BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF041F20

Length=557
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB34587.1|  hypothetical protein B456_006G106600                    291   7e-97   Gossypium raimondii
ref|XP_006488528.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    291   1e-96   Citrus sinensis [apfelsine]
gb|KHG08655.1|  Peptidyl-prolyl cis-trans isomerase CYP20-1 -like...    290   2e-96   Gossypium arboreum [tree cotton]
gb|KDO66887.1|  hypothetical protein CISIN_1g028574mg                   290   2e-96   Citrus sinensis [apfelsine]
ref|XP_006425067.1|  hypothetical protein CICLE_v10029291mg             290   2e-96   Citrus clementina [clementine]
ref|XP_009773253.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    289   6e-96   Nicotiana sylvestris
gb|AFK34845.1|  unknown                                                 288   1e-95   Medicago truncatula
ref|XP_008464041.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    288   1e-95   Cucumis melo [Oriental melon]
gb|KJB34588.1|  hypothetical protein B456_006G106600                    290   1e-95   Gossypium raimondii
ref|XP_002525647.1|  cyclophilin, putative                              288   1e-95   Ricinus communis
ref|XP_004294264.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    288   2e-95   Fragaria vesca subsp. vesca
ref|XP_004500254.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    288   2e-95   Cicer arietinum [garbanzo]
ref|XP_010104628.1|  Peptidyl-prolyl cis-trans isomerase CYP19-4        288   2e-95   Morus notabilis
ref|XP_009785497.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    288   2e-95   Nicotiana sylvestris
ref|XP_008355066.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    287   3e-95   
ref|XP_010043430.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    287   3e-95   Eucalyptus grandis [rose gum]
gb|KDP46494.1|  hypothetical protein JCGZ_08466                         287   3e-95   Jatropha curcas
ref|XP_011080792.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    287   4e-95   Sesamum indicum [beniseed]
gb|AFK44786.1|  unknown                                                 286   5e-95   Lotus japonicus
gb|AFN53672.1|  peptidyl-prolyl cis-trans isomerase                     286   5e-95   Linum usitatissimum
emb|CBI15954.3|  unnamed protein product                                286   5e-95   Vitis vinifera
ref|XP_002277763.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    286   5e-95   Vitis vinifera
ref|XP_004143158.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    286   9e-95   Cucumis sativus [cucumbers]
ref|XP_002313378.1|  peptidyl-prolyl cis-trans isomerase family p...    286   9e-95   Populus trichocarpa [western balsam poplar]
ref|XP_010933259.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    286   1e-94   Elaeis guineensis
ref|XP_010933260.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    286   1e-94   Elaeis guineensis
ref|XP_008358961.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    286   1e-94   
ref|XP_008384800.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    286   1e-94   Malus domestica [apple tree]
gb|AFK38976.1|  unknown                                                 286   1e-94   Lotus japonicus
ref|XP_010253899.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    286   1e-94   Nelumbo nucifera [Indian lotus]
gb|ABS30424.1|  cyclophilin-like protein                                286   1e-94   Nicotiana tabacum [American tobacco]
ref|XP_011032116.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    286   1e-94   Populus euphratica
ref|XP_010253898.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    286   1e-94   Nelumbo nucifera [Indian lotus]
ref|XP_009630738.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    285   2e-94   Nicotiana tomentosiformis
ref|XP_007146769.1|  hypothetical protein PHAVU_006G068200g             285   2e-94   Phaseolus vulgaris [French bean]
ref|XP_010253897.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    286   2e-94   Nelumbo nucifera [Indian lotus]
emb|CAN70835.1|  hypothetical protein VITISV_015871                     285   3e-94   Vitis vinifera
ref|XP_007016102.1|  Cyclophilin 5                                      285   4e-94   
ref|NP_001236075.1|  uncharacterized protein LOC100305485 precursor     284   4e-94   Glycine max [soybeans]
ref|XP_009409920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    285   4e-94   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409921.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    285   5e-94   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002881077.1|  cyclophilin                                        284   5e-94   
gb|AEK80448.1|  peptidyl-prolyl cis-trans isomerase                     284   5e-94   Carica papaya [mamon]
gb|EPS66571.1|  peptidyl-prolyl cis-trans isomerase                     283   5e-94   Genlisea aurea
ref|XP_007205916.1|  hypothetical protein PRUPE_ppa011595mg             283   9e-94   Prunus persica
ref|XP_009605568.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    284   9e-94   Nicotiana tomentosiformis
ref|XP_011043772.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    283   1e-93   Populus euphratica
gb|AAB71401.1|  cyclophilin                                             283   1e-93   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180557.1|  peptidyl-prolyl cis-trans isomerase CYP19-4           283   1e-93   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010685556.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    283   2e-93   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009347261.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    282   2e-93   Pyrus x bretschneideri [bai li]
ref|XP_003538292.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    282   2e-93   
ref|XP_002298312.1|  peptidyl-prolyl cis-trans isomerase family p...    282   2e-93   
emb|CDY55458.1|  BnaC04g54560D                                          282   3e-93   Brassica napus [oilseed rape]
ref|XP_009144343.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    282   3e-93   Brassica rapa
ref|XP_008797942.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    282   3e-93   Phoenix dactylifera
gb|ACJ06541.1|  cyclophilin                                             282   3e-93   Camellia oleifera [abura-tsubaki]
ref|XP_004241161.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    285   3e-93   Solanum lycopersicum
ref|XP_010262860.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    282   4e-93   Nelumbo nucifera [Indian lotus]
ref|XP_008797941.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    282   4e-93   
gb|ABK92628.1|  unknown                                                 282   4e-93   Populus trichocarpa [western balsam poplar]
ref|XP_010227456.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    282   6e-93   Brachypodium distachyon [annual false brome]
gb|AAM63088.1|  cyclophilin                                             281   8e-93   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414329.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    281   8e-93   
emb|CDP09190.1|  unnamed protein product                                281   1e-92   Coffea canephora [robusta coffee]
ref|XP_010510426.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    282   1e-92   Camelina sativa [gold-of-pleasure]
ref|XP_010469913.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    280   1e-92   Camelina sativa [gold-of-pleasure]
ref|XP_006656475.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    280   2e-92   Oryza brachyantha
gb|EYU45977.1|  hypothetical protein MIMGU_mgv1a013993mg                280   2e-92   Erythranthe guttata [common monkey flower]
ref|XP_004966389.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    280   3e-92   Setaria italica
ref|XP_004966388.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    280   3e-92   Setaria italica
gb|ACF49500.1|  cyclophilin B-B                                         280   3e-92   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006350839.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    280   3e-92   Solanum tuberosum [potatoes]
dbj|BAJ90132.1|  predicted protein                                      280   5e-92   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF49505.1|  cyclophilin B-D                                         279   6e-92   Aegilops tauschii
emb|CDP14025.1|  unnamed protein product                                279   1e-91   Coffea canephora [robusta coffee]
gb|EAZ38239.1|  hypothetical protein OsJ_22614                          278   1e-91   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ54439.1|  cyclophilin B                                           278   2e-91   Triticum urartu
ref|XP_006848226.1|  hypothetical protein AMTR_s00029p00245680          277   3e-91   Amborella trichopoda
gb|EAZ02313.1|  hypothetical protein OsI_24414                          278   3e-91   Oryza sativa Indica Group [Indian rice]
ref|XP_006294680.1|  hypothetical protein CARUB_v10023717mg             280   3e-91   
ref|XP_010535384.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    277   4e-91   Tarenaya hassleriana [spider flower]
ref|NP_001058535.1|  Os06g0708500                                       277   4e-91   
ref|NP_200679.1|  cyclophilin ROC7                                      277   4e-91   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD53621.1|  putative cyclophilin                                   277   6e-91   Oryza sativa Japonica Group [Japonica rice]
gb|AAP76508.1|  cyclophilin                                             277   6e-91   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001149847.1|  peptidyl-prolyl cis-trans isomerase CYP19-4 ...    276   7e-91   Zea mays [maize]
gb|AFW69420.1|  putative peptidyl-prolyl cis-trans isomerase fami...    277   7e-91   
ref|XP_006410046.1|  hypothetical protein EUTSA_v10016970mg             279   1e-90   
ref|XP_002437567.1|  hypothetical protein SORBIDRAFT_10g029480          276   1e-90   Sorghum bicolor [broomcorn]
gb|AEE98363.1|  cyclophilin B-D                                         273   2e-90   Deschampsia antarctica
ref|XP_001769405.1|  predicted protein                                  274   6e-90   
gb|EYU45717.1|  hypothetical protein MIMGU_mgv1a013744mg                273   2e-89   Erythranthe guttata [common monkey flower]
ref|XP_005845180.1|  hypothetical protein CHLNCDRAFT_26227              271   4e-89   Chlorella variabilis
ref|XP_009420416.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    271   8e-89   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK20982.1|  unknown                                                 271   8e-89   Picea sitchensis
ref|XP_011035946.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    271   9e-89   Populus euphratica
gb|KFK24386.1|  hypothetical protein AALP_AAs72209U000300               270   2e-88   Arabis alpina [alpine rockcress]
ref|XP_002315159.1|  peptidyl-prolyl cis-trans isomerase family p...    270   3e-88   Populus trichocarpa [western balsam poplar]
gb|ABK94432.1|  unknown                                                 270   3e-88   Populus trichocarpa [western balsam poplar]
gb|ACF49501.1|  cyclophilin B-A                                         270   3e-88   Triticum aestivum [Canadian hard winter wheat]
gb|KCW85440.1|  hypothetical protein EUGRSUZ_B02252                     267   6e-88   Eucalyptus grandis [rose gum]
ref|XP_007008975.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    269   6e-88   
gb|KDO68977.1|  hypothetical protein CISIN_1g027222mg                   268   3e-87   Citrus sinensis [apfelsine]
gb|KDO68980.1|  hypothetical protein CISIN_1g027222mg                   267   3e-87   Citrus sinensis [apfelsine]
gb|KDO68978.1|  hypothetical protein CISIN_1g027222mg                   267   3e-87   Citrus sinensis [apfelsine]
gb|KDO68979.1|  hypothetical protein CISIN_1g027222mg                   267   3e-87   Citrus sinensis [apfelsine]
ref|XP_002979746.1|  hypothetical protein SELMODRAFT_111263             266   4e-87   Selaginella moellendorffii
gb|KDP44773.1|  hypothetical protein JCGZ_01273                         267   6e-87   Jatropha curcas
ref|XP_009788373.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    266   9e-87   Nicotiana sylvestris
ref|XP_002988391.1|  hypothetical protein SELMODRAFT_447339             265   1e-86   Selaginella moellendorffii
ref|XP_006435733.1|  hypothetical protein CICLE_v10032673mg             266   1e-86   Citrus clementina [clementine]
ref|XP_006486319.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    266   1e-86   Citrus sinensis [apfelsine]
gb|KJB74295.1|  hypothetical protein B456_011G287900                    266   1e-86   Gossypium raimondii
ref|XP_009625080.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    265   3e-86   Nicotiana tomentosiformis
ref|XP_001782168.1|  predicted protein                                  264   3e-86   
ref|XP_011084909.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    265   4e-86   Sesamum indicum [beniseed]
ref|XP_006338848.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    264   6e-86   Solanum tuberosum [potatoes]
ref|XP_010322200.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    263   7e-86   Solanum lycopersicum
ref|XP_004240942.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    263   3e-85   
ref|XP_010689673.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    263   4e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010031222.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    262   5e-85   Eucalyptus grandis [rose gum]
gb|ABB86261.1|  cyclophilin ROC7-like                                   261   5e-85   Solanum tuberosum [potatoes]
ref|XP_010031221.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    262   6e-85   Eucalyptus grandis [rose gum]
ref|NP_001077978.1|  peptidyl-prolyl cis-trans isomerase CYP19-4        260   1e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008233754.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    261   1e-84   Prunus mume [ume]
ref|XP_008344818.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    258   1e-84   
gb|AIS71896.1|  peptidyl-prolyl cis-trans isomerase CYP19-4-like ...    261   2e-84   Nicotiana tabacum [American tobacco]
emb|CBW52773.1|  peptidyl-prolyl cis-trans isomerase                    258   5e-84   Polytomella sp. Pringsheim 198.80
ref|XP_003600890.1|  Peptidyl-prolyl cis-trans isomerase                259   6e-84   Medicago truncatula
gb|KCW50482.1|  hypothetical protein EUGRSUZ_J00210                     261   1e-83   Eucalyptus grandis [rose gum]
ref|XP_001695474.1|  peptidyl-prolyl cis-trans isomerase, cycloph...    258   1e-83   Chlamydomonas reinhardtii
ref|XP_002533648.1|  cyclophilin, putative                              258   1e-83   
gb|KCW50481.1|  hypothetical protein EUGRSUZ_J00210                     261   1e-83   Eucalyptus grandis [rose gum]
gb|ABI33223.1|  cyclophilin                                             256   2e-83   Camellia sinensis [black tea]
ref|XP_010534595.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    257   2e-83   Tarenaya hassleriana [spider flower]
ref|XP_002958739.1|  hypothetical protein VOLCADRAFT_84601              257   2e-83   Volvox carteri f. nagariensis
ref|XP_009344915.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    258   2e-83   Pyrus x bretschneideri [bai li]
ref|XP_010534597.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    258   3e-83   Tarenaya hassleriana [spider flower]
gb|KHN34720.1|  Peptidyl-prolyl cis-trans isomerase CYP19-4             258   4e-83   Glycine soja [wild soybean]
emb|CBK24925.2|  unnamed protein product                                256   7e-83   Blastocystis hominis
ref|XP_004500488.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    256   9e-83   Cicer arietinum [garbanzo]
gb|AFK38441.1|  unknown                                                 256   9e-83   Lotus japonicus
emb|CDY52123.1|  BnaA10g29520D                                          255   9e-83   Brassica napus [oilseed rape]
ref|XP_008374016.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    255   1e-82   
ref|XP_004307644.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    256   1e-82   Fragaria vesca subsp. vesca
gb|EYU22353.1|  hypothetical protein MIMGU_mgv1a013286mg                256   1e-82   Erythranthe guttata [common monkey flower]
ref|XP_006403401.1|  hypothetical protein EUTSA_v10010699mg             256   2e-82   Eutrema salsugineum [saltwater cress]
ref|XP_002273217.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    256   2e-82   Vitis vinifera
emb|CDX71155.1|  BnaC03g12390D                                          254   2e-82   
ref|XP_008374012.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    255   2e-82   
emb|CDY61026.1|  BnaAnng17350D                                          254   2e-82   Brassica napus [oilseed rape]
ref|XP_009120386.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    254   2e-82   Brassica rapa
ref|XP_008369251.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    254   3e-82   Malus domestica [apple tree]
ref|XP_010443618.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    254   4e-82   Camelina sativa [gold-of-pleasure]
ref|XP_006281118.1|  hypothetical protein CARUB_v10027149mg             254   4e-82   Capsella rubella
ref|NP_001242013.1|  uncharacterized protein LOC100798499 precursor     254   5e-82   
ref|XP_006401051.1|  hypothetical protein EUTSA_v10014704mg             253   5e-82   Eutrema salsugineum [saltwater cress]
ref|XP_009132031.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    253   5e-82   Brassica rapa
ref|XP_010483473.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    253   6e-82   Camelina sativa [gold-of-pleasure]
gb|KIZ04415.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    253   6e-82   Monoraphidium neglectum
ref|XP_009369163.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    254   9e-82   Pyrus x bretschneideri [bai li]
ref|XP_002864586.1|  hypothetical protein ARALYDRAFT_495994             253   9e-82   
ref|XP_007163542.1|  hypothetical protein PHAVU_001G243000g             254   1e-81   Phaseolus vulgaris [French bean]
ref|XP_003552367.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    254   1e-81   
ref|XP_009116285.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    253   2e-81   Brassica rapa
ref|XP_009785498.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    251   4e-81   Nicotiana sylvestris
emb|CDX72190.1|  BnaC08g26840D                                          252   4e-81   
ref|XP_010454144.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    251   7e-81   Camelina sativa [gold-of-pleasure]
gb|KHN36375.1|  Peptidyl-prolyl cis-trans isomerase CYP20-1             251   7e-81   Glycine soja [wild soybean]
ref|XP_008463237.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    250   2e-80   Cucumis melo [Oriental melon]
ref|XP_006657326.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    249   6e-80   Oryza brachyantha
ref|XP_010427394.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    248   2e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010427393.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    248   2e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010427392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    248   2e-79   Camelina sativa [gold-of-pleasure]
ref|XP_006291798.1|  hypothetical protein CARUB_v10017974mg             247   5e-79   Capsella rubella
ref|XP_004149234.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    246   6e-79   Cucumis sativus [cucumbers]
ref|XP_002878051.1|  hypothetical protein ARALYDRAFT_486034             246   7e-79   Arabidopsis lyrata subsp. lyrata
ref|XP_010516184.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    246   8e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010516183.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    246   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_007218550.1|  hypothetical protein PRUPE_ppa012857mg             243   2e-78   
ref|NP_567029.1|  Cyclophilin-like peptidyl-prolyl cis-trans isom...    245   2e-78   Arabidopsis thaliana [mouse-ear cress]
gb|AAT09096.1|  cyclophilin                                             244   2e-78   Bigelowiella natans
ref|XP_010504464.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    245   3e-78   Camelina sativa [gold-of-pleasure]
ref|XP_002503873.1|  predicted protein                                  243   5e-78   Micromonas commoda
ref|XP_008891344.1|  peptidyl-prolyl cis-trans isomerase                243   1e-77   Phytophthora parasitica INRA-310
dbj|BAD53620.1|  putative cyclophilin                                   241   3e-77   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02312.1|  hypothetical protein OsI_24413                          241   5e-77   Oryza sativa Indica Group [Indian rice]
ref|XP_009537424.1|  hypothetical protein PHYSODRAFT_288960             240   8e-77   Phytophthora sojae
ref|XP_011400187.1|  Peptidyl-prolyl cis-trans isomerase CYP19-4        240   8e-77   Auxenochlorella protothecoides
ref|XP_002901150.1|  peptidyl-prolyl cis-trans isomerase CYP19-4 ...    239   2e-76   Phytophthora infestans T30-4
ref|XP_006435732.1|  hypothetical protein CICLE_v10032673mg             239   2e-76   
ref|XP_010516182.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    239   6e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010516181.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    239   8e-76   Camelina sativa [gold-of-pleasure]
ref|XP_003055075.1|  predicted protein                                  238   1e-75   Micromonas pusilla CCMP1545
ref|XP_004341067.1|  peptidylprolyl cis-trans isomerase, cyclophi...    237   1e-75   Acanthamoeba castellanii str. Neff
ref|XP_002186294.1|  predicted protein                                  237   1e-75   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_010504463.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    238   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_009408731.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    236   4e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_506749.1|  Protein CYN-7                                         233   1e-74   Caenorhabditis elegans [roundworm]
ref|XP_646208.1|  cyclophilin B                                         234   2e-74   Dictyostelium discoideum AX4
gb|AAC47125.1|  cyclophilin                                             233   3e-74   Caenorhabditis elegans [roundworm]
gb|EWM25413.1|  cyclophilin                                             233   3e-74   Nannochloropsis gaditana
ref|XP_001759491.1|  predicted protein                                  233   4e-74   
emb|CAP69837.1|  cyclophilin                                            231   5e-74   Ricinus communis
gb|ABI18377.1|  cyclophilin                                             231   9e-74   Steinernema carpocapsae
ref|XP_002774105.1|  cyclophilin 1, putative                            233   1e-73   Perkinsus marinus ATCC 50983
ref|XP_005770377.1|  peptidyl-prolyl isomerase                          232   2e-73   Emiliania huxleyi CCMP1516
ref|XP_002291895.1|  peptidyl-prolyl cis-trans isomerase; ppiase        230   5e-73   Thalassiosira pseudonana CCMP1335
ref|XP_003115457.1|  CRE-CYN-7 protein                                  228   1e-72   Caenorhabditis remanei
ref|XP_008028418.1|  hypothetical protein SETTUDRAFT_164317             228   2e-72   Exserohilum turcica Et28A
dbj|GAM18552.1|  hypothetical protein SAMD00019534_017270               229   2e-72   Acytostelium subglobosum LB1
gb|AAC47233.1|  cyclophilin Ovcyp-2                                     227   3e-72   Onchocerca volvulus
gb|EFA76366.1|  cyclophilin-type peptidylprolyl cis-trans isomerase     227   3e-72   Heterostelium album PN500
ref|XP_007701371.1|  hypothetical protein COCSADRAFT_92320              227   4e-72   Bipolaris sorokiniana ND90Pr
ref|XP_008878745.1|  peptidyl-prolyl cis-trans isomerase                228   4e-72   Aphanomyces invadans
gb|KFK34831.1|  peptidyl-prolyl cis-trans isomerase                     228   5e-72   Arabis alpina [alpine rockcress]
ref|XP_002638374.1|  Hypothetical protein CBG18578                      227   6e-72   Caenorhabditis briggsae
ref|XP_001579633.1|  cytosolic cyclophilin                              226   1e-71   Trichomonas vaginalis G3
ref|XP_009520427.1|  hypothetical protein PHYSODRAFT_285045             226   1e-71   Phytophthora sojae
emb|CDW53642.1|  peptidyl prolyl cis trans isomerase 7                  226   2e-71   Trichuris trichiura
ref|XP_003139210.1|  cyclophilin Ovcyp-2                                225   2e-71   Loa loa
ref|XP_007692567.1|  hypothetical protein COCMIDRAFT_30232              225   3e-71   Bipolaris oryzae ATCC 44560
gb|AAQ87931.1|  Bet v 7-like protein                                    225   3e-71   Curvularia lunata
ref|XP_009829338.1|  peptidyl-prolyl cis-trans isomerase                226   3e-71   Aphanomyces astaci
emb|CDJ82690.1|  Peptidyl-prolyl cis-trans isomerase domain conta...    225   3e-71   Haemonchus contortus [red stomach worm]
emb|CBK20464.2|  Peptidyl-prolyl cis-trans isomerase                    226   4e-71   Blastocystis hominis
gb|KHJ92301.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    225   4e-71   Oesophagostomum dentatum [nodule worm]
gb|EGT45232.1|  CBN-CYN-7 protein                                       224   5e-71   Caenorhabditis brenneri
gb|ETN78289.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    224   6e-71   Necator americanus
ref|XP_002632172.1|  Hypothetical protein CBG07031                      224   6e-71   Caenorhabditis briggsae
ref|XP_007714724.1|  hypothetical protein COCCADRAFT_102503             224   6e-71   Bipolaris zeicola 26-R-13
gb|KHJ83952.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    225   7e-71   Oesophagostomum dentatum [nodule worm]
dbj|GAM29016.1|  hypothetical protein SAMD00019534_121920               224   7e-71   Acytostelium subglobosum LB1
ref|WP_014393514.1|  peptidylprolyl isomerase                           224   8e-71   Corallococcus coralloides
gb|KDD76700.1|  cyclophilin type peptidyl-prolyl cis-trans isomerase    226   9e-71   Helicosporidium sp. ATCC 50920
ref|XP_008220814.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   1e-70   Prunus mume [ume]
gb|AIG55930.1|  secreted protein                                        224   1e-70   Achlya hypogyna
ref|XP_004254113.1|  peptidyl-prolyl cis-trans isomerase CYP20-1 ...    224   1e-70   Entamoeba invadens IP1
gb|ETP48268.1|  peptidyl-prolyl cis-trans isomerase                     223   1e-70   Phytophthora parasitica P10297
ref|XP_008915854.1|  peptidyl-prolyl cis-trans isomerase                223   2e-70   Phytophthora parasitica INRA-310
gb|KHN80348.1|  Peptidyl-prolyl cis-trans isomerase 3                   223   2e-70   Toxocara canis
gb|AEP37836.1|  cyclophilin a                                           223   2e-70   Plasmopara viticola
gb|EMD94092.1|  hypothetical protein COCHEDRAFT_1201904                 223   3e-70   Bipolaris maydis C5
ref|XP_002638373.1|  C. briggsae CBR-CYN-3 protein                      223   3e-70   Caenorhabditis briggsae
ref|XP_008604422.1|  peptidyl-prolyl cis-trans isomerase B (cyclo...    224   3e-70   Saprolegnia diclina VS20
gb|ERG80132.1|  peptidyl-prolyl cis-trans isomerase 3                   223   3e-70   
ref|NP_001289049.1|  peptidyl-prolyl cis-trans isomerase CYP18-3        222   3e-70   Brassica rapa
ref|XP_002591341.1|  hypothetical protein BRAFLDRAFT_216533             222   3e-70   Branchiostoma floridae
ref|XP_001700372.1|  peptidyl-prolyl cis-trans isomerase, cycloph...    222   3e-70   Chlamydomonas reinhardtii
emb|CDW88516.1|  cyclophilin b                                          222   4e-70   Stylonychia lemnae
ref|XP_001737925.1|  peptidyl-prolyl cis-trans isomerase CYP19-4 ...    223   4e-70   Entamoeba dispar SAW760
gb|AFW69418.1|  putative peptidyl-prolyl cis-trans isomerase fami...    224   4e-70   
ref|WP_040353328.1|  peptidylprolyl isomerase                           222   5e-70   
dbj|BAM13286.1|  CYCLOPHILIN 1                                          222   5e-70   Oryza australiensis
gb|EAQ82402.1|  peptidylprolyl isomerase                                223   6e-70   Blastopirellula marina DSM 3645
ref|XP_004355130.1|  cyclophilin B                                      232   6e-70   Cavenderia fasciculata
ref|XP_001941476.1|  peptidyl-prolyl cis-trans isomerase                221   6e-70   Pyrenophora tritici-repentis Pt-1C-BFP
ref|NP_506751.1|  Protein CYN-3                                         221   8e-70   Caenorhabditis elegans [roundworm]
dbj|BAM13284.1|  CYCLOPHILIN 1                                          221   8e-70   Oryza officinalis
ref|XP_002905297.1|  peptidyl-prolyl cis-trans isomerase                221   9e-70   Phytophthora infestans T30-4
dbj|BAM13285.1|  CYCLOPHILIN 1                                          221   9e-70   Oryza latifolia
gb|ABI14282.1|  cyclophilin-like protein                                221   9e-70   Pfiesteria piscicida
ref|XP_008856516.1|  peptidyl-prolyl cis-trans isomerase, putative      222   1e-69   Entamoeba nuttalli P19
ref|XP_009041439.1|  hypothetical protein AURANDRAFT_33371              222   1e-69   Aureococcus anophagefferens
gb|EGT52739.1|  hypothetical protein CAEBREN_15861                      221   1e-69   Caenorhabditis brenneri
ref|XP_009412893.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     221   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|WP_040528526.1|  peptidylprolyl isomerase                           220   2e-69   
ref|XP_648283.1|  peptidyl-prolyl cis-trans isomerase                   221   2e-69   Entamoeba histolytica HM-1:IMSS
gb|KHJ83216.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    221   2e-69   Oesophagostomum dentatum [nodule worm]
gb|EFA85952.1|  cyclophilin B                                           222   2e-69   Heterostelium album PN500
gb|KHN73182.1|  Peptidyl-prolyl cis-trans isomerase 3                   223   3e-69   Toxocara canis
ref|XP_003115315.1|  hypothetical protein CRE_19071                     219   3e-69   Caenorhabditis remanei
gb|EJY85953.1|  Peptidyl-prolyl cis-trans isomerase B                   221   4e-69   Oxytricha trifallax
ref|XP_001802932.1|  hypothetical protein SNOG_12712                    219   4e-69   Parastagonospora nodorum SN15
gb|ABV22152.1|  cyclophilin                                             220   4e-69   Perkinsus chesapeaki
ref|XP_004967282.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    221   5e-69   Setaria italica
gb|AAC47232.1|  cyclophilin Dicyp-2                                     219   5e-69   Dirofilaria immitis [canine heartworm nematode]
ref|WP_044196140.1|  peptidylprolyl isomerase                           219   5e-69   Hyalangium minutum
gb|KDO30624.1|  peptidyl-prolyl cis-trans isomerase                     219   5e-69   
ref|XP_003295671.1|  hypothetical protein PTT_02276                     219   6e-69   
gb|AAC05639.1|  cyclophilin 1                                           219   6e-69   
ref|XP_002437566.1|  hypothetical protein SORBIDRAFT_10g029470          221   7e-69   
ref|XP_008616184.1|  peptidyl-prolyl cis-trans isomerase                219   7e-69   
gb|AIG55642.1|  secreted protein                                        220   7e-69   
ref|XP_003370874.1|  peptidyl-prolyl cis-trans isomerase 7              219   7e-69   
gb|AGT16090.1|  cyclophilin                                             219   7e-69   
gb|EGT45293.1|  hypothetical protein CAEBREN_23456                      219   8e-69   
ref|NP_001045717.1|  Os02g0121300                                       219   8e-69   
ref|WP_002619414.1|  peptidylprolyl isomerase                           219   9e-69   
ref|XP_009590739.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    218   1e-68   
gb|ACB05668.1|  cyclophilin                                             218   1e-68   
ref|XP_004952611.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    218   1e-68   
gb|ACT53879.1|  cyclophilin                                             218   1e-68   
ref|XP_010526905.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     218   2e-68   
emb|CAA69622.1|  cyclophylin                                            218   2e-68   
ref|XP_005647341.1|  cyclophilin                                        218   2e-68   
ref|XP_003293545.1|  hypothetical protein DICPUDRAFT_90286              219   2e-68   
gb|ERG84468.1|  peptidyl-prolyl cis-trans isomerase 3                   218   2e-68   
ref|XP_009391979.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    218   2e-68   
gb|AFP44118.1|  cyclophilin                                             218   2e-68   
ref|XP_009759250.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     218   2e-68   
pdb|4HY7|A  Chain A, Structural And Biochemical Characterization ...    218   2e-68   
gb|ABU56008.1|  cyclophilin 3                                           218   2e-68   
gb|ABS85544.1|  cyclophilin                                             218   2e-68   
ref|XP_006646800.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    218   2e-68   
gb|AAU87301.1|  cyclophilin                                             218   2e-68   
ref|XP_002772409.1|  20 kDa cyclophilin precursor, putative             218   2e-68   
gb|ACV88654.1|  cyclophilin                                             218   2e-68   
ref|XP_004957482.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    219   3e-68   
ref|XP_002591342.1|  hypothetical protein BRAFLDRAFT_216449             217   3e-68   
gb|ABL67655.1|  putative cyclophilin                                    217   3e-68   
ref|XP_003117181.1|  CRE-CYN-2 protein                                  217   3e-68   
gb|AIZ74330.1|  cyclophilin                                             217   3e-68   
emb|CAA69598.1|  cyclophilin                                            217   3e-68   
ref|XP_006660897.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    219   3e-68   
gb|AAK49427.1|AF262983_1  cyclophilin A-2                               217   4e-68   
ref|XP_006367332.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    217   4e-68   
ref|XP_003522746.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    217   4e-68   
emb|CEF66075.1|  Peptidyl-prolyl cis-trans isomerase D                  217   4e-68   
ref|XP_002459866.1|  hypothetical protein SORBIDRAFT_02g012590          217   4e-68   
pdb|4E1Q|A  Chain A, Crystal Structure Of Wheat Cyclophilin A At ...    218   4e-68   
ref|XP_002630997.1|  C. briggsae CBR-CYN-2 protein                      217   5e-68   
ref|NP_001276071.1|  uncharacterized protein LOC102623101               217   5e-68   
ref|XP_002868859.1|  hypothetical protein ARALYDRAFT_490638             217   5e-68   
ref|XP_002313736.1|  peptidyl-prolyl cis-trans isomerase family p...    217   5e-68   
pdb|4JJM|A  Chain A, Structure Of A Cyclophilin From Citrus Sinen...    217   5e-68   
gb|ABU56006.1|  cyclophilin 1                                           216   5e-68   
ref|XP_004248678.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    216   5e-68   
dbj|BAM13289.1|  CYCLOPHILIN 1                                          216   6e-68   
ref|XP_006388902.1|  peptidyl-prolyl cis-trans isomerase family p...    216   6e-68   
gb|ABU56007.1|  cyclophilin 2                                           216   6e-68   
gb|ACF48822.1|  cyclophilin                                             216   6e-68   
dbj|BAM13283.1|  CYCLOPHILIN 1                                          216   7e-68   
ref|XP_008678672.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    216   7e-68   
gb|AAA57046.1|  cyclophilin 2                                           216   7e-68   
ref|XP_006282738.1|  hypothetical protein CARUB_v10005879mg             216   7e-68   
ref|XP_005787000.1|  peptidyl-prolyl isomerase                          216   7e-68   
ref|XP_009788636.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     216   7e-68   
ref|XP_002460578.1|  hypothetical protein SORBIDRAFT_02g031150          218   7e-68   
dbj|BAQ21277.1|  cyclophilin                                            216   8e-68   
ref|XP_006411664.1|  hypothetical protein EUTSA_v10026397mg             216   8e-68   
ref|XP_011046718.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    216   8e-68   
ref|XP_010694773.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    216   9e-68   
ref|XP_003097196.1|  hypothetical protein CRE_18104                     216   1e-67   
ref|XP_001902628.1|  cyclophilin-type peptidyl-prolyl cis-trans i...    216   1e-67   
ref|XP_003112830.1|  CRE-CYN-1 protein                                  216   1e-67   
ref|XP_009610666.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     216   1e-67   
ref|NP_001063792.1|  Os09g0537600                                       217   1e-67   
emb|CAC81066.1|  putative cyclosporin A-binding protein                 216   1e-67   
ref|XP_005846877.1|  hypothetical protein CHLNCDRAFT_35742              218   1e-67   
ref|XP_004337460.1|  peptidylprolyl cis-trans isomerase                 216   1e-67   
pdb|4JCP|A  Chain A, Structure Of Cyclophilin B From Brugia Malayi      216   1e-67   
gb|ADV04050.1|  cyclophilin                                             216   2e-67   
gb|AEV66153.1|  cyclophilin                                             215   2e-67   
ref|XP_010446391.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    215   2e-67   
ref|XP_002451412.1|  hypothetical protein SORBIDRAFT_04g001740          215   2e-67   
emb|CAB87846.1|  cyclophilin-like protein                               218   2e-67   
ref|XP_008645736.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     215   2e-67   
ref|XP_011088559.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    215   2e-67   
ref|NP_001136688.1|  putative peptidyl-prolyl cis-trans isomerase...    217   2e-67   
gb|KJB47605.1|  hypothetical protein B456_008G034100                    215   2e-67   
ref|XP_010530785.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    215   2e-67   
gb|ABK96333.1|  unknown                                                 215   2e-67   
ref|NP_001234488.1|  peptidyl-prolyl cis-trans isomerase                215   2e-67   
ref|XP_002601271.1|  hypothetical protein BRAFLDRAFT_229322             215   2e-67   
ref|XP_010436974.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    215   2e-67   
gb|KJB12159.1|  hypothetical protein B456_002G003800                    215   2e-67   
ref|XP_010941286.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    215   2e-67   
ref|XP_009112393.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     215   3e-67   
ref|XP_008886041.1|  cyclophilin precursor                              215   3e-67   
ref|XP_003294002.1|  hypothetical protein DICPUDRAFT_58785              215   3e-67   
dbj|BAJ85310.1|  predicted protein                                      216   3e-67   
gb|AGL08208.1|  cyclophilin                                             215   3e-67   
ref|XP_008799420.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     215   3e-67   
ref|XP_007041920.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    215   3e-67   
ref|XP_002274869.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     215   3e-67   
ref|XP_008447986.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     214   3e-67   
gb|ACX47902.1|  cyclophilin                                             214   3e-67   
ref|XP_011036276.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   3e-67   
ref|NP_001238688.1|  uncharacterized protein LOC100527355               214   3e-67   
gb|ABY57946.1|  cyclophilin                                             214   3e-67   
ref|XP_011083569.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   4e-67   
ref|XP_011035947.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    216   4e-67   
gb|EGT35378.1|  hypothetical protein CAEBREN_18953                      214   4e-67   
gb|KFK30470.1|  hypothetical protein AALP_AA7G265300                    214   4e-67   
ref|WP_040729484.1|  peptidylprolyl isomerase                           214   4e-67   
ref|XP_009377655.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     214   4e-67   
tpg|DAA64359.1|  TPA: putative peptidyl-prolyl cis-trans isomeras...    216   4e-67   
ref|XP_006646802.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   4e-67   
gb|EGV19991.1|  peptidyl-prolyl cis-trans isomerase cyclophilin type    215   4e-67   
ref|NP_195585.1|  peptidyl-prolyl cis-trans isomerase CYP1              214   4e-67   
ref|XP_002880359.1|  peptidyl-prolyl cis-trans isomerase                214   4e-67   
gb|ABV26711.1|  cyclophilin                                             214   5e-67   
gb|AEF01110.1|  cyclophilin 2                                           214   5e-67   
ref|XP_005772559.1|  peptidyl-prolyl cis-trans isomerase putative...    214   5e-67   
ref|XP_010531511.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   5e-67   
gb|AEM44784.1|  cyclophilin                                             214   5e-67   
ref|XP_010548088.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   5e-67   
gb|AHV84998.1|  peptidylprolyl isomerase                                214   5e-67   
emb|CDY26779.1|  BnaC09g09060D                                          214   5e-67   
gb|ADG34846.1|  cyclophilin                                             214   6e-67   
ref|XP_009101932.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   6e-67   
gb|KJB77728.1|  hypothetical protein B456_012G153200                    214   6e-67   
ref|XP_011074689.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     214   6e-67   
gb|EMS48237.1|  Peptidyl-prolyl cis-trans isomerase CYP19-4             215   6e-67   
ref|XP_003882240.1|  Peptidyl-prolyl cis-trans isomerase A, related     214   6e-67   
ref|XP_010268679.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     214   7e-67   
gb|ABP35528.1|  cyclophilin                                             214   7e-67   
ref|XP_010431822.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   7e-67   
gb|EPS65110.1|  peptidyl-prolyl cis-trans isomerase                     214   7e-67   
ref|XP_002788075.1|  cyclophilin 1, putative                            214   7e-67   
ref|XP_011037275.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   8e-67   
ref|XP_010090292.1|  Peptidyl-prolyl cis-trans isomerase                214   8e-67   
ref|XP_001322019.1|  cytosolic cyclophilin                              214   8e-67   
ref|XP_011092880.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   8e-67   
ref|WP_017297358.1|  peptidylprolyl isomerase                           214   9e-67   
ref|XP_002765236.1|  20 kDa cyclophilin precursor, putative             213   9e-67   
ref|XP_004357939.1|  cyclophilin-type peptidylprolyl cis-trans is...    217   1e-66   
ref|XP_002510543.1|  cyclophilin, putative                              213   1e-66   
ref|XP_010066256.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     213   1e-66   
gb|KDP27580.1|  hypothetical protein JCGZ_19585                         213   1e-66   
sp|Q39613.1|CYPH_CATRO  RecName: Full=Peptidyl-prolyl cis-trans i...    213   1e-66   
ref|XP_009346636.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    213   1e-66   
ref|XP_007030475.1|  Rotamase cyclophilin 2                             213   1e-66   
ref|XP_002305507.2|  hypothetical protein POPTR_0004s17920g             215   1e-66   
pdb|2MC9|A  Chain A, Cat R 1                                            213   1e-66   
ref|XP_004956263.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    213   1e-66   
ref|XP_001328636.1|  cytosolic cyclophilin                              213   1e-66   
gb|EYC12653.1|  hypothetical protein Y032_0046g1344                     214   1e-66   
ref|XP_010530499.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    211   2e-66   
dbj|BAM13287.1|  CYCLOPHILIN 1                                          213   2e-66   
gb|EYC37494.1|  hypothetical protein Y032_0785g2343                     214   2e-66   
gb|ABZ88806.1|  cyclophilin                                             213   2e-66   
ref|NP_179709.1|  peptidyl-prolyl cis-trans isomerase CYP19-2           213   2e-66   
ref|XP_008236203.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     213   2e-66   
ref|XP_008788633.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    213   2e-66   
emb|CDX72741.1|  BnaC07g47630D                                          213   2e-66   
ref|WP_039311101.1|  peptidylprolyl isomerase                           213   2e-66   
ref|XP_003834284.1|  similar to peptidyl-prolyl cis-trans isomerase     213   2e-66   
ref|XP_004990131.1|  peptidyl-prolyl cis-trans isomerase                213   2e-66   
ref|XP_010472091.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    213   2e-66   
ref|XP_008364692.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    213   2e-66   
ref|XP_006409418.1|  hypothetical protein EUTSA_v10022880mg             213   2e-66   
gb|EYU37917.1|  hypothetical protein MIMGU_mgv1a014959mg                213   2e-66   
ref|XP_010690387.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   2e-66   
gb|AAC47231.1|  cyclophilin Bmcyp-2                                     213   2e-66   
ref|XP_001900811.1|  cyclophilin-type peptidyl-prolyl cis-trans i...    213   2e-66   
ref|XP_004142527.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    213   2e-66   
ref|XP_010429007.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    213   2e-66   
ref|WP_030006986.1|  peptidylprolyl isomerase                           213   2e-66   
ref|XP_004302078.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    213   3e-66   
emb|CDI79350.1|  20 kDa cyclophilin precursor, putative                 212   3e-66   
gb|EGT36088.1|  hypothetical protein CAEBREN_03551                      212   3e-66   
ref|XP_002637839.1|  C. briggsae CBR-CYN-1 protein                      213   3e-66   
ref|XP_006661010.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    213   3e-66   
gb|AAB71402.1|  cyclophilin                                             212   3e-66   
gb|KDP36915.1|  hypothetical protein JCGZ_08206                         212   3e-66   
ref|NP_506561.1|  Protein CYN-1                                         213   3e-66   
ref|NP_001063993.1|  Os09g0571400                                       213   3e-66   
emb|CDP95518.1|  Protein Bm9806, isoform b                              213   3e-66   
gb|EJW85904.1|  cyclophilin-type peptidyl-prolyl cis-trans isomer...    212   3e-66   
ref|NP_001149489.1|  peptidyl-prolyl cis-trans isomerase CYP19-3        212   3e-66   
ref|XP_003142324.1|  cyclophilin-type peptidyl-prolyl cis-trans i...    212   3e-66   
ref|XP_008779401.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    212   4e-66   
ref|XP_003149163.1|  cyclophilin-type peptidyl-prolyl cis-trans i...    214   4e-66   
ref|XP_004289844.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    212   4e-66   
ref|XP_005851021.1|  hypothetical protein CHLNCDRAFT_29941              212   4e-66   
ref|XP_002788074.1|  20 kDa cyclophilin precursor, putative             212   4e-66   
gb|ACG31960.1|  peptidyl-prolyl cis-trans isomerase                     212   4e-66   
gb|AEY79726.1|  cyclophilin                                             212   4e-66   
ref|XP_002452188.1|  hypothetical protein SORBIDRAFT_04g021380          212   4e-66   
ref|XP_010274820.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    212   4e-66   
ref|XP_004296656.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    212   5e-66   
gb|KFK30119.1|  hypothetical protein AALP_AA7G219300                    212   5e-66   
gb|AGI78541.1|  cyclophilin                                             212   5e-66   
ref|NP_001275605.1|  peptidyl-prolyl cis-trans isomerase-like           211   5e-66   
gb|AGS78042.1|  cyclophilin 1                                           211   5e-66   
gb|AFO67220.1|  putative cyclophilin                                    211   5e-66   
gb|AEF01109.1|  cyclophilin 1                                           211   5e-66   
gb|EJW81456.1|  cyclophilin Ovcyp-2                                     211   6e-66   
gb|AFK43730.1|  unknown                                                 211   6e-66   
gb|ABO47873.1|  cyclophilin                                             211   6e-66   
ref|XP_010233732.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     211   7e-66   
gb|ACT63839.1|  cydophilin                                              211   7e-66   
dbj|BAB82452.1|  CYP1                                                   211   7e-66   
ref|XP_010246849.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    213   7e-66   
emb|CBJ93268.1|  cyclophilin                                            211   7e-66   
gb|ABK96400.1|  unknown                                                 211   7e-66   
gb|ABQ14358.1|  putative cyclophilin                                    211   7e-66   
ref|XP_007201241.1|  hypothetical protein PRUPE_ppa012332mg             211   7e-66   
ref|XP_006404551.1|  hypothetical protein EUTSA_v10000350mg             211   7e-66   
gb|AGS78046.1|  cyclophilin 1                                           211   8e-66   
ref|XP_009844129.1|  peptidyl-prolyl cis-trans isomerase 1              211   8e-66   
ref|XP_011001981.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    213   8e-66   
gb|AFJ92644.1|  ABH-like cyclophilin                                    211   9e-66   
ref|XP_006412177.1|  hypothetical protein EUTSA_v10027585mg             212   9e-66   
ref|XP_007136181.1|  hypothetical protein PHAVU_009G025000g             211   1e-65   
ref|XP_002953855.1|  hypothetical protein VOLCADRAFT_109901             211   1e-65   
gb|AGS78047.1|  cyclophilin 1                                           211   1e-65   



