA T CK+G+K+L+ST+PNPNVA G LVGGP
Sbjct  416  DNPAKMSYLVGYGDKYPQYVHHRGASIPTDADTNCKEGWKYLDSTEPNPNVATGALVGGP  475

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNS+Q EPTTYNSA+IVGLLSGL
Sbjct  476  FLNETYIDSRNNSIQGEPTTYNSAVIVGLLSGL  508



>gb|AID55377.1| glycoside hydrolase family 9 B5 [Gossypium hirsutum]
Length=526

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC    + PSDLRKFA SQADYVLG
Sbjct  363  LVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDHSFKPSDLRKFAKSQADYVLG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFKWL+ST+PNPNVAVGGLVGGP
Sbjct  423  KNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFKWLDSTEPNPNVAVGGLVGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNSMQAEPTTYNSA+IVGLLS L
Sbjct  483  FLNETYIDSRNNSMQAEPTTYNSALIVGLLSSL  515



>ref|XP_010667385.1| PREDICTED: endoglucanase 2-like [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVASAFLAVVYSDYMLSSRTA+I+C+G  Y PS+LRKFA+SQADYVLG
Sbjct  360  LIWVSEWNALQHPVASAFLAVVYSDYMLSSRTARISCNGNSYKPSELRKFALSQADYVLG  419

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMS+LVGYGD YP++VHHRGASIP DA TGC DGFKWL ST+PNPNVAVG LVGGP
Sbjct  420  NNPMKMSFLVGYGDKYPQFVHHRGASIPADAKTGCDDGFKWLNSTEPNPNVAVGALVGGP  479

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET+ID RNNSMQ EPTTYN+A++VGLLSGL
Sbjct  480  FLNETFIDDRNNSMQTEPTTYNNALVVGLLSGL  512



>gb|ADU15552.1| EG [Gossypium hirsutum]
Length=526

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC    + PSDLRKFA SQADYVLG
Sbjct  363  LVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDHSFKPSDLRKFAKSQADYVLG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFKWL+ST+PNPNVAVGGLVGGP
Sbjct  423  KNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFKWLDSTEPNPNVAVGGLVGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNSMQAEPTTYNSA+IVGLLS L
Sbjct  483  FLNETYIDSRNNSMQAEPTTYNSALIVGLLSSL  515



>ref|XP_010061046.1| PREDICTED: endoglucanase 10-like [Eucalyptus grandis]
 gb|KCW67943.1| hypothetical protein EUGRSUZ_F01640 [Eucalyptus grandis]
Length=528

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WN+LQHPVASAFLA +YSDYML+SRTAKI+C G+ Y PSDLRKFA SQADYVLG
Sbjct  365  LIWVSEWNSLQHPVASAFLATIYSDYMLTSRTAKISCSGQTYRPSDLRKFAQSQADYVLG  424

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNP+KMSYLVGYGDNYP+YVHHRGASIP +A TGC DGFKWL ST PNPNVA G LVGGP
Sbjct  425  DNPIKMSYLVGYGDNYPQYVHHRGASIPVNAKTGCTDGFKWLNSTDPNPNVATGALVGGP  484

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNSMQ EP+TYNSA+IVGLLSGL
Sbjct  485  FLNETYIDSRNNSMQTEPSTYNSALIVGLLSGL  517



>gb|KJB58121.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=393

 Score =   275 bits (703),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC    + PSDLRK A SQADYVLG
Sbjct  230  LVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDHSFKPSDLRKLAKSQADYVLG  289

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFKWL+ST+PNPNVAVGGLVGGP
Sbjct  290  KNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFKWLDSTEPNPNVAVGGLVGGP  349

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNS QAEPTTYNSA+IVGLLS L
Sbjct  350  FLNETYIDSRNNSKQAEPTTYNSALIVGLLSSL  382



>gb|EYU36779.1| hypothetical protein MIMGU_mgv1a004472mg [Erythranthe guttata]
Length=525

 Score =   278 bits (712),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWISQWNALQHPVASAFLAV+YSDYMLSSRTA+I+C+G  + PSDLRKFA+SQADYVLG
Sbjct  362  LVWISQWNALQHPVASAFLAVIYSDYMLSSRTARISCNGNNFRPSDLRKFAISQADYVLG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMKMSYLVGYGD YP+YVHHRGASIP D  + CK+GFKWL+S +PNPNVA+G LVGGP
Sbjct  422  DNPMKMSYLVGYGDKYPQYVHHRGASIPADDKSDCKEGFKWLDSKEPNPNVAIGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNE+++DSRNNSMQ EP+TYNSA+IVGLLSGL
Sbjct  482  FLNESFVDSRNNSMQTEPSTYNSAVIVGLLSGL  514



>gb|KJB58119.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=424

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC    + PSDLRK A SQADYVLG
Sbjct  261  LVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDHSFKPSDLRKLAKSQADYVLG  320

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFKWL+ST+PNPNVAVGGLVGGP
Sbjct  321  KNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFKWLDSTEPNPNVAVGGLVGGP  380

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNS QAEPTTYNSA+IVGLLS L
Sbjct  381  FLNETYIDSRNNSKQAEPTTYNSALIVGLLSSL  413



>ref|XP_004238345.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
 ref|XP_010320423.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
Length=519

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI++WNALQHPVASAFLAV+YSDYML+S+T K+TCDG  YTPSDLRKFAMSQA+YVLG
Sbjct  356  LIWITEWNALQHPVASAFLAVLYSDYMLTSKTDKMTCDGNEYTPSDLRKFAMSQANYVLG  415

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNP KMSYLVGYGD YP+YVHHRGASIPTDA T CK+G+K+L+ST+PNPNVA G LVGGP
Sbjct  416  DNPAKMSYLVGYGDKYPQYVHHRGASIPTDANTNCKEGWKYLDSTEPNPNVATGALVGGP  475

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNS+Q EPTTYNSA++V LLSGL
Sbjct  476  FLNETYIDSRNNSVQGEPTTYNSAVVVALLSGL  508



>ref|XP_006435157.1| hypothetical protein CICLE_v10000849mg [Citrus clementina]
 gb|ESR48397.1| hypothetical protein CICLE_v10000849mg [Citrus clementina]
Length=524

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WN+LQHPVASAFLA VYSDYML+SRTA++TCDG  + PSDLR FA  QADY+LG
Sbjct  361  LIWVSEWNSLQHPVASAFLATVYSDYMLTSRTAELTCDGHSFKPSDLRDFAKDQADYILG  420

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NP+KMS+LVGYG  YP+YVHHRGASIP DATTGC+DGFKWL+S +PNPNVAVGGLVGGP
Sbjct  421  NNPLKMSFLVGYGKKYPQYVHHRGASIPADATTGCRDGFKWLDSKKPNPNVAVGGLVGGP  480

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNSMQAEP+TYN A+IVGLLS L
Sbjct  481  FLNETYIDSRNNSMQAEPSTYNGAVIVGLLSSL  513



>ref|XP_006473639.1| PREDICTED: endoglucanase 10-like [Citrus sinensis]
Length=524

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WN+LQHPVASAFLA VYSDYML+SRTA++TCDG  + PSDLR FA  QADY+LG
Sbjct  361  LIWVSEWNSLQHPVASAFLAAVYSDYMLTSRTAELTCDGHSFKPSDLRDFAKDQADYILG  420

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NP+KMS+LVGYG  YP+YVHHRGASIP DATTGC+DGFKWL+S +PNPNVAVGGLVGGP
Sbjct  421  NNPLKMSFLVGYGKKYPQYVHHRGASIPADATTGCRDGFKWLDSKKPNPNVAVGGLVGGP  480

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNSMQAEP+TYN A+IVGLLS L
Sbjct  481  FLNETYIDSRNNSMQAEPSTYNGAVIVGLLSSL  513



>gb|KDO84820.1| hypothetical protein CISIN_1g009846mg [Citrus sinensis]
Length=524

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WN+LQHPVASAFLA VYSDYML+SRTA++TCDG  + PSDLR FA  QADY+LG
Sbjct  361  LIWVSEWNSLQHPVASAFLAAVYSDYMLTSRTAELTCDGHSFKPSDLRDFAKDQADYILG  420

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NP+KMS+LVGYG  YP+YVHHRGASIP DATTGC+DGFKWL+S +PNPNVAVGGLVGGP
Sbjct  421  NNPLKMSFLVGYGKKYPQYVHHRGASIPADATTGCRDGFKWLDSKKPNPNVAVGGLVGGP  480

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNSMQAEP+TYN A+IVGLLS L
Sbjct  481  FLNETYIDSRNNSMQAEPSTYNGAVIVGLLSSL  513



>gb|KJB58118.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=526

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC    + PSDLRK A SQADYVLG
Sbjct  363  LVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDHSFKPSDLRKLAKSQADYVLG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFKWL+ST+PNPNVAVGGLVGGP
Sbjct  423  KNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFKWLDSTEPNPNVAVGGLVGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNS QAEPTTYNSA+IVGLLS L
Sbjct  483  FLNETYIDSRNNSKQAEPTTYNSALIVGLLSSL  515



>gb|KJB58120.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=522

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC    + PSDLRK A SQADYVLG
Sbjct  359  LVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDHSFKPSDLRKLAKSQADYVLG  418

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFKWL+ST+PNPNVAVGGLVGGP
Sbjct  419  KNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFKWLDSTEPNPNVAVGGLVGGP  478

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNS QAEPTTYNSA+IVGLLS L
Sbjct  479  FLNETYIDSRNNSKQAEPTTYNSALIVGLLSSL  511



>ref|XP_010104437.1| Endoglucanase 24 [Morus notabilis]
 gb|EXC00970.1| Endoglucanase 24 [Morus notabilis]
Length=525

 Score =   273 bits (699),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVASAFLA +YSDYML+SRTAK++C GK +TP+D+RKF  SQADYVLG
Sbjct  362  LIWVSEWNALQHPVASAFLAALYSDYMLTSRTAKVSCSGKSFTPADIRKFVRSQADYVLG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMS+LVGYGD YP+YVHHRGASIP DA TGC DGFKWL+ST+PNPNVA+G LVGGP
Sbjct  422  ENPMKMSFLVGYGDKYPQYVHHRGASIPVDAKTGCTDGFKWLDSTEPNPNVAIGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F NET+IDSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  482  FQNETFIDSRNNSMQVEPSTYNSAVMVGLLSSL  514



>ref|XP_007017776.1| EG isoform 2 [Theobroma cacao]
 gb|EOY15001.1| EG isoform 2 [Theobroma cacao]
Length=526

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVASAFLA +YSDYML+SRT K+ C    + PSDLRKFA SQADYVLG
Sbjct  363  LIWVSEWNALQHPVASAFLAALYSDYMLTSRTPKLKCGDDSFKPSDLRKFAKSQADYVLG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+KMS+LVGYGD YP+YVHHRGASIP DATTGCKDGFKWL+ST+PNPNVA+G L+GGP
Sbjct  423  SNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCKDGFKWLDSTKPNPNVAIGALLGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNSMQAEPTTYN AIIVGLLS L
Sbjct  483  FLNETYIDSRNNSMQAEPTTYNGAIIVGLLSSL  515



>ref|XP_002510516.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF52703.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=523

 Score =   273 bits (698),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVASAFLA +YSDYML+SRTAK++CDG  + PSDLRKFA SQADYVLG
Sbjct  360  LIWVSEWNALQHPVASAFLAALYSDYMLTSRTAKLSCDGTSFKPSDLRKFAKSQADYVLG  419

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPMKMSYLVGYGD YP+YVHHRGASIP DATTGCKDG+KWL++ +PNPNVA G  VGGP
Sbjct  420  KNPMKMSYLVGYGDKYPQYVHHRGASIPADATTGCKDGWKWLDAEEPNPNVAYGAFVGGP  479

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNE+Y+DSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  480  FLNESYVDSRNNSMQGEPSTYNSAVIVGLLSSL  512



>ref|XP_007017775.1| EG isoform 1 [Theobroma cacao]
 gb|EOY15000.1| EG isoform 1 [Theobroma cacao]
Length=533

 Score =   273 bits (698),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVASAFLA +YSDYML+SRT K+ C    + PSDLRKFA SQADYVLG
Sbjct  363  LIWVSEWNALQHPVASAFLAALYSDYMLTSRTPKLKCGDDSFKPSDLRKFAKSQADYVLG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+KMS+LVGYGD YP+YVHHRGASIP DATTGCKDGFKWL+ST+PNPNVA+G L+GGP
Sbjct  423  SNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCKDGFKWLDSTKPNPNVAIGALLGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNSMQAEPTTYN AIIVGLLS L
Sbjct  483  FLNETYIDSRNNSMQAEPTTYNGAIIVGLLSSL  515



>ref|XP_010244092.1| PREDICTED: endoglucanase 24-like [Nelumbo nucifera]
 ref|XP_010244093.1| PREDICTED: endoglucanase 24-like [Nelumbo nucifera]
Length=527

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W S+WN+L HPVASAFLAV+YSDYML ++TA ITC G+ +TP+DLR FA+SQADYVLG
Sbjct  364  LLWFSEWNSLLHPVASAFLAVIYSDYMLMTQTASITCGGEAFTPADLRNFAISQADYVLG  423

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNP+KMSYLVGYG  YPKYVHHRGASIP DA TGC DGFKWL S++PNPNVA+GGLVGGP
Sbjct  424  DNPLKMSYLVGYGSKYPKYVHHRGASIPADADTGCTDGFKWLSSSKPNPNVAMGGLVGGP  483

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNSMQ EPTTYNSA+IVGLLSGL
Sbjct  484  FLNETYIDSRNNSMQGEPTTYNSALIVGLLSGL  516



>ref|XP_002276739.1| PREDICTED: endoglucanase 10 [Vitis vinifera]
 emb|CBI19843.3| unnamed protein product [Vitis vinifera]
Length=525

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVASAFLAV+YSDYMLSSRTAK++CDG  Y PSDLR FA+SQ +YVLG
Sbjct  362  LIWVSEWNALQHPVASAFLAVLYSDYMLSSRTAKLSCDGDSYKPSDLRHFAISQVNYVLG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMSYLVGYGD YP+YVHHRGASIP DATTGC DGFKWL+S  PNPNVA G LVGGP
Sbjct  422  ENPMKMSYLVGYGDKYPQYVHHRGASIPADATTGCSDGFKWLKSKDPNPNVATGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F NE+++DSRNNSMQ EP+TYN A+IVGLLS L
Sbjct  482  FKNESFVDSRNNSMQVEPSTYNGAVIVGLLSSL  514



>ref|XP_004136389.1| PREDICTED: endoglucanase 2-like [Cucumis sativus]
 ref|XP_004162553.1| PREDICTED: endoglucanase 2-like [Cucumis sativus]
 gb|KGN60025.1| hypothetical protein Csa_3G872070 [Cucumis sativus]
Length=523

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WN+LQHPV+SAFLA +YSDYML+SRTAK +C+G  YTP+DLRKFA SQADYVLG
Sbjct  360  LIWVSEWNSLQHPVSSAFLASLYSDYMLTSRTAKFSCNGDTYTPADLRKFAKSQADYVLG  419

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NP+KMSYLVGYGD +P+YVHHRGASIP DA T CKDGFKWL+ST+PNPN+A G LVGGP
Sbjct  420  NNPLKMSYLVGYGDKFPQYVHHRGASIPADAKTKCKDGFKWLDSTEPNPNIAYGALVGGP  479

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLN+TYIDSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  480  FLNDTYIDSRNNSMQGEPSTYNSALVVGLLSSL  512



>ref|XP_008466493.1| PREDICTED: endoglucanase 10 [Cucumis melo]
Length=523

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WN+LQHPV+SAFLA +YSDYML+SRTAK +C+G  YTP+DLRKFA SQADYVLG
Sbjct  360  LIWVSEWNSLQHPVSSAFLASLYSDYMLTSRTAKFSCNGDSYTPADLRKFAKSQADYVLG  419

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NP+KMSYLVGYGD +P+YVHHRGASIP DA T CKDGFKWL+ST+PNPN+A G LVGGP
Sbjct  420  NNPLKMSYLVGYGDKFPQYVHHRGASIPADAKTKCKDGFKWLDSTEPNPNIAYGALVGGP  479

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLN+TYIDSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  480  FLNDTYIDSRNNSMQGEPSTYNSALVVGLLSSL  512



>ref|XP_002300715.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE79988.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|AEO97188.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97215.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=523

 Score =   268 bits (685),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVASAFLA +YSDYM SS TAK++C+G  Y PSDLRKFA SQADYVLG
Sbjct  360  LIWVSEWNALQHPVASAFLASLYSDYMRSSGTAKLSCNGYSYKPSDLRKFAKSQADYVLG  419

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMS+LVGYG+NYP+YVHHRGASIP DA TGCKDG+ WLE  +PNPNVA G LVGGP
Sbjct  420  NNPMKMSFLVGYGENYPQYVHHRGASIPADAKTGCKDGWTWLERKEPNPNVATGALVGGP  479

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET++D RNNSMQAEPTTYN A+IVGLLSGL
Sbjct  480  FLNETFVDDRNNSMQAEPTTYNGAVIVGLLSGL  512



>ref|XP_011045112.1| PREDICTED: endoglucanase 2 [Populus euphratica]
Length=523

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVASAFLAV+YSDYMLSS TAKI+C+G  Y PSDLRKFA SQADYVLG
Sbjct  359  LIWVSEWNALQHPVASAFLAVLYSDYMLSSGTAKISCNGDSYKPSDLRKFAKSQADYVLG  418

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMSYLVGYG+ YP+YVHHRGASIPTDATTGCKDG+ WL+S +PNPN A G LVGGP
Sbjct  419  NNPMKMSYLVGYGEKYPQYVHHRGASIPTDATTGCKDGWTWLKSKEPNPNEATGALVGGP  478

Query  291  FLNETYI-DSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET++ + RNNSMQAEP+TYNSA+IVGLLSGL
Sbjct  479  FLNETFVSNDRNNSMQAEPSTYNSALIVGLLSGL  512



>gb|KDP36939.1| hypothetical protein JCGZ_08230 [Jatropha curcas]
Length=523

 Score =   268 bits (684),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVASAFLA +YSDYML+SRT +++C G+ Y PSDLRKFA SQADYVLG
Sbjct  359  LIWVSEWNALQHPVASAFLAALYSDYMLTSRTKELSCSGESYKPSDLRKFAKSQADYVLG  418

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPMKMSYLVGYGD YP+YVHHRGASIP DATTGCKDG+KWLES  PNPNVA G LVGGP
Sbjct  419  KNPMKMSYLVGYGDKYPQYVHHRGASIPADATTGCKDGWKWLESEDPNPNVATGALVGGP  478

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F NE+++DSRNNS Q EP+TYNSA+IVGLLS L
Sbjct  479  FQNESFVDSRNNSKQGEPSTYNSAVIVGLLSSL  511



>ref|XP_003527686.1| PREDICTED: endoglucanase 10-like [Glycine max]
 gb|KHN09095.1| Endoglucanase 24 [Glycine soja]
Length=529

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+SQWN+LQHPVASAFLA VYSDYML+S+T K+ CD   +TPSDLR FA SQADYVLG
Sbjct  366  LIWVSQWNSLQHPVASAFLAAVYSDYMLTSQTPKLKCDSDSFTPSDLRDFAKSQADYVLG  425

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM MS+LVGYGD YP++VHHRGASIP DA TGCKDGF+WLES+ PNPNVA G LVGGP
Sbjct  426  KNPMHMSFLVGYGDKYPQFVHHRGASIPADAKTGCKDGFQWLESSDPNPNVATGALVGGP  485

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  486  FLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  518



>dbj|BAF42037.1| cellulase2 [Pyrus communis]
Length=526

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQ PVA+AFLA +YSDYML+SR+ K+ CDG  Y PSD+RKF  SQADYVLG
Sbjct  363  LIWVSEWNALQQPVAAAFLAALYSDYMLTSRSTKLECDGDTYKPSDIRKFVRSQADYVLG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMKMSYLVGYGD YPKYVHHRGASIP +  TGCKDGFK+L+ST PNPN+AVG LVGGP
Sbjct  423  DNPMKMSYLVGYGDKYPKYVHHRGASIPANQKTGCKDGFKYLDSTDPNPNIAVGALVGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYID+RNNS QAEP+TYNSA+IVGLLS L
Sbjct  483  FLNETYIDARNNSKQAEPSTYNSAVIVGLLSSL  515



>ref|XP_007136082.1| hypothetical protein PHAVU_009G016100g [Phaseolus vulgaris]
 gb|ESW08076.1| hypothetical protein PHAVU_009G016100g [Phaseolus vulgaris]
Length=529

 Score =   265 bits (678),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+SQWN+LQ PVASAFLAVVYSDYML+S+T K+ CD   YTPSDLR FA SQADYVLG
Sbjct  366  LIWVSQWNSLQQPVASAFLAVVYSDYMLTSQTPKLKCDSDSYTPSDLRDFAKSQADYVLG  425

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM MS+LVGYGD +P++VHHRGASIP DA TGCKDGFKWL+S+ PNPNVA G LVGGP
Sbjct  426  KNPMDMSFLVGYGDKFPQFVHHRGASIPADAKTGCKDGFKWLDSSDPNPNVATGALVGGP  485

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  486  FLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  518



>gb|EYU38839.1| hypothetical protein MIMGU_mgv1a004578mg [Erythranthe guttata]
Length=519

 Score =   265 bits (677),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVASAFLAVVYSDYML+SRT K++CDG  +  SDLR+FA++QA+YVLG
Sbjct  356  LIWVSEWNALQHPVASAFLAVVYSDYMLTSRTDKLSCDGDNFKASDLREFAITQANYVLG  415

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMSYLVG+G+ YP+YVHHRGAS+P D   GCKDGFKWL+S  PNPNVA G LVGGP
Sbjct  416  NNPMKMSYLVGFGNKYPEYVHHRGASVPGDENPGCKDGFKWLDSDDPNPNVATGALVGGP  475

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNE+Y+DSRNNSMQ EPTTYNSA IVGLLSGL
Sbjct  476  FLNESYVDSRNNSMQGEPTTYNSAFIVGLLSGL  508



>ref|XP_011028991.1| PREDICTED: endoglucanase 2-like [Populus euphratica]
Length=523

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVASAFLA +YSDYM SS TAK++C+G  Y PSDLRKFA SQADYVLG
Sbjct  360  LIWVSEWNALQHPVASAFLASLYSDYMRSSGTAKLSCNGYSYKPSDLRKFAKSQADYVLG  419

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMS+LVGYG+NYP+YVHHRGASIP DA TGCKDG+ WLE  +PNPNVA G LVGGP
Sbjct  420  NNPMKMSFLVGYGENYPQYVHHRGASIPADAKTGCKDGWTWLERKEPNPNVATGALVGGP  479

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F NE ++D RNNSMQAEPTTYN A+IVGLLSGL
Sbjct  480  FFNEKFVDDRNNSMQAEPTTYNGAVIVGLLSGL  512



>ref|XP_008364934.1| PREDICTED: endoglucanase 10-like [Malus domestica]
Length=526

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVA+AFLA +YSDYML+SR+ K+ CDG  Y PSD+RKF  SQADYVLG
Sbjct  363  LIWVSEWNALQHPVAAAFLAALYSDYMLTSRSTKLECDGDTYKPSDIRKFVRSQADYVLG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMKMS+LVGYGD YP+YVHHRGASIP +  TGCKDGFK+L ST+PNPN+AVG LVGGP
Sbjct  423  DNPMKMSFLVGYGDKYPEYVHHRGASIPANQKTGCKDGFKYLNSTEPNPNIAVGALVGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYID RNNS Q EP+TYNSA+IVGLLS L
Sbjct  483  FLNETYIDDRNNSKQGEPSTYNSAVIVGLLSSL  515



>ref|XP_003523541.1| PREDICTED: endoglucanase 10 [Glycine max]
Length=529

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+SQWN+LQHPVASAFLA VYSDYML+S+T K+ C    +TPSDLR FA SQADYVLG
Sbjct  366  LIWVSQWNSLQHPVASAFLAAVYSDYMLTSQTPKLKCGSDSFTPSDLRDFAKSQADYVLG  425