>gb|KJB34587.1| hypothetical protein B456_006G106600 [Gossypium raimondii]
Length=207

 Score =   291 bits (746),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIVIGLFGKAVPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIP+FMI
Sbjct  44   VEIAGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHFKGSAFHRIIPNFMI  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVEAEG QSGTPKSKV+IADSGELPL
Sbjct  164  DGRHVVFGKVLSGMDVVYKVEAEGRQSGTPKSKVVIADSGELPL  207



>ref|XP_006488528.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Citrus 
sinensis]
Length=207

 Score =   291 bits (744),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGS FHRIIPSFM+
Sbjct  44   VEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFML  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVEAEG Q+GTPKSKV+IADSGELPL
Sbjct  164  DGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKSKVVIADSGELPL  207



>gb|KHG08655.1| Peptidyl-prolyl cis-trans isomerase CYP20-1 -like protein [Gossypium 
arboreum]
Length=207

 Score =   290 bits (743),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GLFGKAVPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIP+FMI
Sbjct  44   VEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHFKGSAFHRIIPNFMI  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVEAEG QSGTPKSKV+IADSGELPL
Sbjct  164  DGRHVVFGKVLSGMDVVYKVEAEGRQSGTPKSKVVIADSGELPL  207



>gb|KDO66887.1| hypothetical protein CISIN_1g028574mg [Citrus sinensis]
Length=207

 Score =   290 bits (743),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGS FHRIIPSFM+
Sbjct  44   VEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFML  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVEAEG Q+GTPKSKV++ADSGELPL
Sbjct  164  DGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKSKVVVADSGELPL  207



>ref|XP_006425067.1| hypothetical protein CICLE_v10029291mg [Citrus clementina]
 gb|ESR38307.1| hypothetical protein CICLE_v10029291mg [Citrus clementina]
Length=207

 Score =   290 bits (742),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGS FHRIIPSFM+
Sbjct  44   VEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFML  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVEAEG Q+GTPKSKV+IADSGELPL
Sbjct  164  DGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKSKVVIADSGELPL  207



>ref|XP_009773253.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Nicotiana 
sylvestris]
Length=206

 Score =   289 bits (739),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GLFGK VPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFM+
Sbjct  43   VEIDGKLAGRIVMGLFGKTVPKTAENFRALCTGEKGVGKSGKPLHYKGSTFHRIIPSFML  102

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFK+KHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  103  QGGDFTLGDGRGGESIYGEKFADENFKIKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  162

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  163  DGRHVVFGKVLSGMDVVYKIEAEGRQSGTPKSKVVIADSGELPL  206



>gb|AFK34845.1| unknown [Medicago truncatula]
 gb|KEH34269.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=203

 Score =   288 bits (738),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V++DGK AGR+VIGLFGK VPKTAENFRALCTGEKGIGKSGKPLHYKGS FHRIIPSFMI
Sbjct  40   VQIDGKDAGRVVIGLFGKTVPKTAENFRALCTGEKGIGKSGKPLHYKGSSFHRIIPSFMI  99

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKLKHTGPG LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  100  QGGDFTHGNGMGGESIYGEKFADENFKLKHTGPGFLSMANAGPDTNGSQFFITTVTTSWL  159

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  160  DGRHVVFGKVLSGMDVVYKIEAEGNQSGTPKSKVVIADSGELPL  203



>ref|XP_008464041.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Cucumis 
melo]
Length=204

 Score =   288 bits (737),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRI +GLFGKAVPKTAENFRALCTGEKG+G+SGKPLHYKGS FHRIIPSFMI
Sbjct  41   VEIDGKAAGRIEMGLFGKAVPKTAENFRALCTGEKGVGQSGKPLHYKGSAFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG Q+GTPKSKV+IADSGELPL
Sbjct  161  DGRHVVFGKVLSGMDVVYKIEAEGRQNGTPKSKVVIADSGELPL  204



>gb|KJB34588.1| hypothetical protein B456_006G106600 [Gossypium raimondii]
Length=266

 Score =   290 bits (743),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIVIGLFGKAVPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIP+FMI
Sbjct  44   VEIAGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHFKGSAFHRIIPNFMI  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVEAEG QSGTPKSKV+IADSGELPL
Sbjct  164  DGRHVVFGKVLSGMDVVYKVEAEGRQSGTPKSKVVIADSGELPL  207



>ref|XP_002525647.1| cyclophilin, putative [Ricinus communis]
 gb|EEF36765.1| cyclophilin, putative [Ricinus communis]
Length=204

 Score =   288 bits (737),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGR+V+GLFGKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  41   VEIAGKPAGRVVMGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSAFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPG LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGFLSMANAGPDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV IADSGELPL
Sbjct  161  DGRHVVFGKVLSGMDVVYKIEAEGRQSGTPKSKVTIADSGELPL  204



>ref|XP_004294264.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Fragaria 
vesca subsp. vesca]
Length=204

 Score =   288 bits (736),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGS FHRIIPSFM+
Sbjct  41   VEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSKFHRIIPSFML  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTT+WL
Sbjct  101  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTTWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVEAEG QSGTPKSKV I DSGELPL
Sbjct  161  DGRHVVFGKVLSGMDVVYKVEAEGSQSGTPKSKVAIVDSGELPL  204



>ref|XP_004500254.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Cicer 
arietinum]
Length=204

 Score =   288 bits (736),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGR+VIGL+GK VPKTAENFRALCTGEKG GK+GKPLHYKGS FHRIIPSFMI
Sbjct  41   VEIDGKAAGRVVIGLYGKTVPKTAENFRALCTGEKGTGKNGKPLHYKGSSFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTHGNGMGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  161  DGRHVVFGKVLSGMDVVYKIEAEGNQSGTPKSKVVIADSGELPL  204



>ref|XP_010104628.1| Peptidyl-prolyl cis-trans isomerase CYP19-4 [Morus notabilis]
 gb|EXC01434.1| Peptidyl-prolyl cis-trans isomerase CYP19-4 [Morus notabilis]
Length=204

 Score =   288 bits (736),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGRIV+GLFGK VPKTAENFRALCTGEKGIGKSGKPLHYKGS FHRIIPSFM+
Sbjct  41   VEIDGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGIGKSGKPLHYKGSQFHRIIPSFML  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGQDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV+IADSGEL L
Sbjct  161  DGRHVVFGKVLSGMDVVYKIEAEGRQSGTPKSKVVIADSGELSL  204



>ref|XP_009785497.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X1 [Nicotiana sylvestris]
Length=209

 Score =   288 bits (736),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGR+VIGLFGK VPKT+ENFRALCTGEKGIGKSGKPLHYKGS FHRIIPSFM+
Sbjct  46   VEIDGKPAGRVVIGLFGKTVPKTSENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFML  105

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  106  QGGDFTLGDGRGGESIYGEKFADENFKIKHTGPGLLSMANAGSDTNGSQFFITTVTTSWL  165

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVEAEG QSGTPKSKV+IA+SGELPL
Sbjct  166  DGRHVVFGKVLSGMDVVYKVEAEGRQSGTPKSKVVIAESGELPL  209



>ref|XP_008355066.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Malus 
domestica]
Length=204

 Score =   287 bits (735),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGR+VIGLFGKAVPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIPSFMI
Sbjct  41   VEISGKPAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTT+WL
Sbjct  101  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTNWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV SGMDVVYKVEAEG QSGTPKSKV+IADSGELPL
Sbjct  161  DGRHVVFGKVXSGMDVVYKVEAEGNQSGTPKSKVVIADSGELPL  204



>ref|XP_010043430.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Eucalyptus 
grandis]
 gb|KCW85438.1| hypothetical protein EUGRSUZ_B02252 [Eucalyptus grandis]
Length=203

 Score =   287 bits (734),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GL+GKAVPKT ENFRALCTGEKG GKSGKPLHYKGS FHRIIPSFM+
Sbjct  40   VEIAGKPAGRIVMGLYGKAVPKTTENFRALCTGEKGTGKSGKPLHYKGSSFHRIIPSFML  99

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  100  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  159

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVEAEG QSGTPKSKV+IADSGELPL
Sbjct  160  DGRHVVFGKVLSGMDVVYKVEAEGRQSGTPKSKVVIADSGELPL  203



>gb|KDP46494.1| hypothetical protein JCGZ_08466 [Jatropha curcas]
Length=207

 Score =   287 bits (735),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GLFGKAVPKTAENFRALCTGEKG+GKSGKPLHYKGSVFHRIIPSFM+
Sbjct  44   VEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSVFHRIIPSFML  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTT+WL
Sbjct  104  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTNWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMD VYK+EAEG Q+GTPKSKV+IADSGE+PL
Sbjct  164  DGRHVVFGKVISGMDAVYKIEAEGRQNGTPKSKVVIADSGEIPL  207



>ref|XP_011080792.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Sesamum 
indicum]
Length=205

 Score =   287 bits (734),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGRI +GLFGK VPKTAENFRALCTGEKG+GK GKPLHYKGS+FHRIIPSFMI
Sbjct  42   IEIDGKPAGRITMGLFGKTVPKTAENFRALCTGEKGVGKHGKPLHYKGSIFHRIIPSFMI  101

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFK+KHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  102  QGGDFTLGDGRGGESIYGEKFADENFKIKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  161