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM MS+LVGYGD YP++VHHRGASIP DA TGCKDGF+WLES+ PNPNVA G LVGGP
Sbjct  426  KNPMHMSFLVGYGDKYPQFVHHRGASIPADAKTGCKDGFQWLESSDPNPNVATGALVGGP  485

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  486  FLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  518



>gb|KHN45917.1| Endoglucanase 2 [Glycine soja]
Length=570

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+SQWN+LQHPVASAFLA VYSDYML+S+T K+ C    +TPSDLR FA SQADYVLG
Sbjct  407  LIWVSQWNSLQHPVASAFLAAVYSDYMLTSQTPKLKCGSDSFTPSDLRDFAKSQADYVLG  466

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM MS+LVGYGD YP++VHHRGASIP DA TGCKDGF+WLES+ PNPNVA G LVGGP
Sbjct  467  KNPMHMSFLVGYGDKYPQFVHHRGASIPADAKTGCKDGFQWLESSDPNPNVATGALVGGP  526

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  527  FLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  559



>ref|XP_004500948.1| PREDICTED: endoglucanase 10-like [Cicer arietinum]
Length=528

 Score =   263 bits (671),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVASAFLA VYSDYML+S+T KI CD   +TPSDLR FA SQADYVLG
Sbjct  365  LIWVSEWNALQHPVASAFLAAVYSDYMLTSQTPKIECDSDSFTPSDLRDFARSQADYVLG  424

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM MS+LVGYG  +P++VHHRGASIP DA+TGCKDGF+WL+S+ PNPNVA G LVGGP
Sbjct  425  KNPMHMSFLVGYGKKFPQFVHHRGASIPADASTGCKDGFQWLDSSDPNPNVATGALVGGP  484

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNS QAEP+TYNSA++VGLLS L
Sbjct  485  FLNETYIDSRNNSEQAEPSTYNSAVLVGLLSSL  517



>ref|XP_002307711.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE94707.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|AEO97189.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97216.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=523

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 138/154 (90%), Gaps = 1/154 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+SQWNALQHPVASAFLA +YSDYMLSS TAK++C+G  Y PS+LRKFA SQADYVLG
Sbjct  359  LIWVSQWNALQHPVASAFLAALYSDYMLSSGTAKLSCNGDSYKPSELRKFAKSQADYVLG  418

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMSYLVGYG+ YP+YVHHRGASIPT A TGCKDG+ WLES +PNPN A G LVGGP
Sbjct  419  NNPMKMSYLVGYGEKYPQYVHHRGASIPTGAKTGCKDGWTWLESKEPNPNEATGALVGGP  478

Query  291  FLNETYI-DSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET++ + RNNSMQAEP+TYNSA+IVGLLSGL
Sbjct  479  FLNETFVSNDRNNSMQAEPSTYNSALIVGLLSGL  512



>gb|AFZ78647.1| korrigan [Populus tomentosa]
Length=523

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 138/154 (90%), Gaps = 1/154 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+SQWNALQHPVASAFLA +YSDYMLSS TAK++C+G  Y PS+LRKFA SQADYVLG
Sbjct  359  LIWVSQWNALQHPVASAFLAALYSDYMLSSGTAKLSCNGDSYKPSELRKFAKSQADYVLG  418

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMSYLVGYG+ YP+YVHHRGASIPT A TGCKDG+ WLES +PNPN A G LVGGP
Sbjct  419  NNPMKMSYLVGYGEKYPQYVHHRGASIPTGAKTGCKDGWTWLESKEPNPNEATGALVGGP  478

Query  291  FLNETYI-DSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET++ + RNNSMQAEP+TYNSA+IVGLLSGL
Sbjct  479  FLNETFVSNDRNNSMQAEPSTYNSALIVGLLSGL  512



>gb|AGV22125.1| endo-1,4-beta-glucanase 3 [Betula luminifera]
Length=527

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WN+LQHPVASAFL  ++S+YML+S+TAK++C+GK ++ +DL+ FA SQADYVLG
Sbjct  364  LIWVSEWNSLQHPVASAFLVTLFSNYMLTSQTAKLSCNGKSFSAADLQDFAKSQADYVLG  423

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNP+KMS+LVGYGD YP++VHHRGASIP DA T C +GF+WL+STQPNPNVAVGGLVGGP
Sbjct  424  DNPLKMSFLVGYGDKYPQFVHHRGASIPIDAKTNCTEGFQWLDSTQPNPNVAVGGLVGGP  483

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F NETY+DSRNNSMQ EPTTYN+A++VGLLSGL
Sbjct  484  FQNETYLDSRNNSMQGEPTTYNNAVLVGLLSGL  516



>ref|XP_010536354.1| PREDICTED: endoglucanase 10-like [Tarenaya hassleriana]
Length=524

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPV+SAFLA +YSDYML+SR  K++C GK +  SDLRKFA SQA+Y+LG
Sbjct  361  LIWVSEWNALQHPVSSAFLAALYSDYMLTSRNVKLSCSGKTFRASDLRKFAKSQAEYMLG  420

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM+MS+LVGYGD YP+YVHHRGASIP DATTGCKDGFKWL S  PNPNVA G LVGGP
Sbjct  421  KNPMEMSFLVGYGDKYPQYVHHRGASIPADATTGCKDGFKWLNSEDPNPNVAYGALVGGP  480

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET+IDSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  481  FLNETFIDSRNNSMQNEPSTYNSALVVGLLSSL  513



>gb|KJB14408.1| hypothetical protein B456_002G123700 [Gossypium raimondii]
Length=529

 Score =   260 bits (665),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WN+LQHPVASAFLA +Y DYML+++TAK+TC    + PSDLRKFA  QADYVLG
Sbjct  360  LIWVSEWNSLQHPVASAFLAALYGDYMLTTQTAKLTCGDHSFEPSDLRKFAKLQADYVLG  419

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+KMS+LVGYGD YP+YVHHRGASIP +ATTGC DGF+WL ST+PNPNVAVG LVGGP
Sbjct  420  SNPLKMSFLVGYGDKYPQYVHHRGASIPVNATTGCTDGFQWLNSTKPNPNVAVGALVGGP  479

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET+ DSRNN+MQ EPTTYNSA+IVGLLS L
Sbjct  480  FLNETFFDSRNNTMQTEPTTYNSAVIVGLLSSL  512



>ref|XP_008241905.1| PREDICTED: endoglucanase 24-like [Prunus mume]
Length=533

 Score =   260 bits (664),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+ +WN LQH VASAFLAV+YSDYML+S+T  + CDGK+Y P+DLR FA+SQ DYVLG
Sbjct  370  LIWVIKWNCLQHAVASAFLAVLYSDYMLTSKTEVLYCDGKFYKPTDLRNFAISQVDYVLG  429

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPM+MSYLVGYG  YP+YVHHRG+SIP DA TGC+DGFKWL S+ PNPNVAVG LVGGP
Sbjct  430  ENPMEMSYLVGYGSKYPQYVHHRGSSIPADAHTGCQDGFKWLNSSNPNPNVAVGALVGGP  489

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYID+RNNSMQ EP+TYNSA+IV LLSGL
Sbjct  490  FLNETYIDNRNNSMQGEPSTYNSALIVALLSGL  522



>ref|XP_009378180.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
 ref|XP_009378181.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
Length=537

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+ +WN LQ+ VASAFLA++YSDYML+S+T  + CDGK Y P DLRKFA+SQADYVLG
Sbjct  374  LIWVIKWNCLQYAVASAFLAILYSDYMLTSKTEMLYCDGKSYNPVDLRKFAISQADYVLG  433

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPM+MSYLVGYG +YP+YVHHRGASIP DA TGC DGFKWL+S  PNPNVAVG LVGGP
Sbjct  434  ENPMRMSYLVGYGSSYPQYVHHRGASIPVDAETGCSDGFKWLDSPNPNPNVAVGALVGGP  493

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F+NETYIDSRNNSMQ EP+TYNSA+IV LLSGL
Sbjct  494  FMNETYIDSRNNSMQGEPSTYNSALIVALLSGL  526



>ref|XP_006840111.1| hypothetical protein AMTR_s00224p00023160 [Amborella trichopoda]
 gb|ERN01786.1| hypothetical protein AMTR_s00224p00023160 [Amborella trichopoda]
Length=233

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWISQWNALQHPVASAFLAVVYSDYML+SRT+ + C+ K  +P DLR FA+SQADYVLG
Sbjct  71   LVWISQWNALQHPVASAFLAVVYSDYMLTSRTSTMYCNNKANSPIDLRTFAISQADYVLG  130

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNP K+S+LVGYG NYPK VHHRGASIP +A TGCK GF+WL+ T  NPNVAVG LVGGP
Sbjct  131  DNPTKLSFLVGYGTNYPKQVHHRGASIPVNANTGCK-GFQWLDLTADNPNVAVGALVGGP  189

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N++YID RNNSMQ EP+TYNSA+IVGLLSGL
Sbjct  190  FQNDSYIDFRNNSMQGEPSTYNSAVIVGLLSGL  222



>gb|EPS64495.1| hypothetical protein M569_10284, partial [Genlisea aurea]
Length=530

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+SQW+ALQHP ASAFLA +YSDYML+SRT K++CD + + PSDLRKFA SQADYVLG
Sbjct  366  LIWVSQWDALQHPTASAFLAAIYSDYMLTSRTPKLSCDARDFAPSDLRKFAASQADYVLG  425

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDA--TTGCKDGFKWLESTQPNPNVAVGGLVG  298
             NPMKMSYLVGYGD+YP+YVHHRGASIP  A   TGCKDGF WL S QPNPNVA GGLVG
Sbjct  426  SNPMKMSYLVGYGDSYPQYVHHRGASIPVGAKNNTGCKDGFAWLTSAQPNPNVAAGGLVG  485

Query  297  GPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            GPFLN +++D+RNNSMQ EPTTYNSA+++GLLS L
Sbjct  486  GPFLNGSFVDTRNNSMQNEPTTYNSALVIGLLSAL  520



>ref|XP_008372790.1| PREDICTED: endoglucanase 24-like [Malus domestica]
Length=537

 Score =   258 bits (658),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+ +WN LQH VASAFLA++YSDYML+S+T  + CDGK Y P DLRKFA+SQADYVLG
Sbjct  374  LIWVIKWNCLQHAVASAFLAILYSDYMLTSKTEILYCDGKSYNPVDLRKFAISQADYVLG  433

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPM+MSYLVGYG +YP+YVHHRGASIP  A TGC DGFKWL+S  PNPNVAVG LVGGP
Sbjct  434  ENPMRMSYLVGYGSSYPQYVHHRGASIPVGAETGCIDGFKWLDSPNPNPNVAVGALVGGP  493

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F+NETYIDSRNNSMQ EP+TYNSA+IV LLSGL
Sbjct  494  FMNETYIDSRNNSMQGEPSTYNSALIVALLSGL  526



>ref|XP_009335173.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
Length=526

 Score =   258 bits (658),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQ PVA+AFLA +YSDYML+S + K+ CDG+ Y PSD+RKF  SQA+YVLG
Sbjct  363  LIWVSEWNALQQPVAAAFLAALYSDYMLTSGSTKLECDGETYKPSDIRKFVRSQANYVLG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMKMSYLVGYGD YPKYVHHRGASIP +  T CK+GFK+L+ST+PNPNVAVG LVGGP
Sbjct  423  DNPMKMSYLVGYGDKYPKYVHHRGASIPANKKTSCKEGFKYLDSTKPNPNVAVGALVGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYID+RNNS Q EP+TYNSA++VGLLS L
Sbjct  483  FLNETYIDARNNSRQGEPSTYNSAVVVGLLSSL  515



>ref|XP_008387935.1| PREDICTED: endoglucanase 2 [Malus domestica]
Length=526

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQ PVA+AFLA +YSDYML+S + K+ CDG+ Y PSD+RKF  SQA+YVLG
Sbjct  363  LIWVSEWNALQQPVAAAFLAALYSDYMLTSGSTKLECDGETYKPSDIRKFVRSQANYVLG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMKMSYLVGYGD YP+YVHHRGASIP +  T CK+GFK+L+ST+PNPNVAVG LVGGP
Sbjct  423  DNPMKMSYLVGYGDKYPEYVHHRGASIPANKKTSCKEGFKYLDSTKPNPNVAVGALVGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYID+RNNS Q EP+TYNSA++VGLLS L
Sbjct  483  FLNETYIDARNNSRQGEPSTYNSAVVVGLLSSL  515



>gb|AES73992.2| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=529

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVASAFLA VYSDYML+++T  I CD   + PSDLR FA SQADYVLG
Sbjct  366  LIWVSEWNALQHPVASAFLASVYSDYMLTTQTPNIKCDSDSFKPSDLRDFARSQADYVLG  425

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP  MS+LVGYG N+P++VHHRGASIP +A TGCKDG++WL+S+ PNPNVA G LVGGP
Sbjct  426  KNPQHMSFLVGYGKNFPQFVHHRGASIPANAKTGCKDGWQWLDSSDPNPNVATGALVGGP  485

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  486  FLNETYIDSRNNSMQGEPSTYNSAVIVGLLSSL  518



>ref|XP_004291374.1| PREDICTED: endoglucanase 10-like [Fragaria vesca subsp. vesca]
Length=529

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS+WNALQHPVAS+FLAVVYSDYML+S+TAK+TC+G  + P+D+RKFA+SQ +YVLG
Sbjct  361  LIWISEWNALQHPVASSFLAVVYSDYMLTSKTAKLTCNGDSFKPADIRKFAISQIEYVLG  420

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMSYLVGYGDNYPKYVHHRGASIP DA   C DGFK+ +S+ PNPNVA G LVGGP
Sbjct  421  NNPMKMSYLVGYGDNYPKYVHHRGASIPADAKPSCSDGFKYFKSSDPNPNVATGALVGGP  480

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETY D R+N+ Q EP+TYNSA++VGLLS L
Sbjct  481  FLNETYHDIRDNARQGEPSTYNSAVLVGLLSSL  513



>ref|XP_003603741.1| Endoglucanase [Medicago truncatula]
Length=535

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPVASAFLA VYSDYML+++T  I CD   + PSDLR FA SQADYVLG
Sbjct  372  LIWVSEWNALQHPVASAFLASVYSDYMLTTQTPNIKCDSDSFKPSDLRDFARSQADYVLG  431

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP  MS+LVGYG N+P++VHHRGASIP +A TGCKDG++WL+S+ PNPNVA G LVGGP
Sbjct  432  KNPQHMSFLVGYGKNFPQFVHHRGASIPANAKTGCKDGWQWLDSSDPNPNVATGALVGGP  491

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETYIDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  492  FLNETYIDSRNNSMQGEPSTYNSAVIVGLLSSL  524



>ref|XP_008221286.1| PREDICTED: endoglucanase 10-like [Prunus mume]
Length=526

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPV+SAFLA +YSDYML+SRT+K+ CDG  Y  SD+RKFA SQA+YVLG
Sbjct  363  LIWVSEWNALQHPVSSAFLAALYSDYMLTSRTSKLECDGDSYKASDIRKFARSQANYVLG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NP+KMSYLVGYGD YPKYVHHRGASIP +    C++GF++L +  PNPNVAVG LVGGP
Sbjct  423  ENPLKMSYLVGYGDKYPKYVHHRGASIPANKKPNCREGFEYLNTKDPNPNVAVGALVGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETY+D+RNNS Q EP+TYNSA+IVGLLSGL
Sbjct  483  FLNETYVDARNNSRQGEPSTYNSALIVGLLSGL  515



>ref|XP_010539853.1| PREDICTED: endoglucanase 10 [Tarenaya hassleriana]
Length=524

 Score =   252 bits (644),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WN+LQHPV+SAFLA +YSDYML+SR  K++C GK +  SDLRKFA SQADY+LG
Sbjct  361  LIWVSEWNSLQHPVSSAFLATLYSDYMLTSRIGKLSCSGKTFRASDLRKFAKSQADYMLG  420

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP  MS+LVG+G+ YPK +HHRGASIP DATTGCKDGFKWL S  PNPN+A G LVGGP
Sbjct  421  KNPTGMSFLVGFGEKYPKNIHHRGASIPADATTGCKDGFKWLTSEDPNPNIAYGALVGGP  480

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET++DSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  481  FLNETFVDSRNNSMQNEPSTYNSALVVGLLSSL  513



>ref|XP_010477219.1| PREDICTED: endoglucanase 2-like [Camelina sativa]
Length=517

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVW+S+WNALQHPV+SAFLA +YSDYML+S   +++CD + + PSDLR FA SQADY+LG
Sbjct  355  LVWVSEWNALQHPVSSAFLATLYSDYMLTSGIKELSCDDQSFKPSDLRTFARSQADYMLG  414

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGFKWL S +PNPNVA G LVGGP
Sbjct  415  KNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGFKWLNSDEPNPNVAYGALVGGP  474

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLN+T+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  475  FLNDTFIDARNNSMQNEPSTYNSALVVGLLSSL  507



>ref|XP_009398708.1| PREDICTED: endoglucanase 24-like [Musa acuminata subsp. malaccensis]
Length=524

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWI +W+ALQHPVA++FLAVVYSDYML+SRT++I C GK +TPSDLR FA SQADY+LG
Sbjct  362  LVWIDEWDALQHPVAASFLAVVYSDYMLTSRTSEIDCSGKTFTPSDLRDFATSQADYILG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMK+SYLVGYG +YP+ VHHRGASIP +A TGC +GF+WL ST PNPNVA+G LVGGP
Sbjct  422  NNPMKLSYLVGYGSSYPQQVHHRGASIPANAKTGC-NGFQWLSSTDPNPNVAMGALVGGP  480

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N++YIDSRNNSMQ EP+TYNSA++VGLLSGL
Sbjct  481  FQNDSYIDSRNNSMQGEPSTYNSAVLVGLLSGL  513



>ref|XP_010501531.1| PREDICTED: endoglucanase 2 [Camelina sativa]
Length=517

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPV+SAFLA +YSDYML+S   +++CD + + PSDLRKFA SQADY+LG
Sbjct  355  LIWVSEWNALQHPVSSAFLATLYSDYMLTSGIKELSCDDQSFKPSDLRKFARSQADYMLG  414

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGFKWL S +PNPNVA G LVGGP
Sbjct  415  KNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGFKWLNSEEPNPNVAYGALVGGP  474

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLL  202
            FLN+T+ID+RNNSMQ EP+TYNSA++VGLL
Sbjct  475  FLNDTFIDARNNSMQNEPSTYNSALVVGLL  504



>ref|XP_011100152.1| PREDICTED: endoglucanase 24-like [Sesamum indicum]
Length=528

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+ +W+ALQ+PVASAFLA+VYSDYML+S T  + CDG+ Y P DLR  A+ QADYVLG
Sbjct  365  LIWVREWDALQYPVASAFLALVYSDYMLTSHTRNLYCDGELYEPMDLRNLAIMQADYVLG  424

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPM MSYLVGYG +YP+YVHHRGASIPTDA TGC DGF WL ST PNPNVA+G LVGGP
Sbjct  425  NNPMNMSYLVGYGSSYPQYVHHRGASIPTDAKTGCSDGFMWLSSTAPNPNVAIGALVGGP  484

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N++YIDSRNN+ QAEPTTYNSA++VGLLSGL
Sbjct  485  FQNDSYIDSRNNTAQAEPTTYNSAVLVGLLSGL  517



>ref|XP_010941260.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941261.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941262.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941263.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941264.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
Length=524

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI QWN+LQHPVA++FLAVVYSDYML+SRT+++ C+G+ YTP DLRKFAMSQADY+LG
Sbjct  362  LIWIDQWNSLQHPVAASFLAVVYSDYMLTSRTSEVQCNGETYTPLDLRKFAMSQADYILG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMKMSYLVGYG +YP+ VHHRGASIP +A TGCK G++WL S  PNPN+A G LVGGP
Sbjct  422  DNPMKMSYLVGYGSSYPQQVHHRGASIPANANTGCK-GWQWLSSPNPNPNIATGALVGGP  480

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N++YID RNNSMQ+EP+TYNSA +VGLLSGL
Sbjct  481  FQNDSYIDLRNNSMQSEPSTYNSASLVGLLSGL  513



>ref|XP_009386441.1| PREDICTED: endoglucanase 24-like [Musa acuminata subsp. malaccensis]
Length=523

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWI +WNALQHPVA++FLAVVYSDYML+SRT +I C GK +TP+DLR FA SQADY+LG
Sbjct  361  LVWIDEWNALQHPVAASFLAVVYSDYMLTSRTPEIRCSGKSFTPTDLRNFATSQADYILG  420

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMK+SYLVGYG +YP+ VHHRGASIP +  TGCK GFKWL S  PNPNVA GGLVGGP
Sbjct  421  NNPMKLSYLVGYGSSYPQQVHHRGASIPANLDTGCK-GFKWLTSIAPNPNVATGGLVGGP  479

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N+++IDSRNNSMQ EP+TYNSA++VGLLSGL
Sbjct  480  FKNDSFIDSRNNSMQTEPSTYNSAVLVGLLSGL  512



>gb|KHN00484.1| Endoglucanase 24 [Glycine soja]
Length=509

 Score =   250 bits (638),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+  WN+LQH VASAFLAV+YSDYML+S+T  + C GK Y P DLRKFA+SQADYVLG
Sbjct  347  LIWVVPWNSLQHSVASAFLAVLYSDYMLTSQTEILYCSGKLYKPVDLRKFAISQADYVLG  406

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMSYLVGYG  YPKY+HHRG+SIP +ATTGCKDGFKW +S  PNPNVA G LVGGP
Sbjct  407  ENPMKMSYLVGYGTQYPKYIHHRGSSIPVNATTGCKDGFKWFDSPHPNPNVAFGALVGGP  466

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F +ETY D RNNSMQAEPTTY+SA+ V LLSGL
Sbjct  467  FFDETYNDFRNNSMQAEPTTYSSALFVALLSGL  499



>ref|XP_010029690.1| PREDICTED: endoglucanase 2-like [Eucalyptus grandis]
Length=527

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+++WN+L HPV SAFLAV+YSDYML+S T  + C  + YTP +LR FA+SQ DYVLG
Sbjct  364  LIWVTEWNSLLHPVGSAFLAVLYSDYMLTSGTEALFCSERSYTPGNLRDFAISQVDYVLG  423

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMK+SYLVG+G+NYP+YVHHRG+SIP DATTGCKDGFKWL S+ PNPNVAVG LVGGP
Sbjct  424  ENPMKLSYLVGFGENYPQYVHHRGSSIPADATTGCKDGFKWLNSSAPNPNVAVGALVGGP  483

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F NETY DSRNNSMQ EP+TYNSA+ VG+LSGL
Sbjct  484  FRNETYSDSRNNSMQGEPSTYNSALPVGVLSGL  516



>gb|KCW56649.1| hypothetical protein EUGRSUZ_I02356 [Eucalyptus grandis]
Length=523

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+++WN+L HPV SAFLAV+YSDYML+S T  + C  + YTP +LR FA+SQ DYVLG
Sbjct  360  LIWVTEWNSLLHPVGSAFLAVLYSDYMLTSGTEALFCSERSYTPGNLRDFAISQVDYVLG  419

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMK+SYLVG+G+NYP+YVHHRG+SIP DATTGCKDGFKWL S+ PNPNVAVG LVGGP
Sbjct  420  ENPMKLSYLVGFGENYPQYVHHRGSSIPADATTGCKDGFKWLNSSAPNPNVAVGALVGGP  479

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F NETY DSRNNSMQ EP+TYNSA+ VG+LSGL
Sbjct  480  FRNETYSDSRNNSMQGEPSTYNSALPVGVLSGL  512



>ref|XP_003519870.1| PREDICTED: endoglucanase 24-like [Glycine max]
Length=535

 Score =   250 bits (638),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+  WN+LQH VASAFLAV+YSDYML+S+T  + C GK Y P DLRKFA+SQADYVLG
Sbjct  373  LIWVVPWNSLQHSVASAFLAVLYSDYMLTSQTEILYCSGKLYKPVDLRKFAISQADYVLG  432

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMSYLVGYG  YPKY+HHRG+SIP +ATTGCKDGFKW +S  PNPNVA G LVGGP
Sbjct  433  ENPMKMSYLVGYGTQYPKYIHHRGSSIPVNATTGCKDGFKWFDSPHPNPNVAFGALVGGP  492

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F +ETY D RNNSMQAEPTTY+SA+ V LLSGL
Sbjct  493  FFDETYNDFRNNSMQAEPTTYSSALFVALLSGL  525



>ref|XP_009103373.1| PREDICTED: endoglucanase 2 [Brassica rapa]
Length=533

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+++WNALQHPV+SAFLA +YSDYML+S   K++C    + PSDLRKFA SQADY+LG
Sbjct  370  LIWVAEWNALQHPVSSAFLATLYSDYMLTSGVDKLSCGDTSFKPSDLRKFARSQADYMLG  429

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP  MSYLVGYGD YP++VHHRGASIP DA TGCKDGFKWL S +PNPNVA G LVGGP
Sbjct  430  KNPETMSYLVGYGDKYPEFVHHRGASIPGDANTGCKDGFKWLNSEEPNPNVAYGALVGGP  489

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  490  FLNETFIDARNNSMQNEPSTYNSALVVGLLSSL  522



>emb|CDY66396.1| BnaAnng22170D [Brassica napus]
Length=533

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+++WNALQHPV+SAFLA +YSDYML+S   K++C    + PSDLRKFA SQADY+LG
Sbjct  370  LIWVAEWNALQHPVSSAFLATLYSDYMLTSGVDKLSCGDTSFKPSDLRKFARSQADYMLG  429

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP  MSYLVGYGD YP++VHHRGASIP DA TGCKDGFKWL S +PNPNVA G LVGGP
Sbjct  430  KNPETMSYLVGYGDKYPEFVHHRGASIPGDANTGCKDGFKWLNSEEPNPNVAYGALVGGP  489

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  490  FLNETFIDARNNSMQNEPSTYNSALVVGLLSSL  522



>emb|CDY43425.1| BnaC07g14920D [Brassica napus]
Length=533

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+++WNALQHPV+SAFLA +YSDYML+S   K++C    + PSDLRKFA SQADY+LG
Sbjct  370  LIWVAEWNALQHPVSSAFLATLYSDYMLTSGVDKLSCGDTSFKPSDLRKFARSQADYMLG  429

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP  MSYLVGYGD YP++VHHRGASIP DA TGCKDGFKWL S +PNPNVA G LVGGP
Sbjct  430  KNPETMSYLVGYGDKYPEFVHHRGASIPGDANTGCKDGFKWLNSDEPNPNVAYGALVGGP  489

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  490  FLNETFIDARNNSMQNEPSTYNSALVVGLLSSL  522



>ref|XP_007046716.1| EG [Theobroma cacao]
 gb|EOX90873.1| EG [Theobroma cacao]
Length=527

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI++WN+LQHP+ASAFLA++YSDYML+S+T  + C G  Y P DLRKFAMSQADYVLG
Sbjct  364  LIWITEWNSLQHPMASAFLAIIYSDYMLTSQTETLYCSGNSYKPEDLRKFAMSQADYVLG  423

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPMK+SYLVGYG +YP+YVHHRGASIP DA TGCKDGF+WL S  PNPN+A G LVGGP
Sbjct  424  TNPMKISYLVGYGSSYPQYVHHRGASIPVDADTGCKDGFRWLNSDDPNPNIAFGALVGGP  483

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
             LN++Y+DSR N  Q EP+TYN+A+IVGLLSGL
Sbjct  484  SLNDSYLDSRKNVKQGEPSTYNTALIVGLLSGL  516



>gb|KJB63540.1| hypothetical protein B456_010G005200 [Gossypium raimondii]
Length=525

 Score =   247 bits (630),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI++W++LQHPV SAFLAV+YSDYM +S    ++C    + PSDLRKFA SQADYVLG
Sbjct  360  LIWITKWDSLQHPVGSAFLAVLYSDYMRASDNEILSCGDDSFEPSDLRKFAQSQADYVLG  419

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPM +SYLVGYG  YP++VHHRGASIP DATTGC +GFKWL S +PNPNVA+G LVGGP
Sbjct  420  DNPMDISYLVGYGGKYPEFVHHRGASIPVDATTGCSEGFKWLSSKKPNPNVAIGALVGGP  479

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F NE++IDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  480  FKNESFIDSRNNSMQTEPTTYNSAVLVGLLSSL  512



>gb|AID55379.1| glycoside hydrolase family 9 B7 [Gossypium hirsutum]
Length=525

 Score =   247 bits (630),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI++W++LQHPV SAFLAV+YSDYM +S    ++C    + PSDLRKFA SQADYVLG
Sbjct  360  LIWITKWDSLQHPVGSAFLAVLYSDYMRASDNEILSCGDDSFEPSDLRKFAQSQADYVLG  419

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPM +SYLVGYG  YP++VHHRGASIP DATTGC +GFKWL S +PNPNVA+G LVGGP
Sbjct  420  DNPMDISYLVGYGGKYPEFVHHRGASIPVDATTGCSEGFKWLSSKKPNPNVAIGALVGGP  479

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F NE++IDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  480  FKNESFIDSRNNSMQTEPTTYNSAVLVGLLSSL  512



>gb|KDO78852.1| hypothetical protein CISIN_1g048736mg [Citrus sinensis]
Length=550

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI +WN+LQHPVASAFLAV+YSDYM++S T  + C GK Y P DLRKFA+SQ DY+LG
Sbjct  387  LIWIVKWNSLQHPVASAFLAVLYSDYMIASGTETLYCSGKSYQPHDLRKFAISQVDYLLG  446

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM+MSYLVGYG+NYP YVHHRG+SIP DA TGC DGFKWLES  PNPNVA+G LVGGP
Sbjct  447  KNPMEMSYLVGYGNNYPLYVHHRGSSIPADANTGCTDGFKWLESESPNPNVAIGALVGGP  506

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            FLNE+YIDSRNNSMQ EPTTYNSA
Sbjct  507  FLNESYIDSRNNSMQGEPTTYNSA  530



>ref|XP_006426144.1| hypothetical protein CICLE_v10025306mg [Citrus clementina]
 gb|ESR39384.1| hypothetical protein CICLE_v10025306mg [Citrus clementina]
Length=550

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI +WN+LQHPVASAFLAV+YSDYM++S T  + C GK Y P DLRKFA+SQ DY+LG
Sbjct  387  LIWIVKWNSLQHPVASAFLAVLYSDYMIASGTETLYCSGKSYQPHDLRKFAISQVDYLLG  446

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM+MSYLVGYG+NYP YVHHRG+SIP DA TGC DGFKWLES  PNPNVA+G LVGGP
Sbjct  447  KNPMEMSYLVGYGNNYPLYVHHRGSSIPADANTGCTDGFKWLESESPNPNVAIGALVGGP  506

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            FLNE+YIDSRNNSMQ EPTTYNSA
Sbjct  507  FLNESYIDSRNNSMQGEPTTYNSA  530



>ref|NP_173423.1| glycosyl hydrolase 9B5 [Arabidopsis thaliana]
 sp|Q9FXI9.1|GUN2_ARATH RecName: Full=Endoglucanase 2; AltName: Full=Endo-1,4-beta glucanase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG12562.1|AC007797_22 Similar to endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AAK82507.1| At1g19940/F6F9_1 [Arabidopsis thaliana]
 gb|AAM47371.1| At1g19940/F6F9_1 [Arabidopsis thaliana]
 gb|AEE29915.1| probably endoglucanase [Arabidopsis thaliana]
Length=515

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPV+SAFLA +YSDYML+S   +++C  + + PSDLRKFA SQADY+LG
Sbjct  353  LIWVSEWNALQHPVSSAFLATLYSDYMLTSGVKELSCSDQSFKPSDLRKFARSQADYMLG  412

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP KMSYLVGYG+ YP++VHHRGASIP DATTGCKDGFKWL S +PNPNVA G LVGGP
Sbjct  413  KNPEKMSYLVGYGEKYPEFVHHRGASIPADATTGCKDGFKWLNSDEPNPNVAYGALVGGP  472

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVG  208
            FLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  473  FLNDTFIDARNNSMQNEPSTYNSALVVG  500



>ref|XP_010935039.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
Length=520

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWI QWN+LQHPVA++FLAVVYSDYML+SRTA++ C+G+ +TP DLRKFA+SQADYVLG
Sbjct  358  LVWIDQWNSLQHPVAASFLAVVYSDYMLTSRTAEVQCNGESFTPMDLRKFAISQADYVLG  417

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPM+MSYLVGYG +YP+ VHHRGASIP +A +GCK G++WL S  PNPNVA G LVGGP
Sbjct  418  DNPMEMSYLVGYGSSYPQQVHHRGASIPANANSGCK-GWQWLSSPDPNPNVATGALVGGP  476

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N++YID RNNSMQAEPTTY+SA +V LLSGL
Sbjct  477  FKNDSYIDLRNNSMQAEPTTYSSASLVALLSGL  509



>ref|XP_008799407.1| PREDICTED: endoglucanase 24-like [Phoenix dactylifera]
Length=524

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI QWN+LQHPVA++FLAVVYSDYML+SRT+++ C+G+ ++P DLRKFAM+QADY+LG
Sbjct  362  LIWIDQWNSLQHPVAASFLAVVYSDYMLTSRTSEMHCNGETFSPLDLRKFAMAQADYILG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMKMSYLVGYG NYP+ VHHRGASIP +A TGCK G++WL+S  PNPNVA G LVGGP
Sbjct  422  DNPMKMSYLVGYGSNYPQQVHHRGASIPANANTGCK-GWQWLKSPNPNPNVATGALVGGP  480

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N+++ID RNNSMQ+EP+TY+SA +VGLLSGL
Sbjct  481  FQNDSFIDLRNNSMQSEPSTYSSASLVGLLSGL  513



>ref|XP_006435158.1| hypothetical protein CICLE_v10003402mg, partial [Citrus clementina]
 gb|ESR48398.1| hypothetical protein CICLE_v10003402mg, partial [Citrus clementina]
Length=480

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI++WNALQHPVA AFLA +Y DYM  S    + CD K +   DLR+FA  QADYVLG
Sbjct  316  LIWIAEWNALQHPVAVAFLASLYGDYMEKSDNENLECDEKTFKSEDLREFAKKQADYVLG  375

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNP  MSYLVGY   +PK+VHHRGASIP DATTGCKDG++WLEST+PNPN A G LVGGP
Sbjct  376  DNPNSMSYLVGYSKKFPKFVHHRGASIPADATTGCKDGYQWLESTKPNPNEATGALVGGP  435

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F+NETYIDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  436  FMNETYIDSRNNSMQGEPTTYNSALLVGLLSSL  468



>ref|XP_003629333.1| Endoglucanase [Medicago truncatula]
 gb|AET03809.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=534

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  648  VWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLGD  469
            +W+  WN+LQH VASAFLAV+YSDYML+S+T  + C GK Y P DLRKFA+SQ +YVLG+
Sbjct  373  IWVVPWNSLQHSVASAFLAVLYSDYMLTSQTENLYCSGKMYKPVDLRKFAISQVEYVLGE  432

Query  468  NPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGPF  289
            NPMKMS+LVGYG NYPKY+HHRG+SIP +A TGCKDGFKW +S QPNPNVA G +VGGPF
Sbjct  433  NPMKMSFLVGYGSNYPKYIHHRGSSIPVNAKTGCKDGFKWYDSPQPNPNVAFGAIVGGPF  492

Query  288  LNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
             NETY D RNNSMQAEPTTY++A++V LLSGL
Sbjct  493  FNETYNDFRNNSMQAEPTTYSNALLVALLSGL  524



>ref|XP_010649048.1| PREDICTED: endoglucanase 24-like [Vitis vinifera]
 emb|CBI17386.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+++WN LQH VASAFLAV+YSDYML+S+T  + C GK+Y P+DLRKFA+SQ +YVLG
Sbjct  363  LIWVTEWNPLQHSVASAFLAVIYSDYMLTSKTETLYCSGKHYKPADLRKFAISQTEYVLG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPM M YLVG+G NYP+YVHHRGASIP DA TGC DGFKWLES  PNPN+AVG LVGGP
Sbjct  423  NNPMNMCYLVGHGSNYPQYVHHRGASIPVDAETGCHDGFKWLESLDPNPNLAVGALVGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            FLNETYIDSRNN+MQ EP+TYNSA
Sbjct  483  FLNETYIDSRNNTMQGEPSTYNSA  506



>gb|KDO84821.1| hypothetical protein CISIN_1g036398mg [Citrus sinensis]
Length=514

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI++WNALQHPVA AFLA +Y DYM  S    + CD K +   DLR+FA  QADYVLG
Sbjct  350  LIWIAEWNALQHPVAVAFLASLYGDYMEKSDNENLECDEKTFKSEDLREFAKKQADYVLG  409

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNP  MSYLVGY   +PK+VHHRGASIP DATTGCKDG++WLEST+PNPN A G LVGGP
Sbjct  410  DNPNSMSYLVGYSKKFPKFVHHRGASIPADATTGCKDGYQWLESTKPNPNEATGALVGGP  469

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F+NETYIDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  470  FMNETYIDSRNNSMQGEPTTYNSALLVGLLSSL  502



>ref|XP_006466419.1| PREDICTED: endoglucanase 2-like [Citrus sinensis]
Length=551

 Score =   246 bits (627),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI +WN+LQHPVASAFLAV+YSDYM++S T  + C GK Y P DLRKFA+SQ DY+LG
Sbjct  388  LIWIVKWNSLQHPVASAFLAVLYSDYMITSGTETLYCSGKSYQPHDLRKFAISQVDYLLG  447

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM+MSYLVGYG+NYP YVHHRG+SIP +A TGC DGFKWLES  PNPNVA+G LVGGP
Sbjct  448  KNPMEMSYLVGYGNNYPLYVHHRGSSIPANANTGCTDGFKWLESESPNPNVAIGALVGGP  507

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            FLNE+YIDSRNNSMQ EPTTYNSA
Sbjct  508  FLNESYIDSRNNSMQGEPTTYNSA  531



>ref|XP_009149490.1| PREDICTED: endoglucanase 2 [Brassica rapa]
 ref|XP_009149491.1| PREDICTED: endoglucanase 2 [Brassica rapa]
Length=525

 Score =   244 bits (624),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+++WNALQ PV+S+FLA +YSDYML+S    + C    + PSDLRKFA SQADY+LG
Sbjct  362  LIWVAEWNALQQPVSSSFLATLYSDYMLTSGIENLACGDTSFKPSDLRKFARSQADYMLG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP KMSYLVGYGD YP+YVHHRGASIP DA TGCKDGF+WL S +PNPNVA G LVGGP
Sbjct  422  KNPEKMSYLVGYGDKYPEYVHHRGASIPADANTGCKDGFEWLNSEEPNPNVAYGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLN+T+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  482  FLNDTFIDARNNSMQNEPSTYNSALVVGLLSSL  514



>ref|XP_010459672.1| PREDICTED: endoglucanase 2 [Camelina sativa]
 ref|XP_010459674.1| PREDICTED: endoglucanase 2 [Camelina sativa]
Length=518

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPV+SAFLA +YSDYML+S   +++CD + +  SDLRKFA SQADY+LG
Sbjct  355  LIWVSEWNALQHPVSSAFLATLYSDYMLTSGIKELSCDDQSFKSSDLRKFARSQADYMLG  414

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGFKWL S +PNPNVA G LVGGP
Sbjct  415  KNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGFKWLNSEEPNPNVAYGALVGGP  474

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVG  208
            FLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  475  FLNDTFIDARNNSMQNEPSTYNSALVVG  502



>ref|XP_011462352.1| PREDICTED: endoglucanase 2-like [Fragaria vesca subsp. vesca]
Length=531

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+ +WN LQH ++SAFLAV+YSDYM++S+T  + CDGK Y P DLR FA+SQADY LG
Sbjct  369  LIWVEEWNCLQHALSSAFLAVLYSDYMVASQTEMLYCDGKIYNPEDLRSFAISQADYALG  428

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPMKMSYLVGYG NYP+ VHHRG+SIP DA TGC DGFKWL S  PNPNVAVG LVGGP
Sbjct  429  KNPMKMSYLVGYGSNYPQQVHHRGSSIPVDADTGCSDGFKWLYSPDPNPNVAVGALVGGP  488

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N++Y+D RNNSMQ EP+TYNSA+IV LLSGL
Sbjct  489  FQNDSYMDIRNNSMQGEPSTYNSALIVALLSGL  521



>ref|XP_006307252.1| hypothetical protein CARUB_v10008868mg [Capsella rubella]
 gb|EOA40150.1| hypothetical protein CARUB_v10008868mg [Capsella rubella]
Length=517

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPV+SAFLA +YSDYML+S   + +C  + + PSDLRKFA SQADY+LG
Sbjct  354  LIWVSEWNALQHPVSSAFLATLYSDYMLTSGIKEFSCSDQSFKPSDLRKFARSQADYMLG  413

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGFKWL S +PNPNVA G LVGGP
Sbjct  414  KNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGFKWLNSEEPNPNVAYGALVGGP  473

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVG  208
            FLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  474  FLNDTFIDARNNSMQNEPSTYNSALVVG  501



>ref|XP_007156152.1| hypothetical protein PHAVU_003G262600g [Phaseolus vulgaris]
 gb|ESW28146.1| hypothetical protein PHAVU_003G262600g [Phaseolus vulgaris]
Length=534

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+  WN+LQH VASAFLA++YSDYM +S+T  + C GK Y P DLRKFA+SQADYVLG
Sbjct  372  LIWLVPWNSLQHSVASAFLAILYSDYMQTSQTEILYCGGKLYKPVDLRKFAISQADYVLG  431

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMSYLVGYG + P Y+HHRG+SIP +ATTGCKDGFKWL S  PNPNVA+G LVGGP
Sbjct  432  ENPMKMSYLVGYGTHNPNYIHHRGSSIPVNATTGCKDGFKWLYSPYPNPNVALGALVGGP  491

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETY D RNNSMQ EPTTYNSA+ V LLSGL
Sbjct  492  FLNETYNDFRNNSMQGEPTTYNSALFVALLSGL  524



>emb|CDY29381.1| BnaA06g14150D [Brassica napus]
Length=548

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+++WNALQ PV+S+FLA +YSDYML+S    + C    + PSDLRKFA SQADY+LG
Sbjct  355  LIWVAEWNALQQPVSSSFLATLYSDYMLTSGIENLACGDTSFKPSDLRKFARSQADYMLG  414

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP KMSYLVGYGD YP+YVHHRGASIP DA TGCKDGF+WL S +PNPNVA G LVGGP
Sbjct  415  KNPEKMSYLVGYGDKYPEYVHHRGASIPADANTGCKDGFEWLNSEEPNPNVAYGALVGGP  474

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLN+T+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  475  FLNDTFIDARNNSMQNEPSTYNSALVVGLLSSL  507



>ref|XP_006416450.1| hypothetical protein EUTSA_v10007364mg [Eutrema salsugineum]
 gb|ESQ34803.1| hypothetical protein EUTSA_v10007364mg [Eutrema salsugineum]
Length=523

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+++WNA+QHPV+SAFLA +YSDYML+S   + +C    + PSDLRKFA SQADY+LG
Sbjct  360  LIWVAEWNAMQHPVSSAFLATLYSDYMLTSGIEQFSCGDTSFKPSDLRKFARSQADYMLG  419

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGFKWL+S +PNPNVA G LVGGP
Sbjct  420  KNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGFKWLQSEEPNPNVAYGALVGGP  479

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVG  208
            FLNET+ID+RNNSMQ EP+TYNSA++VG
Sbjct  480  FLNETFIDARNNSMQNEPSTYNSALVVG  507



>ref|XP_008788648.1| PREDICTED: endoglucanase 24 [Phoenix dactylifera]
Length=524

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI QWN+LQHPVA++FLA+VYSDYML+SRTA++ C G+ +T  DLRKFA+SQADY+LG
Sbjct  362  LIWIDQWNSLQHPVAASFLAIVYSDYMLTSRTAEVQCSGETFTLMDLRKFAISQADYILG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMKMSYLVGYG +YP+ VHHRGASIP +A TGCK G++WL S  PNPNVA G +VGGP
Sbjct  422  DNPMKMSYLVGYGSSYPRQVHHRGASIPVNANTGCK-GWQWLSSADPNPNVATGAVVGGP  480

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N++YID RNNSMQ EP+TY+SA +VGLLSGL
Sbjct  481  FKNDSYIDLRNNSMQGEPSTYSSASLVGLLSGL  513



>gb|KFK44119.1| hypothetical protein AALP_AA1G218000 [Arabis alpina]
Length=517

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPV+S FLA +YSDYML+S   K++C  + + PSDLRKFA SQADY+LG
Sbjct  354  LIWVSEWNALQHPVSSGFLASLYSDYMLTSGIEKLSCSDQDFKPSDLRKFAKSQADYMLG  413

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP KMSYLVGYG+ YP++VHHRGASIP DA  GCKDGFKWL S +PNPNVA G LVGGP
Sbjct  414  KNPEKMSYLVGYGEKYPEFVHHRGASIPGDANVGCKDGFKWLNSEEPNPNVAYGALVGGP  473

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVG  208
            F+NET+ID+RNNSMQ EP+TYNSA++VG
Sbjct  474  FMNETFIDARNNSMQNEPSTYNSALVVG  501



>ref|XP_011083520.1| PREDICTED: endoglucanase 10 [Sesamum indicum]
Length=518

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQ  V+SAFLAVVYSDYML+SRTA I+C G  + PSDLR FA++QA+YVLG
Sbjct  355  LIWVSEWNALQQSVSSAFLAVVYSDYMLTSRTAHISCSGSTFKPSDLRDFAITQANYVLG  414

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPM++SY+VGYGDNYP+ VHHRGASIP D    CKDGFKWLE+  PNPN+A G LVGGP
Sbjct  415  DNPMQLSYIVGYGDNYPQQVHHRGASIPADENPSCKDGFKWLEADTPNPNIATGALVGGP  474

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            FLNETYID RNNSMQ EP+TYNSA
Sbjct  475  FLNETYIDVRNNSMQGEPSTYNSA  498



>ref|XP_002893081.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69340.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=516

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WNALQHPV+SAFLA +YSDYML+S   +++C  + + PSDLRKFA SQADY+LG
Sbjct  354  LIWVSEWNALQHPVSSAFLATLYSDYMLTSGIKELSCSDQSFKPSDLRKFARSQADYMLG  413

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGFKWL+S + NPNVA G LVGGP
Sbjct  414  KNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGFKWLDSDEQNPNVAYGALVGGP  473

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVG  208
            FLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  474  FLNDTFIDARNNSMQNEPSTYNSALVVG  501



>ref|XP_011043209.1| PREDICTED: endoglucanase 2-like [Populus euphratica]
Length=530

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+SQWN LQH +ASAFLAV++SDYM++++ + + C GK Y+P+DLR F++SQADY+LG
Sbjct  367  LIWVSQWNCLQHAMASAFLAVLFSDYMVTTQISTLYCHGKSYSPADLRDFSISQADYILG  426

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMSYLVGYG NYP+ VHHRGASIP DA T CKDGF WL+S  PNPNVAVG +VGGP
Sbjct  427  NNPMKMSYLVGYGSNYPQKVHHRGASIPVDANTTCKDGFTWLDSINPNPNVAVGAVVGGP  486

Query  291  FLNETYIDSRNNSMQAEPTTYNSAII  214
            FLNETYIDSRNN MQAEPTTYNSA++
Sbjct  487  FLNETYIDSRNNWMQAEPTTYNSALV  512



>ref|XP_004509346.1| PREDICTED: endoglucanase 10-like [Cicer arietinum]
Length=533

 Score =   242 bits (618),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+  WN+LQH VASAFLAV+YSDYML+S+T  + C GK Y P DLRKFA+SQ +YVLG
Sbjct  371  LIWVVPWNSLQHSVASAFLAVLYSDYMLTSQTEFLYCSGKMYKPVDLRKFAISQVEYVLG  430

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPM+MS++VGYG+ YPKY HHRG+SIP DA TGC+DGFKW +S QPNPNVA G LVGGP
Sbjct  431  ENPMRMSFVVGYGNEYPKYTHHRGSSIPFDAKTGCRDGFKWYDSPQPNPNVAFGALVGGP  490