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV+I DSGELPL
Sbjct  162  DGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVVIVDSGELPL  205



>gb|AFK44786.1| unknown [Lotus japonicus]
Length=204

 Score =   286 bits (733),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GL+GK VPKTAENFRALCTGEKGIGKSGKPLH+KGS FHRIIPSFMI
Sbjct  41   VEIDGKAAGRIVMGLYGKTVPKTAENFRALCTGEKGIGKSGKPLHFKGSSFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTQGNGMGGESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  161  DGRHVVFGKVLSGMDVVYKMEAEGNQSGTPKSKVVIADSGELPL  204



>gb|AFN53672.1| peptidyl-prolyl cis-trans isomerase [Linum usitatissimum]
Length=206

 Score =   286 bits (733),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGRI +GL+GKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFM+
Sbjct  43   VEIDGKPAGRITMGLYGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSSFHRIIPSFML  102

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGEKF DENFKLKHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  103  QGGDFTHGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGKDTNGSQFFITTVTTSWL  162

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVEAEG QSGTPKSKV+I DSGELPL
Sbjct  163  DGRHVVFGKVLSGMDVVYKVEAEGKQSGTPKSKVVIVDSGELPL  206



>emb|CBI15954.3| unnamed protein product [Vitis vinifera]
Length=200

 Score =   286 bits (733),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGR+V+GLFGK VPKT ENFRALCTGEKGIG SGKPLH+KGS FHRIIPSFMI
Sbjct  37   VEIDGKPAGRVVMGLFGKTVPKTVENFRALCTGEKGIGSSGKPLHFKGSAFHRIIPSFMI  96

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  97   QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  156

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPK+KV+IADSGELPL
Sbjct  157  DGRHVVFGKVLSGMDVVYKMEAEGRQSGTPKTKVVIADSGELPL  200



>ref|XP_002277763.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Vitis 
vinifera]
Length=203

 Score =   286 bits (733),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGR+V+GLFGK VPKT ENFRALCTGEKGIG SGKPLH+KGS FHRIIPSFMI
Sbjct  40   VEIDGKPAGRVVMGLFGKTVPKTVENFRALCTGEKGIGSSGKPLHFKGSAFHRIIPSFMI  99

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  100  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  159

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPK+KV+IADSGELPL
Sbjct  160  DGRHVVFGKVLSGMDVVYKMEAEGRQSGTPKTKVVIADSGELPL  203



>ref|XP_004143158.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Cucumis 
sativus]
 ref|XP_004160169.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Cucumis 
sativus]
 gb|KGN47081.1| Peptidyl-prolyl cis-trans isomerase [Cucumis sativus]
Length=204

 Score =   286 bits (732),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRI +GLFGKAVPKTAENFRALCTGEKG+G+SGKPLHYKGS FHRIIPSFMI
Sbjct  41   VEIDGKAAGRIEMGLFGKAVPKTAENFRALCTGEKGVGQSGKPLHYKGSAFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGSDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG Q+GTPKSKV+IADSGELPL
Sbjct  161  DGRHVVFGKVLSGMDVVYKIEAEGRQNGTPKSKVVIADSGELPL  204



>ref|XP_002313378.1| peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
 gb|ABK93462.1| unknown [Populus trichocarpa]
 gb|ABK93647.1| unknown [Populus trichocarpa]
 gb|ABK96129.1| unknown [Populus trichocarpa]
 gb|EEE87333.1| peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
Length=207

 Score =   286 bits (732),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VEVDGKPAGRI IGLFGK VPKT ENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  44   VEVDGKPAGRITIGLFGKTVPKTVENFRALCTGEKGVGKSGKPLHYKGSAFHRIIPSFMI  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPG+LSMANAG DTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGILSMANAGSDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMDVVYKVEAEG Q+GTPKSKV++ADSGELPL
Sbjct  164  DGRHVVFGKVISGMDVVYKVEAEGRQNGTPKSKVVVADSGELPL  207



>ref|XP_010933259.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 isoform 
X1 [Elaeis guineensis]
Length=215

 Score =   286 bits (732),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GKPAGRIV+GLFGK VPKTAENFRALCTGEKG GKSGKPLHYKGS FHRIIPSFMI
Sbjct  52   VEIEGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGTGKSGKPLHYKGSTFHRIIPSFMI  111

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPG LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  112  QGGDFTLGDGRGGESIYGTKFADENFKLKHTGPGFLSMANAGPDTNGSQFFITTVTTSWL  171

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  172  DGRHVVFGKVISGMDVVYKIEAEGRQSGTPKSKVVIADSGELPL  215



>ref|XP_010933260.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 isoform 
X2 [Elaeis guineensis]
Length=211

 Score =   286 bits (732),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GKPAGRIV+GLFGK VPKTAENFRALCTGEKG GKSGKPLHYKGS FHRIIPSFMI
Sbjct  48   VEIEGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGTGKSGKPLHYKGSTFHRIIPSFMI  107

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPG LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  108  QGGDFTLGDGRGGESIYGTKFADENFKLKHTGPGFLSMANAGPDTNGSQFFITTVTTSWL  167

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  168  DGRHVVFGKVISGMDVVYKIEAEGRQSGTPKSKVVIADSGELPL  211



>ref|XP_008358961.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4 [Malus 
domestica]
Length=204

 Score =   286 bits (731),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGR+VIGLFGKAVPKTAENFRALCTGE G+GKSGKPLH+KGS FHRIIPSFMI
Sbjct  41   VEISGKPAGRVVIGLFGKAVPKTAENFRALCTGENGVGKSGKPLHFKGSKFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTT+WL
Sbjct  101  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTNWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  161  DGKHVVFGKVLSGMDVVYKIEAEGNQSGTPKSKVVIADSGELPL  204



>ref|XP_008384800.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4 [Malus 
domestica]
Length=204

 Score =   286 bits (731),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGR+VIGLFGKAVPKTAENFRALCTGE G+GKSGKPLH+KGS FHRIIPSFMI
Sbjct  41   VEISGKPAGRVVIGLFGKAVPKTAENFRALCTGENGVGKSGKPLHFKGSKFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTT+WL
Sbjct  101  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTNWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  161  DGKHVVFGKVLSGMDVVYKIEAEGNQSGTPKSKVVIADSGELPL  204



>gb|AFK38976.1| unknown [Lotus japonicus]
Length=204

 Score =   286 bits (731),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GL+GK VP+TAENFRALCTGEKGIGKSGKPLH+KGS FHRIIPSFMI
Sbjct  41   VEIDGKAAGRIVMGLYGKTVPETAENFRALCTGEKGIGKSGKPLHFKGSSFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTQGNGMGGESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  161  DGRHVVFGKVLSGMDVVYKMEAEGNQSGTPKSKVVIADSGELPL  204



>ref|XP_010253899.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X3 [Nelumbo nucifera]
Length=206

 Score =   286 bits (731),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGRIV+GLFGK VPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  43   IEIDGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGVGKSGKPLHYKGSTFHRIIPSFMI  102

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  103  QGGDFTLGDGRGGESIYGTKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  162

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFG+V+SGMDVVYK+EAEG QSGTPKSKV+I DSGELPL
Sbjct  163  DGRHVVFGQVVSGMDVVYKIEAEGRQSGTPKSKVVIVDSGELPL  206



>gb|ABS30424.1| cyclophilin-like protein [Nicotiana tabacum]
Length=207

 Score =   286 bits (731),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGRIV+GLFGK V KTA+NFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFM+
Sbjct  44   VEIDGKPAGRIVMGLFGKTVSKTADNFRALCTGEKGVGKSGKPLHYKGSTFHRIIPSFML  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGE F DENFK+KHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGESFADENFKIKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  164  DGRHVVFGKVLSGMDVVYKIEAEGGQSGTPKSKVVIADSGELPL  207



>ref|XP_011032116.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Populus 
euphratica]
Length=207

 Score =   286 bits (731),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGRI IGLFGK VPKT ENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  44   VEIDGKPAGRITIGLFGKTVPKTVENFRALCTGEKGVGKSGKPLHYKGSAFHRIIPSFMI  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPG+LSMANAG DTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGILSMANAGSDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMDVVYKVEAEG Q+GTPKSKV++ADSGELPL
Sbjct  164  DGRHVVFGKVISGMDVVYKVEAEGRQNGTPKSKVVVADSGELPL  207



>ref|XP_010253898.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X2 [Nelumbo nucifera]
Length=227

 Score =   286 bits (732),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGRIV+GLFGK VPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  64   IEIDGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGVGKSGKPLHYKGSTFHRIIPSFMI  123

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  124  QGGDFTLGDGRGGESIYGTKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  183

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFG+V+SGMDVVYK+EAEG QSGTPKSKV+I DSGELPL
Sbjct  184  DGRHVVFGQVVSGMDVVYKIEAEGRQSGTPKSKVVIVDSGELPL  227



>ref|XP_009630738.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Nicotiana 
tomentosiformis]
Length=207

 Score =   285 bits (730),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGRIV+GLFGK V KTA+NFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFM+
Sbjct  44   VEIDGKPAGRIVMGLFGKTVSKTADNFRALCTGEKGVGKSGKPLHYKGSTFHRIIPSFML  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGE F DENFK+KHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGESFADENFKIKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  164  DGRHVVFGKVLSGMDVVYKIEAEGGQSGTPKSKVVIADSGELPL  207



>ref|XP_007146769.1| hypothetical protein PHAVU_006G068200g [Phaseolus vulgaris]
 gb|ESW18763.1| hypothetical protein PHAVU_006G068200g [Phaseolus vulgaris]
Length=204

 Score =   285 bits (730),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRI IGL+GKAVPKTAENFRALCTGEKGIGKSGKPLHYKGS FHRIIPSFMI
Sbjct  41   VEIDGKAAGRIEIGLYGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSSFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKLKHTGPG LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTHGNGMGGESIYGEKFPDENFKLKHTGPGFLSMANAGPDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKV+SGMDVVYKVEAEG QSGTPKSKV+IADSGELPL
Sbjct  161  DGKHVVFGKVISGMDVVYKVEAEGRQSGTPKSKVVIADSGELPL  204



>ref|XP_010253897.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X1 [Nelumbo nucifera]
Length=231

 Score =   286 bits (732),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGRIV+GLFGK VPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  68   IEIDGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGVGKSGKPLHYKGSTFHRIIPSFMI  127

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  128  QGGDFTLGDGRGGESIYGTKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  187

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFG+V+SGMDVVYK+EAEG QSGTPKSKV+I DSGELPL
Sbjct  188  DGRHVVFGQVVSGMDVVYKIEAEGRQSGTPKSKVVIVDSGELPL  231



>emb|CAN70835.1| hypothetical protein VITISV_015871 [Vitis vinifera]
Length=203

 Score =   285 bits (728),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGR+V+GLFGK VPKT ENFRALCTGEKGIG SGKPLH+KGS FHRIIPSFMI
Sbjct  40   VEIDGKPAGRVVMGLFGKTVPKTVENFRALCTGEKGIGSSGKPLHFKGSAFHRIIPSFMI  99

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  100  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  159

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPK+KV+I DSGELPL
Sbjct  160  DGRHVVFGKVLSGMDVVYKMEAEGRQSGTPKTKVVIXDSGELPL  203



>ref|XP_007016102.1| Cyclophilin 5 [Theobroma cacao]
 gb|EOY33721.1| Cyclophilin 5 [Theobroma cacao]
Length=207

 Score =   285 bits (728),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGR+V+GLFGKAVPKTAENFRALCTGEKG+GKSGK LHYKGS FHRIIP+FMI
Sbjct  44   VEIAGKPAGRVVMGLFGKAVPKTAENFRALCTGEKGVGKSGKSLHYKGSAFHRIIPNFMI  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG Q+GTPKS+V+IADSGE+PL
Sbjct  164  DGRHVVFGKVLSGMDVVYKIEAEGRQNGTPKSQVVIADSGEIPL  207



>ref|NP_001236075.1| uncharacterized protein LOC100305485 precursor [Glycine max]
 gb|ACU13170.1| unknown [Glycine max]
 gb|KHN06231.1| Peptidyl-prolyl cis-trans isomerase CYP19-4 [Glycine soja]
Length=204

 Score =   284 bits (727),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GK AGRIV+GL+GKAVPKTAENFRALCTGEKG GKSGKPLHYKGS FHRIIPSFM+
Sbjct  41   VEINGKEAGRIVMGLYGKAVPKTAENFRALCTGEKGTGKSGKPLHYKGSSFHRIIPSFML  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKLKHTGPGLLSMANAGP+TNGSQFFITTVTTSWL
Sbjct  101  QGGDFTQGNGMGGESIYGEKFADENFKLKHTGPGLLSMANAGPNTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV+I DSGELPL
Sbjct  161  DGRHVVFGKVLSGMDVVYKIEAEGTQSGTPKSKVVIVDSGELPL  204



>ref|XP_009409920.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=216

 Score =   285 bits (728),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GLFGKAVPKTAENFRALCTGEKGIGKSGK LHYKGS FHRIIPSFMI
Sbjct  53   VEIGGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKTLHYKGSAFHRIIPSFMI  112

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  113  QGGDFTLGDGRGGESIYGSKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  172

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYK+EAEG Q+G+PKSKV+IADSGELPL
Sbjct  173  DGKHVVFGKVLSGMDVVYKIEAEGRQNGSPKSKVVIADSGELPL  216



>ref|XP_009409921.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=212

 Score =   285 bits (728),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GLFGKAVPKTAENFRALCTGEKGIGKSGK LHYKGS FHRIIPSFMI
Sbjct  49   VEIGGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKTLHYKGSAFHRIIPSFMI  108

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  109  QGGDFTLGDGRGGESIYGSKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  168

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYK+EAEG Q+G+PKSKV+IADSGELPL
Sbjct  169  DGKHVVFGKVLSGMDVVYKIEAEGRQNGSPKSKVVIADSGELPL  212



>ref|XP_002881077.1| cyclophilin [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57336.1| cyclophilin [Arabidopsis lyrata subsp. lyrata]
Length=201

 Score =   284 bits (726),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGR+VIGLFGKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  38   VEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMI  97

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG+KF DENFKLKHTGPGLLSMAN+G DTNGSQFFITTVTTSWL
Sbjct  98   QGGDFTHGNGMGGESIYGQKFEDENFKLKHTGPGLLSMANSGEDTNGSQFFITTVTTSWL  157

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+ GMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  158  DGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGELPL  201



>gb|AEK80448.1| peptidyl-prolyl cis-trans isomerase [Carica papaya]
Length=208

 Score =   284 bits (727),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGRIV+GLFGK VPKT ENFRALCTGEKGIGK+GKPLHYKGS  HRIIPSFMI
Sbjct  45   IEIDGKPAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKNGKPLHYKGSTLHRIIPSFMI  104

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKLKHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  105  QGGDFTHGNGMGGESIYGEKFADENFKLKHTGPGLLSMANAGKDTNGSQFFITTVTTSWL  164

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMDVVYKVEAEG QSGTPKSKV+IADSGELPL
Sbjct  165  DGRHVVFGKVVSGMDVVYKVEAEGRQSGTPKSKVVIADSGELPL  208



>gb|EPS66571.1| peptidyl-prolyl cis-trans isomerase, partial [Genlisea aurea]
Length=184

 Score =   283 bits (725),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGRI +GLFG  VPKTAENFRALCTGEKGIGKSGKPLHYKGS FHRIIPSFMI
Sbjct  21   IEIDGKPAGRITMGLFGNTVPKTAENFRALCTGEKGIGKSGKPLHYKGSSFHRIIPSFMI  80

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  81   QGGDFTLGDGRGGESIYGEKFADENFKIKHTGPGLLSMANAGKDTNGSQFFITTVTTSWL  140

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMDVVYK+EAEG QSGTPKSKV+IADSGELP+
Sbjct  141  DGRHVVFGKVISGMDVVYKIEAEGKQSGTPKSKVVIADSGELPM  184



>ref|XP_007205916.1| hypothetical protein PRUPE_ppa011595mg [Prunus persica]
 gb|EMJ07115.1| hypothetical protein PRUPE_ppa011595mg [Prunus persica]
Length=204

 Score =   283 bits (725),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGR+VIGLFGK VPKTAENFRALCTGEKGIGKSGKPLH+KGS FHRIIPSFMI
Sbjct  41   VEIAGKPAGRVVIGLFGKTVPKTAENFRALCTGEKGIGKSGKPLHFKGSKFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAG DTNGSQFFITTVTT+WL
Sbjct  101  QGGDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGSDTNGSQFFITTVTTNWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG Q+GTPKSKV+IADSGELPL
Sbjct  161  DGRHVVFGKVLSGMDVVYKIEAEGNQNGTPKSKVVIADSGELPL  204



>ref|XP_009605568.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Nicotiana 
tomentosiformis]
Length=209

 Score =   284 bits (726),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGRIV+GLFGK VPKTAENFRALCTGEKGIGKSGKPLHYKGS FHRIIPSFM+
Sbjct  46   VEIDGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFML  105

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFK+KHTGPGLLSMANAG DTNGSQFF+TTVTTSWL
Sbjct  106  QGGDFTLGDGRGGESIYGEKFADENFKIKHTGPGLLSMANAGSDTNGSQFFVTTVTTSWL  165

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVEAEG QSGTPKSKV+IA SGEL L
Sbjct  166  DGRHVVFGKVLSGMDVVYKVEAEGRQSGTPKSKVVIAVSGELSL  209



>ref|XP_011043772.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Populus 
euphratica]
Length=207

 Score =   283 bits (724),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGRI +GLFGK VPKT ENFRALCTGEKGIGK+GKPLHYKG+VFHRIIPSFMI
Sbjct  44   VEIDGKPAGRITMGLFGKTVPKTTENFRALCTGEKGIGKAGKPLHYKGNVFHRIIPSFMI  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGE F DENFKLKHTGPG+LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGENFADENFKLKHTGPGILSMANAGPDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMDVVYK+EAEG Q+GTPKSKV+I DSGELPL
Sbjct  164  DGRHVVFGKVMSGMDVVYKMEAEGRQNGTPKSKVVIVDSGELPL  207



>gb|AAB71401.1| cyclophilin [Arabidopsis thaliana]
Length=201

 Score =   283 bits (723),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGR+VIGLFGKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  38   VEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMI  97

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG+KF DENFKLKHTGPG+LSMAN+G DTNGSQFFITTVTTSWL
Sbjct  98   QGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSMANSGEDTNGSQFFITTVTTSWL  157

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+ GMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  158  DGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGELPL  201



>ref|NP_180557.1| peptidyl-prolyl cis-trans isomerase CYP19-4 [Arabidopsis thaliana]
 sp|Q8LDP4.2|CP19D_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP19-4; Short=PPIase 
CYP19-4; AltName: Full=Cyclophilin of 19 kDa 4; AltName: 
Full=Cyclophilin-5; AltName: Full=Rotamase CYP19-4; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC31856.1| cyclophilin [Arabidopsis thaliana]
 gb|AAK96784.1| cyclophilin [Arabidopsis thaliana]
 gb|AAN15387.1| cyclophilin [Arabidopsis thaliana]
 gb|AEC08327.1| peptidyl-prolyl cis-trans isomerase CYP19-4 [Arabidopsis thaliana]
Length=201

 Score =   283 bits (723),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGR+VIGLFGKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  38   VEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMI  97

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG+KF DENFKLKHTGPG+LSMAN+G DTNGSQFFITTVTTSWL
Sbjct  98   QGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSMANSGEDTNGSQFFITTVTTSWL  157

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+ GMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  158  DGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGELPL  201



>ref|XP_010685556.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4 [Beta 
vulgaris subsp. vulgaris]
Length=208

 Score =   283 bits (723),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGR+V+GLFGKAVPKTAENFRALCTGEKG+ KSGKPLHYKGS FHRIIPSFMI
Sbjct  45   VEIDGKPAGRVVMGLFGKAVPKTAENFRALCTGEKGVSKSGKPLHYKGSTFHRIIPSFMI  104

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDG GGESIYGEKF DENFKLKHTGPG LSMANAG +TNGSQFFITTVTTSWL
Sbjct  105  QGGDFTRGDGTGGESIYGEKFADENFKLKHTGPGFLSMANAGKNTNGSQFFITTVTTSWL  164

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYK+EAEG Q+GTPKSKV IADSGELPL
Sbjct  165  DGKHVVFGKVLSGMDVVYKMEAEGRQNGTPKSKVTIADSGELPL  208



>ref|XP_009347261.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Pyrus 
x bretschneideri]
Length=204

 Score =   282 bits (722),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGR+VIGLFGKAVPKTAENFRALCTGEKG+G SG+PLH+KGS FHRIIPSFMI
Sbjct  41   VEISGKPAGRVVIGLFGKAVPKTAENFRALCTGEKGVGTSGQPLHFKGSKFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFKLKH GPGLLSMAN+GPDTNGSQFFITTVTT+WL
Sbjct  101  QGGDFTLGDGRGGESIYGEKFADENFKLKHIGPGLLSMANSGPDTNGSQFFITTVTTNWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  161  DGRHVVFGKVLSGMDVVYKIEAEGNQSGTPKSKVVIADSGELPL  204



>ref|XP_003538292.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 isoform 
1 [Glycine max]
 gb|KHN34280.1| Peptidyl-prolyl cis-trans isomerase CYP19-4 [Glycine soja]
Length=204

 Score =   282 bits (722),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GK AGRIV+GLFGKAVPKTAENFRALCTGEKG GKSGKPLHYKGS FHRIIPSFM+
Sbjct  41   VEINGKEAGRIVMGLFGKAVPKTAENFRALCTGEKGTGKSGKPLHYKGSSFHRIIPSFML  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTHGNGMGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFG+VLSG+DVVY +EAEG QSGTPKSKV+I DSGELPL
Sbjct  161  DGRHVVFGRVLSGLDVVYNIEAEGTQSGTPKSKVVIVDSGELPL  204



>ref|XP_002298312.1| peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
 gb|EEE83117.1| peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
Length=207

 Score =   282 bits (722),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGRI +GLFGK VPKTAENFRALCTGEKGIGK GKPLHYKG+VFHRIIPSFMI
Sbjct  44   VEIDGKPAGRITMGLFGKTVPKTAENFRALCTGEKGIGKDGKPLHYKGNVFHRIIPSFMI  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGE F DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGENFADENFKLKHTGPGTLSMANAGRDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMDVVYK+EAEG Q+GTPKSKV+IADSGELPL
Sbjct  164  DGRHVVFGKVMSGMDVVYKMEAEGRQNGTPKSKVVIADSGELPL  207



>emb|CDY55458.1| BnaC04g54560D [Brassica napus]
Length=201

 Score =   282 bits (722),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGR+VIGLFGK VPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  38   VEIDGKEAGRVVIGLFGKTVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMI  97

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG+KF DENFKLKHTGPGLLSMAN+G DTNGSQFFITTVTTSWL
Sbjct  98   QGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGLLSMANSGEDTNGSQFFITTVTTSWL  157

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+ GMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  158  DGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGELPL  201



>ref|XP_009144343.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4 [Brassica 
rapa]
 emb|CDY58941.1| BnaAnng15590D [Brassica napus]
Length=201

 Score =   282 bits (722),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGR+VIGLFGK VPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  38   VEIDGKEAGRVVIGLFGKTVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMI  97

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG+KF DENFKLKHTGPGLLSMAN+G DTNGSQFFITTVTTSWL
Sbjct  98   QGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGLLSMANSGEDTNGSQFFITTVTTSWL  157

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+ GMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  158  DGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGELPL  201



>ref|XP_008797942.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X2 [Phoenix dactylifera]
Length=210

 Score =   282 bits (722),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+ GKPAGRIV+GLFGK VPKTAENFRALCTGEKG GKSGKPLHYKGS FHRIIPSFMI
Sbjct  47   IEIGGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGSGKSGKPLHYKGSTFHRIIPSFMI  106

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPGL+SMANAGPDTNGSQFFITTVTTSWL
Sbjct  107  QGGDFTLGDGRGGESIYGTKFADENFKLKHTGPGLMSMANAGPDTNGSQFFITTVTTSWL  166

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKV+SGMDVVYKVEAEG Q+GTPKSKV+IADSGELPL
Sbjct  167  DGKHVVFGKVISGMDVVYKVEAEGRQNGTPKSKVVIADSGELPL  210



>gb|ACJ06541.1| cyclophilin [Camellia oleifera]
Length=207

 Score =   282 bits (722),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GLFGKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFM+
Sbjct  44   VEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFML  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG +F DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGGEFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKS V IADSGELPL
Sbjct  164  DGRHVVFGKVLSGMDVVYKIEAEGNQSGTPKSNVQIADSGELPL  207



>ref|XP_004241161.2| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4 [Solanum 
lycopersicum]
Length=276

 Score =   285 bits (728),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGRIV+GLFGK VPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIPSFMI
Sbjct  113  VEIDGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPSFMI  172

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTT+WL
Sbjct  173  QGGDFTLGDGRGGESIYGEKFADENFKIKHTGPGLLSMANAGSDTNGSQFFITTVTTTWL  232

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV IADSGELPL
Sbjct  233  DGRHVVFGKVLSGMDVVYKMEAEGRQSGTPKSKVTIADSGELPL  276



>ref|XP_010262860.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Nelumbo 
nucifera]
Length=207

 Score =   282 bits (721),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGRIV+GLFGK VPKTAENFRALCTGEKGIGK+GKPLHYKGS FHRIIPSFMI
Sbjct  44   IEIDGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGIGKNGKPLHYKGSTFHRIIPSFMI  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGEKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKV+SGMDVVYK+EAEG QSG PKSKV IADSGELPL
Sbjct  164  DGKHVVFGKVVSGMDVVYKIEAEGRQSGAPKSKVAIADSGELPL  207



>ref|XP_008797941.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X1 [Phoenix dactylifera]
Length=214

 Score =   282 bits (722),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+ GKPAGRIV+GLFGK VPKTAENFRALCTGEKG GKSGKPLHYKGS FHRIIPSFMI
Sbjct  51   IEIGGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGSGKSGKPLHYKGSTFHRIIPSFMI  110

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPGL+SMANAGPDTNGSQFFITTVTTSWL
Sbjct  111  QGGDFTLGDGRGGESIYGTKFADENFKLKHTGPGLMSMANAGPDTNGSQFFITTVTTSWL  170

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKV+SGMDVVYKVEAEG Q+GTPKSKV+IADSGELPL
Sbjct  171  DGKHVVFGKVISGMDVVYKVEAEGRQNGTPKSKVVIADSGELPL  214



>gb|ABK92628.1| unknown [Populus trichocarpa]
Length=207

 Score =   282 bits (721),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGRI +GLFGK VPKTAENFRALCTGEKGIGK GKPLHYKG+VFHRIIPSFMI
Sbjct  44   VEIDGKPAGRITMGLFGKTVPKTAENFRALCTGEKGIGKDGKPLHYKGNVFHRIIPSFMI  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGE F DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGENFADENFKLKHTGPGTLSMANAGRDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMDVVYK+EAEG Q+GTPKSKV+IADSGELPL
Sbjct  164  DGRHVVFGKVMSGMDVVYKMEAEGRQNGTPKSKVVIADSGELPL  207