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N+TY D RNNSMQAEPTTY++A++V LLSGL
Sbjct  491  FFNDTYNDFRNNSMQAEPTTYSNALLVALLSGL  523



>ref|XP_002462729.1| hypothetical protein SORBIDRAFT_02g030990 [Sorghum bicolor]
 gb|EER99250.1| hypothetical protein SORBIDRAFT_02g030990 [Sorghum bicolor]
Length=525

 Score =   237 bits (604),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS WN+LQH   +AFLAVVYSDYMLS+RTA + C GKYY+P+D+R FA SQA+Y+LG
Sbjct  363  LVWISGWNSLQHATNAAFLAVVYSDYMLSTRTAAVQCSGKYYSPTDIRNFAASQANYILG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF++L S+ PNPNVAVG LVGGP
Sbjct  423  DNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GFQYLHSSDPNPNVAVGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  482  FQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  514



>ref|XP_010113364.1| Endoglucanase 24 [Morus notabilis]
 gb|EXC35371.1| Endoglucanase 24 [Morus notabilis]
Length=544

 Score =   237 bits (605),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+  W+ LQH +ASAFLAV+Y DYML+S+T  + CDG+ YTP DLRKFAMSQ DYVLG
Sbjct  381  LIWVINWHCLQHSMASAFLAVLYGDYMLTSQTEILYCDGQSYTPEDLRKFAMSQVDYVLG  440

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM+MSYLVGYG+NYP+ VHHRG+SIP DA TGCKDGF+WL S +PNPN+A+G LVGGP
Sbjct  441  QNPMEMSYLVGYGNNYPQQVHHRGSSIPVDAKTGCKDGFEWLYSPKPNPNLAIGALVGGP  500

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVG  208
            FLNETY+D RNNSM +EP+TYN+A++V 
Sbjct  501  FLNETYVDYRNNSMLSEPSTYNNALLVA  528



>gb|KJB43353.1| hypothetical protein B456_007G195700, partial [Gossypium raimondii]
Length=521

 Score =   236 bits (603),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI++WN LQH VASAFLAV+YSDYML+S+T  + C G  Y P DLR FA+SQADYVLG
Sbjct  363  LIWITEWNPLQHAVASAFLAVLYSDYMLTSQTETLYCSGNSYKPDDLRNFAISQADYVLG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMSYLVGYG  YP YVHHRG+SIP +A T C+DGFKWL S  PNPN+AVG LVGGP
Sbjct  423  ENPMKMSYLVGYGSRYPLYVHHRGSSIPVNADTSCQDGFKWLYSDDPNPNIAVGALVGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
             LN++Y D+R+N  Q+EP+TYNSA++VGLLSGL
Sbjct  483  SLNDSYSDTRDNVKQSEPSTYNSALLVGLLSGL  515



>ref|XP_006340729.1| PREDICTED: endoglucanase 2-like [Solanum tuberosum]
Length=526

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVW++QWN  Q+ VAS+FLAVVYSDYMLSS+T+ + C GK Y P++LR FA+SQ DY+LG
Sbjct  361  LVWVNQWNPFQYSVASSFLAVVYSDYMLSSQTSNLYCSGKLYEPTELRNFAVSQLDYILG  420

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPM+MSYLVGYG  YP+ VHHRGASIP +A + C DGFKWL +  PNPNVAVG LVGGP
Sbjct  421  NNPMEMSYLVGYGSRYPQQVHHRGASIPVNANSNCSDGFKWLHTRHPNPNVAVGALVGGP  480

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
             L++TY+DSRNN  Q+EPTTYNSA+IVGL+SGL
Sbjct  481  SLSDTYMDSRNNISQSEPTTYNSALIVGLISGL  513



>gb|EEC84946.1| hypothetical protein OsI_32163 [Oryza sativa Indica Group]
Length=528

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS WN+LQH   +AFLAVVYSDYML+S+TA + C GKYY+P+D+R FA+SQA+Y+LG
Sbjct  366  LVWISGWNSLQHATNAAFLAVVYSDYMLTSQTAAVQCSGKYYSPTDIRNFAISQANYILG  425

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF++L ST PNPNVA+G LVGGP
Sbjct  426  DNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GFQYLHSTSPNPNVAMGALVGGP  484

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  485  FQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  517



>ref|NP_001063771.1| Os09g0533900 [Oryza sativa Japonica Group]
 sp|Q69SG5.1|GUN24_ORYSJ RecName: Full=Endoglucanase 24; AltName: Full=Endo-1,4-beta glucanase 
24; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD33331.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAF25685.1| Os09g0533900 [Oryza sativa Japonica Group]
 dbj|BAG94612.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGW30395.1| cellulase [Oryza sativa]
Length=528

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS WN+LQH   +AFLAVVYSDYML+S+TA + C GKYY+P+D+R FA+SQA+Y+LG
Sbjct  366  LVWISGWNSLQHATNAAFLAVVYSDYMLTSQTAAVQCSGKYYSPTDIRNFAISQANYILG  425

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF++L ST PNPNVA+G LVGGP
Sbjct  426  DNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GFQYLHSTSPNPNVAMGALVGGP  484

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  485  FQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  517



>gb|EEE70113.1| hypothetical protein OsJ_30126 [Oryza sativa Japonica Group]
Length=528

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS WN+LQH   +AFLAVVYSDYML+S+TA + C GKYY+P+D+R FA+SQA+Y+LG
Sbjct  366  LVWISGWNSLQHATNAAFLAVVYSDYMLTSQTAAVQCSGKYYSPTDIRNFAISQANYILG  425

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF++L ST PNPNVA+G LVGGP
Sbjct  426  DNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GFQYLHSTSPNPNVAMGALVGGP  484

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  485  FQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  517



>emb|CDY44194.1| BnaC05g15510D [Brassica napus]
Length=1131

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+++WNALQ PV+SAFLA +YSDY+L+S    ++C    + PSDLRKF+ SQADY+LG
Sbjct  377  LIWVAEWNALQQPVSSAFLATLYSDYLLTSGIENLSCGDTSFKPSDLRKFSRSQADYMLG  436

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP KMSYLVGYGD YP++VHHRGASIP DA TGCKDGFKWL S +PNPNVA G LVGGP
Sbjct  437  KNPEKMSYLVGYGDKYPEFVHHRGASIPADANTGCKDGFKWLNSEEPNPNVAYGALVGGP  496

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            FLN+T+ID+RNNSMQ EP+TYNSA++VGLLS
Sbjct  497  FLNDTFIDARNNSMQNEPSTYNSALVVGLLS  527



>gb|AEO97190.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97217.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=530

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVW+S+WN LQH +ASAFLAV++ DYM++++ + + C GK Y+P+DLR FA+SQADY+LG
Sbjct  367  LVWVSKWNCLQHAMASAFLAVLFGDYMVTTQISTLYCQGKSYSPADLRNFAISQADYILG  426

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMSYLVGYG NYP+ VHHRGASIP DA T CKDGF WL+S  PNPNVAVG +VGGP
Sbjct  427  NNPMKMSYLVGYGSNYPQNVHHRGASIPVDANTTCKDGFTWLDSINPNPNVAVGAVVGGP  486

Query  291  FLNETYIDSRNNSMQAEPTTYN  226
            FLNETYIDSRNN MQAEPTTYN
Sbjct  487  FLNETYIDSRNNWMQAEPTTYN  508



>ref|XP_006383120.1| hypothetical protein POPTR_0005s11750g [Populus trichocarpa]
 gb|ERP60917.1| hypothetical protein POPTR_0005s11750g [Populus trichocarpa]
Length=530

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVW+S+WN LQH +ASAFLAV++ DYM++++ + + C GK Y+P+DLR FA+SQADY+LG
Sbjct  367  LVWVSKWNCLQHAMASAFLAVLFGDYMVTTQISTLYCHGKSYSPADLRNFAISQADYILG  426

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMSYLVGYG NYP+ VHHRGASIP DA T CKDGF WL+S  PNPNVAVG +VGGP
Sbjct  427  NNPMKMSYLVGYGSNYPQNVHHRGASIPVDANTTCKDGFTWLDSINPNPNVAVGAVVGGP  486

Query  291  FLNETYIDSRNNSMQAEPTTYN  226
            FLNETYIDSRNN MQAEPTTYN
Sbjct  487  FLNETYIDSRNNWMQAEPTTYN  508



>gb|KDP46724.1| hypothetical protein JCGZ_06512 [Jatropha curcas]
Length=538

 Score =   235 bits (599),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+ +WN+LQ+ VASAF+A+++SDYM++S    + C G  Y+P++LR FA+SQADY+LG
Sbjct  375  LIWVVKWNSLQYSVASAFIALLFSDYMVASHIPTLYCSGILYSPTELRSFAISQADYILG  434

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM+MS+LVGYG+ YP+YVHHRG+SIP DA TGCKDGF+WL+S  PNPN+AVG LVGGP
Sbjct  435  KNPMEMSFLVGYGNEYPQYVHHRGSSIPVDAKTGCKDGFEWLDSPNPNPNIAVGALVGGP  494

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNETY DSR N +QAE TTYN A+IVGLLSGL
Sbjct  495  FLNETYNDSRRNIIQAEATTYNGALIVGLLSGL  527



>ref|NP_001145749.1| hypothetical protein [Zea mays]
 gb|ACL52523.1| unknown [Zea mays]
 tpg|DAA62473.1| TPA: hypothetical protein ZEAMMB73_855274 [Zea mays]
Length=526

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS WN+LQH   +AFL+VVYSDYMLS+RTA + C GKYY+P+D+R FA SQA+Y+LG
Sbjct  364  LVWISGWNSLQHATNAAFLSVVYSDYMLSTRTAAVQCSGKYYSPTDIRNFAASQANYILG  423

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMK+SYLVGYG +YPK VHHRGASIP DA TGCK GF++L S  PNPNVA G LVGGP
Sbjct  424  DNPMKLSYLVGYGSSYPKQVHHRGASIPADAKTGCK-GFEYLHSPSPNPNVATGALVGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  483  FQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  515



>ref|XP_006661478.1| PREDICTED: endoglucanase 24-like [Oryza brachyantha]
Length=498

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS WN+LQH   +AFLAVVYSDYML+S+TA + C GKYY+P+D+R FA+SQ +Y+LG
Sbjct  336  LVWISPWNSLQHATNAAFLAVVYSDYMLTSQTAAVQCSGKYYSPTDIRNFAISQVNYILG  395

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF++L S+ PNPNVA+G LVGGP
Sbjct  396  DNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GFQYLHSSSPNPNVAMGALVGGP  454

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N+T++DSR+N++Q E +TYNS  +VG+LSGL
Sbjct  455  FQNDTFVDSRDNALQTESSTYNSGTLVGVLSGL  487



>gb|AFZ78646.1| korrigan [Populus tomentosa]
Length=530

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L W+S+WN LQH +ASAFLAV++SDYM++++ + + C GK Y+P+D+R  A+SQADY+LG
Sbjct  367  LAWVSKWNCLQHAMASAFLAVLFSDYMVTTQISTLYCHGKSYSPADMRDLAISQADYILG  426

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMKMSYLVGYG NYP+ VHHRGASIP DA T CKDGF WL+S  PNPNVAVG +VGGP
Sbjct  427  NNPMKMSYLVGYGSNYPQNVHHRGASIPVDANTTCKDGFTWLDSINPNPNVAVGAVVGGP  486

Query  291  FLNETYIDSRNNSMQAEPTTYN  226
            FLNETYIDSRNN MQAEPTTYN
Sbjct  487  FLNETYIDSRNNWMQAEPTTYN  508



>ref|XP_004232483.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
Length=526

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVW++QWN  Q+ VAS+FLAVVYSDYMLSS+T+ + C GK Y P++LR FA+SQ DY+LG
Sbjct  361  LVWVNQWNPFQYSVASSFLAVVYSDYMLSSQTSNLYCSGKLYEPTELRNFAVSQLDYILG  420

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +N M+MSYLVGYG  YP+ VHHRGASIP +A + C DGFKWL +   NPNVAVG LVGGP
Sbjct  421  NNSMEMSYLVGYGSRYPQQVHHRGASIPVNANSNCSDGFKWLHTRHSNPNVAVGALVGGP  480

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
             L++TY+DSRNN  Q+EPTTYNSA+IVGL+SGL
Sbjct  481  SLSDTYMDSRNNISQSEPTTYNSALIVGLISGL  513



>ref|XP_004957464.1| PREDICTED: endoglucanase 24-like [Setaria italica]
Length=528

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   +AFLA+VYSDYMLS++TA + C GKYY+P+D+R FA SQA+Y+LG
Sbjct  366  LIWISGWNSLQHATNAAFLAIVYSDYMLSTQTAAVQCSGKYYSPTDIRNFAASQANYILG  425

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMK+SYLVGYG  YP+ VHHRGASIP DA TGCK GF++L S  PNPNVA+G LVGGP
Sbjct  426  DNPMKLSYLVGYGSVYPQQVHHRGASIPADAKTGCK-GFQYLHSPDPNPNVAMGALVGGP  484

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  485  FQNDTFVDSRDNALQTESSTYNSGTLVGLLSGL  517



>gb|EMT32027.1| Endoglucanase 24 [Aegilops tauschii]
Length=504

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS WN+LQH + +AFLAVVYSDYML+S+TA + C GKY++P+D+R FA+SQA+YVLG
Sbjct  342  LVWISGWNSLQHGINAAFLAVVYSDYMLTSQTAAVECSGKYFSPTDIRNFAISQANYVLG  401

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF++L S+ PNPNVA G +VGGP
Sbjct  402  DNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GFEYLHSSSPNPNVATGAVVGGP  460

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N++++D R+N++Q E +TYNS   VGLL+GL
Sbjct  461  FQNDSFVDLRDNAVQTESSTYNSGTFVGLLAGL  493



>ref|XP_009624009.1| PREDICTED: endoglucanase 2-like [Nicotiana tomentosiformis]
Length=527

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVW++QWN LQ+ VAS+FLAVVYSDYMLSS+T  + C G+ Y P++LR FA+ Q DY+LG
Sbjct  362  LVWVNQWNPLQYSVASSFLAVVYSDYMLSSQTPNLYCIGELYEPTELRNFAVLQLDYILG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPM+MSYLVGYG  YP+ VHHRGASIP D  + C DGFKWL + +PNPNVAVG LVGGP
Sbjct  422  NNPMEMSYLVGYGSRYPQQVHHRGASIPVDVNSNCSDGFKWLHTREPNPNVAVGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
             L++TY+DSRNN  Q+E TTYN+A+IVGL+SGL
Sbjct  482  SLSDTYMDSRNNISQSETTTYNTALIVGLISGL  514



>dbj|BAJ93299.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=531

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS WN+LQH + +AFLAVVYSDYML+S+TA + C GKY++P+D+R FA+SQA+YVLG
Sbjct  369  LVWISGWNSLQHGINAAFLAVVYSDYMLTSQTAAVECSGKYFSPTDIRNFAISQANYVLG  428

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DN MK+SYLVGYG NYP+ VHHRGASIP DA TGCK GF++L S+ PNPNVA+G +VGGP
Sbjct  429  DNTMKLSYLVGYGSNYPQQVHHRGASIPADAKTGCK-GFEYLHSSSPNPNVAMGAVVGGP  487

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N+T++D R+N++Q E +TYNS   VGLL+GL
Sbjct  488  FQNDTFVDLRDNAVQTESSTYNSGTFVGLLAGL  520



>ref|XP_003578508.1| PREDICTED: endoglucanase 24 [Brachypodium distachyon]
Length=529

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVWIS WN++QH   S FLA VYSDYML+S+TA + C GKY++P+D+R FA+SQA+Y+LG
Sbjct  367  LVWISGWNSIQHGTNSGFLASVYSDYMLTSQTAAVQCSGKYFSPTDIRNFAISQANYILG  426

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF++L S+ PNPNVA+G LVGGP
Sbjct  427  DNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GFEYLHSSSPNPNVAMGALVGGP  485

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N++++DSR+N++Q E +TYNS  +VGLL+GL
Sbjct  486  FQNDSFVDSRDNAVQTESSTYNSGTLVGLLAGL  518



>gb|EAZ38281.1| hypothetical protein OsJ_22659 [Oryza sativa Japonica Group]
Length=494

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++++WN+LQHPVASAFLA VYSDYM SS   +++C G+ ++P+DLRKFA SQADY+LG
Sbjct  332  LLYVAEWNSLQHPVASAFLAAVYSDYMQSSGKTELSCSGQGFSPADLRKFAKSQADYLLG  391

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPMK+SYLVGYGD YP+ VHHRGASIP D  TGC DG KWLE+++PNPNVA G LVGGP
Sbjct  392  SNPMKISYLVGYGDRYPEKVHHRGASIPEDVDTGC-DGHKWLETSKPNPNVATGALVGGP  450

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            + N++++D R+N MQ E TTYNSA++ GLLS L
Sbjct  451  YKNDSFVDERDNVMQNEATTYNSALVAGLLSAL  483



>ref|XP_003563568.1| PREDICTED: endoglucanase 18-like [Brachypodium distachyon]
Length=516

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++++ WN+LQHPVASAFLA VYSDYML+S   +++C  + ++P+DLRKFA SQADYVLG
Sbjct  354  LLYVADWNSLQHPVASAFLAAVYSDYMLTSGKTELSCGSQTFSPADLRKFAKSQADYVLG  413

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPMK+SYLVGYGD+YP+ VHHRGASIP D  TGC  G +WLES +PNPNVA G LVGGP
Sbjct  414  ENPMKVSYLVGYGDSYPQQVHHRGASIPADVDTGCG-GQEWLESPEPNPNVATGALVGGP  472

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N++++D R+N MQ E TTYNSA+IVGLLSG+
Sbjct  473  FRNDSFVDKRDNVMQNEATTYNSALIVGLLSGI  505



>ref|XP_009128120.1| PREDICTED: endoglucanase 10 [Brassica rapa]
 ref|XP_009128121.1| PREDICTED: endoglucanase 10 [Brassica rapa]
Length=526

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LV +S+WNALQ  V++AFLA ++SDYML+SR  KI+C+GK +  ++LR FA SQADY+LG
Sbjct  363  LVLVSEWNALQQSVSAAFLASLFSDYMLTSRLHKISCNGKIFKATELRDFAKSQADYILG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM MS++VGYGD YP+Y+HHRGASIP DATTGC DGF++  ST+PNPN+A G LVGGP
Sbjct  423  KNPMGMSFVVGYGDKYPEYIHHRGASIPEDATTGCLDGFEYFNSTKPNPNIAYGALVGGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET+ D+R+N  Q EPTTYN+A++VGL+S L
Sbjct  483  FLNETFRDARDNVRQNEPTTYNNALLVGLMSSL  515



>ref|XP_006390284.1| hypothetical protein EUTSA_v10018397mg [Eutrema salsugineum]
 gb|ESQ27570.1| hypothetical protein EUTSA_v10018397mg [Eutrema salsugineum]
Length=524

 Score =   226 bits (576),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVW+S+WN+LQ  V++AFLA ++SDYMLSSR  KI+CDGK +  ++LR FA SQADY+LG
Sbjct  361  LVWVSEWNSLQQSVSAAFLASLFSDYMLSSRIHKISCDGKIFKATELRDFAKSQADYMLG  420

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM MS++VGYGD YP++VHHRGASIP DATTGC DGFK+  ST+PNPN+A G LVGGP
Sbjct  421  KNPMGMSFVVGYGDKYPEFVHHRGASIPADATTGCLDGFKYFNSTKPNPNIAYGALVGGP  480

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            F NET++DSR+N MQ EPTTYN+A
Sbjct  481  FFNETFLDSRDNPMQNEPTTYNNA  504



>ref|NP_001058583.1| Os06g0715300 [Oryza sativa Japonica Group]
 sp|Q5Z9P8.1|GUN18_ORYSJ RecName: Full=Endoglucanase 18; AltName: Full=Endo-1,4-beta glucanase 
18 [Oryza sativa Japonica Group]
 dbj|BAD53575.1| putative endo-beta-1,4-D-glucanase [Oryza sativa Japonica Group]
 dbj|BAF20497.1| Os06g0715300 [Oryza sativa Japonica Group]
Length=518

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++++WN+LQHPVASAFLA VYSDYM SS   +++C G+ ++P+DLRKFA SQADY+LG
Sbjct  356  LLYVAEWNSLQHPVASAFLAAVYSDYMQSSGKTELSCSGQGFSPADLRKFAKSQADYLLG  415

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPMK+SYLVGYGD YP+ VHHRGASIP D  TGC DG KWLE+++PNPNVA G LVGGP
Sbjct  416  SNPMKISYLVGYGDRYPEKVHHRGASIPEDVDTGC-DGHKWLETSKPNPNVATGALVGGP  474

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            + N++++D R+N MQ E TTYNSA++ GLLS L
Sbjct  475  YKNDSFVDERDNVMQNEATTYNSALVAGLLSAL  507



>gb|EAZ02358.1| hypothetical protein OsI_24462 [Oryza sativa Indica Group]
Length=518

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++++WN+LQHPVASAFLA VYSDYM SS   +++C G+ ++P+DLRKFA SQADY+LG
Sbjct  356  LLYVAEWNSLQHPVASAFLAAVYSDYMQSSGKTELSCSGQGFSPADLRKFAKSQADYLLG  415

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPMK+SYLVGYGD YP+ VHHRGASIP D  TGC DG KWLE+++PNPNVA G LVGGP
Sbjct  416  SNPMKISYLVGYGDRYPEKVHHRGASIPEDVDTGC-DGHKWLETSKPNPNVATGALVGGP  474

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            + N++++D R+N MQ E TTYNSA++ GLLS L
Sbjct  475  YKNDSFVDERDNVMQNEATTYNSALVAGLLSAL  507



>ref|XP_010416457.1| PREDICTED: endoglucanase 10-like [Camelina sativa]
Length=525

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVW+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDGK +  ++LR FA SQADY+LG
Sbjct  362  LVWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRDFAKSQADYMLG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+  S++VGYGD YP++VHHRGASIPTDATTGC DGFKW  ST+PNPN+A G LVGGP
Sbjct  422  KNPLGTSFVVGYGDKYPEFVHHRGASIPTDATTGCLDGFKWFNSTKPNPNIAYGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            F NET+ DSR N MQ EPTTYN+A
Sbjct  482  FFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_009803640.1| PREDICTED: endoglucanase 2-like [Nicotiana sylvestris]
Length=527

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVW++QWN LQ+ VAS+FLAVVYSDYML S+T+ + C G+ Y P++LR FA+SQ DY+LG
Sbjct  362  LVWVNQWNPLQYSVASSFLAVVYSDYMLCSQTSNLYCSGELYEPTELRNFAVSQLDYILG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +N M++SYLVGYG  YP+ VHHRGASIP D  + C DGFKWL + +PNPNVAVG LVGGP
Sbjct  422  NNRMEISYLVGYGSRYPQQVHHRGASIPVDDNSNCSDGFKWLHTREPNPNVAVGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
             L++TY+D RNN  Q+E TTYNSA+IVGL+SGL
Sbjct  482  SLSDTYMDFRNNISQSETTTYNSALIVGLISGL  514



>gb|ABK24648.1| unknown [Picea sitchensis]
Length=532

 Score =   224 bits (572),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 121/155 (78%), Gaps = 2/155 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WI+QWNA+QH V SA L ++YSDY+L+SR   I C  K + P DLRKFA SQ DY+LG
Sbjct  367  LIWITQWNAIQHSVNSALLTLIYSDYLLTSRVENIKCGDKDFAPEDLRKFAFSQVDYILG  426

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT--GCKDGFKWLESTQPNPNVAVGGLVG  298
            +NPMKMSYLVG+G NYPK VHHRGASIP DA+T   C  GF W +S  PNPNV  G LVG
Sbjct  427  ENPMKMSYLVGFGGNYPKQVHHRGASIPADASTVYDCNSGFVWFKSKSPNPNVVTGALVG  486

Query  297  GPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            GPFLN+++ID R+N MQ EP+TYNSA +VGLLSGL
Sbjct  487  GPFLNDSFIDIRSNPMQNEPSTYNSAALVGLLSGL  521