>ref|XP_010227456.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Brachypodium 
distachyon]
Length=215

 Score =   282 bits (721),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E++GKPAGR+V+GLFGKAVPKTAENFRALCTGEKG GKSGKPLHYKGS FHRIIPSFMI
Sbjct  52   IEIEGKPAGRVVMGLFGKAVPKTAENFRALCTGEKGTGKSGKPLHYKGSSFHRIIPSFMI  111

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  112  QGGDFTLGDGRGGESIYGTKFADENFKLKHTGPGFLSMANAGRDTNGSQFFITTVTTSWL  171

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDV+YKVEAEG Q+GTPKSKV+IADSGELPL
Sbjct  172  DGKHVVFGKVLSGMDVIYKVEAEGQQTGTPKSKVVIADSGELPL  215



>gb|AAM63088.1| cyclophilin [Arabidopsis thaliana]
Length=201

 Score =   281 bits (718),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGR+VIGLFGKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  38   VEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMI  97

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG+KF DENFKLKHTGPG+LSMAN+G D NGSQFFITTVTTSWL
Sbjct  98   QGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSMANSGEDXNGSQFFITTVTTSWL  157

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+ GMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  158  DGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGELPL  201



>ref|XP_010414329.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Camelina 
sativa]
Length=205

 Score =   281 bits (719),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGR+VIGLFGKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  42   VEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMI  101

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG+KF DENFKLKHTGPGLLSMAN+G DTNGSQFFITTV TSWL
Sbjct  102  QGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGLLSMANSGEDTNGSQFFITTVKTSWL  161

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV  GMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  162  DGRHVVFGKVEQGMDVVYKIEAEGKQSGTPKSKVVIADSGELPL  205



>emb|CDP09190.1| unnamed protein product [Coffea canephora]
Length=208

 Score =   281 bits (719),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DG+PAGR+V+GLFGKAVPKTAENFRALCTGEKG GKSGKPLHYKGS FHRIIP+FMI
Sbjct  45   VEIDGRPAGRVVMGLFGKAVPKTAENFRALCTGEKGTGKSGKPLHYKGSKFHRIIPNFMI  104

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  105  QGGDFTLGDGRGGESIYGEKFADENFKIKHTGPGLLSMANAGADTNGSQFFITTVTTSWL  164

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVY +EAEG Q+GTPKS+V IADSGELPL
Sbjct  165  DGRHVVFGKVLSGMDVVYAIEAEGRQNGTPKSEVKIADSGELPL  208



>ref|XP_010510426.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4 [Camelina 
sativa]
Length=232

 Score =   282 bits (721),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGR+VIGLFGKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  69   VEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMI  128

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG+KF DENFKLKHTGPGLLSMAN+G DTNGSQFFITTV TSWL
Sbjct  129  QGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGLLSMANSGEDTNGSQFFITTVKTSWL  188

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV  GMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  189  DGRHVVFGKVEQGMDVVYKIEAEGKQSGTPKSKVVIADSGELPL  232



>ref|XP_010469913.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Camelina 
sativa]
Length=204

 Score =   280 bits (717),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGR+VIGLFGKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  41   VEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG+KF DENFKLKHTGPGLLSMAN+G DTNGSQFFITTV TSWL
Sbjct  101  QGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGLLSMANSGEDTNGSQFFITTVKTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV  GMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  161  DGRHVVFGKVEQGMDVVYKIEAEGKQSGTPKSKVLIADSGELPL  204



>ref|XP_006656475.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Oryza 
brachyantha]
Length=215

 Score =   280 bits (717),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGR+V+GLFGK VPKTAENFRALCTGEKG GKSGKPLH+KGS FHRIIPSFMI
Sbjct  52   IEIDGKPAGRVVMGLFGKTVPKTAENFRALCTGEKGTGKSGKPLHFKGSAFHRIIPSFMI  111

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  112  QGGDFTLGDGRGGESIYGTKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWL  171

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYK+EAEG Q+G+PKSKV+IADSGELPL
Sbjct  172  DGKHVVFGKVLSGMDVVYKIEAEGQQTGSPKSKVVIADSGELPL  215



>gb|EYU45977.1| hypothetical protein MIMGU_mgv1a013993mg [Erythranthe guttata]
Length=204

 Score =   280 bits (716),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGRI IGLFGK VPKTAENFRALCTGEKGIGK GKPL+YKGS FHRIIPSFMI
Sbjct  41   IEIDGKPAGRITIGLFGKTVPKTAENFRALCTGEKGIGKHGKPLYYKGSKFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFK+KHTGPG+LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTLGDGRGGESIYGEKFADENFKIKHTGPGILSMANAGPDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFG+VLSGMDVVYK+EAEG Q+GTPK KV+IA+SGELPL
Sbjct  161  DGRHVVFGEVLSGMDVVYKIEAEGKQNGTPKKKVVIAESGELPL  204



>ref|XP_004966389.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like isoform 
X2 [Setaria italica]
Length=215

 Score =   280 bits (716),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGRIV+GLFGK VPKTAENFRALCTGEKG GKSGKPLHYKGS FHRIIPSFM+
Sbjct  52   IEIDGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGTGKSGKPLHYKGSTFHRIIPSFML  111

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  112  QGGDFTLGDGRGGESIYGMKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWL  171

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYKVEAEG QSG PKSKVIIADSGELPL
Sbjct  172  DGKHVVFGKVLSGMDVVYKVEAEGRQSGQPKSKVIIADSGELPL  215



>ref|XP_004966388.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like isoform 
X1 [Setaria italica]
Length=220

 Score =   280 bits (717),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGRIV+GLFGK VPKTAENFRALCTGEKG GKSGKPLHYKGS FHRIIPSFM+
Sbjct  57   IEIDGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGTGKSGKPLHYKGSTFHRIIPSFML  116

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  117  QGGDFTLGDGRGGESIYGMKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWL  176

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYKVEAEG QSG PKSKVIIADSGELPL
Sbjct  177  DGKHVVFGKVLSGMDVVYKVEAEGRQSGQPKSKVIIADSGELPL  220



>gb|ACF49500.1| cyclophilin B-B [Triticum aestivum]
 gb|EMS49826.1| Peptidyl-prolyl cis-trans isomerase CYP19-4 [Triticum urartu]
 gb|EMT19800.1| Peptidyl-prolyl cis-trans isomerase CYP19-4 [Aegilops tauschii]
Length=213

 Score =   280 bits (716),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGR+V+GLFGKAVPKTAENFRALCTGEKG+G SGKPLHYKGS FHRIIPSFMI
Sbjct  50   IEIDGKPAGRVVMGLFGKAVPKTAENFRALCTGEKGMGNSGKPLHYKGSSFHRIIPSFMI  109

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  110  QGGDFTLGDGRGGESIYGTKFADENFKLKHTGPGYLSMANAGRDTNGSQFFITTVTTSWL  169

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYKVEAEG Q+GTPKSKV+IADSGE+PL
Sbjct  170  DGKHVVFGKVLSGMDVVYKVEAEGKQNGTPKSKVVIADSGEVPL  213



>ref|XP_006350839.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Solanum 
tuberosum]
Length=207

 Score =   280 bits (715),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGR+V+GLFGK VPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIPSFMI
Sbjct  44   VEIDGKPAGRVVMGLFGKTVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPSFMI  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFK+KHTGPG LSMANAG DTNGSQFFITTVTT+WL
Sbjct  104  QGGDFTLGDGRGGESIYGEKFADENFKIKHTGPGQLSMANAGSDTNGSQFFITTVTTTWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPKS V IADSGELPL
Sbjct  164  DGRHVVFGKVLSGMDVVYKMEAEGRQSGTPKSTVTIADSGELPL  207



>dbj|BAJ90132.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=218

 Score =   280 bits (715),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGR+V+GLFGKAVPKTAENFRALCTGEKG+G SGKPLHYKGS FHRIIPSFMI
Sbjct  55   IEIDGKPAGRVVMGLFGKAVPKTAENFRALCTGEKGMGNSGKPLHYKGSSFHRIIPSFMI  114

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  115  QGGDFTLGDGRGGESIYGTKFADENFKLKHTGPGYLSMANAGRDTNGSQFFITTVTTSWL  174

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYKVEAEG Q+GTPKSKV+IADSGE+PL
Sbjct  175  DGKHVVFGKVLSGMDVVYKVEAEGKQNGTPKSKVVIADSGEVPL  218



>gb|ACF49505.1| cyclophilin B-D [Aegilops tauschii]
Length=213

 Score =   279 bits (714),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGR+V+GLFGKAVPKTAENFRALCTGEKG+G SGKPLHYKGS FHRIIPSFMI
Sbjct  50   IEIDGKPAGRVVMGLFGKAVPKTAENFRALCTGEKGMGNSGKPLHYKGSSFHRIIPSFMI  109

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG KF DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  110  QGGDFTPGDGRGGESIYGTKFADENFKLKHTGPGYLSMANAGRDTNGSQFFITTVTTSWL  169

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYKVEAEG Q+GTPKSKV+IADSGE+PL
Sbjct  170  DGKHVVFGKVLSGMDVVYKVEAEGKQNGTPKSKVVIADSGEVPL  213



>emb|CDP14025.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   279 bits (713),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            ++++GKPAGRIVIGLFGK VPKTAENFRALCTGEKG+G+SGKPLHYKGS FHRIIPSFMI
Sbjct  64   LQINGKPAGRIVIGLFGKVVPKTAENFRALCTGEKGVGRSGKPLHYKGSSFHRIIPSFMI  123

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+ F DENF+LKHTGPGLLSMANAGPDTNGSQFFITTV TSWL
Sbjct  124  QGGDFTHGDGRGGESIYGDNFADENFQLKHTGPGLLSMANAGPDTNGSQFFITTVITSWL  183

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVEAEG QSGTPKSKVII DSGEL L
Sbjct  184  DGRHVVFGKVLSGMDVVYKVEAEGRQSGTPKSKVIITDSGELTL  227



>gb|EAZ38239.1| hypothetical protein OsJ_22614 [Oryza sativa Japonica Group]
Length=204

 Score =   278 bits (711),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGR+V+GLFGK VPKTAENFRALCTGEKG GKSGK LH+KGS FHRIIPSFMI
Sbjct  41   VEIDGKPAGRVVMGLFGKTVPKTAENFRALCTGEKGTGKSGKALHFKGSAFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTLGDGRGGESIYGTKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYK+EAEG QSG+PKSKV+IADSGELP+
Sbjct  161  DGKHVVFGKVLSGMDVVYKIEAEGQQSGSPKSKVVIADSGELPM  204



>gb|ACJ54439.1| cyclophilin B [Triticum urartu]
Length=213

 Score =   278 bits (710),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKP GR+V+GLFGKAVPKTAENFRALCTGEKG+G SGKPLHYKGS FHRIIPSFMI
Sbjct  50   IEIDGKPVGRVVMGLFGKAVPKTAENFRALCTGEKGMGNSGKPLHYKGSSFHRIIPSFMI  109

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  110  QGGDFTLGDGRGGESIYGTKFADENFKLKHTGPGYLSMANAGRDTNGSQFFITTVTTSWL  169

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYKVEAEG Q+GTPKSKV+IADSGE+PL
Sbjct  170  DGKHVVFGKVLSGMDVVYKVEAEGKQNGTPKSKVVIADSGEVPL  213



>ref|XP_006848226.1| hypothetical protein AMTR_s00029p00245680 [Amborella trichopoda]
 gb|ERN09807.1| hypothetical protein AMTR_s00029p00245680 [Amborella trichopoda]
Length=207

 Score =   277 bits (709),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GKPAGRI +GLFGK VPKTAENFRALCTGEKGIGKSGKPLHYKGS FHRIIPSFM+
Sbjct  44   VEINGKPAGRIEMGLFGKTVPKTAENFRALCTGEKGIGKSGKPLHYKGSSFHRIIPSFML  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG  F DENFKLKHTGPG LSMAN+GPDTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTLGDGRGGESIYGNSFADENFKLKHTGPGHLSMANSGPDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKV+SGMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  164  DGKHVVFGKVISGMDVVYKIEAEGRQSGTPKSKVVIADSGELPL  207



>gb|EAZ02313.1| hypothetical protein OsI_24414 [Oryza sativa Indica Group]
Length=220

 Score =   278 bits (710),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGR+V+GLFGK VPKTAENFRALCTGEKG GKSGK LH+KGS FHRIIPSFMI
Sbjct  57   VEIDGKPAGRVVMGLFGKTVPKTAENFRALCTGEKGTGKSGKALHFKGSAFHRIIPSFMI  116

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  117  QGGDFTLGDGRGGESIYGTKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWL  176

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYK+EAEG QSG+PKSKV+IADSGELP+
Sbjct  177  DGKHVVFGKVLSGMDVVYKIEAEGQQSGSPKSKVVIADSGELPM  220



>ref|XP_006294680.1| hypothetical protein CARUB_v10023717mg [Capsella rubella]
 gb|EOA27578.1| hypothetical protein CARUB_v10023717mg [Capsella rubella]
Length=302

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GK AGR+VIGLFGKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  139  VEIEGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMI  198

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG+KF DENFKLKHTGPGLLSMAN+G DTNGSQFFITTV TSWL
Sbjct  199  QGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGLLSMANSGEDTNGSQFFITTVKTSWL  258

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+ GMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  259  DGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGELPL  302



>ref|XP_010535384.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Tarenaya 
hassleriana]
Length=204

 Score =   277 bits (708),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGK AGRIV+GLFGK VPKTAENFRALCTGEKGIGKSGKPLHYKGS FHRIIPSFM+
Sbjct  41   IEIDGKSAGRIVMGLFGKTVPKTAENFRALCTGEKGIGKSGKPLHYKGSKFHRIIPSFML  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGE F DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTHGNGMGGESIYGETFPDENFKIKHTGPGLLSMANAGKDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMDVVYK+EAEG QSGTPKS V+I DSGELPL
Sbjct  161  DGRHVVFGKVVSGMDVVYKIEAEGNQSGTPKSNVVITDSGELPL  204



>ref|NP_001058535.1| Os06g0708500 [Oryza sativa Japonica Group]
 dbj|BAD53622.1| putative cyclophilin [Oryza sativa Japonica Group]
 dbj|BAD53628.1| putative cyclophilin [Oryza sativa Japonica Group]
 dbj|BAF20449.1| Os06g0708500 [Oryza sativa Japonica Group]
 dbj|BAG92995.1| unnamed protein product [Oryza sativa Japonica Group]
Length=220

 Score =   277 bits (709),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGR+V+GLFGK VPKTAENFRALCTGEKG GKSGK LH+KGS FHRIIPSFMI
Sbjct  57   VEIDGKPAGRVVMGLFGKTVPKTAENFRALCTGEKGTGKSGKALHFKGSAFHRIIPSFMI  116

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  117  QGGDFTLGDGRGGESIYGTKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWL  176

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYK+EAEG QSG+PKSKV+IADSGELP+
Sbjct  177  DGKHVVFGKVLSGMDVVYKIEAEGQQSGSPKSKVVIADSGELPM  220



>ref|NP_200679.1| cyclophilin ROC7 [Arabidopsis thaliana]
 sp|Q9SP02.1|CP20A_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP20-1; Short=PPIase 
CYP20-1; AltName: Full=Cyclophilin of 20 kDa 1; AltName: 
Full=Rotamase CYP20-1; AltName: Full=Rotamase cyclophilin-7; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF05760.1|AF192490_1 cyclophilin [Arabidopsis thaliana]
 dbj|BAA97339.1| cyclophilin [Arabidopsis thaliana]
 gb|AAK82490.1| AT5g58710/mzn1_160 [Arabidopsis thaliana]
 gb|AAM16173.1| AT5g58710/mzn1_160 [Arabidopsis thaliana]
 gb|AAM63473.1| cyclophilin ROC7 [Arabidopsis thaliana]
 gb|AED97088.1| cyclophilin ROC7 [Arabidopsis thaliana]
Length=204

 Score =   277 bits (708),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GLFGK VPKT ENFRALCTGEKGIGK+GK LHYKGS FHRIIPSFM+
Sbjct  41   VEIDGKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKNGKALHYKGSSFHRIIPSFML  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTHGNGMGGESIYGEKFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV++GMDVVYKVEAEG QSGTPKSKV+I DSGELPL
Sbjct  161  DGRHVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL  204



>dbj|BAD53621.1| putative cyclophilin [Oryza sativa Japonica Group]
 dbj|BAD53629.1| putative cyclophilin [Oryza sativa Japonica Group]
 dbj|BAG87582.1| unnamed protein product [Oryza sativa Japonica Group]
Length=225

 Score =   277 bits (708),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGR+V+GLFGK VPKTAENFRALCTGEKG GKSGK LH+KGS FHRIIPSFMI
Sbjct  62   VEIDGKPAGRVVMGLFGKTVPKTAENFRALCTGEKGTGKSGKALHFKGSAFHRIIPSFMI  121

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  122  QGGDFTLGDGRGGESIYGTKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWL  181

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYK+EAEG QSG+PKSKV+IADSGELP+
Sbjct  182  DGKHVVFGKVLSGMDVVYKIEAEGQQSGSPKSKVVIADSGELPM  225



>gb|AAP76508.1| cyclophilin, partial [Triticum aestivum]
 gb|AAP80861.1| cyclophilin [Triticum aestivum]
Length=233

 Score =   277 bits (709),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGR+V+GLFGKAVPKTAENFRALCTGEKG+G SGKPLHYKGS FHRIIPSFMI
Sbjct  69   IEIDGKPAGRVVMGLFGKAVPKTAENFRALCTGEKGMGNSGKPLHYKGSSFHRIIPSFMI  128

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  129  QGGDFTLGDGRGGESIYGTKFGDENFKLKHTGPGYLSMANAGRDTNGSQFFITTVTTSWL  188

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYKVEA G Q+GTPKSKV+IADSGE+PL
Sbjct  189  DGKHVVFGKVLSGMDVVYKVEAXGKQNGTPKSKVVIADSGEVPL  232



>ref|NP_001149847.1| peptidyl-prolyl cis-trans isomerase CYP19-4 precursor [Zea mays]
 gb|ACG36980.1| peptidyl-prolyl cis-trans isomerase CYP19-4 precursor [Zea mays]
 gb|AFW69419.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea 
mays]
Length=215

 Score =   276 bits (707),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGRIV+GLFGK VPKTAENFRALCTGEKG+GKSGK LHYKGS FHRIIPSFM+
Sbjct  52   IEIDGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGVGKSGKALHYKGSKFHRIIPSFML  111

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  112  QGGDFTLGDGRGGESIYGLKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWL  171

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYKVEAEG QSG PKSKV+IADSGELP+
Sbjct  172  DGKHVVFGKVLSGMDVVYKVEAEGRQSGEPKSKVVIADSGELPM  215



>gb|AFW69420.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea 
mays]
Length=220

 Score =   277 bits (708),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGRIV+GLFGK VPKTAENFRALCTGEKG+GKSGK LHYKGS FHRIIPSFM+
Sbjct  57   IEIDGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGVGKSGKALHYKGSKFHRIIPSFML  116

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  117  QGGDFTLGDGRGGESIYGLKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWL  176

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYKVEAEG QSG PKSKV+IADSGELP+
Sbjct  177  DGKHVVFGKVLSGMDVVYKVEAEGRQSGEPKSKVVIADSGELPM  220



>ref|XP_006410046.1| hypothetical protein EUTSA_v10016970mg [Eutrema salsugineum]
 gb|ESQ51499.1| hypothetical protein EUTSA_v10016970mg [Eutrema salsugineum]
Length=313

 Score =   279 bits (714),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GK AGR+VIGLFGK VPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  150  VEIEGKDAGRVVIGLFGKTVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMI  209

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG+KF DENFKLKHTGPGLLSMAN+G DTNGSQFFITTV TSWL
Sbjct  210  QGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGLLSMANSGEDTNGSQFFITTVKTSWL  269

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+ GMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  270  DGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGELPL  313



>ref|XP_002437567.1| hypothetical protein SORBIDRAFT_10g029480 [Sorghum bicolor]
 gb|EER88934.1| hypothetical protein SORBIDRAFT_10g029480 [Sorghum bicolor]
Length=215

 Score =   276 bits (705),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGRIV+GLFGK VPKTAENFRALCTGEKG+GKSGK LHYKGS FHRIIPSFM+
Sbjct  52   IEIDGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGVGKSGKALHYKGSAFHRIIPSFML  111

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  112  QGGDFTLGDGRGGESIYGLKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWL  171

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYKVEAEG QSG PKSKV+I DSGELP+
Sbjct  172  DGKHVVFGKVLSGMDVVYKVEAEGRQSGQPKSKVVITDSGELPM  215



>gb|AEE98363.1| cyclophilin B-D [Deschampsia antarctica]
Length=160

 Score =   273 bits (698),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  545  GKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMIQggd  366
            GKPAGR+V+GLFG AVPKTAENFRALCTGEKGIGKSGKPLHYKGS FHRIIPSFMIQGGD
Sbjct  1    GKPAGRVVMGLFGNAVPKTAENFRALCTGEKGIGKSGKPLHYKGSSFHRIIPSFMIQGGD  60

Query  365  ftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRH  186
            FT G+G GGESIYG KF DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWLDG+H
Sbjct  61   FTHGNGMGGESIYGTKFADENFKLKHTGPGYLSMANAGKDTNGSQFFITTVTTSWLDGKH  120

Query  185  VVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            VVFGKVLSGMDV+YKVEAEG QSGTPK KV++ADSGE+PL
Sbjct  121  VVFGKVLSGMDVIYKVEAEGAQSGTPKKKVVVADSGEVPL  160



>ref|XP_001769405.1| predicted protein [Physcomitrella patens]
 gb|EDQ65774.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   274 bits (700),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+D KP GR+VIGLFGKA PKT ENFRALCTGEKG GKSGKPLHYKGSVFHRIIPSFMI
Sbjct  41   VEIDNKPVGRVVIGLFGKAAPKTVENFRALCTGEKGNGKSGKPLHYKGSVFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGD T G+GRGGESIYGEKF DENF+LKHTGPG+LSMANAGP+TNGSQFFI TV TSWL
Sbjct  101  QGGDITHGNGRGGESIYGEKFADENFRLKHTGPGILSMANAGPNTNGSQFFICTVKTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSG+DVVYKVEAEG   GTPKSKV IADSGE+PL
Sbjct  161  DGRHVVFGKVLSGLDVVYKVEAEGTSGGTPKSKVFIADSGEIPL  204



>gb|EYU45717.1| hypothetical protein MIMGU_mgv1a013744mg [Erythranthe guttata]
Length=211

 Score =   273 bits (697),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALC-----TGEKGIGKSGKPLHYKGSVFHRII  393
            VE+DGKPAGRI +GLFGK VPKTAENFRALC     TGE GIG  GKPLHYKGS FHRII
Sbjct  43   VEIDGKPAGRITMGLFGKTVPKTAENFRALCFRALCTGEHGIGGQGKPLHYKGSKFHRII  102

Query  392  PSFMIQggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTV  213
            PSFMIQGGDFTLGDGRGGES+YGEKF DENFK+KHTGPGLLSMAN+GPDTNGSQFFITTV
Sbjct  103  PSFMIQGGDFTLGDGRGGESVYGEKFADENFKIKHTGPGLLSMANSGPDTNGSQFFITTV  162

Query  212  TTSWLDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            TTSWLDGRHVVFGKVLSGMDVVYK+EAEG Q+GTPKSKV+I+DSGELPL
Sbjct  163  TTSWLDGRHVVFGKVLSGMDVVYKMEAEGTQNGTPKSKVVISDSGELPL  211



>ref|XP_005845180.1| hypothetical protein CHLNCDRAFT_26227, partial [Chlorella variabilis]
 gb|EFN53078.1| hypothetical protein CHLNCDRAFT_26227 [Chlorella variabilis]
Length=175

 Score =   271 bits (692),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GL+GK VPKT ENFRALCTGEKG+GKSGKPLHYKG+VFHRIIPSFM+
Sbjct  6    VEIDGKAAGRIVMGLYGKTVPKTVENFRALCTGEKGVGKSGKPLHYKGTVFHRIIPSFML  65

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            Q GDFT GDG GGESIYGEKF DENFKL+H   G+LSMANAG DTNGSQFFITTV T+WL
Sbjct  66   QSGDFTRGDGTGGESIYGEKFEDENFKLRHKSAGVLSMANAGKDTNGSQFFITTVKTAWL  125

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFG+VL GMDVVYKVEAEG QSGTPKSKVIIADSGELP+
Sbjct  126  DGRHVVFGRVLEGMDVVYKVEAEGSQSGTPKSKVIIADSGELPV  169



>ref|XP_009420416.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Musa 
acuminata subsp. malaccensis]
Length=207

 Score =   271 bits (693),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GLFGK VPKTAENFRALCTGEKG+GKSGK LH+KGS FHRIIPSFMI
Sbjct  44   VEIGGKPAGRIVMGLFGKTVPKTAENFRALCTGEKGVGKSGKALHFKGSTFHRIIPSFMI  103

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG  F DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  104  QGGDFTHGDGRGGESIYGMTFADENFKLKHTGPGFLSMANAGRDTNGSQFFITTVTTSWL  163

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGMDVVYK+EAEG Q+G+PKS+V+IADSGELPL
Sbjct  164  DGKHVVFGKVLSGMDVVYKIEAEGKQNGSPKSEVVIADSGELPL  207



>gb|ABK20982.1| unknown [Picea sitchensis]
 gb|ABK22028.1| unknown [Picea sitchensis]
 gb|ABR17148.1| unknown [Picea sitchensis]
 gb|ABR18435.1| unknown [Picea sitchensis]
 gb|ACN40017.1| unknown [Picea sitchensis]
 gb|ACN40100.1| unknown [Picea sitchensis]
 gb|ACN40475.1| unknown [Picea sitchensis]
Length=204

 Score =   271 bits (692),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGR+VIGLFGK VPKT ENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  40   VEIAGKPAGRVVIGLFGKTVPKTVENFRALCTGEKGVGKSGKPLHYKGSFFHRIIPSFMI  99

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPG LSMANAGPDTNGSQFFITTVTT WL
Sbjct  100  QGGDFTLGDGRGGESIYGIKFADENFKLKHTGPGFLSMANAGPDTNGSQFFITTVTTDWL  159

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFGKV+SGMDVVYKVEAEG QSG PK KV IADSGEL
Sbjct  160  DGRHVVFGKVISGMDVVYKVEAEGKQSGQPKRKVKIADSGEL  201



>ref|XP_011035946.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like isoform 
X1 [Populus euphratica]
Length=231

 Score =   271 bits (694),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKP GR+V+GLFGK VPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIPSFMI
Sbjct  68   VEIAGKPMGRVVMGLFGKTVPKTAENFRALCTGEKGMGKSGKPLHFKGSTFHRIIPSFMI  127

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDG+GGESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTV TSWL
Sbjct  128  QGGDFTQGDGQGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVVTSWL  187

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGMD++YK+EAEG Q+G P+ KV++ DSGE+PL
Sbjct  188  DGHHVVFGKVLSGMDIIYKIEAEGKQNGVPRHKVVVLDSGEMPL  231



>gb|KFK24386.1| hypothetical protein AALP_AAs72209U000300 [Arabis alpina]
Length=201

 Score =   270 bits (690),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V+++GK AGR+VIGLFGKAVPKT ENFRALCTGE G+GKSGK LHYKGS FHRIIPSFMI
Sbjct  38   VQIEGKDAGRVVIGLFGKAVPKTTENFRALCTGENGVGKSGKALHYKGSKFHRIIPSFMI  97

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG+KF DENFKL+HTGPG+LSMAN+G DTNGSQFFITTV TSWL
Sbjct  98   QGGDFTHGNGMGGESIYGQKFADENFKLEHTGPGVLSMANSGGDTNGSQFFITTVKTSWL  157

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+ GMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  158  DGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGELPL  201



>ref|XP_002315159.1| peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
 gb|EEF01330.1| peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
Length=231

 Score =   270 bits (691),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKP GR+V+GLFGK VPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIPSFMI
Sbjct  68   VEIAGKPMGRVVMGLFGKTVPKTAENFRALCTGEKGMGKSGKPLHFKGSTFHRIIPSFMI  127

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGEKF DENFKLKHTGPG+LSMANAGPDTNGSQFFITTV TSWL
Sbjct  128  QGGDFTQGDGRGGESIYGEKFADENFKLKHTGPGMLSMANAGPDTNGSQFFITTVVTSWL  187

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGMD++YK+EAEG Q+G P+ KV++ DSGE+PL
Sbjct  188  DGHHVVFGKVLSGMDIIYKIEAEGKQNGVPRHKVVVLDSGEMPL  231



>gb|ABK94432.1| unknown [Populus trichocarpa]
Length=231

 Score =   270 bits (691),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKP GR+V+GLFGK VPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIPSFMI
Sbjct  68   VEIAGKPMGRVVMGLFGKTVPKTAENFRALCTGEKGMGKSGKPLHFKGSTFHRIIPSFMI  127

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGEKF DENFKLKHTGPG+LSMANAGPDTNGSQFFITTV TSWL
Sbjct  128  QGGDFTQGDGRGGESIYGEKFADENFKLKHTGPGMLSMANAGPDTNGSQFFITTVVTSWL  187

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGMD++YK+EAEG Q+G P+ KV++ DSGE+PL
Sbjct  188  DGHHVVFGKVLSGMDIIYKIEAEGKQNGVPRHKVVVLDSGEMPL  231



>gb|ACF49501.1| cyclophilin B-A [Triticum aestivum]
 gb|ACF49503.1| cyclophilin B-A, partial [Triticum turgidum subsp. durum]
 gb|ACF49504.1| cyclophilin B-D, partial [Triticum turgidum subsp. durum]
Length=207

 Score =   270 bits (689),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGR+V+GLFGKAVPKTAENFRALCTGEKG+G SGKPLHYKGS FHRIIPSFMI
Sbjct  50   IEIDGKPAGRVVMGLFGKAVPKTAENFRALCTGEKGMGNSGKPLHYKGSSFHRIIPSFMI  109

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  110  QGGDFTLGDGRGGESIYGTKFADENFKLKHTGPGYLSMANAGRDTNGSQFFITTVTTSWL  169

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIAD  84
            DG+HVVFGKVLSGMDVVYKVEAEG Q+GTPKSKV+IAD
Sbjct  170  DGKHVVFGKVLSGMDVVYKVEAEGKQNGTPKSKVVIAD  207



>gb|KCW85440.1| hypothetical protein EUGRSUZ_B02252 [Eucalyptus grandis]
Length=152

 Score =   267 bits (682),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -1

Query  521  IGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMIQggdftlgdgrg  342
            +GL+GKAVPKT ENFRALCTGEKG GKSGKPLHYKGS FHRIIPSFM+QGGDFTLGDGRG
Sbjct  1    MGLYGKAVPKTTENFRALCTGEKGTGKSGKPLHYKGSSFHRIIPSFMLQGGDFTLGDGRG  60

Query  341  GESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLS  162
            GESIYGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLS
Sbjct  61   GESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLS  120

Query  161  GMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            GMDVVYKVEAEG QSGTPKSKV+IADSGELPL
Sbjct  121  GMDVVYKVEAEGRQSGTPKSKVVIADSGELPL  152



>ref|XP_007008975.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Theobroma cacao]
 gb|EOY17785.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Theobroma cacao]
Length=221

 Score =   269 bits (688),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V++DGK AGRIV+GLFGK VPKTAENFRALCTGEKG G SGK LHYKGS FHRIIPSFMI
Sbjct  58   VQIDGKSAGRIVMGLFGKTVPKTAENFRALCTGEKGTGNSGKRLHYKGSTFHRIIPSFMI  117

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGEKF DENFKLKH GPGLLSMAN GPDTNGSQFFITTVTTSWL
Sbjct  118  QGGDFTRGDGRGGESIYGEKFADENFKLKHDGPGLLSMANGGPDTNGSQFFITTVTTSWL  177

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVL+GMDVVYK+E EG  SG PKSKV+I DSGE+P+
Sbjct  178  DGRHVVFGKVLAGMDVVYKIEGEGRHSGVPKSKVVIVDSGEMPI  221



>gb|KDO68977.1| hypothetical protein CISIN_1g027222mg [Citrus sinensis]
Length=226

 Score =   268 bits (684),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +EV GKP GRIV+GLFGKAVPKT ENFRALCTGEKGIGKSGKPL+YKGS FHRIIPSFMI
Sbjct  63   IEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMI  122

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESI+GE F DENFKLKHTGPG+LSMANAGPDTNGSQFFITTV TSWL
Sbjct  123  QGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWL  182

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVV K+EAEG QSG PKSKV+I++SGE+ L
Sbjct  183  DGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEMAL  226



>gb|KDO68980.1| hypothetical protein CISIN_1g027222mg [Citrus sinensis]
Length=198

 Score =   267 bits (682),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +EV GKP GRIV+GLFGKAVPKT ENFRALCTGEKGIGKSGKPL+YKGS FHRIIPSFMI
Sbjct  35   IEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMI  94

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESI+GE F DENFKLKHTGPG+LSMANAGPDTNGSQFFITTV TSWL
Sbjct  95   QGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWL  154

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVV K+EAEG QSG PKSKV+I++SGE+ L
Sbjct  155  DGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEMAL  198



>gb|KDO68978.1| hypothetical protein CISIN_1g027222mg [Citrus sinensis]
Length=208

 Score =   267 bits (682),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +EV GKP GRIV+GLFGKAVPKT ENFRALCTGEKGIGKSGKPL+YKGS FHRIIPSFMI
Sbjct  45   IEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMI  104

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESI+GE F DENFKLKHTGPG+LSMANAGPDTNGSQFFITTV TSWL
Sbjct  105  QGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWL  164

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVV K+EAEG QSG PKSKV+I++SGE+ L
Sbjct  165  DGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEMAL  208



>gb|KDO68979.1| hypothetical protein CISIN_1g027222mg [Citrus sinensis]
Length=216

 Score =   267 bits (683),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +EV GKP GRIV+GLFGKAVPKT ENFRALCTGEKGIGKSGKPL+YKGS FHRIIPSFMI
Sbjct  53   IEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMI  112

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESI+GE F DENFKLKHTGPG+LSMANAGPDTNGSQFFITTV TSWL
Sbjct  113  QGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWL  172

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVV K+EAEG QSG PKSKV+I++SGE+ L
Sbjct  173  DGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEMAL  216



>ref|XP_002979746.1| hypothetical protein SELMODRAFT_111263 [Selaginella moellendorffii]
 gb|EFJ19148.1| hypothetical protein SELMODRAFT_111263 [Selaginella moellendorffii]
Length=204

 Score =   266 bits (681),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGR+V+GL+GKAVPKTAENFRALCTGEKG G  GK LH+KGS FHRIIPSFMI
Sbjct  41   VEIGGKPAGRVVMGLYGKAVPKTAENFRALCTGEKGTGSQGKALHFKGSAFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG KF DENFKLKHTGPG+LSMANAG +TNGSQFFITTV TSWL
Sbjct  101  QGGDFTHGNGMGGESIYGTKFADENFKLKHTGPGVLSMANAGSNTNGSQFFITTVKTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKV+SGMD+VYKVEAEG QSG PKSKV IADSGELPL
Sbjct  161  DGKHVVFGKVISGMDIVYKVEAEGSQSGAPKSKVTIADSGELPL  204



>gb|KDP44773.1| hypothetical protein JCGZ_01273 [Jatropha curcas]
Length=231

 Score =   267 bits (683),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +EV+GK  GR+V+GLFGK VPKT ENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  68   IEVNGKSMGRVVMGLFGKTVPKTVENFRALCTGEKGMGKSGKPLHYKGSAFHRIIPSFMI  127

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGEKF DENFKLKHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  128  QGGDFTCGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGQDTNGSQFFITTVTTSWL  187

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELP  69
            DG HVVFGKVLSGM++VYK+EAEG Q+G PK KV+I DSGE+P
Sbjct  188  DGHHVVFGKVLSGMEIVYKIEAEGNQNGVPKHKVVILDSGEMP  230



>ref|XP_009788373.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Nicotiana 
sylvestris]
Length=228

 Score =   266 bits (681),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GKP GRIV+GLFGK VPKTAENFRALCTGEKG GK+GKPLHYKGS FHRIIPSFMI
Sbjct  66   VEINGKPTGRIVMGLFGKIVPKTAENFRALCTGEKGTGKAGKPLHYKGSTFHRIIPSFMI  125

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGE F DENF LKHT PG+LSMANAGPDTNGSQFFITTVTT WL
Sbjct  126  QGGDFTRGDGRGGESIYGESFADENFDLKHTEPGILSMANAGPDTNGSQFFITTVTTGWL  185

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELP  69
            DG HVVFGKVLSGMDVVYK+EAEG  SGTPKSKVII++SGELP
Sbjct  186  DGHHVVFGKVLSGMDVVYKIEAEGRGSGTPKSKVIISNSGELP  228



>ref|XP_002988391.1| hypothetical protein SELMODRAFT_447339 [Selaginella moellendorffii]
 gb|EFJ10481.1| hypothetical protein SELMODRAFT_447339 [Selaginella moellendorffii]
Length=204

 Score =   265 bits (678),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGR+V+GL+GKAVPKTAENFRALCTGEKG G  GK LH+KGS FHRIIPSFMI
Sbjct  41   VEIGGKPAGRVVMGLYGKAVPKTAENFRALCTGEKGTGSQGKTLHFKGSAFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG KF DENFKLKHTGPG+LSMANAG +TNGSQFFITTV TSWL
Sbjct  101  QGGDFTHGNGMGGESIYGTKFADENFKLKHTGPGVLSMANAGSNTNGSQFFITTVKTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKV+SGMD+VYKVEAEG QSG PKSKV IADSGELPL
Sbjct  161  DGKHVVFGKVISGMDIVYKVEAEGSQSGAPKSKVTIADSGELPL  204



>ref|XP_006435733.1| hypothetical protein CICLE_v10032673mg [Citrus clementina]
 ref|XP_006486318.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X1 [Citrus sinensis]
 gb|ESR48973.1| hypothetical protein CICLE_v10032673mg [Citrus clementina]
Length=226

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +EV GKP GRIV+GLFGKAVPKT ENFRALCTGEKGIGKSGKPL+YKGS FHRIIPSFMI
Sbjct  63   IEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMI  122

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESI+GE F DENFKLKHTGPG+LSMANAGPDTNGSQFFIT V TSWL
Sbjct  123  QGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITAVITSWL  182

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVV K+EAEG QSG PKSKV+I++SGE+ L
Sbjct  183  DGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEMAL  226



>ref|XP_006486319.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X2 [Citrus sinensis]
Length=216

 Score =   266 bits (679),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +EV GKP GRIV+GLFGKAVPKT ENFRALCTGEKGIGKSGKPL+YKGS FHRIIPSFMI
Sbjct  53   IEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMI  112

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESI+GE F DENFKLKHTGPG+LSMANAGPDTNGSQFFIT V TSWL
Sbjct  113  QGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITAVITSWL  172

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVV K+EAEG QSG PKSKV+I++SGE+ L
Sbjct  173  DGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEMAL  216



>gb|KJB74295.1| hypothetical protein B456_011G287900 [Gossypium raimondii]
Length=221

 Score =   266 bits (679),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V++DGK AGRIVIGLFGK VPKTAENFRALCTGEKG GKSGKPLHYKGS FHRIIPSFMI
Sbjct  58   VQIDGKSAGRIVIGLFGKTVPKTAENFRALCTGEKGAGKSGKPLHYKGSTFHRIIPSFMI  117

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGE+F DENFKLKH GPG LSMANAGP+TNGSQFFITTVTT WL
Sbjct  118  QGGDFTRGDGRGGESIYGERFADENFKLKHEGPGRLSMANAGPNTNGSQFFITTVTTGWL  177

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKV++GMDVV+K+EA+G QSG PK+KV+I DSGE+P+
Sbjct  178  DGHHVVFGKVIAGMDVVFKIEAQGRQSGVPKAKVVIVDSGEMPI  221



>ref|XP_009625080.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Nicotiana 
tomentosiformis]
Length=228

 Score =   265 bits (678),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GKP GRIV+GLFGK VPKTAENFRALCTGEKG GK+GKPLHYKGS FHRIIPSFMI
Sbjct  66   VEINGKPTGRIVMGLFGKIVPKTAENFRALCTGEKGTGKAGKPLHYKGSTFHRIIPSFMI  125

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGE F DENF LKHT PG+LSMANAGPDTNGSQFFITTVTT WL
Sbjct  126  QGGDFTRGDGRGGESIYGESFPDENFDLKHTEPGILSMANAGPDTNGSQFFITTVTTGWL  185

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELP  69
            DG HVVFGKVLSGMDVVYK+EAEG  SGTPKSKVII++SGELP
Sbjct  186  DGHHVVFGKVLSGMDVVYKIEAEGRGSGTPKSKVIISNSGELP  228



>ref|XP_001782168.1| predicted protein [Physcomitrella patens]
 gb|EDQ52991.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   264 bits (675),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ G+PAGR+V+GLFGKA PKT ENFRALCTGEKG G SGKPLH+KGS FHRIIPSFMI
Sbjct  35   VEIGGQPAGRVVMGLFGKAAPKTVENFRALCTGEKGKGLSGKPLHFKGSAFHRIIPSFMI  94

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+GRGGESIYGEKF DE+FKLKHTGPG+LSMANAGP+TNGSQFFI TV TSWL
Sbjct  95   QGGDFTHGNGRGGESIYGEKFADESFKLKHTGPGILSMANAGPNTNGSQFFICTVKTSWL  154

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVEAEG   GTPK KV IADSGE+PL
Sbjct  155  DGRHVVFGKVLSGMDVVYKVEAEGTSGGTPKKKVTIADSGEIPL  198



>ref|XP_011084909.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Sesamum 
indicum]
Length=226

 Score =   265 bits (676),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E++GK  GRIV+GLFGK VP+TAENFRALCTGEKGIGKSGKPLH+KGS FHRIIPSFMI
Sbjct  63   IEINGKRIGRIVMGLFGKTVPRTAENFRALCTGEKGIGKSGKPLHFKGSQFHRIIPSFMI  122

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESI+G++F DENFKLKHTGPG+LSMAN+GPD+NGSQFFITTVTTSWL
Sbjct  123  QGGDFTRGDGRGGESIFGDRFPDENFKLKHTGPGVLSMANSGPDSNGSQFFITTVTTSWL  182

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVV K+EAEG QSG+PKS VII+DSGEL L
Sbjct  183  DGRHVVFGKVLSGMDVVRKIEAEGKQSGSPKSTVIISDSGELSL  226



>ref|XP_006338848.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Solanum 
tuberosum]
Length=229

 Score =   264 bits (675),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GKP GRIV+GLFGK VPKTAENFRALCTGEKG GK+GKPLHYKGS FHRIIPSFMI
Sbjct  66   VEINGKPTGRIVMGLFGKTVPKTAENFRALCTGEKGTGKAGKPLHYKGSSFHRIIPSFMI  125

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGE F DENF LKHT PG+LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  126  QGGDFTRGDGRGGESIYGESFPDENFDLKHTEPGILSMANAGPDTNGSQFFITTVTTSWL  185

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELP  69
            D  HVVFGKVLSGMDVV+K+EAEG QSGTPKSKV I++SGELP
Sbjct  186  DKHHVVFGKVLSGMDVVHKIEAEGRQSGTPKSKVRISNSGELP  228



>ref|XP_010322200.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4 isoform 
X2 [Solanum lycopersicum]
Length=182

 Score =   263 bits (671),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GKP GRIV+GLFGK VPKTAENFRALCTGEKG GK+GKPLHYKGS FHRIIPSFMI
Sbjct  19   VEINGKPTGRIVMGLFGKTVPKTAENFRALCTGEKGTGKAGKPLHYKGSSFHRIIPSFMI  78

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGE F DENF LKHT PG+LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  79   QGGDFTRGDGRGGESIYGESFPDENFDLKHTEPGILSMANAGPDTNGSQFFITTVTTSWL  138

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELP  69
            D  HVVFGKVLSGMDVV+K+EAEG QSGTPKSKV I +SG+LP
Sbjct  139  DKHHVVFGKVLSGMDVVHKIEAEGRQSGTPKSKVRITNSGDLP  181



>ref|XP_004240942.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4 isoform 
X1 [Solanum lycopersicum]
 gb|AAW22880.1| putative cyclophilin [Solanum lycopersicum]
Length=225

 Score =   263 bits (671),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GKP GRIV+GLFGK VPKTAENFRALCTGEKG GK+GKPLHYKGS FHRIIPSFMI
Sbjct  62   VEINGKPTGRIVMGLFGKTVPKTAENFRALCTGEKGTGKAGKPLHYKGSSFHRIIPSFMI  121

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGE F DENF LKHT PG+LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  122  QGGDFTRGDGRGGESIYGESFPDENFDLKHTEPGILSMANAGPDTNGSQFFITTVTTSWL  181

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELP  69
            D  HVVFGKVLSGMDVV+K+EAEG QSGTPKSKV I +SG+LP
Sbjct  182  DKHHVVFGKVLSGMDVVHKIEAEGRQSGTPKSKVRITNSGDLP  224



>ref|XP_010689673.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Beta 
vulgaris subsp. vulgaris]
Length=239

 Score =   263 bits (671),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DG PAGRIVIGLFGK VP+T ENFRALCTGEKG GKSGK LHYKGS+FHRIIPSFMI
Sbjct  75   VEIDGMPAGRIVIGLFGKTVPRTVENFRALCTGEKGTGKSGKALHYKGSMFHRIIPSFMI  134

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT+GDGRGGESIYGEKF DENFKLKHTGPG LSMANAGPDTNGSQFFITTV T+WL
Sbjct  135  QGGDFTVGDGRGGESIYGEKFADENFKLKHTGPGFLSMANAGPDTNGSQFFITTVKTNWL  194

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFG+VLSGMDVVYK+E  G Q G PKSKV+I +SGE+
Sbjct  195  DGRHVVFGEVLSGMDVVYKIEGRGTQKGIPKSKVVILNSGEI  236



>ref|XP_010031222.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X2 [Eucalyptus grandis]
Length=231

 Score =   262 bits (670),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GLFGK VPKT ENFRALCTGEKGIGKSGKPL+YKGS FHRIIP FMI
Sbjct  68   VEIGGKPAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKSGKPLNYKGSQFHRIIPKFMI  127

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHT  G LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  128  QGGDFTLGDGRGGESIYGNKFSDENFKLKHTDAGRLSMANAGPDTNGSQFFITTVTTSWL  187

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVV+K+EAEG QSG PKS V+I+DSGEL L
Sbjct  188  DGRHVVFGKVLSGMDVVHKIEAEGGQSGQPKSIVVISDSGELDL  231



>gb|ABB86261.1| cyclophilin ROC7-like [Solanum tuberosum]
Length=206

 Score =   261 bits (667),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPAGR+V+GLFGK VP TAENFRALCTGEKG+GKSGKPLH+KGS FHRIIPSFMI
Sbjct  40   VEIDGKPAGRVVMGLFGKTVPNTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPSFMI  99

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTT+WL
Sbjct  100  QGGDFTLGDGRGGESIYGEKFADENFKIKHTGPGLLSMANAGSDTNGSQFFITTVTTTWL  159

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKV  96
            DGRHVVFGKVLSGMDVVYK+EAEG QSGTPK+++
Sbjct  160  DGRHVVFGKVLSGMDVVYKMEAEGRQSGTPKAQL  193



>ref|XP_010031221.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X1 [Eucalyptus grandis]
Length=232

 Score =   262 bits (669),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GLFGK VPKT ENFRALCTGEKGIGKSGKPL+YKGS FHRIIP FMI
Sbjct  69   VEIGGKPAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKSGKPLNYKGSQFHRIIPKFMI  128

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHT  G LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  129  QGGDFTLGDGRGGESIYGNKFSDENFKLKHTDAGRLSMANAGPDTNGSQFFITTVTTSWL  188

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVV+K+EAEG QSG PKS V+I+DSGEL L
Sbjct  189  DGRHVVFGKVLSGMDVVHKIEAEGGQSGQPKSIVVISDSGELDL  232



>ref|NP_001077978.1| peptidyl-prolyl cis-trans isomerase CYP19-4 [Arabidopsis thaliana]
 gb|AEC08328.1| peptidyl-prolyl cis-trans isomerase CYP19-4 [Arabidopsis thaliana]
Length=191

 Score =   260 bits (664),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 147/164 (90%), Gaps = 10/164 (6%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGR+VIGLFGKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  38   VEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMI  97

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG+KF DENFKLKHT          GPDTNGSQFFITTVTTSWL
Sbjct  98   QGGDFTHGNGMGGESIYGQKFADENFKLKHT----------GPDTNGSQFFITTVTTSWL  147

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+ GMDVVYK+EAEG QSGTPKSKV+IADSGELPL
Sbjct  148  DGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGELPL  191



>ref|XP_008233754.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like isoform 
X1 [Prunus mume]
Length=223

 Score =   261 bits (667),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E++GKP GRI++GLFGK VPKT ENFRALCTGEKG G S KPLHYKGS FHRIIPSFMI
Sbjct  60   IEINGKPIGRIIMGLFGKTVPKTIENFRALCTGEKGTGMSRKPLHYKGSAFHRIIPSFMI  119

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG+ F DENFKL+HTGPG+LSMANAGPDTNGSQFFITTV TSWL
Sbjct  120  QGGDFTLGDGRGGESIYGDSFADENFKLQHTGPGILSMANAGPDTNGSQFFITTVKTSWL  179

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVE  G Q+G PKSKV+I DSGELPL
Sbjct  180  DGRHVVFGKVLSGMDVVYKVEEVGGQNGVPKSKVVITDSGELPL  223



>ref|XP_008344818.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4, partial 
[Malus domestica]
Length=148

 Score =   258 bits (660),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = -1

Query  509  GKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMIQggdftlgdgrgGESI  330
            GKAVPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIPSFMIQGGDFTLGDGRGGESI
Sbjct  1    GKAVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPSFMIQGGDFTLGDGRGGESI  60

Query  329  YGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDV  150
            YGEKF DENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTT+WLDGRHVVFGKV SGMDV
Sbjct  61   YGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTNWLDGRHVVFGKVPSGMDV  120

Query  149  VYKVEAEGMQSGTPKSKVIIADSGELPL  66
            VYKVEAEG QSGTPKSKV+IADSGELPL
Sbjct  121  VYKVEAEGNQSGTPKSKVVIADSGELPL  148



>gb|AIS71896.1| peptidyl-prolyl cis-trans isomerase CYP19-4-like protein [Nicotiana 
tabacum]
Length=228

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++G+P GRIV+GLFGK VPKTAENFRALCTGEKG GK+GKPLHYKGS FHRIIPSFMI
Sbjct  66   VEINGRPTGRIVMGLFGKIVPKTAENFRALCTGEKGTGKAGKPLHYKGSTFHRIIPSFMI  125

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGE F DENF LKHT PG+LSMANAGPDTNGSQFFITTVTT WL
Sbjct  126  QGGDFTRGDGRGGESIYGESFADENFDLKHTEPGILSMANAGPDTNGSQFFITTVTTGWL  185

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELP  69
            DG HVVFGKVLSGMDVVYK+EA    SGTPKSKVII++SGELP
Sbjct  186  DGHHVVFGKVLSGMDVVYKIEAXXRGSGTPKSKVIISNSGELP  228



>emb|CBW52773.1| peptidyl-prolyl cis-trans isomerase [Polytomella sp. Pringsheim 
198.80]
Length=204

 Score =   258 bits (660),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GL+G  VPKT ENFRALCTGEKGIGKSGKPLHYKGS+FHRIIP FM+
Sbjct  41   VEIDGKAAGRIVMGLYGNVVPKTVENFRALCTGEKGIGKSGKPLHYKGSIFHRIIPQFML  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDG GGESIYG KF DENFKLKH GPG LSMAN+G DTNGSQFFITTV TSWL
Sbjct  101  QGGDFTRGDGTGGESIYGNKFADENFKLKHKGPGFLSMANSGADTNGSQFFITTVATSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            +GRHVVFG VL GMDVVYKVE+ G  SG PKSKV+IADSGE+P+
Sbjct  161  NGRHVVFGTVLEGMDVVYKVESMGTSSGRPKSKVVIADSGEIPM  204



>ref|XP_003600890.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
 gb|AES71141.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=233

 Score =   259 bits (663),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK  GRIV+GLFG  VPKTAENFRALCTGEKG+GKSG PLHYKGS FHRIIPSFM+
Sbjct  70   VEIDGKSVGRIVMGLFGTTVPKTAENFRALCTGEKGVGKSGNPLHYKGSAFHRIIPSFMV  129

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG LSMAN+G DTNGSQFFITTV TSWL
Sbjct  130  QGGDFTSGDGRGGESIYGDKFADENFKLKHTGPGYLSMANSGQDTNGSQFFITTVKTSWL  189

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFGKVLSGMDV++K+EAEG +SG+PK  V+I DSGEL
Sbjct  190  DGRHVVFGKVLSGMDVLHKIEAEGSESGSPKRTVVILDSGEL  231



>gb|KCW50482.1| hypothetical protein EUGRSUZ_J00210 [Eucalyptus grandis]
Length=313

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GLFGK VPKT ENFRALCTGEKGIGKSGKPL+YKGS FHRIIP FMI
Sbjct  150  VEIGGKPAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKSGKPLNYKGSQFHRIIPKFMI  209

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHT  G LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  210  QGGDFTLGDGRGGESIYGNKFSDENFKLKHTDAGRLSMANAGPDTNGSQFFITTVTTSWL  269

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVV+K+EAEG QSG PKS V+I+DSGEL L
Sbjct  270  DGRHVVFGKVLSGMDVVHKIEAEGGQSGQPKSIVVISDSGELDL  313



>ref|XP_001695474.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Chlamydomonas 
reinhardtii]
 gb|EDP01732.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Chlamydomonas 
reinhardtii]
Length=222