>ref|XP_006302134.1| hypothetical protein CARUB_v10020139mg [Capsella rubella]
 gb|EOA35032.1| hypothetical protein CARUB_v10020139mg [Capsella rubella]
Length=525

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDGK +  ++LR FA SQADY+LG
Sbjct  362  LIWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRDFAKSQADYMLG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+  S++VGYGD YP++VHHRGASIP DATTGC DGFKW  ST+PNPN+A G LVGGP
Sbjct  422  KNPLGTSFVVGYGDKYPQFVHHRGASIPADATTGCLDGFKWFNSTKPNPNIAYGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            FLNET+ DSR N MQ EPTTYN+A
Sbjct  482  FLNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_010471690.1| PREDICTED: endoglucanase 10 [Camelina sativa]
Length=525

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVW+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDGK +  ++LR FA SQADY+LG
Sbjct  362  LVWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRDFAKSQADYMLG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+  S++VGYGD YP++VHHRGASIP DATTGC DGFKW  ST+PNPN+A G LVGGP
Sbjct  422  KNPLGTSFVVGYGDKYPEFVHHRGASIPADATTGCLDGFKWFNSTKPNPNIAYGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            F NET+ DSR N MQ EPTTYN+A
Sbjct  482  FFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_010428595.1| PREDICTED: endoglucanase 10-like [Camelina sativa]
Length=525

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LVW+S+WN+LQ  V+SAFLA ++SDYML+SR  KI+CDGK +  ++LR FA SQADY+LG
Sbjct  362  LVWVSEWNSLQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRDFAKSQADYMLG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+  S++VGYGD YP++VHHRGASIP DATTGC DGFKW  ST+PNPN+A G LVGGP
Sbjct  422  KNPLGTSFVVGYGDKYPEFVHHRGASIPADATTGCLDGFKWFNSTKPNPNIAYGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            F NET+ DSR N MQ EPTTYN+A
Sbjct  482  FFNETFTDSRENPMQNEPTTYNNA  505



>emb|CDY39048.1| BnaA02g17370D [Brassica napus]
Length=526

 Score =   223 bits (569),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LV +S+WNALQ  V++AFLA ++SDYML+SR  KI+C+GK +  ++LR FA SQADY+LG
Sbjct  363  LVLVSEWNALQQSVSAAFLASLFSDYMLTSRLHKISCNGKIFKATELRDFAKSQADYILG  422

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM MS++VGYGD YP+Y+HHRGASIP DATTGC DGF++  ST+PNPN+A G LV GP
Sbjct  423  KNPMGMSFVVGYGDKYPEYIHHRGASIPEDATTGCLDGFEYFNSTKPNPNIAYGALVRGP  482

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            FLNET+ D+R+N  Q EPTTYN+A++VGL+S L
Sbjct  483  FLNETFRDARDNVRQNEPTTYNNALLVGLMSSL  515



>ref|NP_177697.1| glycosyl hydrolase 9B7 [Arabidopsis thaliana]
 sp|Q8LCP6.2|GUN10_ARATH RecName: Full=Endoglucanase 10; AltName: Full=Endo-1,4-beta glucanase 
10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF87112.1|AC006434_8 F10A5.13 [Arabidopsis thaliana]
 gb|AAK64042.1| putative endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AAN12892.1| putative endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AEE35745.1| glycosyl hydrolase 9B7 [Arabidopsis thaliana]
Length=525

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDGK +  ++LR FA SQADY+LG
Sbjct  362  LIWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRDFAKSQADYMLG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+  S++VGYGD YP++VHHRGASIP DATTGC DGFKW  ST+PNPN+A G LVGGP
Sbjct  422  KNPLGTSFVVGYGDKYPQFVHHRGASIPADATTGCLDGFKWFNSTKPNPNIAYGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            F NET+ DSR N MQ EPTTYN+A
Sbjct  482  FFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_002889037.1| hypothetical protein ARALYDRAFT_895440 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65296.1| hypothetical protein ARALYDRAFT_895440 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDGK +  ++LR FA SQADY+LG
Sbjct  362  LIWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRDFAKSQADYMLG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+  S++VGYGD YP++VHHRGASIP DATTGC DGFKW  ST+PNPN+A G LVGGP
Sbjct  422  KNPLGTSFVVGYGDKYPQFVHHRGASIPADATTGCLDGFKWFNSTKPNPNIAYGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            F NET+ DSR N MQ EPTTYN+A
Sbjct  482  FFNETFTDSRENPMQNEPTTYNNA  505



>gb|AAM63477.1| endo-beta-1,4-glucanase, putative [Arabidopsis thaliana]
Length=525

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDGK +  ++LR FA SQADY+LG
Sbjct  362  LIWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRDFAKSQADYMLG  421

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NP+  S++VGYGD YP++VHHRGASIP DATTGC DGFKW  ST+PNPN+A G LVGGP
Sbjct  422  KNPLGTSFVVGYGDKYPQFVHHRGASIPADATTGCLDGFKWFNSTKPNPNIAYGALVGGP  481

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            F NET+ DSR N MQ EPTTYN+A
Sbjct  482  FFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_010530451.1| PREDICTED: endoglucanase 2-like [Tarenaya hassleriana]
Length=501

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 126/155 (81%), Gaps = 4/155 (3%)
 Frame = -1

Query  672  SAEPIRV---LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAK-ITCDGKYYTPSDLRK  505
            +A P R    L+W+S+WNALQ  VASAFLA +Y+DY++SS + + + C G+ + PS+L+ 
Sbjct  337  TASPSRTQSGLIWVSEWNALQEAVASAFLASLYADYIISSPSDQTLLCGGQSFDPSELKS  396

Query  504  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  325
            FA SQ DYVLG NPM MSYLVGYGD+YP+ VHHRGASIP +ATTGC DGF WL S +PNP
Sbjct  397  FAKSQVDYVLGQNPMNMSYLVGYGDSYPRQVHHRGASIPANATTGCTDGFVWLMSEEPNP  456

Query  324  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  220
            NVAVG LVGGPFLNETY+D RNN+MQAEPTTYN+A
Sbjct  457  NVAVGALVGGPFLNETYVDDRNNTMQAEPTTYNTA  491



>dbj|BAK04397.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=519

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++++WN+LQHPVASAFLA VY DYML+S   ++TC G+ ++P+DLRKFA SQADYVLG
Sbjct  356  LLYVAEWNSLQHPVASAFLAAVYGDYMLTSGKTELTCGGQSFSPADLRKFAQSQADYVLG  415

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMK+SYLVGYGD+YP+ VHHRGASIP+D  TGC  G +WLES  PNPNVA G LVGGP
Sbjct  416  DNPMKLSYLVGYGDSYPQRVHHRGASIPSDVNTGCG-GQEWLESPDPNPNVATGALVGGP  474

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIV  211
            F N++++D R N MQ E TTYNSA+IV
Sbjct  475  FKNDSFVDERQNVMQNEATTYNSALIV  501



>ref|XP_006656489.1| PREDICTED: endoglucanase 18-like [Oryza brachyantha]
Length=519

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++++WN+LQHPVASAFLA VYSDYML+S   +++C G+ ++P+DLRKFA SQADYVLG
Sbjct  357  LLYVAEWNSLQHPVASAFLAAVYSDYMLTSGKTELSCGGQSFSPADLRKFAKSQADYVLG  416

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPMK+SYLVGYGD YP+ VHHRGASIP D  TGC DG KWLES++ NPNVA G LVGGP
Sbjct  417  SNPMKISYLVGYGDRYPQRVHHRGASIPADVDTGC-DGHKWLESSKDNPNVATGALVGGP  475

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVG  208
            F N+T+ D R+N MQ E TTYNSA++ G
Sbjct  476  FKNDTFSDKRDNVMQNEATTYNSALVAG  503



>gb|EMS54236.1| Endoglucanase 18 [Triticum urartu]
Length=485

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++++ WN+LQHPVASAFLA VY DYML+S   ++TC G+ ++P+DLRKFA SQADYVLG
Sbjct  322  LLYVADWNSLQHPVASAFLAAVYGDYMLTSGKTELTCGGQSFSPADLRKFAQSQADYVLG  381

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMK+SYLVGYGD+YP+ VHHRGASIP D  TGC  G +WLES  PNPNVA G LVGGP
Sbjct  382  DNPMKLSYLVGYGDSYPQRVHHRGASIPADVNTGCG-GQEWLESPDPNPNVAAGALVGGP  440

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIV  211
            F N++++D R N MQ E TTYNSA+IV
Sbjct  441  FKNDSFVDERQNVMQNEATTYNSALIV  467



>ref|XP_002530743.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF31649.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=414

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 122/156 (78%), Gaps = 3/156 (2%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTP---SDLRKFAMSQADY  481
            L+W+ +WN LQ+ VASAFLAV++SDYM++S    + C G++Y     + LR     QADY
Sbjct  250  LIWVLKWNPLQYAVASAFLAVLFSDYMVASHIPTLYCSGQFYRQMIFAALRFRRCFQADY  309

Query  480  VLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLV  301
            VLG NPM+MS+LVGYG N+P+YVHHRG+SIP DA TGCKDGF WL S  PNPNV VG LV
Sbjct  310  VLGKNPMEMSFLVGYGLNFPRYVHHRGSSIPVDARTGCKDGFMWLHSQNPNPNVPVGALV  369

Query  300  GGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            GGPFLNETY+DSRNN+  AEPTTY+SA+ VGLLS L
Sbjct  370  GGPFLNETYVDSRNNTDIAEPTTYSSALFVGLLSAL  405



>emb|CDP04111.1| unnamed protein product [Coffea canephora]
Length=138

 Score =   206 bits (523),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  573  MLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGAS  394
            M  S T  + C+G  Y P DLR FA+SQA+YVLG NPMKMSYLVGY  +YPKYVHHRGAS
Sbjct  1    MFWSGTPTLYCNGDQYEPMDLRSFAISQANYVLGSNPMKMSYLVGYSSDYPKYVHHRGAS  60

Query  393  IPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAII  214
            IP DA TGCKDGFKWL S  PNPN+A G LVGGPFLN+TYIDSRNNS+QAEPTTYNSA I
Sbjct  61   IPADANTGCKDGFKWLRSPSPNPNIATGALVGGPFLNDTYIDSRNNSIQAEPTTYNSAFI  120

Query  213  VGLLSGL  193
            VGLLSGL
Sbjct  121  VGLLSGL  127



>ref|XP_002439027.1| hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
 gb|EER90394.1| hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
Length=522

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++++W++LQHPVASAFLA VYS+YM +S  +++TC GK +T  DLRKFA SQADYVLG
Sbjct  360  LLYVAEWDSLQHPVASAFLANVYSNYMATSGKSELTCSGKSFTALDLRKFAKSQADYVLG  419

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMK+SYLVG+GD YP+ VHHRGASIP D  TGC DG KWL+S  PNPNVA G LVGGP
Sbjct  420  DNPMKLSYLVGFGDTYPQRVHHRGASIPADVDTGC-DGQKWLKSPDPNPNVATGALVGGP  478

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVG  208
            F N++++D R N  Q EPTTYNSA++VG
Sbjct  479  FKNDSFVDDRENVQQNEPTTYNSALVVG  506



>ref|XP_004966453.1| PREDICTED: endoglucanase 18-like [Setaria italica]
Length=521

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++++WN+LQHPVASAFLA VYSDYM +S   ++TC GK +T +DLRKFA SQADYVLG
Sbjct  359  LLYVAEWNSLQHPVASAFLAAVYSDYMSTSGKTELTCSGKSFTAADLRKFAKSQADYVLG  418

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMK+SYLVG+GD+YP+ VHHRGASIP D  TGC DG +WL+S +PNPNVA G LVGGP
Sbjct  419  DNPMKLSYLVGFGDSYPQRVHHRGASIPADVDTGC-DGQEWLKSPKPNPNVATGALVGGP  477

Query  291  FLNETYIDSRNNSMQAEPTTYNSAII  214
            F N+++ID R N  Q E TTYNSA+I
Sbjct  478  FKNDSFIDDRENVRQNEATTYNSALI  503



>ref|NP_001066668.2| Os12g0428200 [Oryza sativa Japonica Group]
 dbj|BAF29687.2| Os12g0428200 [Oryza sativa Japonica Group]
Length=471

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++++WN+LQHPVASAFLA VYSDYM SSR  ++TC G+ ++PSDLRKFA SQADY+LG
Sbjct  202  LLYVAEWNSLQHPVASAFLAAVYSDYMQSSRKTELTCSGQGFSPSDLRKFAKSQADYLLG  261

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPMK+SYLVGYGD YP+ VHHRG SIP +  TGC D  KWLE+++PNPNV    LVGG 
Sbjct  262  SNPMKISYLVGYGDRYPERVHHRGISIPENVDTGC-DSHKWLETSKPNPNVTTDALVGGL  320

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            + N +++D R+N M  E TTYN A++ GLLS L
Sbjct  321  YKNNSFVDERDNVMHNEATTYNCALVAGLLSAL  353



>emb|CDY47506.1| BnaAnng09040D [Brassica napus]
Length=499

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LV +S WN LQ  V++AFLA ++SDYML+SR  KI+C+GK +  ++LR FA SQADY+LG
Sbjct  336  LVLVSDWNPLQQSVSAAFLASLFSDYMLTSRIHKISCNGKIFKATELRDFAKSQADYILG  395

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM MS++VGYGD YP+Y+HHRGASIP DATTGC DGFK+  ST+PNPN+A G LVGGP
Sbjct  396  KNPMGMSFVVGYGDKYPEYIHHRGASIPADATTGCLDGFKYFNSTKPNPNIAYGALVGGP  455

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            +LNET+ DSR N  Q EPTTYN+A
Sbjct  456  YLNETFSDSRENVRQNEPTTYNNA  479



>gb|ABA97969.1| Glycosyl hydrolase family 9 protein, expressed [Oryza sativa 
Japonica Group]
Length=694

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++++WN+LQHPVASAFLA VYSDYM SSR  ++TC G+ ++PSDLRKFA SQADY+LG
Sbjct  380  LLYVAEWNSLQHPVASAFLAAVYSDYMQSSRKTELTCSGQGFSPSDLRKFAKSQADYLLG  439

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPMK+SYLVGYGD YP+ VHHRG SIP +  TGC D  KWLE+++PNPNV    LVGG 
Sbjct  440  SNPMKISYLVGYGDRYPERVHHRGISIPENVDTGC-DSHKWLETSKPNPNVTTDALVGGL  498

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            + N +++D R+N M  E TTYN A++ GLLS L
Sbjct  499  YKNNSFVDERDNVMHNEATTYNCALVAGLLSAL  531



>ref|XP_009106216.1| PREDICTED: endoglucanase 10-like [Brassica rapa]
Length=527

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LV +S WN LQ  V++AFLA ++SDYML+SR  KI+C+GK +  ++LR FA SQADY+LG
Sbjct  364  LVLVSDWNPLQQSVSAAFLASLFSDYMLTSRIHKISCNGKIFKATELRDFAKSQADYILG  423

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPM MS++VGYGD YP+Y+HHRGASIP DATTGC D FK+  ST+PNPN+A G LVGGP
Sbjct  424  KNPMGMSFVVGYGDKYPEYIHHRGASIPADATTGCLDEFKYFNSTKPNPNIAYGALVGGP  483

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            +LNET+ DSR N  Q EPTTYN+A
Sbjct  484  YLNETFSDSRENVRQNEPTTYNNA  507



>ref|NP_001288527.1| uncharacterized protein LOC103626453 precursor [Zea mays]
 gb|AFW69494.1| hypothetical protein ZEAMMB73_138975 [Zea mays]
 gb|AGG19095.1| cellulase [Zea mays]
Length=521

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++++WN+LQHPVASAFLA VYS+YM +S  +++TC GK +T  DLR+FA SQADYVLG
Sbjct  359  LLYVAEWNSLQHPVASAFLANVYSNYMATSGKSELTCSGKSFTALDLRRFAKSQADYVLG  418

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            DNPMK+SYLVG+GD+YP+ VHHRGASIP    TGC DG +WL+S +PNPNVA G LVGGP
Sbjct  419  DNPMKLSYLVGFGDSYPQRVHHRGASIPAGVDTGC-DGQEWLKSPEPNPNVATGALVGGP  477

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            F N++++D R N  Q EPTTYNSA
Sbjct  478  FKNDSFVDDRENVQQNEPTTYNSA  501



>emb|CDX73186.1| BnaC06g36340D [Brassica napus]
Length=527

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LV +S WN LQ  V++AFLA ++SDYML+SR  KI+C+GK +  ++LR FA SQADY+LG
Sbjct  364  LVLVSDWNPLQQSVSAAFLASLFSDYMLTSRIHKISCNGKIFKATELRDFAKSQADYILG  423

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             N M MS++VGYGD YP+++HHRGASIP DATTGC DGFK+  ST+PNPN+A G LVGGP
Sbjct  424  KNSMGMSFVVGYGDKYPEFIHHRGASIPADATTGCLDGFKYFNSTKPNPNIAYGALVGGP  483

Query  291  FLNETYIDSRNNSMQAEPTTYNSA  220
            +LNET+ DSR N  Q EPTTYN+A
Sbjct  484  YLNETFSDSRENVRQNEPTTYNNA  507



>gb|EAZ20312.1| hypothetical protein OsJ_35923 [Oryza sativa Japonica Group]
Length=392

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++++WN+LQHPVASAFLA VYSDYM SSR  ++TC G+ ++PSDLRKFA SQADY+LG
Sbjct  202  LLYVAEWNSLQHPVASAFLAAVYSDYMQSSRKTELTCSGQGFSPSDLRKFAKSQADYLLG  261

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
             NPMK+SYLVGYGD YP+ VHHRG SIP +  TGC D  KWLE+++PNPNV    LVGG 
Sbjct  262  SNPMKISYLVGYGDRYPERVHHRGISIPENVDTGC-DSHKWLETSKPNPNVTTDALVGGL  320

Query  291  FLNETYIDSRNNSMQAEPTTYNSAI  217
            + N +++D R+N M  E TTYN A+
Sbjct  321  YKNNSFVDERDNVMHNEATTYNCAL  345



>ref|XP_002961546.1| hypothetical protein SELMODRAFT_77612 [Selaginella moellendorffii]
 gb|EFJ36806.1| hypothetical protein SELMODRAFT_77612 [Selaginella moellendorffii]
Length=562

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 115/153 (75%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+SQ NA+QH V SAFLAVVY+DY+ SS   +  C G  +   DLR FA SQADY+LG
Sbjct  399  LLWVSQRNAVQHAVGSAFLAVVYADYLSSSGVKQFRCSGNSFAAKDLRAFAASQADYILG  458

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPM  SYLVGYG N+P+ +HHR ASIP DA TGCKDGF+WL ++ PNP+VA G LVGGP
Sbjct  459  ENPMSKSYLVGYGANFPQQLHHREASIPLDAATGCKDGFRWLHASAPNPHVATGALVGGP  518

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N++Y D R+N+MQ E TTYNSA +  LL  L
Sbjct  519  FQNDSYSDLRDNTMQNEATTYNSAAMSALLVAL  551



>ref|XP_002971269.1| hypothetical protein SELMODRAFT_94888 [Selaginella moellendorffii]
 gb|EFJ27867.1| hypothetical protein SELMODRAFT_94888 [Selaginella moellendorffii]
Length=561

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 115/153 (75%), Gaps = 0/153 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W+SQ NA+QH V SAFLAVVY+DY+ SS   +  C G  +   DLR FA SQADY+LG
Sbjct  398  LLWVSQRNAVQHAVGSAFLAVVYADYLSSSGVKQFRCSGNSFAAKDLRAFAASQADYILG  457

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            +NPM  SYLVGYG N+P+ +HHR ASIP DA TGCKDGF+WL ++ PNP+VA G LVGGP
Sbjct  458  ENPMSKSYLVGYGANFPQQLHHREASIPLDAATGCKDGFRWLHASAPNPHVATGALVGGP  517

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F N++Y D R+N+MQ E TTYNSA +  LL  L
Sbjct  518  FQNDSYSDLRDNTMQNEATTYNSAAMSALLVAL  550



>ref|XP_001763275.1| predicted protein [Physcomitrella patens]
 gb|EDQ71805.1| predicted protein [Physcomitrella patens]
Length=475

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 114/154 (74%), Gaps = 1/154 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            ++WI QW+ALQH + SA LA  YSDY+ +++   I+C G  +TP++LR FA SQADYVLG
Sbjct  309  MLWIEQWSALQHGINSALLATFYSDYLSAAQLPGISCSGISFTPAELRSFAASQADYVLG  368

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT-GCKDGFKWLESTQPNPNVAVGGLVGG  295
             NP+  S++VGYG  YP+ +HHRGASIP + T   CK GF W +STQPNPN+A G +VGG
Sbjct  369  ANPLSTSFMVGYGAEYPQKLHHRGASIPVNPTVYDCKGGFIWFDSTQPNPNIAHGAIVGG  428

Query  294  PFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            PF NETY D+R+N +Q E +T+NSA +  L +GL
Sbjct  429  PFKNETYSDTRDNILQNEASTHNSAAMASLTAGL  462



>ref|XP_001781646.1| predicted protein [Physcomitrella patens]
 gb|EDQ53532.1| predicted protein [Physcomitrella patens]
Length=474

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 113/153 (74%), Gaps = 1/153 (1%)
 Frame = -1

Query  648  VWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLGD  469
            +W+++W+ALQH + SA LA  YSDY+++++++ ITC GK +T + LR FA SQA+YVLG+
Sbjct  309  IWLNEWSALQHGINSALLASFYSDYLVAAKSSGITCSGKSFTHAQLRAFASSQANYVLGN  368

Query  468  NPMKMSYLVGYGDNYPKYVHHRGASIPTDA-TTGCKDGFKWLESTQPNPNVAVGGLVGGP  292
            NP+  S++VGYG+ +PKY+HHRGASIP D   T C   + W +S +PNPN+A G +VGGP
Sbjct  369  NPLSTSFMVGYGEKHPKYLHHRGASIPVDQIKTDCAHSWGWYDSKEPNPNIAYGAVVGGP  428

Query  291  FLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            F NETY D+R N MQ E + Y SA   GL +GL
Sbjct  429  FKNETYTDARTNIMQNEASVYTSAAFAGLSAGL  461



>ref|XP_002966695.1| hypothetical protein SELMODRAFT_144066 [Selaginella moellendorffii]
 gb|EFJ32722.1| hypothetical protein SELMODRAFT_144066 [Selaginella moellendorffii]
Length=472

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 113/154 (73%), Gaps = 1/154 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            ++W+SQWN++QH V SAFL+ +Y+DY+ S+    ++C GK +    LR+ A  QADY+LG
Sbjct  304  MIWVSQWNSIQHAVNSAFLSCLYADYLSSAGITTLSCSGKIFQVEHLRELAGFQADYILG  363

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIP-TDATTGCKDGFKWLESTQPNPNVAVGGLVGG  295
             NPM MSY+VGYG  YP  +HHR ASIP T +   CK+GF++L ++ PNPN+A G LVGG
Sbjct  364  KNPMGMSYVVGYGKKYPLRLHHRAASIPSTLSEVECKEGFQYLHTSTPNPNIAEGALVGG  423

Query  294  PFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            PF N++++D R+NSMQ E T+YNSA +  L++ L
Sbjct  424  PFQNDSFVDDRDNSMQNEATSYNSAGLAALMASL  457



>ref|XP_002978046.1| hypothetical protein SELMODRAFT_417952 [Selaginella moellendorffii]
 gb|EFJ20703.1| hypothetical protein SELMODRAFT_417952 [Selaginella moellendorffii]
Length=551

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 113/154 (73%), Gaps = 1/154 (1%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            ++W+SQWN++QH V SAFL+ +Y+DY+ S+    ++C GK +    LR+ A  QADY+LG
Sbjct  383  MIWVSQWNSIQHAVNSAFLSCLYADYLSSAGITTLSCSGKIFEVEHLRELAGFQADYILG  442

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIP-TDATTGCKDGFKWLESTQPNPNVAVGGLVGG  295
             NPM MSY+VGYG  YP  +HHR ASIP T +   CK+GF++L ++ PNPN+A G LVGG
Sbjct  443  KNPMGMSYVVGYGKKYPLRLHHRAASIPSTLSEVECKEGFQYLHTSTPNPNIAEGALVGG  502