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKP GRIV+GL+G  VPKT ENFRALCTGEKG G SGKPLH+K S+FHRIIP FMI
Sbjct  59   VEIDGKPEGRIVVGLYGNTVPKTVENFRALCTGEKGTGTSGKPLHFKNSIFHRIIPQFMI  118

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDG GGESIYG +F DENF LKHTGPG+LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  119  QGGDFTRGDGTGGESIYGSRFPDENFALKHTGPGVLSMANAGPDTNGSQFFITTVTTSWL  178

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+ GMDVVYKVEA G  SG P  KV IADSGELPL
Sbjct  179  DGRHVVFGKVVEGMDVVYKVEAVGTSSGKPSKKVTIADSGELPL  222



>ref|XP_002533648.1| cyclophilin, putative [Ricinus communis]
 gb|EEF28736.1| cyclophilin, putative [Ricinus communis]
Length=198

 Score =   258 bits (658),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+ G+  GRIV+GLFGK VPKT ENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFMI
Sbjct  35   IEIGGRSMGRIVMGLFGKTVPKTVENFRALCTGEKGMGKSGKPLHYKGSTFHRIIPSFMI  94

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGEKF DE+FKLKHT PGLLSMANAG DTNGSQFFITTV TSWL
Sbjct  95   QGGDFTRGDGRGGESIYGEKFADEDFKLKHTEPGLLSMANAGQDTNGSQFFITTVMTSWL  154

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGMDVVYK+E EG ++G PK KV+I DSGE+PL
Sbjct  155  DGHHVVFGKVLSGMDVVYKIEGEGSENGIPKRKVVILDSGEMPL  198



>gb|KCW50481.1| hypothetical protein EUGRSUZ_J00210 [Eucalyptus grandis]
Length=314

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGRIV+GLFGK VPKT ENFRALCTGEKGIGKSGKPL+YKGS FHRIIP FMI
Sbjct  151  VEIGGKPAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKSGKPLNYKGSQFHRIIPKFMI  210

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFKLKHT  G LSMANAGPDTNGSQFFITTVTTSWL
Sbjct  211  QGGDFTLGDGRGGESIYGNKFSDENFKLKHTDAGRLSMANAGPDTNGSQFFITTVTTSWL  270

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVV+K+EAEG QSG PKS V+I+DSGEL L
Sbjct  271  DGRHVVFGKVLSGMDVVHKIEAEGGQSGQPKSIVVISDSGELDL  314



>gb|ABI33223.1| cyclophilin [Camellia sinensis]
Length=164

 Score =   256 bits (653),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -1

Query  527  IVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMIQggdftlgdg  348
            +  G  GKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPS M+QGGDFTLGDG
Sbjct  11   VCHGSLGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSSMLQGGDFTLGDG  70

Query  347  rgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKV  168
            RGGESIYGEKF DENFKLKHTGPG LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKV
Sbjct  71   RGGESIYGEKFADENFKLKHTGPGFLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKV  130

Query  167  LSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            LSGMDVVYK+EAEG QSGTPKS V IADSGELPL
Sbjct  131  LSGMDVVYKIEAEGNQSGTPKSNVQIADSGELPL  164



>ref|XP_010534595.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-2-like isoform 
X1 [Tarenaya hassleriana]
Length=191

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E++G PAGRIV+GLFG+ VPKT ENFRALCTGEKG+G SGKPLH+KGS FHRIIPSFMI
Sbjct  28   IEINGSPAGRIVMGLFGEIVPKTTENFRALCTGEKGLGNSGKPLHFKGSTFHRIIPSFMI  87

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG+LSM NAGPDTNGSQFFITTVTTSWL
Sbjct  88   QGGDFTRGDGRGGESIYGDKFSDENFKLKHTGPGVLSMTNAGPDTNGSQFFITTVTTSWL  147

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG HVVFGKVLSGMDVV++VE++G ++G PK++VII++SGEL
Sbjct  148  DGHHVVFGKVLSGMDVVHRVESQGSENGVPKNRVIISESGEL  189



>ref|XP_002958739.1| hypothetical protein VOLCADRAFT_84601 [Volvox carteri f. nagariensis]
 gb|EFJ40195.1| hypothetical protein VOLCADRAFT_84601 [Volvox carteri f. nagariensis]
Length=212

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGK AGRIVIGL+G  VPKT ENFRALCTGEKG+G+SGK L YKGS FHRIIP FMI
Sbjct  49   IEIDGKAAGRIVIGLYGNTVPKTVENFRALCTGEKGMGQSGKLLSYKGSSFHRIIPQFMI  108

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDG GGESIYG +F DENF LKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL
Sbjct  109  QGGDFTRGDGTGGESIYGSRFPDENFALKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  168

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+ GMDVV+KVEA G +SGTP  KV+IADSGELPL
Sbjct  169  DGRHVVFGKVVEGMDVVFKVEAIGSRSGTPSKKVVIADSGELPL  212



>ref|XP_009344915.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Pyrus 
x bretschneideri]
Length=228

 Score =   258 bits (658),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E++GKP GRIV+GLFGK VPKT ENFRALCTGEKG G S KPLHYKGS FHRIIPSFMI
Sbjct  62   IEINGKPIGRIVMGLFGKTVPKTIENFRALCTGEKGTGTSRKPLHYKGSTFHRIIPSFMI  121

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG+KF DENFKL+HTGPG+LSMANAGPDTNGSQFFITTV T WL
Sbjct  122  QGGDFTLGDGRGGESIYGDKFADENFKLQHTGPGILSMANAGPDTNGSQFFITTVKTGWL  181

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMDVVYKVE  G  +G P+SKV+I DSGELP+
Sbjct  182  DGRHVVFGKVISGMDVVYKVEEVGDANGVPRSKVVITDSGELPM  225



>ref|XP_010534597.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-2-like isoform 
X2 [Tarenaya hassleriana]
Length=228

 Score =   258 bits (658),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E++G PAGRIV+GLFG+ VPKT ENFRALCTGEKG+G SGKPLH+KGS FHRIIPSFMI
Sbjct  65   IEINGSPAGRIVMGLFGEIVPKTTENFRALCTGEKGLGNSGKPLHFKGSTFHRIIPSFMI  124

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG+LSM NAGPDTNGSQFFITTVTTSWL
Sbjct  125  QGGDFTRGDGRGGESIYGDKFSDENFKLKHTGPGVLSMTNAGPDTNGSQFFITTVTTSWL  184

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG HVVFGKVLSGMDVV++VE++G ++G PK++VII++SGEL
Sbjct  185  DGHHVVFGKVLSGMDVVHRVESQGSENGVPKNRVIISESGEL  226



>gb|KHN34720.1| Peptidyl-prolyl cis-trans isomerase CYP19-4 [Glycine soja]
Length=238

 Score =   258 bits (658),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +++ GK AGRIV+GL+G  VPKTAENFRALCTGEKG+G+SGK LHYKGS FHRIIPSFM+
Sbjct  75   IQIHGKLAGRIVMGLYGNTVPKTAENFRALCTGEKGVGRSGKSLHYKGSTFHRIIPSFMV  134

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG LSMAN+G DTNGSQFFITTV TSWL
Sbjct  135  QGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGYLSMANSGEDTNGSQFFITTVKTSWL  194

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFGKVLSGMDV+YK+EAEG +SG+PK+KV+I DSGEL
Sbjct  195  DGRHVVFGKVLSGMDVLYKIEAEGSESGSPKNKVVILDSGEL  236



>emb|CBK24925.2| unnamed protein product [Blastocystis hominis]
Length=202

 Score =   256 bits (653),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DG+  GRIV+GLFGK VPKT ENFRALCTGEKGIGKSGKPLHYKGS+FHRIIP+FMI
Sbjct  41   IEIDGEKVGRIVMGLFGKTVPKTVENFRALCTGEKGIGKSGKPLHYKGSIFHRIIPNFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKLKHTGPG+LSMANAGPDTNGSQFFITTV T WL
Sbjct  101  QGGDFTAGNGTGGESIYGEKFSDENFKLKHTGPGILSMANAGPDTNGSQFFITTVKTQWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFGKV+ GM++V ++EA G  SGTP  KV+I DSGEL
Sbjct  161  DGRHVVFGKVIEGMEIVKQIEAVGTGSGTPTKKVVIVDSGEL  202



>ref|XP_004500488.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Cicer 
arietinum]
Length=233

 Score =   256 bits (655),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGK AGRIV+GLFG  VPKTAENFRALCTGEKG+G+SGK LHYKGS FHRIIPSFM+
Sbjct  70   IEIDGKLAGRIVMGLFGTTVPKTAENFRALCTGEKGVGRSGKALHYKGSTFHRIIPSFMV  129

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESI+G+KF DENFK+KH+GPG LSMAN+G DTNGSQFFITTV T+WL
Sbjct  130  QGGDFTFGDGRGGESIFGDKFADENFKVKHSGPGYLSMANSGQDTNGSQFFITTVKTTWL  189

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFGKVLSGMDV+YK+EAEG +SG+PK KVI+ DSGEL
Sbjct  190  DGRHVVFGKVLSGMDVLYKIEAEGSESGSPKRKVIVLDSGEL  231



>gb|AFK38441.1| unknown [Lotus japonicus]
Length=230

 Score =   256 bits (655),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GLFG  VPKT ENFRALCTGEKG+G+S KPLHYKGS FHRIIPSFM+
Sbjct  67   VEIDGKSAGRIVMGLFGSTVPKTVENFRALCTGEKGVGRSRKPLHYKGSAFHRIIPSFMV  126

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG+KF DENFKLKHTGPG LSMAN+G DTNGSQFFITTV TSWL
Sbjct  127  QGGDFTLGDGRGGESIYGDKFADENFKLKHTGPGYLSMANSGQDTNGSQFFITTVKTSWL  186

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFGKVLSGM+V+YK+E+EG +SG PK KV+I DSGEL
Sbjct  187  DGRHVVFGKVLSGMEVLYKIESEGSESGLPKRKVVILDSGEL  228



>emb|CDY52123.1| BnaA10g29520D [Brassica napus]
 emb|CDX80340.1| BnaC09g34020D [Brassica napus]
Length=204

 Score =   255 bits (652),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GLFGK VPKTAENFRALCTGEKGIGK GK LHYKGS FHRIIPSFM+
Sbjct  41   VEIDGKEAGRIVMGLFGKTVPKTAENFRALCTGEKGIGKKGKALHYKGSSFHRIIPSFML  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGE F DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTHGNGMGGESIYGETFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMDVVYK+EAEG QSGTPKSKV+I DSGELPL
Sbjct  161  DGRHVVFGKVVSGMDVVYKIEAEGNQSGTPKSKVVIVDSGELPL  204



>ref|XP_008374016.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like isoform 
X2 [Malus domestica]
Length=204

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E++GKP GRIV+GLFGK VPKT ENFRALCTGEKG G S KPLHYKGS FHRIIPSFMI
Sbjct  41   IEINGKPFGRIVMGLFGKTVPKTTENFRALCTGEKGTGTSRKPLHYKGSTFHRIIPSFMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG+KF DENFKL+HTG G+LSMANAGPDTNGSQFFITTV T WL
Sbjct  101  QGGDFTLGDGRGGESIYGDKFADENFKLQHTGSGILSMANAGPDTNGSQFFITTVKTDWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMDVVYKVE  G  +G P+SKV+I DSGELP+
Sbjct  161  DGRHVVFGKVISGMDVVYKVEEVGDANGVPRSKVVITDSGELPM  204



>ref|XP_004307644.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Fragaria 
vesca subsp. vesca]
Length=227

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKP GRIV+GLFGK VPKT ENFRALCTGEKGIG S KPLHYKGS+FHRIIPSFMI
Sbjct  64   IEIDGKPIGRIVMGLFGKTVPKTIENFRALCTGEKGIGNSMKPLHYKGSIFHRIIPSFMI  123

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG+KF DENFK+KHTGPG LSMAN+G DTNGSQFFITTV TSWL
Sbjct  124  QGGDFTLGDGRGGESIYGDKFADENFKVKHTGPGYLSMANSGQDTNGSQFFITTVKTSWL  183

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGMDVVYKVE  G  +G PKSKV+I DSG LP+
Sbjct  184  DGHHVVFGKVLSGMDVVYKVEQVGGSNGVPKSKVVIKDSGALPM  227



>gb|EYU22353.1| hypothetical protein MIMGU_mgv1a013286mg [Erythranthe guttata]
Length=225

 Score =   256 bits (653),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGK  GRIVIGLFGK VPKTAENFRALCTGEKGIG SGKPLH+KGS FHRIIP FMI
Sbjct  64   IEIDGKHTGRIVIGLFGKTVPKTAENFRALCTGEKGIGTSGKPLHFKGSKFHRIIPGFMI  123

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLG+GRGGESI+G+KF DENFKLKHTGPG+LSMAN+G D+NGSQFFITTV TSWL
Sbjct  124  QGGDFTLGNGRGGESIFGDKFPDENFKLKHTGPGVLSMANSGADSNGSQFFITTVITSWL  183

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFGKV+SGM+VV K+EA+G QSGTPK++VII+DSGEL
Sbjct  184  DGRHVVFGKVVSGMEVVQKIEAQGRQSGTPKTEVIISDSGEL  225



>ref|XP_006403401.1| hypothetical protein EUTSA_v10010699mg [Eutrema salsugineum]
 gb|ESQ44854.1| hypothetical protein EUTSA_v10010699mg [Eutrema salsugineum]
Length=224

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            ++++G PAGRI+IGLFGK VPKTAENFRALCTGEKG+G+ GKPL++KGS FHRIIPSFMI
Sbjct  61   IQINGSPAGRILIGLFGKTVPKTAENFRALCTGEKGVGEMGKPLYFKGSSFHRIIPSFMI  120

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG KF DENFKLKHTGPG+LSMAN+GPD+NGSQFFITTVTTSWL
Sbjct  121  QGGDFTRGDGRGGESIYGVKFADENFKLKHTGPGVLSMANSGPDSNGSQFFITTVTTSWL  180

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGMDVV+K+EA+G  SG PK K+II DSGE+ L
Sbjct  181  DGHHVVFGKVLSGMDVVHKIEAQGQDSGEPKGKIIILDSGEVSL  224



>ref|XP_002273217.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Vitis 
vinifera]
 emb|CBI25479.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VEV GKP GRI +GLFGK VPKT ENFRALCTGEKG GKSGKPLHYKGS FHRIIPSFMI
Sbjct  65   VEVSGKPIGRITMGLFGKTVPKTIENFRALCTGEKGRGKSGKPLHYKGSAFHRIIPSFMI  124

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGE+F DENFKL HT PGL+SMANAGPD+NGSQFFITTV T WL
Sbjct  125  QGGDFTLGDGRGGESIYGERFADENFKLNHTSPGLVSMANAGPDSNGSQFFITTVATHWL  184

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVLSGM+VVYK+E  G ++G P  KV+I+DSGELPL
Sbjct  185  DGKHVVFGKVLSGMEVVYKIEELGSRNGAPTQKVVISDSGELPL  228



>emb|CDX71155.1| BnaC03g12390D [Brassica napus]
Length=201

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GK AGRIV+GLFGK VPKTAENFRALCTGEKG+GK GK LHYKGS FHRIIPSFM+
Sbjct  38   VEINGKEAGRIVMGLFGKTVPKTAENFRALCTGEKGVGKKGKALHYKGSSFHRIIPSFML  97

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  98   QGGDFTDGNGMGGESIYGEKFADENFKLKHTGPGYLSMANAGEDTNGSQFFITTVTTSWL  157

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV++GMDVVYK+EAEG QSGTPKSKV+I DSGELPL
Sbjct  158  DGRHVVFGKVVTGMDVVYKIEAEGSQSGTPKSKVVIVDSGELPL  201



>ref|XP_008374012.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like isoform 
X1 [Malus domestica]
Length=225

 Score =   255 bits (652),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E++GKP GRIV+GLFGK VPKT ENFRALCTGEKG G S KPLHYKGS FHRIIPSFMI
Sbjct  62   IEINGKPFGRIVMGLFGKTVPKTTENFRALCTGEKGTGTSRKPLHYKGSTFHRIIPSFMI  121

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG+KF DENFKL+HTG G+LSMANAGPDTNGSQFFITTV T WL
Sbjct  122  QGGDFTLGDGRGGESIYGDKFADENFKLQHTGSGILSMANAGPDTNGSQFFITTVKTDWL  181

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV+SGMDVVYKVE  G  +G P+SKV+I DSGELP+
Sbjct  182  DGRHVVFGKVISGMDVVYKVEEVGDANGVPRSKVVITDSGELPM  225



>emb|CDY61026.1| BnaAnng17350D [Brassica napus]
Length=201

 Score =   254 bits (649),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GK AGRIV+GLFGK VPKTAENFRALCTGEKG+GK GK LHYKGS FHRIIPSFM+
Sbjct  38   VEINGKEAGRIVMGLFGKTVPKTAENFRALCTGEKGMGKKGKALHYKGSSFHRIIPSFML  97

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  98   QGGDFTDGNGMGGESIYGEKFADENFKLKHTGPGYLSMANAGEDTNGSQFFITTVTTSWL  157

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV++GMDVVYK+EAEG QSGTPKSKV+I DSGELPL
Sbjct  158  DGRHVVFGKVVTGMDVVYKIEAEGSQSGTPKSKVVIVDSGELPL  201



>ref|XP_009120386.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Brassica 
rapa]
Length=205

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GLFGK VPKTAENFRALCTGEKGIGK GK LHYKGS FHRIIPSFM+
Sbjct  42   VEIDGKEAGRIVMGLFGKTVPKTAENFRALCTGEKGIGKKGKALHYKGSSFHRIIPSFML  101

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGE F DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  102  QGGDFTHGNGMGGESIYGETFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWL  161

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV++GMDVVYK+EAEG QSGTPKSKV+I DSGELPL
Sbjct  162  DGRHVVFGKVVTGMDVVYKIEAEGNQSGTPKSKVVIVDSGELPL  205



>ref|XP_008369251.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X1 [Malus domestica]
Length=226

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E++GKP GRIV+GLFGK VPKT ENFRALCTGEKG G S KPLHYKGS FHRIIPSFMI
Sbjct  63   IEINGKPIGRIVMGLFGKTVPKTIENFRALCTGEKGTGTSRKPLHYKGSTFHRIIPSFMI  122

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG+KF DENFKLKHTGPG+LSMANAGPDTNGSQFFITTV T WL
Sbjct  123  QGGDFTLGDGRGGESIYGDKFADENFKLKHTGPGILSMANAGPDTNGSQFFITTVKTGWL  182

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVV KVE  G + G P+SKV+I +SGELP+
Sbjct  183  DGRHVVFGKVLSGMDVVSKVEEVGGKDGVPRSKVVITNSGELPM  226



>ref|XP_010443618.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X1 [Camelina sativa]
 ref|XP_010443619.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X2 [Camelina sativa]
Length=204

 Score =   254 bits (648),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GLFGK VPKT ENFRALCTGEKGIGK GK LHYKGS FHRIIPSFM+
Sbjct  41   VEIDGKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKKGKALHYKGSSFHRIIPSFML  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGE F DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTHGNGMGGESIYGETFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV++GMDVVYKVEAEG QSGTPKSKV+I DSGELPL
Sbjct  161  DGRHVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL  204



>ref|XP_006281118.1| hypothetical protein CARUB_v10027149mg [Capsella rubella]
 gb|EOA14016.1| hypothetical protein CARUB_v10027149mg [Capsella rubella]
Length=204

 Score =   254 bits (648),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GLFGK VPKT ENFRALCTGEKGIGK GK LHYKGS FHRIIPSFM+
Sbjct  41   VEIDGKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKKGKALHYKGSSFHRIIPSFML  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGE F DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTHGNGMGGESIYGETFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV++GMDVVYKVEAEG QSGTPKSKV+I DSGELPL
Sbjct  161  DGRHVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL  204



>ref|NP_001242013.1| uncharacterized protein LOC100798499 precursor [Glycine max]
 gb|ACU19783.1| unknown [Glycine max]
Length=238

 Score =   254 bits (650),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +++ GK AGRIV+GL+G  VPKTAENFRALCTGEKG+G+SGK LHYKGS FHRIIPSFM+
Sbjct  75   IQIHGKLAGRIVMGLYGNTVPKTAENFRALCTGEKGVGRSGKSLHYKGSTFHRIIPSFMV  134

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG L MAN+G DTNGSQFFITTV TSWL
Sbjct  135  QGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGYLFMANSGEDTNGSQFFITTVKTSWL  194

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFGKVLSGMDV+YK+EAEG +SG+PK+KV+I DSGEL
Sbjct  195  DGRHVVFGKVLSGMDVLYKIEAEGSESGSPKNKVVILDSGEL  236



>ref|XP_006401051.1| hypothetical protein EUTSA_v10014704mg [Eutrema salsugineum]
 gb|ESQ42504.1| hypothetical protein EUTSA_v10014704mg [Eutrema salsugineum]
Length=204

 Score =   253 bits (647),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GL+GK VPKTAENFRALCTGEKGIGK GK LHYKGS FHRIIPSFM+
Sbjct  41   VEIDGKEAGRIVMGLYGKTVPKTAENFRALCTGEKGIGKKGKALHYKGSSFHRIIPSFML  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGE F DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTHGNGMGGESIYGETFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV++GMDVVYK+EAEG QSGTPKSKV+I DSGELPL
Sbjct  161  DGRHVVFGKVVTGMDVVYKIEAEGNQSGTPKSKVVIVDSGELPL  204



>ref|XP_009132031.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Brassica 
rapa]
Length=201

 Score =   253 bits (647),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++GK AGRIV+GLFGK VPKTAENFRALCTGEKG+GK GK LHYKGS FHRIIPSFM+
Sbjct  38   VEINGKEAGRIVMGLFGKTVPKTAENFRALCTGEKGMGKKGKALHYKGSSFHRIIPSFML  97

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  98   QGGDFTDGNGMGGESIYGEKFADENFKLKHTGPGYLSMANAGEDTNGSQFFITTVTTSWL  157

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV++GMDVVYK+EAEG QSGTPKSKV+I DSGELP+
Sbjct  158  DGRHVVFGKVVTGMDVVYKIEAEGSQSGTPKSKVVIVDSGELPI  201



>ref|XP_010483473.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Camelina 
sativa]
Length=204

 Score =   253 bits (647),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GLFGK VPKT ENFRALCTGEKGIGK GK LHYKGS FHRIIPSFM+
Sbjct  41   VEIDGKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKKGKALHYKGSSFHRIIPSFML  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGE F DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTHGNGMGGESIYGETFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV++GMDVVYKVEAEG QSGTPKSKV+I DSGELPL
Sbjct  161  DGRHVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL  204



>gb|KIZ04415.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Monoraphidium 
neglectum]
Length=204

 Score =   253 bits (647),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGKPAGRIV+GLFG  VPKT ENFRALCTGEKG GKSGKPLH+KGSVFHRIIP FMI
Sbjct  39   IEIDGKPAGRIVMGLFGDIVPKTVENFRALCTGEKGTGKSGKPLHFKGSVFHRIIPQFMI  98

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDG GGESIYGEKF DENFKLKH  PG LSMANAGP+TNGSQFFITTV T+WL
Sbjct  99   QGGDFTRGDGTGGESIYGEKFADENFKLKHKAPGYLSMANAGPNTNGSQFFITTVKTAWL  158

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFGKV+ GMDVV KVEA G  SGTP  KV IADSGE+
Sbjct  159  DGRHVVFGKVIEGMDVVLKVEAIGSGSGTPSKKVTIADSGEI  200



>ref|XP_009369163.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X1 [Pyrus x bretschneideri]
Length=226

 Score =   254 bits (648),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E++GKP GRIV+GLFGK VPKT ENFRALCTGEKG G S KPLHYKGS FHRIIPSFMI
Sbjct  63   IEINGKPIGRIVMGLFGKTVPKTIENFRALCTGEKGTGTSRKPLHYKGSTFHRIIPSFMI  122

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKL+HTGPG+LSMANAGPDTNGSQFFITTV T WL
Sbjct  123  QGGDFTFGDGRGGESIYGDKFADENFKLRHTGPGILSMANAGPDTNGSQFFITTVKTGWL  182

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVV KVE  G + G P+SKV+I +SGELP+
Sbjct  183  DGRHVVFGKVLSGMDVVSKVEEVGGKDGVPRSKVVITNSGELPM  226



>ref|XP_002864586.1| hypothetical protein ARALYDRAFT_495994 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40845.1| hypothetical protein ARALYDRAFT_495994 [Arabidopsis lyrata subsp. 
lyrata]
Length=204

 Score =   253 bits (646),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GLFGK VPKT ENFRALCTGEKGIGK GK LHYKGS FHRIIPSFM+
Sbjct  41   VEIDGKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKKGKALHYKGSSFHRIIPSFML  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGE F DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTHGNGMGGESIYGETFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV++GMDVVYK+EAEG QSGTPKSKV+I DSGELPL
Sbjct  161  DGRHVVFGKVVTGMDVVYKIEAEGNQSGTPKSKVVIVDSGELPL  204



>ref|XP_007163542.1| hypothetical protein PHAVU_001G243000g [Phaseolus vulgaris]
 gb|ESW35536.1| hypothetical protein PHAVU_001G243000g [Phaseolus vulgaris]
Length=234

 Score =   254 bits (648),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+ GK AGRIVIGLFG  VPKT ENFRALCTGEKG G+SG+ LHYKGS FHRIIPSFM+
Sbjct  71   IEIHGKLAGRIVIGLFGNTVPKTVENFRALCTGEKGKGRSGESLHYKGSTFHRIIPSFMV  130

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKH+GPG LSMAN+G DTNGSQFFITTV TSWL
Sbjct  131  QGGDFTRGDGRGGESIYGDKFADENFKLKHSGPGYLSMANSGQDTNGSQFFITTVKTSWL  190

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFGKV+SGMDV+YK+EAEG +SG+PK+KV+I+DSGEL
Sbjct  191  DGRHVVFGKVISGMDVLYKIEAEGSESGSPKNKVVISDSGEL  232



>ref|XP_003552367.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Glycine 
max]
Length=235

 Score =   254 bits (648),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +++ GK AGRIV+GLFG  VPKTAENFRALCTGEKG+G+SGK LHYKGS FHRI+PSFM+
Sbjct  72   IQIHGKVAGRIVMGLFGNTVPKTAENFRALCTGEKGVGRSGKSLHYKGSTFHRIMPSFMV  131

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG LSMAN+G DTNGSQFFITTV TSWL
Sbjct  132  QGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGYLSMANSGEDTNGSQFFITTVKTSWL  191

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG HVVFGKVLSGMDV+YK+EAEG ++G+PK+KV+I DSGEL
Sbjct  192  DGHHVVFGKVLSGMDVLYKIEAEGSENGSPKNKVVILDSGEL  233



>ref|XP_009116285.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-2 [Brassica 
rapa]
 emb|CDY27255.1| BnaA09g35470D [Brassica napus]
Length=224

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            ++++G PAGRI+IGLFGK VPKTAENFRALCTGEKG+G  GKPL++KGS FHRIIPSFMI
Sbjct  61   IQINGSPAGRILIGLFGKIVPKTAENFRALCTGEKGVGNMGKPLYFKGSTFHRIIPSFMI  120