Query  294  PFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            PF N++++D R+NSMQ E T+YNSA +  L++ L
Sbjct  503  PFQNDSFVDDRDNSMQNEATSYNSAGLAALMASL  536



>gb|KHN34290.1| Endoglucanase 24 [Glycine soja]
Length=516

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 95/120 (79%), Gaps = 2/120 (2%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ--ADYV  478
            L+W+  WN+LQ  VAS FLAV+Y DYML+S+T  + C GK Y P DLRKF++SQ  ADYV
Sbjct  383  LIWVVPWNSLQLSVASVFLAVLYRDYMLTSQTEILYCSGKLYKPVDLRKFSISQFQADYV  442

Query  477  LGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGLVG  298
            LG+NPMKMSYLVGYG  YPKY+HHRG+SI  +ATTGCKDGFKW ES  PNPNVA G L+ 
Sbjct  443  LGENPMKMSYLVGYGTQYPKYLHHRGSSIAVNATTGCKDGFKWFESPHPNPNVAFGALIA  502



>gb|EPS65630.1| hypothetical protein M569_09145, partial [Genlisea aurea]
Length=483

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 107/159 (67%), Gaps = 6/159 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITC-DGKYYTPSDLRKFAMSQADYVL  475
            L+++ +WN LQ+  ++AFL   YS Y+   +TA + C DG+   P DL  FA SQADY+L
Sbjct  324  LLYVQKWNNLQYTSSAAFLMAAYSGYLSEGKTAVVNCPDGRQLQPLDLLNFARSQADYIL  383

Query  474  GDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT----TGCKDGFK-WLESTQPNPNVAVG  310
            G NPM +SYLVGYGD+YP  VHHRGASIP+ +      GC +G++ W  S++ NPNV  G
Sbjct  384  GKNPMSLSYLVGYGDHYPIRVHHRGASIPSTSVLRSAVGCAEGYEVWYGSSKGNPNVIFG  443

Query  309  GLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            GLVGGP  N+ + D R+N  Q EPT   +A +VGLLS L
Sbjct  444  GLVGGPDENDEFTDERSNYEQNEPTLSGTAPMVGLLSKL  482



>gb|AFN16945.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYMLS+RTAK+ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMLSTRTAKVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16938.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   145 bits (365),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C+GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCNGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16911.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16912.1| cellulase-like protein, partial [Panicum racemosum]
Length=107

 Score =   144 bits (364),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRSFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16859.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16860.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16861.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16862.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16863.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16864.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16865.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16866.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16867.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16868.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16869.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16870.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16871.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16872.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16873.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16874.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16875.1| cellulase-like protein, partial [Panicum amarum var. amarulum]
 gb|AFN16876.1| cellulase-like protein, partial [Panicum amarum var. amarulum]
 gb|AFN16878.1| cellulase-like protein, partial [Panicum amarum var. amarulum]
 gb|AFN16887.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16889.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16892.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16893.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16895.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16896.1| cellulase-like protein, partial [Panicum virgatum var. cubense]
 gb|AFN16897.1| cellulase-like protein, partial [Panicum virgatum var. cubense]
 gb|AFN16913.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16914.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16915.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16916.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16918.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16924.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16925.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16926.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16927.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16928.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16929.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16930.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16931.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16933.1| cellulase-like protein, partial [Panicum urvilleanum]
 gb|AFN16934.1| cellulase-like protein, partial [Panicum urvilleanum]
 gb|AFN16936.1| cellulase-like protein, partial [Panicum urvilleanum]
 gb|AFN16937.1| cellulase-like protein, partial [Panicum virgatum]
 gb|AFN16939.1| cellulase-like protein, partial [Panicum virgatum]
 gb|AFN16940.1| cellulase-like protein, partial [Panicum virgatum]
 gb|AFN16941.1| cellulase-like protein, partial [Panicum virgatum]
 gb|AFN16942.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   144 bits (364),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16906.1| cellulase-like protein, partial [Panicum mystasipum]
 gb|AFN16908.1| cellulase-like protein, partial [Panicum olyroides]
 gb|AFN16909.1| cellulase-like protein, partial [Panicum olyroides]
Length=107

 Score =   144 bits (364),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   +AFLA+VYSDYMLS+RTA++ C GKYY+PSD+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNAAFLALVYSDYMLSTRTAEVQCSGKYYSPSDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16888.1| cellulase-like protein, partial [Panicum chloroleucum]
Length=107

 Score =   144 bits (364),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVRCSGKYYSPTDIRNFATSQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16885.1| cellulase-like protein, partial [Panicum chloroleucum]
Length=107

 Score =   144 bits (364),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMLSARTAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16884.1| cellulase-like protein, partial [Panicum cervicatum]
 gb|AFN16905.1| cellulase-like protein, partial [Panicum mystasipum]
 gb|AFN16919.1| cellulase-like protein, partial [Panicum rudgei]
Length=107

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   +AFLA+VYSDYMLS+RTA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNAAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>ref|XP_006847867.1| hypothetical protein AMTR_s00029p00087270 [Amborella trichopoda]
 gb|ERN09448.1| hypothetical protein AMTR_s00029p00087270 [Amborella trichopoda]
Length=617

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 102/158 (65%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++  WN +Q   +SAFL VVYSDY L +  A + C      PS+L  FA SQADY+LG
Sbjct  329  LLYVGDWNNMQFVSSSAFLVVVYSDY-LRAANAPLNCPEAQLHPSNLISFAQSQADYILG  387

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT----GCKDGFK-WLESTQPNPNVAVGG  307
             NP  MSYLVG+G NYP  VHHRGASI + A +     C +GF+ W    Q +PN+ VG 
Sbjct  388  KNPRAMSYLVGFGPNYPTRVHHRGASIVSKAVSPAPVRCLEGFESWFNREQRDPNILVGA  447

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP  N+ +ID R+N  Q EPTTYN A ++GL + L
Sbjct  448  LVGGPDRNDRFIDERSNYEQTEPTTYNVAPLIGLFAKL  485



>ref|XP_010058568.1| PREDICTED: endoglucanase 14-like [Eucalyptus grandis]
Length=492

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W   WN LQ+   +AF+A VY+DY L S+ A I C G   + SDL + A SQADY+LG
Sbjct  335  LLWFQPWNNLQYTSTAAFIAAVYADY-LDSKKASIQCPGGIASSSDLIELAQSQADYILG  393

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKDGFK-WLESTQPNPNVAVGG  307
            +NP K+SY+VGYG NYP  VHHRGA   SI  D T   C  GF  W     PNPNV  G 
Sbjct  394  ENPNKLSYMVGYGSNYPTQVHHRGASIVSIKKDPTPVSCSQGFDLWFNKNAPNPNVLDGA  453

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + Y DSR+N   AEP T N+A  VG+L+ L
Sbjct  454  LVGGPDQQDGYSDSRSNYQMAEPATANTAPFVGVLARL  491



>gb|KCW73256.1| hypothetical protein EUGRSUZ_E01717 [Eucalyptus grandis]
Length=475

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W   WN LQ+   +AF+A VY+DY L S+ A I C G   + SDL + A SQADY+LG
Sbjct  318  LLWFQPWNNLQYTSTAAFIAAVYADY-LDSKKASIQCPGGIASSSDLIELAQSQADYILG  376

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKDGFK-WLESTQPNPNVAVGG  307
            +NP K+SY+VGYG NYP  VHHRGA   SI  D T   C  GF  W     PNPNV  G 
Sbjct  377  ENPNKLSYMVGYGSNYPTQVHHRGASIVSIKKDPTPVSCSQGFDLWFNKNAPNPNVLDGA  436

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + Y DSR+N   AEP T N+A  VG+L+ L
Sbjct  437  LVGGPDQQDGYSDSRSNYQMAEPATANTAPFVGVLARL  474



>gb|AFN16894.1| cellulase-like protein, partial [Panicum chloroleucum]
Length=107

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYMLS++TA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMLSTQTAEVQCSGKYYSPTDIRNFATSQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>ref|XP_003519454.1| PREDICTED: endoglucanase 11 [Glycine max]
Length=524

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 97/156 (62%), Gaps = 6/156 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ QWN +Q+   +AFL  +YSD+ L S   K+ C G      ++  FA SQADY+LG
Sbjct  347  LIYVRQWNNMQYVSTAAFLLSIYSDF-LQSTNQKLNCHGGTVDHEEILNFAKSQADYILG  405

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG NYPK VHHRGASI          GC  G+  W  S  PNPNV VG 
Sbjct  406  SNPMNMSYLVGYGPNYPKRVHHRGASIVSYKKNKGFIGCTQGYDNWYGSQAPNPNVLVGA  465

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            LVGGP   + + D RNN MQ E  TYN+A +VG+ +
Sbjct  466  LVGGPDGKDNFEDRRNNFMQTEACTYNTAPLVGVFA  501



>gb|AFN16886.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16890.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16935.1| cellulase-like protein, partial [Panicum urvilleanum]
Length=107

 Score =   142 bits (359),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYMLS++TA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMLSTQTAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|KHN38485.1| Endoglucanase 11 [Glycine soja]
Length=514

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 97/156 (62%), Gaps = 6/156 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ QWN +Q+   +AFL  +YSD+ L S   K+ C G      ++  FA SQADY+LG
Sbjct  337  LIYVRQWNNMQYVSTAAFLLSIYSDF-LQSTNQKLNCHGGTVDHEEILNFAKSQADYILG  395

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG NYPK VHHRGASI          GC  G+  W  S  PNPNV VG 
Sbjct  396  SNPMNMSYLVGYGPNYPKRVHHRGASIVSYKKNKGFIGCTQGYDNWYGSQAPNPNVLVGA  455

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            LVGGP   + + D RNN MQ E  TYN+A +VG+ +
Sbjct  456  LVGGPDGKDNFEDRRNNFMQTEACTYNTAPLVGVFA  491



>gb|AFN16879.1| cellulase-like protein, partial [Panicum aquaticum]
 gb|AFN16882.1| cellulase-like protein, partial [Panicum bergii]
 gb|AFN16901.1| cellulase-like protein, partial [Panicum gouinii]
 gb|AFN16910.1| cellulase-like protein, partial [Panicum pedersenii]
 gb|AFN16923.1| cellulase-like protein, partial [Panicum stramineum]
Length=107

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSSYPQQVHHRGA  107



>gb|AFN16877.1| cellulase-like protein, partial [Panicum amarum var. amarulum]
Length=107

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS W++LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWSSLQHATNSAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16922.1| cellulase-like protein, partial [Panicum stramineum]
Length=107

 Score =   142 bits (358),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   +AFLA+VYSDYMLS+RTA++ C GKYY+PSD+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNAAFLALVYSDYMLSTRTAEVQCSGKYYSPSDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSSYPQQVHHRGA  107



>ref|XP_010264780.1| PREDICTED: endoglucanase 12-like [Nelumbo nucifera]
Length=628

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W   WN LQ+  ++ F+A  YS+Y+ ++R A I C G    PSDL  F  SQA+Y+LG
Sbjct  471  LLWWQPWNDLQYTTSAMFVATAYSEYLTAAR-ATIQCQGGRVGPSDLISFVRSQANYILG  529

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKDGFK-WLESTQPNPNVAVGG  307
             NP  MSY+VG+G +YP+ VHHRGA   SI  D T   CK G+  W     PNPNV VG 
Sbjct  530  SNPKGMSYMVGFGSSYPQMVHHRGASIVSIKKDRTPVTCKGGYDMWFNRNAPNPNVLVGA  589

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            +VGGP  N+ Y DSR+N  QAEP T N+A  VG+L+ L
Sbjct  590  IVGGPDQNDAYTDSRSNFQQAEPATVNTAPFVGVLAKL  627



>ref|XP_003616918.1| Endoglucanase [Medicago truncatula]
 gb|AES99876.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=517

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 95/156 (61%), Gaps = 6/156 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ QWN +QH   ++FL  +YSDY L +   K+TC G      ++  FA SQ DY+LG
Sbjct  340  LLYVRQWNNMQHVSTASFLLTIYSDY-LKNTNQKLTCHGGILDHKEILSFAKSQVDYILG  398

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG +YPK VHHRGASI          GC  G+  W     PNPNV VG 
Sbjct  399  SNPMNMSYLVGYGPSYPKRVHHRGASIMSYKENKGFIGCTQGYDNWYSKEDPNPNVLVGA  458

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            LVGGP   + + D RNN MQ E  TYN+A +V L +
Sbjct  459  LVGGPDWQDNFEDKRNNFMQTEACTYNTAPLVALFA  494



>gb|AFK38997.1| unknown [Medicago truncatula]
Length=517

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 95/156 (61%), Gaps = 6/156 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ QWN +QH   ++FL  +YSDY L +   K+TC G      ++  FA SQ DY+LG
Sbjct  340  LLYVRQWNNMQHVSTASFLFTIYSDY-LKNTNQKLTCHGGILDHKEILSFAKSQVDYILG  398

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG +YPK VHHRGASI          GC  G+  W     PNPNV VG 
Sbjct  399  SNPMNMSYLVGYGPSYPKRVHHRGASIMSYKENKGFIGCTQGYDNWYSKEDPNPNVLVGA  458

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            LVGGP   + + D RNN MQ E  TYN+A +V L +
Sbjct  459  LVGGPDWQDNFEDKRNNFMQTEACTYNTAPLVALFA  494



>gb|AFN16946.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   142 bits (357),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH    AFLA+VYSDYMLS+RTA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNPAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>ref|XP_010666165.1| PREDICTED: endoglucanase 14-like [Beta vulgaris subsp. vulgaris]
Length=484

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 99/156 (63%), Gaps = 6/156 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W + W+ LQ+   + F+  +Y+DY+ +S  + + C      P DL  FA SQ DY+LG
Sbjct  327  LLWFNDWDNLQYTSTATFVITIYADYLFASEKS-LNCPSSLVNPPDLIAFAKSQVDYILG  385

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKDGF-KWLESTQPNPNVAVGG  307
             NP   SY+VGYG NYP+ VHHRG+   SI  D T  GCKDGF  W    QPNPNV VG 
Sbjct  386  ANPKNTSYMVGYGSNYPQQVHHRGSSIVSIKKDPTPVGCKDGFTNWFNKNQPNPNVLVGA  445

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            +VGGP  N+ Y+D R++   AEP T NSA +VG+L+
Sbjct  446  IVGGPDKNDNYVDQRSDYQLAEPATANSAGLVGVLA  481



>gb|AFN16920.1| cellulase-like protein, partial [Setaria palmifolia]
 gb|AFN16921.1| cellulase-like protein, partial [Setaria palmifolia]
Length=107

 Score =   142 bits (357),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   +AFLA+VYSDYMLS+RTA + C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNAAFLAIVYSDYMLSTRTAAVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG  YP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSTYPRQVHHRGA  107



>gb|AFN16904.1| cellulase-like protein, partial [Panicum miliaceum]
Length=107

 Score =   141 bits (356),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYM+S+RTA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMISTRTAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSSYPQQVHHRGA  107



>gb|AFN16944.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   141 bits (356),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVG G NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGNGSNYPQQVHHRGA  107



>gb|AFN16891.1| cellulase-like protein, partial [Panicum chloroleucum]
Length=107

 Score =   141 bits (356),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            D+PM++SYLVGYG NYP+ VHHRGA
Sbjct  83   DSPMRLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16881.1| cellulase-like protein, partial [Panicum bergii]
 gb|AFN16883.1| cellulase-like protein, partial [Panicum capillare]
 gb|AFN16903.1| cellulase-like protein, partial [Panicum miliaceum]
 gb|AFN16907.1| cellulase-like protein, partial [Panicum nephelophilum]
Length=107

 Score =   141 bits (356),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   +AFLA+VYSDYMLS+RTA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNAAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSSYPQQVHHRGA  107



>gb|AFN16880.1| cellulase-like protein, partial [Panicum aquaticum]
 gb|AFN16898.1| cellulase-like protein, partial [Panicum dichotomiflorum]
 gb|AFN16899.1| cellulase-like protein, partial [Panicum dichotomiflorum]
Length=107

 Score =   141 bits (356),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYMLS+ TA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMLSTGTAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|EYU29517.1| hypothetical protein MIMGU_mgv1a003302mg [Erythranthe guttata]
Length=593

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 103/158 (65%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ +WN LQ+  +SAFL  VYSDY+  S++  + C      P +L  FA SQADY+LG
Sbjct  336  LLYVREWNNLQYTASSAFLLAVYSDYLAKSKSV-VKCPSVQVQPQELLTFAKSQADYILG  394

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNPNVAVGG  307
             NP  MSYLVG+G +YP +VHHRGASI +     +  GC +GF+ W +  + +PNV  G 
Sbjct  395  KNPKSMSYLVGFGQSYPLHVHHRGASITSISLLKSAVGCVEGFESWYKRVEADPNVIYGA  454

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP  N+ Y DSR+N  Q+EPT   +A +VGL S L
Sbjct  455  LVGGPNANDEYFDSRSNYEQSEPTISGTAPLVGLFSRL  492



>ref|XP_011047209.1| PREDICTED: endoglucanase 11-like [Populus euphratica]
 ref|XP_011047210.1| PREDICTED: endoglucanase 11-like [Populus euphratica]
Length=528

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 97/158 (61%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+ I QWN +Q+   +AFL  VYSD++L+S   K+ C G    P ++  FA SQ DY+LG
Sbjct  352  LLHIRQWNNMQYVSTAAFLLTVYSDFLLNS-NQKLKCHGGSVDPEEILGFAKSQVDYILG  410

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W    +PNPNV VG 
Sbjct  411  SNPMNMSYLVGYGPKYPARVHHRGASIVSYRENKGFIGCTQGYDNWYGREEPNPNVLVGA  470

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R+N MQ E  TYN+A +VG+ + L
Sbjct  471  LVGGPDCQDNFTDQRSNYMQTEACTYNTAPLVGVFAKL  508



>gb|AFN16917.1| cellulase-like protein, partial [Panicum racemosum]
Length=107

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYMLS++ A++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMLSTQAAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16932.1| cellulase-like protein, partial [Urochloa plantaginea]
Length=107

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   +AFL+VVYSDYMLS+RTA + C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNAAFLSVVYSDYMLSTRTAAVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSSYPQQVHHRGA  107



>ref|XP_010252537.1| PREDICTED: endoglucanase 11-like [Nelumbo nucifera]
Length=526

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 96/156 (62%), Gaps = 5/156 (3%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL  VYSDY+      K+ C G    P ++  FA+SQ DY+LG
Sbjct  348  LLYIRQWNNMQYVSTAAFLLTVYSDYLQRYSDQKLNCPGGEVGPREILDFAISQVDYILG  407

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP+ VHHRGASI     +    GC  G+  W    + NPNV VG 
Sbjct  408  SNPMGMSYLVGYGPKYPRRVHHRGASIVSYRESKGFIGCTQGYDNWYGRDEANPNVLVGA  467

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            LVGGP   + + D R+N MQ E  TYN+A +VGL +
Sbjct  468  LVGGPDCQDNFRDRRSNFMQTEACTYNTAPLVGLFA  503



>ref|XP_007215908.1| hypothetical protein PRUPE_ppa004172mg [Prunus persica]
 gb|EMJ17107.1| hypothetical protein PRUPE_ppa004172mg [Prunus persica]
Length=525

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 99/156 (63%), Gaps = 6/156 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL  VYSD++ SS   K++C G      ++  FA SQ DY+LG
Sbjct  351  LLYIRQWNNMQYVSTAAFLLTVYSDFLKSS-NQKLSCHGGMVGHEEVLDFAKSQIDYILG  409

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP+ VHHRGAS+ +        GC  G+  W    +PNPNV VG 
Sbjct  410  SNPMNMSYLVGYGPKYPQRVHHRGASVESYRENKGFIGCTQGYDNWYGREEPNPNVLVGA  469

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            LVGGP   + ++D R+N MQ E  TYN+A +VG+ +
Sbjct  470  LVGGPDCQDNFVDQRDNYMQTEACTYNTAPLVGVFA  505



>gb|EYU26799.1| hypothetical protein MIMGU_mgv1a020424mg [Erythranthe guttata]
Length=458

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 104/158 (66%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W   W+ LQ+  +++F+   Y+DY+  +R A + C G    P+DL  FA SQ DY+LG
Sbjct  300  LLWFLPWSNLQYVNSASFIMSAYADYLSKAR-ATLRCAGGAVGPNDLISFARSQVDYILG  358

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKDGF-KWLESTQPNPNVAVGG  307
            +NP ++SY+VG+G NYPK VHHRGA   SI  D T  GC+DGF  W      NPNV  G 
Sbjct  359  NNPKRLSYMVGFGSNYPKRVHHRGASIVSIKKDRTRVGCQDGFNNWYNRNADNPNVITGA  418

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            +VGGP  ++ Y D+RNN  QAEP+T N+A +VG+L+ L
Sbjct  419  IVGGPDQSDQYTDARNNYQQAEPSTANNAPLVGVLARL  456



>ref|XP_008230008.1| PREDICTED: endoglucanase 11 [Prunus mume]
Length=526

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 99/156 (63%), Gaps = 6/156 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL  VYSD++ SS   K++C G      ++  FA SQ DY+LG
Sbjct  352  LLYIRQWNNMQYVSTAAFLLTVYSDFLKSS-NQKLSCHGGMVGHEEVLDFAKSQTDYILG  410

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP+ VHHRGAS+ +        GC  G+  W    +PNPNV VG 
Sbjct  411  ANPMNMSYLVGYGPKYPQRVHHRGASVESYRENKGFIGCTQGYDNWYGRDEPNPNVLVGA  470

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            LVGGP   + ++D R+N MQ E  TYN+A +VG+ +
Sbjct  471  LVGGPDCQDNFVDQRDNYMQTEACTYNTAPLVGVFA  506



>gb|KJB13746.1| hypothetical protein B456_002G092400 [Gossypium raimondii]
Length=452

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL  VYSDY+ +S   ++ CD     P ++  FA SQADY+LG
Sbjct  278  LLYIRQWNNMQYVSNAAFLLTVYSDYLRAS-NQRLRCDRGKVGPEEVLLFARSQADYILG  336

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP+ +HHRGASI +        GC  G+  W     PNPNV VG 
Sbjct  337  ANPMGMSYLVGYGSRYPQRMHHRGASIESYRENKGFIGCTQGYDYWYPRNDPNPNVVVGA  396

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R N MQ E  TYN+A +VG+L+ L
Sbjct  397  LVGGPDHMDRFSDDRKNFMQTEACTYNTASLVGVLAKL  434



>gb|KHM99090.1| Endoglucanase 11 [Glycine soja]
Length=527

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 96/156 (62%), Gaps = 6/156 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ QWN +Q+   +AFL  +YSD+ L +   K+ C G      ++  FA SQ DY+LG
Sbjct  350  LIYVRQWNNMQYVSTAAFLLSIYSDF-LQNTNQKLNCHGGTVDHEEILNFAKSQVDYILG  408

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG NYPK VHHRGASI          GC  G+  W  S  PNPNV VG 
Sbjct  409  SNPMNMSYLVGYGPNYPKRVHHRGASIVSYKKNKGFIGCTQGYDNWYGSQAPNPNVLVGA  468

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            LVGGP   + + D RNN MQ E  TYN+A +VG+ +
Sbjct  469  LVGGPDGKDNFEDRRNNFMQTEACTYNTAPLVGVFA  504



>gb|AID55385.1| glycoside hydrolase family 9 B8 [Gossypium hirsutum]
Length=522

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL  VYSDY+ +S   ++ CD     P ++  FA SQADY+LG
Sbjct  348  LLYIRQWNNMQYVSNAAFLLTVYSDYLRAS-NQRLRCDRGKVGPEEVLLFARSQADYILG  406

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP+ +HHRGASI +        GC  G+  W     PNPNV VG 
Sbjct  407  ANPMGMSYLVGYGSRYPQRMHHRGASIESYRENKGFIGCTQGYDYWYPRNDPNPNVVVGA  466

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R N MQ E  TYN+A +VG+L+ L
Sbjct  467  LVGGPDHMDRFSDDRKNFMQTEACTYNTASLVGVLAKL  504



>ref|XP_010110634.1| Endoglucanase 11 [Morus notabilis]
 gb|EXC27256.1| Endoglucanase 11 [Morus notabilis]
Length=522

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ QWN +Q+   ++FL +VYSDY+ +S   K+TC G+  +  ++  FA SQ DY+LG
Sbjct  346  LLYVRQWNNMQYVSTASFLLIVYSDYLKAS-NQKLTCQGEAISHEEVFTFAKSQVDYILG  404

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NP   SYLVGYG NYPK VHHRGASI          GC  G+  W    +PNPNV VG 
Sbjct  405  SNPQNKSYLVGYGPNYPKRVHHRGASIGSYRENKGFIGCTQGYDNWYGRDEPNPNVLVGA  464

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R N MQ E  TYN+A +VG+ + L
Sbjct  465  LVGGPDCQDNFSDERYNYMQTEACTYNTAPLVGVFAKL  502



>gb|KJB13747.1| hypothetical protein B456_002G092400 [Gossypium raimondii]
Length=522

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL  VYSDY+ +S   ++ CD     P ++  FA SQADY+LG
Sbjct  348  LLYIRQWNNMQYVSNAAFLLTVYSDYLRAS-NQRLRCDRGKVGPEEVLLFARSQADYILG  406

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP+ +HHRGASI +        GC  G+  W     PNPNV VG 
Sbjct  407  ANPMGMSYLVGYGSRYPQRMHHRGASIESYRENKGFIGCTQGYDYWYPRNDPNPNVVVGA  466

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R N MQ E  TYN+A +VG+L+ L
Sbjct  467  LVGGPDHMDRFSDDRKNFMQTEACTYNTASLVGVLAKL  504



>ref|XP_008385953.1| PREDICTED: endoglucanase 11-like [Malus domestica]
Length=286

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 96/157 (61%), Gaps = 6/157 (4%)
 Frame = -1

Query  648  VWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLGD  469
            ++I QWN +Q+   +AFL   YSDY+ ++    +TCD    +P ++  FA SQ DY+LG 
Sbjct  113  LYIRQWNNMQYXSNAAFLLTTYSDYLQATHE-NLTCDKGQVSPQEILSFAKSQVDYILGS  171

Query  468  NPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGGL  304
            NPM MSYL GYG  YP+ VHHRGASI +        GC  G+  W     PNPNV  G L
Sbjct  172  NPMAMSYLXGYGPKYPQRVHHRGASIDSYKKNKGFIGCTQGYDSWYGRQGPNPNVLXGAL  231

Query  303  VGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            VGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  232  VGGPDGNDGFXDERWNYMQTEACTYNTATLVGVLAKL  268



>gb|AFN16900.1| cellulase-like protein, partial [Panicum elephantipes]
Length=107

 Score =   139 bits (351),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   +AFLA+VYSDYMLS++TA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNAAFLALVYSDYMLSTQTAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG  YP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSTYPQQVHHRGA  107



>ref|XP_004304093.1| PREDICTED: endoglucanase 11 [Fragaria vesca subsp. vesca]
Length=517

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 100/156 (64%), Gaps = 6/156 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   ++FL  +YSD++ SS   K++C G      ++  FA SQ DY+LG
Sbjct  340  LLYIRQWNNMQYVSTASFLLTMYSDFLKSS-NQKLSCHGGTVAHQEILSFAKSQVDYILG  398

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NP  MSYLVGYG NYP+ VHHRGAS+       A  GC  G+  W    +PNPNV VG 
Sbjct  399  SNPSNMSYLVGYGSNYPQRVHHRGASVVSYRENKAFIGCTQGYDNWYGRLEPNPNVLVGA  458

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            LVGGP  ++ ++D R+N MQ E  TYN+A +VG+ +
Sbjct  459  LVGGPDSHDNFLDQRDNYMQTEACTYNTAPLVGVFA  494



>gb|EAY82930.1| hypothetical protein OsI_38148 [Oryza sativa Indica Group]
Length=348

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ +WN+LQHPVASAFLA VYSDYM SSR  +++C G+ ++PSDLRKFA SQADY+LG
Sbjct  28   LLYVDEWNSLQHPVASAFLAAVYSDYMQSSRKTELSCSGQGFSPSDLRKFAKSQADYLLG  87

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  370
             NPMK+S LVGYGD YP+ VHHRG SIP D  TG
Sbjct  88   SNPMKISCLVGYGDRYPERVHHRGTSIPEDVDTG  121



>gb|AFN16943.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   139 bits (350),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+ +R FA SQA+ +LG
Sbjct  23   LIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSGKYYSPTGIRNFAASQANCILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSNYPQQVHHRGA  107



>ref|XP_009334150.1| PREDICTED: endoglucanase 11-like [Pyrus x bretschneideri]
Length=509

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL   Y+DY+ ++    +TCD    +P ++  FA SQ DY+LG
Sbjct  335  LLYIRQWNNMQYVSNAAFLLTTYTDYLQATH-ENLTCDKGQVSPQEILSFAKSQVDYILG  393

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP+ VHHRGASI +        GC  G+  W     PNPNV VG 
Sbjct  394  SNPMAMSYLVGYGPKYPQRVHHRGASIDSYKKNKGFIGCTQGYDSWYGKQGPNPNVLVGA  453

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  454  LVGGPDGNDGFRDERWNYMQTEACTYNTATLVGVLAKL  491



>gb|KDP39180.1| hypothetical protein JCGZ_00937 [Jatropha curcas]
Length=502

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 98/158 (62%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN LQ+   +AFL  VYSDY+ +S   ++ CD     P ++  FA SQ DY+LG
Sbjct  335  LLYIRQWNNLQYASTAAFLLTVYSDYLQAS-NQRLKCDRGTLDPQEIFGFAKSQVDYILG  393

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFKW-LESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP+ VHHRGASI +        GC  G+     S  PNPNV VG 
Sbjct  394  ANPMNMSYLVGYGSKYPQKVHHRGASIASYKEYKGFVGCTQGYDIGYNSQDPNPNVLVGA  453

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            +VGGP  N+ + D R N +Q E  TYN+A +VG+ + L
Sbjct  454  IVGGPDKNDEFRDERGNYVQTEACTYNTACLVGVFAKL  491



>gb|EYU26800.1| hypothetical protein MIMGU_mgv1a019325mg [Erythranthe guttata]
Length=474

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W  QW+ LQ+  +++F+   Y+DY LS     I C      P+DL  FA SQ DY+LG
Sbjct  316  LLWFLQWSNLQYVTSASFIITAYADY-LSKTHKNIQCASGIVGPNDLMAFAKSQVDYMLG  374

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NP  MSY+VG+G NYPK VHHRGASI +         C++GF +W  + Q NPNV  G 
Sbjct  375  SNPKNMSYMVGFGSNYPKQVHHRGASIVSIKKDSRPMSCQEGFEEWFHNNQENPNVLTGA  434

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            +VGGP  ++ Y D+R+N  QAEP+T N+A +VG+L+ L
Sbjct  435  IVGGPDRSDQYTDARDNYQQAEPSTANNAPLVGVLARL  472



>gb|AFN16902.1| cellulase-like protein, partial [Panicum gouinii]
Length=107

 Score =   139 bits (349),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+WIS WN+LQH   +AFLA+VYSDYMLS++TA++ C GKYY+P+D+R FA SQA+Y+LG
Sbjct  23   LIWISGWNSLQHATNAAFLALVYSDYMLSTQTAEVQCSGKYYSPTDIRNFAASQANYILG  82

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGA  397
            DNPMK+SYLVGYG  YP+ VHHRGA
Sbjct  83   DNPMKLSYLVGYGSAYPQQVHHRGA  107



>gb|KDP30800.1| hypothetical protein JCGZ_13743 [Jatropha curcas]
Length=532

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 95/158 (60%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+ + QWN +Q+   +AFL  +YSD++ SS   K+ C G      ++  FA SQ DY+LG
Sbjct  352  LLHVRQWNNMQYVSTAAFLLTIYSDFLRSS-DRKLVCHGGLVDHEEILNFAKSQVDYILG  410

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W    +PNPNV VG 
Sbjct  411  SNPMNMSYLVGYGSKYPTRVHHRGASIVSYRENKGFIGCTQGYDNWYSQKEPNPNVLVGA  470

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + ++D R N MQ E  TYN+A +VG+ + L
Sbjct  471  LVGGPDCQDNFMDQRGNYMQTEACTYNTAPLVGVFAKL  508



>ref|XP_010688721.1| PREDICTED: endoglucanase 5 [Beta vulgaris subsp. vulgaris]
Length=639

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 98/158 (62%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LV++ QWN +Q+  ++AFL  VYSDY LS   A + C      P DL  FA SQADY+LG
Sbjct  339  LVYVRQWNNMQYASSAAFLIAVYSDY-LSQGKAVVNCPEGTMKPQDLLNFAQSQADYILG  397

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NP  +SYLVG+G NYP  VHHRGASI      +A  GC  GF +W   +  NPNV  GG
Sbjct  398  KNPKSISYLVGFGKNYPTQVHHRGASIAAISVHNAQVGCVQGFEEWYHRSSANPNVVHGG  457

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP  N+ Y + R+N  Q EPT   +A ++GL S L
Sbjct  458  LVGGPDNNDEYDNDRSNYEQTEPTLSGTAPLIGLFSKL  495



>ref|XP_002529469.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF32935.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=510

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 98/158 (62%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN LQ+   +AFL  VYSD++L+S   ++ CD     P ++   A SQ DY+LG
Sbjct  336  LLYIRQWNNLQYVSTAAFLLTVYSDHLLAS-NQRLKCDRGILDPQEILSVAKSQIDYILG  394

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNPNVAVGG  307
             NP+ MSYLVGYG  YP+ VHHRGASI +        GC  G+  W     PNPNV VG 
Sbjct  395  ANPVGMSYLVGYGTEYPQRVHHRGASIESYKGNKGFIGCTQGYDMWYNRQDPNPNVVVGA  454

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R N MQ E  TYN+A +VG+L+ L
Sbjct  455  LVGGPDEKDEFSDERGNYMQTEACTYNTASLVGVLARL  492



>ref|XP_011046752.1| PREDICTED: endoglucanase 11-like [Populus euphratica]
Length=493

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 98/158 (62%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL   YSD++ +S   ++ CD     PSD+ KFA SQ DY+LG
Sbjct  318  LLYIRQWNNMQYVSTAAFLLTTYSDHLQAS-NQRLQCDQGTLDPSDIFKFAKSQVDYILG  376

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFKWLESTQ-PNPNVAVGG  307
             NPM MSYLVGYG  YP  VHHRGASI +        GC  G+    S Q PNPNV  G 
Sbjct  377  YNPMGMSYLVGYGAKYPARVHHRGASIESYKEQKDFIGCMQGYDIGYSRQGPNPNVLTGA  436

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP + + + D R N MQ E  TYN+A +VG+ + L
Sbjct  437  LVGGPDMKDQFRDERENYMQTEACTYNTATLVGVFAKL  474



>ref|NP_001142480.1| uncharacterized protein LOC100274698 [Zea mays]
 gb|ACG24268.1| hypothetical protein [Zea mays]
Length=198

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = -1

Query  624  LQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYL  445
            LQ+ V +AFLA +YSDY+ ++ T    C   +YT   LRKFA SQ DY+LG NP+KMSY+
Sbjct  19   LQYAVNAAFLASLYSDYLEAADTPGWYCGPNFYTTEVLRKFARSQLDYILGKNPLKMSYV  78

Query  444  VGYGDNYPKYVHHRGASIPTDATT-GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYID  268
            VG+G+ YPK  HHRGASIP +    GCK G+KW ++ + NPN+ VG +V GP   + Y D
Sbjct  79   VGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGPDRRDGYKD  138

Query  267  SRNNSMQAEPT-TYNSAIIVGLLS  199
             R N    EPT   N+ ++  L+S
Sbjct  139  VRTNYNYTEPTLAANAGLVAALIS  162



>ref|XP_009804981.1| PREDICTED: endoglucanase 5 [Nicotiana sylvestris]
Length=630

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ +WN LQ+  ++AFL  +YSDY LS R A +TC      PSD+  FA SQADY+LG
Sbjct  334  LIYVREWNNLQYASSAAFLLAMYSDY-LSERKAVLTCPEGQVQPSDVLSFAKSQADYILG  392

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIP----TDATTGCKDGFK-WLESTQPNPNVAVGG  307
             NP  +SYLVGYG NYP +VHHRGASI       +   C +GF+ W    Q NPN+  GG
Sbjct  393  KNPKSISYLVGYGQNYPIHVHHRGASIAPVSVLHSAVTCIEGFETWYRRPQANPNIIYGG  452

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R+N  Q EPT   SA +VGL   L
Sbjct  453  LVGGPSKTDDFSDDRSNYEQTEPTLSGSAPLVGLFCKL  490



>ref|XP_002321149.2| hypothetical protein POPTR_0014s15590g [Populus trichocarpa]
 gb|EEE99464.2| hypothetical protein POPTR_0014s15590g [Populus trichocarpa]
Length=528

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 96/158 (61%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+ I QWN +Q+   +AFL  VYSD++L+S   K+ C G      ++  FA SQ DY+LG
Sbjct  352  LLHIRQWNNMQYVSTAAFLLTVYSDFLLNS-NQKLKCHGGSVDHEEILGFAKSQVDYILG  410

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W    +PNPNV VG 
Sbjct  411  SNPMNMSYLVGYGPKYPARVHHRGASIVSYRENKGFIGCTQGYDNWYGREEPNPNVLVGA  470

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R+N MQ E  TYN+A +VG+ + L
Sbjct  471  LVGGPDCQDNFTDQRSNYMQTEACTYNTAPLVGVFAKL  508



>gb|AFZ78643.1| korrigan [Populus tomentosa]
Length=528

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 96/158 (61%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+ I QWN +Q+   +AFL  VYSD++L+S   K+ C G      ++  FA SQ DY+LG
Sbjct  352  LLHIRQWNNMQYVSTAAFLLTVYSDFLLNS-NQKLNCHGGSVDHEEILGFAKSQVDYILG  410

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W    +PNPNV VG 
Sbjct  411  SNPMNMSYLVGYGPKYPARVHHRGASIVSYRENKGFIGCTQGYDNWYGREEPNPNVLVGA  470

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R+N MQ E  TYN+A +VG+ + L
Sbjct  471  LVGGPDCQDNFTDQRSNYMQTEACTYNTAPLVGVFAKL  508



>gb|AEO97204.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97231.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=528

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 96/158 (61%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+ I QWN +Q+   +AFL  VYSD++L+S   K+ C G      ++  FA SQ DY+LG
Sbjct  352  LLHIRQWNNMQYVSTAAFLLTVYSDFLLNS-NQKLKCHGGSVDHEEILGFAKSQVDYILG  410

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W    +PNPNV VG 
Sbjct  411  SNPMNMSYLVGYGPKYPARVHHRGASIVSYRENKGFIGCTQGYDNWYGREEPNPNVLVGA  470

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R+N MQ E  TYN+A +VG+ + L
Sbjct  471  LVGGPDCQDNFTDQRSNYMQTEACTYNTAPLVGVFAKL  508



>ref|XP_008460200.1| PREDICTED: endoglucanase 13-like [Cucumis melo]
Length=492

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 97/160 (61%), Gaps = 10/160 (6%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+W   WN LQ+  ++ FLA VYSDY LSS+   I C G    PSDL  FA SQ DY+LG
Sbjct  335  LLWFQPWNNLQYVTSATFLATVYSDY-LSSKGVSIQCPGGLVQPSDLISFAKSQVDYILG  393

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI------PTDATTGCKDGFK-WLESTQPNPNVAV  313
             NP  MSY+VG+G  YP  VHHRGASI      PT  T  C+ GF  W     PNPNV  
Sbjct  394  SNPSGMSYMVGFGSKYPTQVHHRGASIVSIKRDPTLVT--CQGGFNLWFNRNAPNPNVLH  451

Query  312  GGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            G +VGGP  N+ Y DSR+N   AEP T   A +VG+L+ L
Sbjct  452  GAVVGGPDPNDAYWDSRSNFKTAEPATVTPAPLVGVLARL  491



>emb|CAF18445.1| endo-1,4-beta-D-glucanase KORRIGAN [Pisum sativum]
Length=229

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 98/145 (68%), Gaps = 1/145 (1%)
 Frame = -1

Query  624  LQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYL  445
            LQ+ V +AFLA +YSDY+ ++ T    C   +Y+   LR+FA +Q DY+LG NP KMSY+
Sbjct  59   LQYVVNAAFLATLYSDYLDAADTPGWYCGPNFYSTDKLREFARTQIDYILGKNPRKMSYI  118

Query  444  VGYGDNYPKYVHHRGASIP-TDATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYID  268
            VG+G++YPK+VHHRGASIP T     CK G+KW ++++PNPN+ VG +V GP  ++ + D
Sbjct  119  VGFGNHYPKHVHHRGASIPKTKVKYNCKGGWKWRDTSKPNPNILVGAMVAGPDRHDGFHD  178

Query  267  SRNNSMQAEPTTYNSAIIVGLLSGL  193
             R+N    EPT   +A +V  L  L
Sbjct  179  VRSNYNYTEPTLAGNAGLVAALVAL  203



>ref|XP_003617621.1| Endoglucanase [Medicago truncatula]
Length=574

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 100/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL  +YSD++L++   K+ C      P++L  FA SQ DY+LG
Sbjct  414  LLYIRQWNNMQYVANAAFLLAIYSDHLLAT-NQKLHCQKGEVGPNELLAFAKSQVDYILG  472

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG N+P+ VHHRGAS  +        GC  G+  W ES +PNPN+ +G 
Sbjct  473  SNPMGMSYLVGYGSNFPQRVHHRGASTESYKGNMGFIGCTQGYDNWYESPKPNPNILIGA  532

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R N  Q E  TYN+A +VG+ + L
Sbjct  533  LVGGPDNKDQFRDERRNFEQLEACTYNTAALVGVFARL  570



>gb|AET00580.2| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=504

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 100/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL  +YSD++L++   K+ C      P++L  FA SQ DY+LG
Sbjct  344  LLYIRQWNNMQYVANAAFLLAIYSDHLLAT-NQKLHCQKGEVGPNELLAFAKSQVDYILG  402

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG N+P+ VHHRGAS  +        GC  G+  W ES +PNPN+ +G 
Sbjct  403  SNPMGMSYLVGYGSNFPQRVHHRGASTESYKGNMGFIGCTQGYDNWYESPKPNPNILIGA  462

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R N  Q E  TYN+A +VG+ + L
Sbjct  463  LVGGPDNKDQFRDERRNFEQLEACTYNTAALVGVFARL  500



>ref|XP_011072104.1| PREDICTED: endoglucanase 5-like [Sesamum indicum]
Length=584

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 100/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ +WN LQ+P ++AFL  VYSDY+  +++  + C        DL  FA SQADY+LG
Sbjct  305  LLYLHEWNNLQYPASAAFLLAVYSDYLAKAKSV-VKCPDGELQHQDLLNFAKSQADYILG  363

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIP----TDATTGCKDGFK-WLESTQPNPNVAVGG  307
             NPM +SY+VGYG NYP +VHHRGASI       +  GC +GF+ W +  + NPNV  G 
Sbjct  364  KNPMSLSYIVGYGQNYPMHVHHRGASIAPVSLLKSAVGCVEGFETWYKRPEANPNVIHGA  423

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R+N  Q EPT   +A +VGL S L
Sbjct  424  LVGGPNAKDEFTDDRSNYEQTEPTLSGTAPLVGLFSKL  461



>gb|AFZ78645.1| korrigan [Populus tomentosa]
Length=505

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL   YSD++ +S   ++ CD     PSD+ KFA SQ DY+LG
Sbjct  330  LLYIRQWNNMQYVSTAAFLLTTYSDHLQAS-NQRLQCDQGTLDPSDIFKFAKSQVDYILG  388

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFKWLESTQ-PNPNVAVGG  307
             NP+ MSYLVGYG  YP+ VHHRGASI +        GC  G+    S Q PNPNV  G 
Sbjct  389  YNPLGMSYLVGYGAKYPERVHHRGASIESYKGQKDFIGCMQGYDIGYSRQGPNPNVLTGA  448

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP + + + D R N MQ E  TYN+A +VG+ + L
Sbjct  449  LVGGPDMKDQFRDERENYMQTEACTYNTATLVGVFAKL  486



>ref|XP_002300328.1| hypothetical protein POPTR_0001s36600g [Populus trichocarpa]
 gb|EEE85133.1| hypothetical protein POPTR_0001s36600g [Populus trichocarpa]
Length=517

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL   YSD++ +S   ++ CD     PSD+ KFA SQ DY+LG
Sbjct  342  LLYIRQWNNMQYVSTAAFLLTTYSDHLQAS-NQRLQCDQGTLDPSDIFKFAKSQVDYILG  400

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFKWLESTQ-PNPNVAVGG  307
             NP+ MSYLVGYG  YP+ VHHRGASI +        GC  G+    S Q PNPNV  G 
Sbjct  401  YNPLGMSYLVGYGAKYPERVHHRGASIESYKGQKDFIGCMQGYDIGYSRQGPNPNVLTGA  460

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP + + + D R N MQ E  TYN+A +VG+ + L
Sbjct  461  LVGGPDMKDQFRDERENYMQTEACTYNTATLVGVFAKL  498



>ref|XP_008366459.1| PREDICTED: endoglucanase 11-like [Malus domestica]
Length=371

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 95/157 (61%), Gaps = 6/157 (4%)
 Frame = -1

Query  648  VWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLGD  469
            ++I QWN +Q+   +AFL   YSDY L +    +TCD    +P ++  FA SQ DY+LG 
Sbjct  202  LYIRQWNNMQYXSNAAFLLTTYSDY-LQATHENLTCDKGQVSPQEILSFAKSQVDYILGS  260

Query  468  NPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGGL  304
            NPM MSYL GYG  YP+ VHHRGASI +        GC  G+  W     PNPNV  G L
Sbjct  261  NPMAMSYLXGYGPKYPQRVHHRGASIDSYKKNKGFIGCTQGYDSWYGRQGPNPNVLXGAL  320

Query  303  VGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            VGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  321  VGGPDGNDGFXDERWNYMQTEACTYNTATLVGVLAKL  357



>gb|ABF98747.1| endo-1,4-beta-glucanase Cel1, putative, expressed [Oryza sativa 
Japonica Group]
Length=497

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = -1

Query  624  LQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYL  445
            LQ+ V +AFLA +YSDY+ ++ T    C   +YT   LRKFA SQ DYVLG NP+KMSY+
Sbjct  319  LQYVVNAAFLASLYSDYLDAADTPGWYCGPTFYTTEVLRKFARSQLDYVLGKNPLKMSYV  378

Query  444  VGYGDNYPKYVHHRGASIPTDATT-GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYID  268
            VG+G+ YPK  HHRGASIP +    GCK GFKW E+ +PNPN+ +G LV GP  ++ + D
Sbjct  379  VGFGNKYPKRAHHRGASIPHNGVKYGCKGGFKWRETKKPNPNILIGALVAGPDRHDGFKD  438

Query  267  SRNNSMQAEPT-TYNSAIIVGLLS  199
             R N    EPT   N+ ++  L+S
Sbjct  439  VRTNYNYTEPTLAANAGLVAALIS  462



>gb|AFW74700.1| hypothetical protein ZEAMMB73_090741 [Zea mays]
Length=398

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 98/157 (62%), Gaps = 4/157 (3%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            ++W+  WN LQ   ++AF+   +SD++  +  + + C      PS L  FA SQADY+LG
Sbjct  238  VLWLEPWNNLQFVTSAAFVVAAHSDHLAGAAASSLRCGAATLPPSQLLAFARSQADYILG  297

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT----GCKDGFKWLESTQPNPNVAVGGL  304
             NP +MSY+VGYG  +P+ VHHRGAS+P+  ++     CK GF +     PNPNV VG +
Sbjct  298  ANPERMSYMVGYGARFPEQVHHRGASVPSIKSSPGKITCKGGFAYYSRDTPNPNVLVGAI  357

Query  303  VGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            VGGP  N+ Y DSR N  Q EP+T   A +VG+L+ L
Sbjct  358  VGGPDGNDRYDDSRPNYKQTEPSTVTVAPMVGVLARL  394