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG+LSMAN+GPD+NGSQFFITTVTT WL
Sbjct  121  QGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGVLSMANSGPDSNGSQFFITTVTTGWL  180

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGM+VV K+EA+G  SG PK KVII DSGE+ L
Sbjct  181  DGHHVVFGKVLSGMEVVRKIEAQGQSSGEPKGKVIILDSGEVSL  224



>ref|XP_009785498.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X2 [Nicotiana sylvestris]
Length=193

 Score =   251 bits (640),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 144/164 (88%), Gaps = 16/164 (10%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGKPA                ENFRALCTGEKGIGKSGKPLHYKGS FHRIIPSFM+
Sbjct  46   VEIDGKPA----------------ENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFML  89

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENFK+KHTGPGLLSMANAG DTNGSQFFITTVTTSWL
Sbjct  90   QGGDFTLGDGRGGESIYGEKFADENFKIKHTGPGLLSMANAGSDTNGSQFFITTVTTSWL  149

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYKVEAEG QSGTPKSKV+IA+SGELPL
Sbjct  150  DGRHVVFGKVLSGMDVVYKVEAEGRQSGTPKSKVVIAESGELPL  193



>emb|CDX72190.1| BnaC08g26840D [Brassica napus]
Length=224

 Score =   252 bits (643),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            ++++G PAGRI+IGLFGK VPKTAENFRALCTGEKG+G  GKPL++KGS FHRIIPSFMI
Sbjct  61   IQINGSPAGRILIGLFGKIVPKTAENFRALCTGEKGVGNMGKPLYFKGSSFHRIIPSFMI  120

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG+LSMAN+GPD+NGSQFFITTVTT WL
Sbjct  121  QGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGVLSMANSGPDSNGSQFFITTVTTGWL  180

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGM+VV K+EA+G  SG PK KVII DSGE+ L
Sbjct  181  DGHHVVFGKVLSGMEVVRKIEAQGQSSGEPKGKVIILDSGEVSL  224



>ref|XP_010454144.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Camelina 
sativa]
Length=204

 Score =   251 bits (640),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+DGK AGRIV+GLFGK VPKT ENFRALCTGEKGIGK GK LHYKGS FHRIIPSFM+
Sbjct  41   VEIDGKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKKGKALHYKGSSFHRIIPSFML  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGE F DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWL
Sbjct  101  QGGDFTHGNGMGGESIYGETFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKV++GMDVVYKVEAEG QSGTPKSKV+I DSGE PL
Sbjct  161  DGRHVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGEHPL  204



>gb|KHN36375.1| Peptidyl-prolyl cis-trans isomerase CYP20-1 [Glycine soja]
Length=235

 Score =   251 bits (642),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +++ GK  GRIV+GLFG  VPKTAENFRALCTGEKG+G+SGK LHYKGS FHRI+PSFM+
Sbjct  72   IQIHGKVVGRIVMGLFGNTVPKTAENFRALCTGEKGVGRSGKSLHYKGSTFHRIMPSFMV  131

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG LSMAN+G DTNGSQFFITTV TSWL
Sbjct  132  QGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGYLSMANSGEDTNGSQFFITTVKTSWL  191

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG HVVFGKVLSGMDV+YK+EAEG ++G+PK+KV+I DSGEL
Sbjct  192  DGHHVVFGKVLSGMDVLYKIEAEGSENGSPKNKVVILDSGEL  233



>ref|XP_008463237.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Cucumis 
melo]
Length=220

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKP+GR+VIGLFG+ VPKTAENFRALCTGEKGIG+SGKPLHYKGS FHRIIPSFMI
Sbjct  56   VEIGGKPSGRVVIGLFGETVPKTAENFRALCTGEKGIGRSGKPLHYKGSNFHRIIPSFMI  115

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGEKF DENF LKH GPG +SMAN+G DTNGSQFFITTV TSWL
Sbjct  116  QGGDFTRGDGRGGESIYGEKFADENFLLKHDGPGFVSMANSGEDTNGSQFFITTVKTSWL  175

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQ-SGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGMDVV+K+EAEG Q  G PK++V I+ SGELP+
Sbjct  176  DGHHVVFGKVLSGMDVVFKIEAEGNQGDGKPKTEVSISQSGELPV  220



>ref|XP_006657326.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Oryza 
brachyantha]
Length=217

 Score =   249 bits (635),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + +DGKPAGRIV+GLFG  VPKTAENFRA+CTGEKGIGKSGKPL+YKG+ FHRIIP FMI
Sbjct  55   ITIDGKPAGRIVMGLFGDTVPKTAENFRAICTGEKGIGKSGKPLYYKGTTFHRIIPGFMI  114

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGD   G+G G +SIYG  F DENFK+ H+ PG LSMANAG DTNGSQFFITTV  + L
Sbjct  115  QGGDTANGNGTGSDSIYGSMFADENFKISHSAPGFLSMANAGKDTNGSQFFITTVKLTRL  174

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFGKVLSGMDVVYK+EAEG QSGTPK +V+I+DSGEL
Sbjct  175  DGKHVVFGKVLSGMDVVYKIEAEGSQSGTPKCRVVISDSGEL  216



>ref|XP_010427394.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-2 isoform 
X3 [Camelina sativa]
Length=227

 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            ++++G PAGRI+IGLFGK VPKTAENFRALCTGEKG+G  GK L++KGS+FHRIIP FMI
Sbjct  64   IQINGSPAGRILIGLFGKIVPKTAENFRALCTGEKGVGNMGKSLYFKGSIFHRIIPGFMI  123

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG+LSMAN+GPD+NGSQFFITTVTTSWL
Sbjct  124  QGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGILSMANSGPDSNGSQFFITTVTTSWL  183

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGM+VV K+EA+G  SG PK KVII  SGE+ L
Sbjct  184  DGHHVVFGKVLSGMEVVRKIEAQGQDSGEPKGKVIIFASGEVSL  227



>ref|XP_010427393.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-2 isoform 
X2 [Camelina sativa]
Length=228

 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            ++++G PAGRI+IGLFGK VPKTAENFRALCTGEKG+G  GK L++KGS+FHRIIP FMI
Sbjct  65   IQINGSPAGRILIGLFGKIVPKTAENFRALCTGEKGVGNMGKSLYFKGSIFHRIIPGFMI  124

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG+LSMAN+GPD+NGSQFFITTVTTSWL
Sbjct  125  QGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGILSMANSGPDSNGSQFFITTVTTSWL  184

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGM+VV K+EA+G  SG PK KVII  SGE+ L
Sbjct  185  DGHHVVFGKVLSGMEVVRKIEAQGQDSGEPKGKVIIFASGEVSL  228



>ref|XP_010427392.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-2 isoform 
X1 [Camelina sativa]
Length=231

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            ++++G PAGRI+IGLFGK VPKTAENFRALCTGEKG+G  GK L++KGS+FHRIIP FMI
Sbjct  68   IQINGSPAGRILIGLFGKIVPKTAENFRALCTGEKGVGNMGKSLYFKGSIFHRIIPGFMI  127

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG+LSMAN+GPD+NGSQFFITTVTTSWL
Sbjct  128  QGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGILSMANSGPDSNGSQFFITTVTTSWL  187

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGM+VV K+EA+G  SG PK KVII  SGE+ L
Sbjct  188  DGHHVVFGKVLSGMEVVRKIEAQGQDSGEPKGKVIIFASGEVSL  231



>ref|XP_006291798.1| hypothetical protein CARUB_v10017974mg [Capsella rubella]
 gb|EOA24696.1| hypothetical protein CARUB_v10017974mg [Capsella rubella]
Length=228

 Score =   247 bits (630),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            ++++G PAGRI+IGLFGK VPKTAENFRALCTGEKG+G  GKPL++KGS FHRIIP FMI
Sbjct  65   IQINGSPAGRILIGLFGKIVPKTAENFRALCTGEKGVGNMGKPLYFKGSSFHRIIPGFMI  124

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG LSMAN+GPD+NGSQFFITTVTTSWL
Sbjct  125  QGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGFLSMANSGPDSNGSQFFITTVTTSWL  184

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGM+VV K+EA+G  SG PK KVII  SGE  L
Sbjct  185  DGHHVVFGKVLSGMEVVRKIEAQGQGSGEPKGKVIIFASGEASL  228



>ref|XP_004149234.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Cucumis 
sativus]
 ref|XP_004171252.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Cucumis 
sativus]
 gb|KGN50654.1| hypothetical protein Csa_5G202380 [Cucumis sativus]
Length=220

 Score =   246 bits (628),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+ GKP+GR+VIGLFG+ VPKTAENFRALCTGEKGIG+SGK LHYKGS FHRIIPSFMI
Sbjct  56   IEIGGKPSGRVVIGLFGETVPKTAENFRALCTGEKGIGRSGKSLHYKGSKFHRIIPSFMI  115

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYGEKF DENF LKH GPG +SMAN+G DTNGSQFFITT+ TSWL
Sbjct  116  QGGDFTRGDGRGGESIYGEKFADENFLLKHDGPGFVSMANSGEDTNGSQFFITTIKTSWL  175

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQ-SGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGMDVV+K+EAEG Q  G PK++V I+ SGELP+
Sbjct  176  DGHHVVFGKVLSGMDVVFKIEAEGNQGDGKPKTEVSISQSGELPV  220



>ref|XP_002878051.1| hypothetical protein ARALYDRAFT_486034 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54310.1| hypothetical protein ARALYDRAFT_486034 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   246 bits (629),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            ++++G PAGRI+IGLFGK VPKTAENFRALCTGEKG+G  GKPL++KGS FHRIIP FMI
Sbjct  65   IQINGSPAGRILIGLFGKIVPKTAENFRALCTGEKGVGNMGKPLYFKGSSFHRIIPGFMI  124

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG LSMAN+GPD+NGSQFFITTVTTSWL
Sbjct  125  QGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGFLSMANSGPDSNGSQFFITTVTTSWL  184

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGM+VV K+EA+G  SG PK  VI+  SGE+ L
Sbjct  185  DGHHVVFGKVLSGMEVVRKIEAQGQDSGVPKGNVIVFASGEVSL  228



>ref|XP_010516184.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-2-like isoform 
X4 [Camelina sativa]
Length=229

 Score =   246 bits (628),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            ++++G PAGRI+IGLFGK VPKTAENFRALCTGEKG+G  GKPL++KGS+FHRIIP FMI
Sbjct  66   IQINGSPAGRILIGLFGKIVPKTAENFRALCTGEKGVGNMGKPLYFKGSIFHRIIPGFMI  125

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG KF DENFKLKHTGPG+LSMAN+G D+NGSQFFITTVTTSWL
Sbjct  126  QGGDFTRGDGRGGESIYGHKFADENFKLKHTGPGILSMANSGTDSNGSQFFITTVTTSWL  185

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGM+VV K+EA+G  SG PK KVII  SGE  L
Sbjct  186  DGHHVVFGKVLSGMEVVRKIEAQGQDSGEPKGKVIIFASGEASL  229



>ref|XP_010516183.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-2-like isoform 
X3 [Camelina sativa]
Length=232

 Score =   246 bits (628),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            ++++G PAGRI+IGLFGK VPKTAENFRALCTGEKG+G  GKPL++KGS+FHRIIP FMI
Sbjct  69   IQINGSPAGRILIGLFGKIVPKTAENFRALCTGEKGVGNMGKPLYFKGSIFHRIIPGFMI  128

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG KF DENFKLKHTGPG+LSMAN+G D+NGSQFFITTVTTSWL
Sbjct  129  QGGDFTRGDGRGGESIYGHKFADENFKLKHTGPGILSMANSGTDSNGSQFFITTVTTSWL  188

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGM+VV K+EA+G  SG PK KVII  SGE  L
Sbjct  189  DGHHVVFGKVLSGMEVVRKIEAQGQDSGEPKGKVIIFASGEASL  232



>ref|XP_007218550.1| hypothetical protein PRUPE_ppa012857mg [Prunus persica]
 gb|EMJ19749.1| hypothetical protein PRUPE_ppa012857mg [Prunus persica]
Length=152

 Score =   243 bits (619),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  521  IGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMIQggdftlgdgrg  342
            +GLFGK VPKT ENFRALCTGEKG G S KPLHYKGS FHRIIPSFMIQGGDFTLGDGRG
Sbjct  1    MGLFGKTVPKTIENFRALCTGEKGTGMSRKPLHYKGSAFHRIIPSFMIQGGDFTLGDGRG  60

Query  341  GESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLS  162
            GESIYG+ F DENFKL+HTGPG+LSMANAGPDTNGSQFFITTV TSWLDGRHVVFGKVLS
Sbjct  61   GESIYGDSFADENFKLQHTGPGILSMANAGPDTNGSQFFITTVKTSWLDGRHVVFGKVLS  120

Query  161  GMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            GMDVVYKVE  G Q+G PKS+V+I DSGELPL
Sbjct  121  GMDVVYKVEEVGGQNGVPKSRVVITDSGELPL  152



>ref|NP_567029.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 sp|Q8L8W5.1|CP21B_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP21-2; Short=PPIase 
CYP21-2; AltName: Full=Cyclophilin of 21 kDa 2; AltName: 
Full=Cyclophilin-21-2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM67079.1| cyclophilin-like protein [Arabidopsis thaliana]
 gb|AAS75302.1| single domain cyclophilin type peptidyl-prolyl cis-trans isomerase 
[Arabidopsis thaliana]
 gb|AEE79457.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
Length=228

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            ++++G PAGRI+IGLFG  VPKTAENFR+LCTGEKG+G  GKPL++KGS FHRIIP FMI
Sbjct  65   IQINGSPAGRILIGLFGNIVPKTAENFRSLCTGEKGVGNMGKPLYFKGSSFHRIIPGFMI  124

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG LSMAN+GPD+NGSQFFITTVTTSWL
Sbjct  125  QGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGFLSMANSGPDSNGSQFFITTVTTSWL  184

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGM+VV K+EA+G  SG PK+ VII  SGE+ L
Sbjct  185  DGHHVVFGKVLSGMEVVRKIEAQGQDSGVPKANVIIFASGEVSL  228



>gb|AAT09096.1| cyclophilin [Bigelowiella natans]
Length=201

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ G+ AGRIV+GL+GK VPKTAENFRALCTGEKG GKSGKPLHYKGS FHRIIP FMI
Sbjct  34   VEIGGEKAGRIVMGLYGKTVPKTAENFRALCTGEKGTGKSGKPLHYKGSSFHRIIPQFMI  93

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+GRGGESIYGEKF DENFKL+HT P  LSMANAGP+TNGSQFFITTV TSWL
Sbjct  94   QGGDFTQGNGRGGESIYGEKFEDENFKLRHTSPYQLSMANAGPNTNGSQFFITTVKTSWL  153

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFG+VL G DVV K+EA G  SGTP  KV I DSGEL
Sbjct  154  DGRHVVFGRVLEGTDVVDKIEAAGSPSGTPSKKVTIVDSGEL  195



>ref|XP_010504464.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-2-like isoform 
X2 [Camelina sativa]
Length=229

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            ++++G PAGRI+IGLFGK VPKTAENFRALCTGEKG+G  GK L++K S+FHRIIP FMI
Sbjct  66   IQINGSPAGRILIGLFGKIVPKTAENFRALCTGEKGVGNMGKSLYFKVSIFHRIIPGFMI  125

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG+LSMAN+GPD+NGSQFFITTVTTSWL
Sbjct  126  QGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGILSMANSGPDSNGSQFFITTVTTSWL  185

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGM+VV K+EA+G  SG PK KVII  SGE+ L
Sbjct  186  DGHHVVFGKVLSGMEVVRKIEAQGQDSGEPKGKVIIFASGEVSL  229



>ref|XP_002503873.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65131.1| predicted protein [Micromonas sp. RCC299]
Length=198

 Score =   243 bits (620),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V + G+PAGRI +GL+G AVPKT ENFRALCTGEKG+G  GKPLHYKGS+FHRIIP FM+
Sbjct  35   VSIGGQPAGRITMGLYGTAVPKTVENFRALCTGEKGVGNRGKPLHYKGSIFHRIIPQFML  94

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+GRGGESIYGEKF DE+F +KH+G G LSMANAGP+TNGSQFFITT+ T+WL
Sbjct  95   QGGDFTDGNGRGGESIYGEKFADESFAIKHSGAGDLSMANAGPNTNGSQFFITTIKTAWL  154

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVL GMDVVYKVEA G QSG P  +V+I DSGEL +
Sbjct  155  DGRHVVFGKVLEGMDVVYKVEAVGSQSGKPSKEVVITDSGELEM  198



>ref|XP_008891344.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
INRA-310]
 gb|ACR82294.1| cyclophilin B [Phytophthora nicotianae]
 gb|ETI50563.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
P1569]
 gb|ETK90435.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica]
 gb|ETL43849.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica]
 gb|ETL97019.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica]
 gb|ETM50168.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica]
 gb|ETN22040.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
INRA-310]
 gb|ETO79302.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
P1976]
 gb|ETP20336.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
CJ01A1]
Length=206

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V +DG+PAGRIV+GL+GK VPKTAENFRALCTGEKG+GKSGKPLHYK S+FHRIIP+FM+
Sbjct  36   VSIDGEPAGRIVMGLYGKTVPKTAENFRALCTGEKGVGKSGKPLHYKDSIFHRIIPNFMV  95

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT  +G GGESIYGEKF DENFKLKH G G LSMAN+G +TNGSQFFI TV TSWL
Sbjct  96   QGGDFTNFNGMGGESIYGEKFPDENFKLKHAGKGTLSMANSGANTNGSQFFICTVKTSWL  155

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL*GFLAE  48
            DGRHVVFG+V+ GMDV+  +EA G  SGTP  KV++ +SGEL    F+ E
Sbjct  156  DGRHVVFGRVIKGMDVLDAIEAVGSPSGTPSKKVVVTESGELAADNFVEE  205



>dbj|BAD53620.1| putative cyclophilin [Oryza sativa Japonica Group]
 dbj|BAD53627.1| putative cyclophilin [Oryza sativa Japonica Group]
 gb|EAZ38238.1| hypothetical protein OsJ_22613 [Oryza sativa Japonica Group]
Length=208

 Score =   241 bits (616),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + ++GKPAGRIV+GLFG  VPKTAENFRA+CTGEKG+GKSGKPL YKG+ FHRIIP FMI
Sbjct  46   ITINGKPAGRIVMGLFGNTVPKTAENFRAICTGEKGLGKSGKPLSYKGTPFHRIIPGFMI  105

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGD   G+G G +SIYG  F DENFK+ H+ PGLLSMAN   DTNGSQFFITTV  + L
Sbjct  106  QGGDTVSGNGTGCDSIYGGMFPDENFKINHSAPGLLSMANYAKDTNGSQFFITTVKLTRL  165

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFGKVLSGMDVVYK+EAEG QSGTP+SKV+I+DSGEL
Sbjct  166  DGKHVVFGKVLSGMDVVYKIEAEGSQSGTPRSKVLISDSGEL  207



>gb|EAZ02312.1| hypothetical protein OsI_24413 [Oryza sativa Indica Group]
Length=208

 Score =   241 bits (614),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + ++GKPAGRIV+GLFG  VPKTAENFRA+CTGEKG+GKSGKPL YKG+ FHRIIP FMI
Sbjct  46   ITINGKPAGRIVMGLFGNTVPKTAENFRAICTGEKGLGKSGKPLSYKGTPFHRIIPGFMI  105

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGD  +G+G G +SIYG  F DENFK+ H+ PGLLSMAN   DTNGSQFFITTV  + L
Sbjct  106  QGGDTVIGNGTGCDSIYGGMFPDENFKINHSAPGLLSMANYAKDTNGSQFFITTVKLTRL  165

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFGKVLSGMDVVYK+EAEG QSGTP+SKV+I+DSGEL
Sbjct  166  DGKHVVFGKVLSGMDVVYKIEAEGSQSGTPRSKVLISDSGEL  207



>ref|XP_009537424.1| hypothetical protein PHYSODRAFT_288960 [Phytophthora sojae]
 gb|EGZ06660.1| hypothetical protein PHYSODRAFT_288960 [Phytophthora sojae]
Length=206

 Score =   240 bits (613),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V +DG PAGRIV+GL+GK VPKT ENFRALCTGEKG GKSGKPLHYK S+FHRIIP+FM+
Sbjct  36   VSIDGAPAGRIVMGLYGKTVPKTVENFRALCTGEKGEGKSGKPLHYKDSIFHRIIPNFMV  95

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT  +G GGESIYGEKF DENFKLKH G G LSMAN+G +TNGSQFFI TV TSWL
Sbjct  96   QGGDFTHFNGMGGESIYGEKFPDENFKLKHAGKGTLSMANSGANTNGSQFFICTVKTSWL  155

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL*GFLAE  48
            DGRHVVFG+V++GMDV+  +EA G  SGTP  KV+I DSGEL    F+ E
Sbjct  156  DGRHVVFGRVINGMDVLDAIEAVGSPSGTPSKKVVITDSGELAADDFVQE  205



>ref|XP_011400187.1| Peptidyl-prolyl cis-trans isomerase CYP19-4 [Auxenochlorella 
protothecoides]
 gb|KFM27220.1| Peptidyl-prolyl cis-trans isomerase CYP19-4 [Auxenochlorella 
protothecoides]
Length=210

 Score =   240 bits (613),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DG PAGRIV+GL+GK VPKTAENFRAL TGEKGIG+S KPL ++GS FHRIIP FM+
Sbjct  36   IEIDGAPAGRIVMGLYGKTVPKTAENFRALATGEKGIGQSKKPLTFQGSHFHRIIPQFML  95

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDG GGESIYG KF DENFKLKHTGPG+LSMAN+G D+NGSQFFITTV TSWL
Sbjct  96   QGGDFTRGDGTGGESIYGPKFADENFKLKHTGPGVLSMANSGRDSNGSQFFITTVKTSWL  155

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFG+V+ GMDVVYK+EA G QSG P  KV IA SGE+
Sbjct  156  DGRHVVFGRVIEGMDVVYKIEALGSQSGQPSKKVTIAKSGEV  197



>ref|XP_002901150.1| peptidyl-prolyl cis-trans isomerase CYP19-4 precursor [Phytophthora 
infestans T30-4]
 gb|EEY59136.1| peptidyl-prolyl cis-trans isomerase CYP19-4 precursor [Phytophthora 
infestans T30-4]
Length=206

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V +DG+PAGRIV+GL+GK VPKT ENFRALCTGEKG+G SGKPLHYK S+FHRIIP+FM+
Sbjct  36   VSIDGQPAGRIVMGLYGKTVPKTVENFRALCTGEKGVGNSGKPLHYKESIFHRIIPNFML  95

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT  +G GGESIYG+KF DENFKLKH G G LSMAN+G +TNGSQFFI TV TSWL
Sbjct  96   QGGDFTDFNGMGGESIYGQKFPDENFKLKHAGKGTLSMANSGANTNGSQFFICTVKTSWL  155

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL*GFLAE  48
            DGRHVVFG+V+ GMDV+  VEA G  SGTP  KV+I DSGEL    F+ E
Sbjct  156  DGRHVVFGRVIKGMDVLDAVEAVGSPSGTPSKKVVITDSGELAADDFVEE  205



>ref|XP_006435732.1| hypothetical protein CICLE_v10032673mg [Citrus clementina]
 gb|ESR48972.1| hypothetical protein CICLE_v10032673mg [Citrus clementina]
Length=218

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 144/164 (88%), Gaps = 8/164 (5%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +EV GKP GRIV+GLFGKAVPKT         GEKGIGKSGKPL+YKGS FHRIIPSFMI
Sbjct  63   IEVGGKPIGRIVMGLFGKAVPKT--------VGEKGIGKSGKPLYYKGSSFHRIIPSFMI  114

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESI+GE F DENFKLKHTGPG+LSMANAGPDTNGSQFFIT V TSWL
Sbjct  115  QGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITAVITSWL  174

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVV K+EAEG QSG PKSKV+I++SGE+ L
Sbjct  175  DGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEMAL  218



>ref|XP_010516182.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-2-like isoform 
X2 [Camelina sativa]
Length=235

 Score =   239 bits (610),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 145/170 (85%), Gaps = 6/170 (4%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCT------GEKGIGKSGKPLHYKGSVFHRI  396
            ++++G PAGRI+IGLFGK VPKTAENFRALCT      GEKG+G  GKPL++KGS+FHRI
Sbjct  66   IQINGSPAGRILIGLFGKIVPKTAENFRALCTVYPPGAGEKGVGNMGKPLYFKGSIFHRI  125

Query  395  IPSFMIQggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITT  216
            IP FMIQGGDFT GDGRGGESIYG KF DENFKLKHTGPG+LSMAN+G D+NGSQFFITT
Sbjct  126  IPGFMIQGGDFTRGDGRGGESIYGHKFADENFKLKHTGPGILSMANSGTDSNGSQFFITT  185

Query  215  VTTSWLDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            VTTSWLDG HVVFGKVLSGM+VV K+EA+G  SG PK KVII  SGE  L
Sbjct  186  VTTSWLDGHHVVFGKVLSGMEVVRKIEAQGQDSGEPKGKVIIFASGEASL  235



>ref|XP_010516181.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-2-like isoform 
X1 [Camelina sativa]
Length=238

 Score =   239 bits (609),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 145/170 (85%), Gaps = 6/170 (4%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCT------GEKGIGKSGKPLHYKGSVFHRI  396
            ++++G PAGRI+IGLFGK VPKTAENFRALCT      GEKG+G  GKPL++KGS+FHRI
Sbjct  69   IQINGSPAGRILIGLFGKIVPKTAENFRALCTVYPPGAGEKGVGNMGKPLYFKGSIFHRI  128

Query  395  IPSFMIQggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITT  216
            IP FMIQGGDFT GDGRGGESIYG KF DENFKLKHTGPG+LSMAN+G D+NGSQFFITT
Sbjct  129  IPGFMIQGGDFTRGDGRGGESIYGHKFADENFKLKHTGPGILSMANSGTDSNGSQFFITT  188

Query  215  VTTSWLDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            VTTSWLDG HVVFGKVLSGM+VV K+EA+G  SG PK KVII  SGE  L
Sbjct  189  VTTSWLDGHHVVFGKVLSGMEVVRKIEAQGQDSGEPKGKVIIFASGEASL  238



>ref|XP_003055075.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60327.1| predicted protein [Micromonas pusilla CCMP1545]
Length=202

 Score =   238 bits (606),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V + G PAGRI +GL+G  VPKTAENFRAL TGEKG GK GKPLHYKGS FHR+IP+FMI
Sbjct  39   VSIGGIPAGRITMGLYGDVVPKTAENFRALATGEKGTGKRGKPLHYKGSTFHRVIPNFMI  98

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+GRGGESIYG KF DENF L+H GPG LSMAN+GP+TNGSQFFI T+ TSWL
Sbjct  99   QGGDFTDGNGRGGESIYGAKFADENFSLQHAGPGDLSMANSGPNTNGSQFFICTIKTSWL  158