>ref|NP_001051192.1| Os03g0736300 [Oryza sativa Japonica Group]
 sp|Q84R49.1|GUN10_ORYSJ RecName: Full=Endoglucanase 10; AltName: Full=Endo-1,4-beta glucanase 
10; AltName: Full=OsGLU2 [Oryza sativa Japonica Group]
 gb|AAP03405.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 gb|AAR07086.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 gb|ABF98746.1| endo-1,4-beta-glucanase Cel1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13106.1| Os03g0736300 [Oryza sativa Japonica Group]
 dbj|BAG91933.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76139.1| hypothetical protein OsI_13426 [Oryza sativa Indica Group]
 gb|EEE59884.1| hypothetical protein OsJ_12485 [Oryza sativa Japonica Group]
Length=620

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = -1

Query  624  LQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYL  445
            LQ+ V +AFLA +YSDY+ ++ T    C   +YT   LRKFA SQ DYVLG NP+KMSY+
Sbjct  442  LQYVVNAAFLASLYSDYLDAADTPGWYCGPTFYTTEVLRKFARSQLDYVLGKNPLKMSYV  501

Query  444  VGYGDNYPKYVHHRGASIPTDATT-GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYID  268
            VG+G+ YPK  HHRGASIP +    GCK GFKW E+ +PNPN+ +G LV GP  ++ + D
Sbjct  502  VGFGNKYPKRAHHRGASIPHNGVKYGCKGGFKWRETKKPNPNILIGALVAGPDRHDGFKD  561

Query  267  SRNNSMQAEPT-TYNSAIIVGLLS  199
             R N    EPT   N+ ++  L+S
Sbjct  562  VRTNYNYTEPTLAANAGLVAALIS  585



>gb|KHN38252.1| Endoglucanase 11 [Glycine soja]
Length=515

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   ++FL  VYSD++L++   K+ C      P ++  FA SQ DY+LG
Sbjct  344  LLYIRQWNNMQYVATASFLLTVYSDHLLAT-DQKLHCQKGEVGPHEMLAFAKSQVDYILG  402

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  +P+ VHHRGASI +        GC  G+  W    +PNPNV +G 
Sbjct  403  TNPMAMSYLVGYGPKFPQKVHHRGASIESYGENKGFIGCTQGYDNWYGRVEPNPNVLIGA  462

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP + + + D R N +Q E  TYN+A +VG+ + L
Sbjct  463  LVGGPDIKDQFKDERRNYIQTEACTYNTAALVGVFARL  500



>gb|AEO97205.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97232.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=524

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL   YSD++ +S   ++ CD     PSD+ KFA SQ DY+LG
Sbjct  349  LLYIRQWNNMQYVSTAAFLLTTYSDHLQAS-NQRLQCDQGTLDPSDIFKFAKSQVDYILG  407

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFKWLESTQ-PNPNVAVGG  307
             NP+ MSYLVGYG  YP+ VHHRGASI +        GC  G+    S Q PNPNV  G 
Sbjct  408  YNPLGMSYLVGYGAKYPERVHHRGASIESYKGQKDFIGCMQGYDIGYSRQGPNPNVLTGA  467

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP + + + D R N MQ E  TYN+A +VG+ + L
Sbjct  468  LVGGPDMKDQFRDERENYMQTEACTYNTATLVGVFAKL  505



>ref|XP_007212600.1| hypothetical protein PRUPE_ppa016852mg [Prunus persica]
 gb|EMJ13799.1| hypothetical protein PRUPE_ppa016852mg [Prunus persica]
Length=513

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 98/158 (62%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL   YSDY+ ++    +TCD     P +L  FA SQ DY+LG
Sbjct  339  LLYIRQWNNMQYVSNAAFLLTTYSDYLQATHQ-NLTCDKGQVGPQELLSFAKSQVDYILG  397

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NP  MSYLVGYG  YP+ +HHRGASI +        GC +G+  W     PNPNV VG 
Sbjct  398  SNPTAMSYLVGYGPKYPQRLHHRGASIESYKRNKGFIGCTEGYDSWYGMHDPNPNVLVGA  457

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  458  LVGGPDGNDGFRDERWNYMQTEACTYNTATLVGVLAKL  495



>ref|XP_003518530.1| PREDICTED: endoglucanase 11-like [Glycine max]
Length=515

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   ++FL  VYSD++L++   K+ C      P ++  FA SQ DY+LG
Sbjct  344  LLYIRQWNNMQYVATASFLLTVYSDHLLAT-DQKLHCQKGEVGPHEMLAFAKSQVDYILG  402

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  +P+ VHHRGASI +        GC  G+  W    +PNPNV +G 
Sbjct  403  TNPMAMSYLVGYGPKFPQKVHHRGASIESYGENKGFIGCTQGYDNWYGRVEPNPNVLIGA  462

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP + + + D R N +Q E  TYN+A +VG+ + L
Sbjct  463  LVGGPDIKDQFKDERRNYIQTEACTYNTAALVGVFARL  500



>ref|XP_006596588.1| PREDICTED: endoglucanase 11-like [Glycine max]
Length=523

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ QWN +Q+   ++FL  VYSD++L++   K+ C      P ++  FA SQ DY+LG
Sbjct  345  LLYVRQWNNMQYVATASFLLTVYSDHLLAT-DQKLHCQKGEVGPHEMLAFAKSQVDYILG  403

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  +P+ VHHRGASI +        GC  G+  W    +PNPNV +G 
Sbjct  404  SNPMAMSYLVGYGPKFPRRVHHRGASIESYGENKGFIGCTQGYDNWYGRVEPNPNVLIGA  463

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP + + + D R N +Q E  TYN+A +VG+ + L
Sbjct  464  LVGGPDIKDQFKDERRNYVQTEACTYNTAALVGVFARL  501



>ref|XP_010457267.1| PREDICTED: endoglucanase 1-like [Camelina sativa]
Length=150

 Score =   138 bits (347),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 96/148 (65%), Gaps = 5/148 (3%)
 Frame = -1

Query  624  LQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYL  445
            +Q+  +++FL + Y+ Y+ S+RT    C G   TP+ LR  A  Q DY+LGDNP+KMSY+
Sbjct  1    MQYVTSTSFLLLTYAKYLTSARTVAY-CGGSVVTPARLRSIAKKQVDYLLGDNPLKMSYM  59

Query  444  VGYGDNYPKYVHHRGASIPTDAT----TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNET  277
            VGYG  YP+ +HHRG+S+P+ A       C DGF    S  PNPNV VG +VGGP  N+ 
Sbjct  60   VGYGPKYPRRIHHRGSSLPSVAAHPSKIQCHDGFSMFISQSPNPNVLVGAVVGGPDQNDQ  119

Query  276  YIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            + D R++  ++EP TY +A +VG L+ L
Sbjct  120  FPDERSDYGRSEPATYINAPLVGALAYL  147



>ref|XP_002277177.2| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 5 [Vitis vinifera]
Length=611

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LV++ +WN +Q+  ++AFL  VYSDY LS+  A + C      P +L  FA SQADY+LG
Sbjct  336  LVYLHEWNNMQYASSAAFLLAVYSDY-LSAENAVLKCPDAQVQPYELLNFAKSQADYILG  394

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDA----TTGCKDGFK-WLESTQPNPNVAVGG  307
             NP  MSYLVGYG  YP + HHRG+SI + A    T GC +GF+ W    + NPNV  GG
Sbjct  395  KNPKSMSYLVGYGQKYPVHAHHRGSSIASVAVLHSTVGCVEGFESWYHRPEANPNVIYGG  454

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP  N+ + D R+N  Q EPT    A +VGL S L
Sbjct  455  LVGGPDKNDGFSDDRSNYEQTEPTLSGGAPLVGLFSKL  492



>ref|XP_003579470.1| PREDICTED: endoglucanase 13 [Brachypodium distachyon]
Length=612

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 105/159 (66%), Gaps = 8/159 (5%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYM-LSSRTAKITCDGKYYTPSDLRKFAMSQADYVL  475
            L++++ WN +Q+  +SAFL  VY+DY+ +S R  ++ C     +PS++ +F   Q DYVL
Sbjct  340  LLYVADWNNMQYVTSSAFLLAVYADYLAVSGR--QLKCPDGEVSPSEMIRFVRRQVDYVL  397

Query  474  GDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVG  310
            GDNP  MSY+VGYG+N+P+ VHHRGASIP     +   GC DGF ++  + + +PNV  G
Sbjct  398  GDNPASMSYMVGYGENFPRRVHHRGASIPAVGSVNGIVGCMDGFDRFYNTKEADPNVLYG  457

Query  309  GLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
             LVGGP  N+ ++D R N  +AEPT   +A IVG+ + L
Sbjct  458  ALVGGPDANDAFVDDRCNYQRAEPTIATAAPIVGVFARL  496



>emb|CBI27137.3| unnamed protein product [Vitis vinifera]
Length=615

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            LV++ +WN +Q+  ++AFL  VYSDY LS+  A + C      P +L  FA SQADY+LG
Sbjct  336  LVYLHEWNNMQYASSAAFLLAVYSDY-LSAENAVLKCPDAQVQPYELLNFAKSQADYILG  394

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDA----TTGCKDGFK-WLESTQPNPNVAVGG  307
             NP  MSYLVGYG  YP + HHRG+SI + A    T GC +GF+ W    + NPNV  GG
Sbjct  395  KNPKSMSYLVGYGQKYPVHAHHRGSSIASVAVLHSTVGCVEGFESWYHRPEANPNVIYGG  454

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP  N+ + D R+N  Q EPT    A +VGL S L
Sbjct  455  LVGGPDKNDGFSDDRSNYEQTEPTLSGGAPLVGLFSKL  492



>gb|AGG19097.1| cellulase [Zea mays]
Length=413

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 98/157 (62%), Gaps = 4/157 (3%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            ++W+  WN LQ   ++AF+   +SD++  +  + + C      PS L  FA SQADY+LG
Sbjct  253  VLWLEPWNNLQFVTSAAFVVAAHSDHLAGAAASSLRCGAATLPPSQLLAFARSQADYILG  312

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT----GCKDGFKWLESTQPNPNVAVGGL  304
             NP +MSY+VGYG  +P+ VHHRGAS+P+  ++     CK GF +     PNPNV VG +
Sbjct  313  ANPERMSYMVGYGARFPEQVHHRGASVPSIKSSPGKITCKGGFAYYSRDTPNPNVLVGAI  372

Query  303  VGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            VGGP  N+ Y DSR N  Q EP+T   A +VG+L+ L
Sbjct  373  VGGPDGNDRYDDSRPNYKQTEPSTVTVAPMVGVLARL  409



>ref|XP_004491112.1| PREDICTED: endoglucanase 11-like [Cicer arietinum]
Length=532

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 96/156 (62%), Gaps = 6/156 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   ++FL  +YSD+ L +   K+TC        ++  FA SQ DY+LG
Sbjct  355  LLYIRQWNNMQYVSTASFLLTIYSDF-LKNTNQKLTCHEGIVDHEEILSFAKSQVDYILG  413

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVG+G +YPK VHHRGASI          GC  G+  W  S  PNPNV +G 
Sbjct  414  SNPMNMSYLVGFGPSYPKRVHHRGASIMSYKENKGFIGCTQGYDNWYSSEDPNPNVLIGA  473

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            LVGGP   + + D R+N MQ E  TYN+A +VGL +
Sbjct  474  LVGGPDWEDNFEDRRSNFMQTEACTYNTAPLVGLFA  509



>ref|XP_008364782.1| PREDICTED: endoglucanase 11-like [Malus domestica]
Length=507

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 98/158 (62%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL  +YSDY+ ++    +TCD     P ++  F  SQ DY+LG
Sbjct  334  LLYIRQWNNMQYVSNAAFLLTIYSDYIQAAH-HNLTCDKGQVGPQEILSFTKSQVDYILG  392

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP+ +HHRGASI +        GC  G+  W     PNPNV VG 
Sbjct  393  SNPMGMSYLVGYGPKYPRRLHHRGASIDSYKKNXGFIGCTQGYHNWYGRQGPNPNVLVGA  452

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  453  LVGGPDGNDGFRDERWNYMQTEACTYNTATLVGVLAKL  490



>ref|XP_009351718.1| PREDICTED: endoglucanase 5 [Pyrus x bretschneideri]
Length=628

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 100/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ +WN LQ+  ++AFL  VYSDY LS+  AK+ C      P +L  FA SQADY+LG
Sbjct  339  LLYVREWNNLQYVTSAAFLLAVYSDY-LSAANAKLACPDGQAQPQELLNFAKSQADYILG  397

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNPNVAVGG  307
             NP  MSY+VG G NYP +VHHRGASIP+     +   C  GF+ W   T+ NPNV  G 
Sbjct  398  KNPKSMSYIVGIGQNYPVHVHHRGASIPSVFTLHSAVECVQGFEMWYHRTEANPNVIYGA  457

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP  N+ + D R++  Q EPT   +  +VGLLS L
Sbjct  458  LVGGPDQNDYFSDDRSSYEQTEPTLSGTGPLVGLLSKL  495



>gb|KHG28140.1| hypothetical protein F383_15365 [Gossypium arboreum]
Length=511

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 96/158 (61%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   + FL  VYSD++ +S +  + C      P ++  FA SQ DY+LG
Sbjct  340  LLYIRQWNNMQYMSTATFLLTVYSDFLRNS-SQHLRCPTGTIDPEEILSFAKSQVDYILG  398

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W    +PNPNV VG 
Sbjct  399  SNPMNMSYLVGYGSKYPIRVHHRGASIVSYREKKGFIGCTQGYDNWYSRVEPNPNVLVGA  458

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + ++D R+N MQ E  TYN+A +VG+ + L
Sbjct  459  LVGGPDCRDNFMDQRDNYMQTEACTYNTAPLVGVFARL  496



>gb|KDP25211.1| hypothetical protein JCGZ_20367 [Jatropha curcas]
Length=495

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 100/157 (64%), Gaps = 5/157 (3%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++ +  + LQ+  ++AFL + YS Y LSS    + C G   T   L   A  Q DY+LG
Sbjct  336  LLYKASESNLQYVTSTAFLLLTYSKY-LSSNGGAVKCGGSVVTAESLESAAKKQVDYILG  394

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT----TGCKDGFKWLESTQPNPNVAVGGL  304
            DNP KMSY+VG+G+ YP++VHHRG+S+P+  T      C DGF++ +ST PNPNV VG +
Sbjct  395  DNPAKMSYMVGFGNKYPQHVHHRGSSVPSIHTHPERISCNDGFQYFKSTSPNPNVLVGAI  454

Query  303  VGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            +GGP   + + D RNN  Q+EP TY +A  VG L+ L
Sbjct  455  IGGPDNQDNFADDRNNYQQSEPATYINAPFVGALAFL  491



>ref|XP_008342129.1| PREDICTED: endoglucanase 11-like [Malus domestica]
Length=516

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 99/156 (63%), Gaps = 6/156 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ QWN +Q+   ++FL  VYSD++ +S   K++C G      ++  FA SQ DY+LG
Sbjct  339  LLYVRQWNNMQYVSTASFLLTVYSDFLETS-NQKLSCHGGTAGHEEVLSFAKSQIDYILG  397

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NP+ MSYLVGYG  YP+ VHHRGAS+ +        GC  G+  W    +PNPNV VG 
Sbjct  398  SNPLNMSYLVGYGPKYPRRVHHRGASVESYRENKGFIGCTQGYDNWYGREEPNPNVLVGA  457

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            LVGGP   + ++D R+N MQ E  TYN+A +VG+ +
Sbjct  458  LVGGPDCKDNFVDRRDNYMQTEACTYNTAPLVGVFA  493



>ref|XP_008379665.1| PREDICTED: endoglucanase 11-like isoform X1 [Malus domestica]
 ref|XP_008348140.1| PREDICTED: endoglucanase 11-like isoform X1 [Malus domestica]
Length=513

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 98/156 (63%), Gaps = 6/156 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+  A++FL  VYSD++ +S    + C G      ++  FA SQ DY+LG
Sbjct  339  LLYIRQWNNMQYVSAASFLLTVYSDFLKTS-NGNLNCHGGTAGHEEVLSFAKSQIDYILG  397

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NP+ MSYLVGYG  YP+ VHHRGAS+ +        GC  G+  W    +PNPNV VG 
Sbjct  398  SNPLNMSYLVGYGPKYPQRVHHRGASVESYRENKGFIGCTQGYDSWYAREEPNPNVLVGA  457

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            LVGGP   + ++D R+N MQ E  TYN+A +VG+ +
Sbjct  458  LVGGPDCKDNFVDRRDNYMQTEACTYNTAPLVGVFA  493



>ref|XP_008227038.1| PREDICTED: endoglucanase 11-like [Prunus mume]
Length=513

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 97/158 (61%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL   YSDY+ ++    + CD     P +L  FA SQ DY+LG
Sbjct  339  LLYIRQWNNMQYVSNAAFLLTTYSDYLQATHQ-NLACDKGRVGPQELLSFAKSQVDYILG  397

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NP  MSYLVGYG  YP+ +HHRGASI +        GC  G+  W    +PNPNV VG 
Sbjct  398  SNPTAMSYLVGYGPKYPQRLHHRGASIESYKRNKGFIGCTQGYDSWYRMHRPNPNVLVGA  457

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  458  LVGGPDGNDGFRDERWNYMQTEACTYNTATLVGVLAKL  495



>ref|XP_008437388.1| PREDICTED: endoglucanase 6-like isoform X1 [Cucumis melo]
 ref|XP_008437389.1| PREDICTED: endoglucanase 6-like isoform X2 [Cucumis melo]
Length=624

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++  +WN +Q    ++F+A VYSDY+ SSR++ + C   Y  PS+L  FA SQ DY+LG
Sbjct  333  LIFRQRWNNMQFVTTASFVAAVYSDYLTSSRSS-MKCPAGYVQPSELLSFAKSQVDYILG  391

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNPNVAVGG  307
            DNP   SY+VGYG+N+P+ VHHRG+SI +         C++G+  W      +PN  VG 
Sbjct  392  DNPRATSYMVGYGNNFPRRVHHRGSSIVSYKRNSKFIACREGYATWFSKKTSDPNTLVGA  451

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R+N  Q EP TYN+A ++GLL+ L
Sbjct  452  LVGGPDAYDNFADQRDNYEQTEPATYNNAPLLGLLARL  489



>ref|XP_009365103.1| PREDICTED: endoglucanase 11 isoform X1 [Pyrus x bretschneideri]
Length=516

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 100/156 (64%), Gaps = 6/156 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ +WN +Q+  A++FL  VYSD++ +S   K++C G      ++  FA SQ DY+LG
Sbjct  339  LLYVRRWNNMQYVSAASFLLTVYSDFLKTS-NGKLSCHGGTVGYEEVLSFAKSQMDYILG  397

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNVAVGG  307
             NP+ MSYLVGYG  YP+ VHHRGAS+ +        GC  G+  W    +PNPNV VG 
Sbjct  398  SNPLNMSYLVGYGPKYPQRVHHRGASVESYRENKGFIGCTQGYDSWYAREEPNPNVLVGA  457

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  199
            LVGGP   + ++D R+N MQ E  TYN+A +VG+ +
Sbjct  458  LVGGPDCKDNFVDRRDNYMQTEACTYNTAPLVGVFA  493



>gb|AID55384.1| glycoside hydrolase family 9 B11 [Gossypium hirsutum]
Length=511

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 95/158 (60%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   + FL  VYSD++ +S    + C      P ++  FA SQ DY+LG
Sbjct  340  LLYIRQWNNMQYVSTATFLLTVYSDFLRNS-NQHLRCPTGTIDPEEILSFAKSQVDYILG  398

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPNVAVGG  307
             NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W    +PNPNV VG 
Sbjct  399  SNPMNMSYLVGYGSKYPIRVHHRGASIVSYRENKGFIGCTQGYDNWYSRVEPNPNVLVGA  458

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + ++D R+N MQ E  TYN+A +VG+ + L
Sbjct  459  LVGGPDCRDNFMDQRDNYMQTEACTYNTAPLVGVFARL  496



>ref|XP_004491466.1| PREDICTED: endoglucanase 11-like [Cicer arietinum]
Length=519

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 102/159 (64%), Gaps = 7/159 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++I QWN +Q+   +AFL  +YSD++L++   K+ C      P+++  FA SQ DY+LG
Sbjct  342  LLYIRQWNNMQYVANAAFLLTIYSDHLLAN-NQKLHCQKNEVGPNEIFAFAKSQVDYILG  400

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT-----TGCKDGFK-WLESTQPNPNVAVG  310
             NPM +SYLVGYG  +P+ VHHRGASI +         GC  G++ W ES++PNPN+ +G
Sbjct  401  SNPMGISYLVGYGPKFPQRVHHRGASIKSYNKGNMDFIGCTQGYENWYESSEPNPNILIG  460

Query  309  GLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
             LVGGP   + + D R N  Q E  TYN+A +VG+ + L
Sbjct  461  ALVGGPDNKDLFKDERRNYEQMEACTYNTAALVGVFARL  499



>ref|XP_007043305.1| Glycosyl hydrolase 9C1 isoform 1 [Theobroma cacao]
 gb|EOX99136.1| Glycosyl hydrolase 9C1 isoform 1 [Theobroma cacao]
Length=626

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 100/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ +WN LQ+  A+AFL  VYSDY LS+  AK+TC      P+++  FA SQADY+LG
Sbjct  336  LMYVREWNNLQYASAAAFLLAVYSDY-LSAAKAKLTCPDGQVQPNEVLNFAKSQADYILG  394

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNPNVAVGG  307
             NP  MSYLVGYG  YP +VHHRGASI +      T  C  GF+ W    + +PNV  G 
Sbjct  395  KNPKSMSYLVGYGPKYPIHVHHRGASIASITVLPQTVSCVQGFEAWYRRPEADPNVINGA  454

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP  N+ + D R+N  Q EPT   SA +VGL S L
Sbjct  455  LVGGPDQNDNFSDDRSNYEQTEPTLSGSAPLVGLFSKL  492



>ref|XP_007043306.1| Glycosyl hydrolase 9C1 isoform 2 [Theobroma cacao]
 gb|EOX99137.1| Glycosyl hydrolase 9C1 isoform 2 [Theobroma cacao]
Length=627

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 100/158 (63%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L+++ +WN LQ+  A+AFL  VYSDY LS+  AK+TC      P+++  FA SQADY+LG
Sbjct  336  LMYVREWNNLQYASAAAFLLAVYSDY-LSAAKAKLTCPDGQVQPNEVLNFAKSQADYILG  394

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNPNVAVGG  307
             NP  MSYLVGYG  YP +VHHRGASI +      T  C  GF+ W    + +PNV  G 
Sbjct  395  KNPKSMSYLVGYGPKYPIHVHHRGASIASITVLPQTVSCVQGFEAWYRRPEADPNVINGA  454

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP  N+ + D R+N  Q EPT   SA +VGL S L
Sbjct  455  LVGGPDQNDNFSDDRSNYEQTEPTLSGSAPLVGLFSKL  492



>ref|XP_007142327.1| hypothetical protein PHAVU_008G270900g [Phaseolus vulgaris]
 gb|ESW14321.1| hypothetical protein PHAVU_008G270900g [Phaseolus vulgaris]
Length=515

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 97/158 (61%), Gaps = 6/158 (4%)
 Frame = -1

Query  651  LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLG  472
            L++  +WN +Q+   ++FL  +YSD++ ++   K+ C      P  +  FA SQ DY+LG
Sbjct  341  LLYTREWNNMQYVATASFLLTLYSDHLQATHQ-KLQCHRGEVGPHQMFAFAKSQVDYILG  399

Query  471  DNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT----GCKDGFK-WLESTQPNPNVAVGG  307
             NPM MSYLVGYG N+PK VHHRGASI +        GC  G+  W    QPNPNV +G 
Sbjct  400  SNPMAMSYLVGYGPNFPKRVHHRGASIESSKENKGFIGCVQGYDTWYGRVQPNPNVLIGA  459

Query  306  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  193
            LVGGP   + + D R N +Q EP TYN+A +VG+ + L
Sbjct  460  LVGGPDRKDQFKDERQNYIQTEPCTYNTAALVGVFARL  497



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700