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELP  69
            DGRHVVFGKVL GMDVVYK+EA G  SGTP  +V I DSG+LP
Sbjct  159  DGRHVVFGKVLEGMDVVYKIEAVGSSSGTPSKEVTITDSGQLP  201



>ref|XP_004341067.1| peptidylprolyl cis-trans isomerase, cyclophilin-type, putative 
[Acanthamoeba castellanii str. Neff]
 gb|ELR19003.1| peptidylprolyl cis-trans isomerase, cyclophilin-type, putative 
[Acanthamoeba castellanii str. Neff]
Length=202

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DGK  GR+V GL+G  VPKT ENFRALCTGEKG+G  GKPLHYKGS FHR+IP+FMI
Sbjct  37   IEIDGKLEGRVVFGLYGGTVPKTVENFRALCTGEKGVGSKGKPLHYKGSSFHRVIPNFMI  96

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G G GGESIYG++F DENFKLKHT PGLLSMANAG DTNGSQFFITTV T WL
Sbjct  97   QGGDFTHGTGVGGESIYGDRFADENFKLKHTTPGLLSMANAGKDTNGSQFFITTVATPWL  156

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG+HVVFGKVL G D++ K+E+ G QSG P + + IADSGELPL
Sbjct  157  DGKHVVFGKVLEGYDIIKKLESLGSQSGKPSATLTIADSGELPL  200



>ref|XP_002186294.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65764.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=194

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -1

Query  557  VEVDGKP--AGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSF  384
            VE++G P   GRIV+GLFG  VPKT ENFR+LCTGEKG+GK+GKPLH+KGS+FHRIIP+F
Sbjct  31   VEIEGAPDSGGRIVMGLFGDVVPKTVENFRSLCTGEKGVGKAGKPLHFKGSIFHRIIPNF  90

Query  383  MIQggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTS  204
            MIQGGDFT G+GRGGESIYGEKF DENF+LKH GP  LSMANAGP+TNGSQFFITTV TS
Sbjct  91   MIQGGDFTQGNGRGGESIYGEKFADENFELKHEGPLYLSMANAGPNTNGSQFFITTVKTS  150

Query  203  WLDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            WLDGRHVVFGKVL G DVV  VEA+G  SG PK+KV + DSGE+
Sbjct  151  WLDGRHVVFGKVLEGEDVVKAVEAQGTNSGQPKAKVTLVDSGEV  194



>ref|XP_010504463.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-2-like isoform 
X1 [Camelina sativa]
Length=235

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 146/170 (86%), Gaps = 6/170 (4%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCT------GEKGIGKSGKPLHYKGSVFHRI  396
            ++++G PAGRI+IGLFGK VPKTAENFRALCT      GEKG+G  GK L++K S+FHRI
Sbjct  66   IQINGSPAGRILIGLFGKIVPKTAENFRALCTVYPPGAGEKGVGNMGKSLYFKVSIFHRI  125

Query  395  IPSFMIQggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITT  216
            IP FMIQGGDFT GDGRGGESIYG+KF DENFKLKHTGPG+LSMAN+GPD+NGSQFFITT
Sbjct  126  IPGFMIQGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGILSMANSGPDSNGSQFFITT  185

Query  215  VTTSWLDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            VTTSWLDG HVVFGKVLSGM+VV K+EA+G  SG PK KVII  SGE+ L
Sbjct  186  VTTSWLDGHHVVFGKVLSGMEVVRKIEAQGQDSGEPKGKVIIFASGEVSL  235



>ref|XP_009408731.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Musa 
acuminata subsp. malaccensis]
Length=206

 Score =   236 bits (602),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 140/168 (83%), Gaps = 4/168 (2%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+ GKP GRI++GLFGK VPKTAENFRA+CTGEKG  K G  L+YKGS FHRIIP FMI
Sbjct  39   IEIAGKPVGRIIMGLFGKTVPKTAENFRAICTGEKGRDKYGVRLYYKGSTFHRIIPHFMI  98

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVT----  210
            QGGD   G+GRG ++IY E F DENFKL HTGPGLLSMANAGPDTNG QFFITTV     
Sbjct  99   QGGDIVFGNGRGIDNIYDEPFADENFKLNHTGPGLLSMANAGPDTNGCQFFITTVKLTRY  158

Query  209  TSWLDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            ++WLDG+HVVFG+VLSGMDVVYK+EA G  SG P+S+V+IA+SGELPL
Sbjct  159  STWLDGKHVVFGEVLSGMDVVYKIEAVGQASGVPRSRVVIAESGELPL  206



>ref|NP_506749.1| Protein CYN-7 [Caenorhabditis elegans]
 sp|P52015.2|CYP7_CAEEL RecName: Full=Peptidyl-prolyl cis-trans isomerase 7; Short=PPIase 
7; AltName: Full=Cyclophilin-7; AltName: Full=Rotamase 
7 [Caenorhabditis elegans]
 emb|CAA21760.1| CYN-7 [Caenorhabditis elegans]
Length=171

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + GKP GRIV+ L+   VPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIP FMI
Sbjct  10   ITIAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPEFMI  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFK KHTGPG+LSMANAGP+TNGSQFF+ TV T+WL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ G+D+V KVE  G  SGTPKS+ +IAD G+L
Sbjct  130  DGKHVVFGRVVEGLDIVSKVEGNGSSSGTPKSECLIADCGQL  171



>ref|XP_646208.1| cyclophilin B [Dictyostelium discoideum AX4]
 sp|Q9TW32.1|PPIB_DICDI RecName: Full=Peptidyl-prolyl cis-trans isomerase B; Short=PPIase 
B; AltName: Full=Cyclophilin B; AltName: Full=Rotamase 
B; Flags: Precursor [Dictyostelium discoideum]
 gb|AAD48893.1|AF053068_1 cyclophilin B [Dictyostelium discoideum]
 gb|AAD48910.1|AF123597_1 cyclophilin B [Dictyostelium discoideum AX2]
 gb|EAL71910.1| cyclophilin B [Dictyostelium discoideum AX4]
Length=197

 Score =   234 bits (597),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+D KPAGRIV GL+GK VPKT ENFRALCTGEKG+G SGKPLHYK S FHRIIP+FMI
Sbjct  36   IEIDNKPAGRIVFGLYGKTVPKTVENFRALCTGEKGLGTSGKPLHYKDSKFHRIIPNFMI  95

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDG GGESIYG+KF DENFK+KH+ PGLLSMANAGP+TNGSQFFITTV TSWL
Sbjct  96   QGGDFTRGDGTGGESIYGKKFNDENFKIKHSKPGLLSMANAGPNTNGSQFFITTVVTSWL  155

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRH VFG+V+ GMD+V  +E+ G QSGTP     I++SGEL
Sbjct  156  DGRHTVFGEVIEGMDIVKLLESIGSQSGTPSKIAKISNSGEL  197



>gb|AAC47125.1| cyclophilin [Caenorhabditis elegans]
Length=171

 Score =   233 bits (593),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +   GKP GRIV+ L+   VPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIP FMI
Sbjct  10   ITTAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPEFMI  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFK KHTGPG+LSMANAGP+TNGSQFF+ TV T+WL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ G+D+V KVE  G  SGTPKS+ +IAD G+L
Sbjct  130  DGKHVVFGRVVEGLDIVSKVEGNGSSSGTPKSECLIADCGQL  171



>gb|EWM25413.1| cyclophilin [Nannochloropsis gaditana]
Length=197

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + V  KPAGRIV GL+G  VP+T ENFRALCTGEKGIG +G+PLHYKGS FHR+IPSFM+
Sbjct  35   INVADKPAGRIVFGLYGNTVPRTVENFRALCTGEKGIGGAGRPLHYKGSKFHRVIPSFML  94

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT  +G GGESIYG +F DENFKLKHT PGLLSMANAG DTNGSQFFITTV TSWL
Sbjct  95   QGGDFTHNNGMGGESIYGGRFADENFKLKHTRPGLLSMANAGRDTNGSQFFITTVVTSWL  154

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFG+VL GMDVV  +E  G   GT K  VIIADSGEL
Sbjct  155  DGRHVVFGEVLEGMDVVKMIEGLGSDDGTVKKPVIIADSGEL  196



>ref|XP_001759491.1| predicted protein [Physcomitrella patens]
 gb|EDQ75793.1| predicted protein [Physcomitrella patens]
Length=180

 Score =   233 bits (593),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +EVD  P GR+VIGL+GKA PKT ENFRALCTGEKG G+ GKPL +KGS+FHRIIP FMI
Sbjct  17   IEVDTVPVGRVVIGLYGKAAPKTVENFRALCTGEKGNGQGGKPLDFKGSIFHRIIPGFMI  76

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGD T G+G GGESIYG KF DE F LKH+GPG++SMANAGP+TNGSQFFI TV TS L
Sbjct  77   QGGDITHGNGYGGESIYGAKFADEKFTLKHSGPGIVSMANAGPNTNGSQFFIYTVKTSRL  136

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
             G+HVVFGKVL G+DVVYKVEAEG  SGTP+ KV+IADSG +P+
Sbjct  137  GGKHVVFGKVLRGLDVVYKVEAEGSSSGTPERKVVIADSGGIPV  180



>emb|CAP69837.1| cyclophilin [Ricinus communis]
Length=133

 Score =   231 bits (588),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/133 (95%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  464  TGEKGIGKSGKPLHYKGSVFHRIIPSFMIQggdftlgdgrgGESIYGEKFXDENFKLKHT  285
            TGEKG+GKSGKPLHYKGS FHRIIPSFMIQGGDFTLGDGRGGESIYGEKF DENFKLKHT
Sbjct  1    TGEKGVGKSGKPLHYKGSAFHRIIPSFMIQGGDFTLGDGRGGESIYGEKFADENFKLKHT  60

Query  284  GPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPK  105
            GPG LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYK+EAEG QSGTPK
Sbjct  61   GPGFLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGRQSGTPK  120

Query  104  SKVIIADSGELPL  66
            SKV IADSGELPL
Sbjct  121  SKVTIADSGELPL  133



>gb|ABI18377.1| cyclophilin [Steinernema carpocapsae]
Length=170

 Score =   231 bits (589),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + GK AGRIV+ L+   VP+TAENFRALCTGEKG+GKSGKPLHYKGS FHR+IP+FMI
Sbjct  9    LTIGGKAAGRIVMELYNDIVPRTAENFRALCTGEKGMGKSGKPLHYKGSKFHRVIPNFMI  68

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFK +HTGPG+LSMANAGP+TNGSQFF+ TV T WL
Sbjct  69   QGGDFTRGNGTGGESIYGEKFNDENFKERHTGPGILSMANAGPNTNGSQFFLCTVKTEWL  128

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ G+D+V KVE++G QSG P S+ +IAD G+L
Sbjct  129  DGKHVVFGQVVEGLDIVKKVESQGSQSGKPASECVIADCGQL  170



>ref|XP_002774105.1| cyclophilin 1, putative [Perkinsus marinus ATCC 50983]
 gb|EER05921.1| cyclophilin 1, putative [Perkinsus marinus ATCC 50983]
Length=218

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+ GK AGRI   L+GK VPKT ENFRALCTGEKG+GKSGKPL YKGS FHR+IP FM 
Sbjct  40   IEIGGKAAGRIEFDLYGKQVPKTVENFRALCTGEKGVGKSGKPLWYKGSSFHRVIPGFMC  99

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYGEKF DENF LKHT P LLSMANAGPD+NGSQFFIT   T WL
Sbjct  100  QGGDFTLGDGRGGESIYGEKFADENFGLKHTKPYLLSMANAGPDSNGSQFFITVAKTPWL  159

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFG+V  G+D+V K+EA G QSGTP +KV+I DSGELPL
Sbjct  160  DGRHVVFGRVSKGVDIVKKIEAVGSQSGTPSAKVVIVDSGELPL  203



>ref|XP_005770377.1| peptidyl-prolyl isomerase [Emiliania huxleyi CCMP1516]
 ref|XP_005776793.1| peptidyl-prolyl isomerase [Emiliania huxleyi CCMP1516]
 gb|EOD17948.1| peptidyl-prolyl isomerase [Emiliania huxleyi CCMP1516]
 gb|EOD24364.1| peptidyl-prolyl isomerase [Emiliania huxleyi CCMP1516]
Length=201

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + G+PAGRIV+GL+GK VPKT ENFRAL TGEKG+GKSGKPL +KGS FHR+IP+FM+
Sbjct  29   ITIGGEPAGRIVMGLYGKTVPKTVENFRALATGEKGMGKSGKPLAFKGSKFHRVIPNFML  88

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDG GGESIYGEKF DENFKLKHTGPG+LSMANAGP TNGSQFFI TV T+WL
Sbjct  89   QGGDFTRGDGTGGESIYGEKFADENFKLKHTGPGILSMANAGPGTNGSQFFICTVKTAWL  148

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFGKVL GMD+V KVE  G  SG    +V+IADSGEL
Sbjct  149  DGKHVVFGKVLEGMDIVKKVEGVGSPSGKTSKEVLIADSGEL  190



>ref|XP_002291895.1| peptidyl-prolyl cis-trans isomerase; ppiase [Thalassiosira pseudonana 
CCMP1335]
 gb|EED90746.1| peptidyl-prolyl cis-trans isomerase; ppiase [Thalassiosira pseudonana 
CCMP1335]
Length=195

 Score =   230 bits (587),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE++G   GRIV+GLFG  VPKT ENFRALCTGEKG+GK GKPLHYKGSVFHR+IP+FM+
Sbjct  34   VEIEGAEGGRIVLGLFGDTVPKTVENFRALCTGEKGVGKRGKPLHYKGSVFHRVIPNFML  93

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+GRGGESIYGEKF DENF+LKH GP  LSMANAGP+TNGSQFFITTV T WL
Sbjct  94   QGGDFTDGNGRGGESIYGEKFADENFELKHEGPFYLSMANAGPNTNGSQFFITTVKTPWL  153

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFGKVL G D+V K+E  G  SG     + IADSGEL
Sbjct  154  DGRHVVFGKVLEGEDIVKKIEGFGSNSGATTKTITIADSGEL  195



>ref|XP_003115457.1| CRE-CYN-7 protein [Caenorhabditis remanei]
 gb|EFO99944.1| CRE-CYN-7 protein [Caenorhabditis remanei]
Length=171

 Score =   228 bits (582),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + GK  GRIV+ L+   VPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIP FMI
Sbjct  10   ISIGGKAVGRIVMELYADIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPDFMI  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFK KHTGPG+LSMANAGP+TNGSQFF+ TV T+WL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFGKV  GMDVV K+E  G  SG PK+ ++IAD G+L
Sbjct  130  DGKHVVFGKVSQGMDVVQKIETFGTDSGKPKADIVIADCGQL  171



>ref|XP_008028418.1| hypothetical protein SETTUDRAFT_164317 [Setosphaeria turcica 
Et28A]
 gb|EOA83983.1| hypothetical protein SETTUDRAFT_164317 [Setosphaeria turcica 
Et28A]
Length=171

 Score =   228 bits (581),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + ++ +PAGRIV+ LF   VPKTAENFRALCTGEKG+GKSGKPLHYKGS FHR+IP FM+
Sbjct  10   ITINNQPAGRIVMELFADKVPKTAENFRALCTGEKGVGKSGKPLHYKGSSFHRVIPQFML  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENF+L+HTGPG+LSMANAGP TNGSQFFI TV TSWL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFEDENFELRHTGPGILSMANAGPGTNGSQFFICTVKTSWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ GMDVV  VE +G  SG   + + IA+SG+L
Sbjct  130  DGKHVVFGQVVEGMDVVQAVERQGSGSGKTNAPITIANSGQL  171



>dbj|GAM18552.1| hypothetical protein SAMD00019534_017270 [Acytostelium subglobosum 
LB1]
Length=198

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DG   G+IV+GL+GK VPKT ENF+ALCTGEKG G+SGKPLH+KGS FHRIIP+FMI
Sbjct  37   IEIDGVNVGKIVMGLYGKTVPKTVENFKALCTGEKGTGQSGKPLHFKGSKFHRIIPNFMI  96

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDG GGESI+G+KF DENFKLKHT  GLLSMANAGP+TNGSQFFITT  TSWL
Sbjct  97   QGGDFTRGDGTGGESIFGKKFDDENFKLKHTKVGLLSMANAGPNTNGSQFFITTAITSWL  156

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFG+V+ GMD+V +VEA G QSGTP   V+I +SG +
Sbjct  157  DGRHVVFGEVVEGMDIVKQVEAVGSQSGTPSKTVVIVNSGAI  198



>gb|AAC47233.1| cyclophilin Ovcyp-2 [Onchocerca volvulus]
Length=171

 Score =   227 bits (579),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + G+ +GRIV+ LF   VPKTAENFRALCTGEKG+GKSGKPLHYKGS FHR+IP+FM 
Sbjct  10   ITIGGQQSGRIVMELFNDIVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRVIPNFMC  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFK KHTGPG+LSMANAGPDTNGSQFF+ TV T WL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFEDENFKEKHTGPGVLSMANAGPDTNGSQFFLCTVKTDWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ GMDVV K+EA G QSG     V++A+ G+L
Sbjct  130  DGKHVVFGRVVDGMDVVQKIEAVGSQSGKTSKDVVVANCGQL  171



>gb|EFA76366.1| cyclophilin-type peptidylprolyl cis-trans isomerase [Polysphondylium 
pallidum PN500]
Length=172

 Score =   227 bits (579),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + ++G P+GRI+  LF   VPKTAENFRALCTGEKGIGKSGKPLH+KGS FHRIIP+FM+
Sbjct  10   ITINGAPSGRIIFELFKDVVPKTAENFRALCTGEKGIGKSGKPLHFKGSSFHRIIPNFML  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKLKHTGPG+LSMANAGP+TNGSQFF+ TV T+WL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFADENFKLKHTGPGILSMANAGPNTNGSQFFVCTVETAWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+H VFGKV+ G+ +V ++E  G QSG P + V IAD G+L
Sbjct  130  DGKHTVFGKVVDGLPLVKEIEKRGSQSGKPSAVVTIADCGQL  171



>ref|XP_007701371.1| hypothetical protein COCSADRAFT_92320 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD63126.1| hypothetical protein COCSADRAFT_92320 [Bipolaris sorokiniana 
ND90Pr]
Length=171

 Score =   227 bits (579),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V + G+PAGR+V+ LF   VPKTAENFRALCTGEKG GKSGKPLHY+GSVFHR+IP FM+
Sbjct  10   VSIGGQPAGRVVMELFADQVPKTAENFRALCTGEKGTGKSGKPLHYQGSVFHRVIPQFML  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKL+HTGPG+LSMANAGP TNGSQFFI TV TSWL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFEDENFKLRHTGPGILSMANAGPGTNGSQFFICTVKTSWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ GMDVV  VE  G Q+G    +V I  SG+L
Sbjct  130  DGKHVVFGQVVEGMDVVQAVEKVGSQTGKTSKEVKIEKSGQL  171



>ref|XP_008878745.1| peptidyl-prolyl cis-trans isomerase [Aphanomyces invadans]
 gb|ETV92709.1| peptidyl-prolyl cis-trans isomerase [Aphanomyces invadans]
Length=202

 Score =   228 bits (582),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + G+ AGRIV+GL+GK VPKT ENFRALCTGEKG+GK+GK L YK S FHRIIP FMI
Sbjct  32   ITIGGRDAGRIVMGLYGKTVPKTVENFRALCTGEKGLGKTGKALWYKDSTFHRIIPDFMI  91

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G G GGESIYGEKF DENFKLKH G G LSMANAGP+TNGSQFFI TV TSWL
Sbjct  92   QGGDFTHGTGTGGESIYGEKFEDENFKLKHEGAGTLSMANAGPNTNGSQFFICTVKTSWL  151

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFG+V+SGMDVV  VE  G  SGTP  KV+I  SGEL
Sbjct  152  DGRHVVFGRVVSGMDVVKAVEKVGAGSGTPSQKVVIKASGEL  193



>gb|KFK34831.1| peptidyl-prolyl cis-trans isomerase [Arabis alpina]
Length=218

 Score =   228 bits (582),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 141/164 (86%), Gaps = 8/164 (5%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            ++++G PAGRI+IGLFGK VPKTA        GEKG+G +GKPL++KGS FHRIIPSFMI
Sbjct  63   IQINGSPAGRILIGLFGKTVPKTA--------GEKGVGNNGKPLYFKGSSFHRIIPSFMI  114

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT GDGRGGESIYG+KF DENFKLKHTGPG+LSMAN+GPD+NGSQFFITTVTT WL
Sbjct  115  QGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGVLSMANSGPDSNGSQFFITTVTTGWL  174

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DG HVVFGKVLSGM+VV K+EA+G  SG PK KVII DSGEL L
Sbjct  175  DGHHVVFGKVLSGMEVVRKIEAQGQSSGEPKGKVIILDSGELSL  218



>ref|XP_002638374.1| Hypothetical protein CBG18578 [Caenorhabditis briggsae]
 emb|CAP36000.1| Protein CBG18578 [Caenorhabditis briggsae]
Length=172

 Score =   227 bits (578),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + GK AGRIV+ L+   VPKTA+NFRALCTGEKG GKSGKPLH+KGS FHRIIP FMI
Sbjct  11   ISIGGKAAGRIVMELYNDIVPKTADNFRALCTGEKGTGKSGKPLHFKGSKFHRIIPDFMI  70

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFK KHTGPG+LSMANAGP+TNGSQFF+ TV T+WL
Sbjct  71   QGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWL  130

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V  GMD+V K+E+ G +SG PK+  +IAD G+L
Sbjct  131  DGKHVVFGRVTQGMDIVQKIESFGTESGKPKADCMIADCGQL  172



>ref|XP_001579633.1| cytosolic cyclophilin [Trichomonas vaginalis G3]
 gb|EAY18647.1| cytosolic cyclophilin, putative [Trichomonas vaginalis G3]
Length=186

 Score =   226 bits (577),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + ++G+ AG I  GLFG  VPKTAENFRALCTGEKG+GK GKPLHYKGS FHR+IP+FMI
Sbjct  23   ISINGEDAGTIKFGLFGDDVPKTAENFRALCTGEKGMGKLGKPLHYKGSPFHRVIPNFMI  82

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGD T G+G GGESIYG KF DE+FK+ H GPGLLSMAN+GP+TNGSQFFITTV   WL
Sbjct  83   QGGDITSGNGYGGESIYGSKFADESFKITHDGPGLLSMANSGPNTNGSQFFITTVPCPWL  142

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            +G+HVVFGKV+ GM++V K+E+ G QSGTPK+K+IIAD GE+
Sbjct  143  NGKHVVFGKVIEGMEIVKKIESLGSQSGTPKAKIIIADCGEI  184



>ref|XP_009520427.1| hypothetical protein PHYSODRAFT_285045 [Phytophthora sojae]
 gb|EGZ25139.1| hypothetical protein PHYSODRAFT_285045 [Phytophthora sojae]
Length=171

 Score =   226 bits (575),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = -1

Query  551  VDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMIQg  372
            V G PAGRI   LF   VPKTAENFRALCTGEKG+G+SGKPLHYKGS FHR+IP+FM QG
Sbjct  12   VGGAPAGRITFELFADKVPKTAENFRALCTGEKGVGRSGKPLHYKGSAFHRVIPNFMCQG  71

Query  371  gdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDG  192
            GDFT G+G GGESIYGEKF DENF LKH G G+LSMANAGP+TNGSQFFI TV TSWLDG
Sbjct  72   GDFTRGNGTGGESIYGEKFPDENFLLKHKGEGILSMANAGPNTNGSQFFICTVETSWLDG  131

Query  191  RHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            +HVVFG+V+ GMDVV  +EA G QSG  K  V+IA+ GEL
Sbjct  132  KHVVFGRVVDGMDVVKNIEAVGSQSGQTKKAVVIANCGEL  171



>emb|CDW53642.1| peptidyl prolyl cis trans isomerase 7 [Trichuris trichiura]
 gb|KFD48681.1| hypothetical protein M513_10465 [Trichuris suis]
 gb|KFD70668.1| hypothetical protein M514_10465 [Trichuris suis]
 gb|KHJ40438.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Trichuris 
suis]
Length=173

 Score =   226 bits (575),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + +  K AGRIVI LF   VP+TAENFR LCTGEKG+GK GKPLHYK S+FHRIIP+FM 
Sbjct  11   ISIGDKSAGRIVIELFSDVVPRTAENFRCLCTGEKGMGKLGKPLHYKDSIFHRIIPNFMC  70

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENF LKHTGPG LSMANAG +TNGSQFFITTV TSWL
Sbjct  71   QGGDFTRGNGTGGESIYGEKFADENFNLKHTGPGTLSMANAGANTNGSQFFITTVRTSWL  130

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFG V+ GMDVV  +EA+G  +GTPK +V I + G+L
Sbjct  131  DGRHVVFGAVVEGMDVVKNMEAQGTSNGTPKKEVKIVNCGQL  172



>ref|XP_003139210.1| cyclophilin Ovcyp-2 [Loa loa]
 gb|EFO24859.1| peptidyl-prolyl cis-trans isomerase 3 [Loa loa]
 gb|EJD75189.1| peptidyl-prolyl cis-trans isomerase 3, variant [Loa loa]
Length=171

 Score =   225 bits (574),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + G  +GRIV+ LF   VPKTAENFRALCTGEKGIGKSGKPLHYKGS FHR+IP+FM 
Sbjct  10   ITIGGNASGRIVMELFSDVVPKTAENFRALCTGEKGIGKSGKPLHYKGSKFHRVIPNFMC  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT  +G GGESIYGEKF DENFK KH GPG+LSMANAGP+TNGSQFF+ TV T WL
Sbjct  70   QGGDFTRSNGTGGESIYGEKFEDENFKEKHNGPGVLSMANAGPNTNGSQFFLCTVKTDWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ GMDVV K+EA G QSG     V++A+ G+L
Sbjct  130  DGKHVVFGRVVEGMDVVQKIEAVGSQSGKTSKDVVVANCGQL  171



>ref|XP_007692567.1| hypothetical protein COCMIDRAFT_30232 [Bipolaris oryzae ATCC 
44560]
 gb|EUC40922.1| hypothetical protein COCMIDRAFT_30232 [Bipolaris oryzae ATCC 
44560]
Length=171

 Score =   225 bits (573),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V + G+PAGRIV+ LF   VPKTAENFRALCTGEKG GKSGKPLHY+GSVFHR+IP FM+
Sbjct  10   VSIGGQPAGRIVMELFADQVPKTAENFRALCTGEKGTGKSGKPLHYQGSVFHRVIPQFML  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYG+KF DENFKL HTGPG+LSMANAGP TNGSQFFI TV TSWL
Sbjct  70   QGGDFTRGNGTGGESIYGDKFEDENFKLSHTGPGILSMANAGPGTNGSQFFICTVKTSWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFGKV+ G+DVV  VE  G Q+G    +V I  SG+L
Sbjct  130  DGKHVVFGKVVEGLDVVQAVEKVGSQTGKTSKEVKIEKSGQL  171



>gb|AAQ87931.1| Bet v 7-like protein [Curvularia lunata]
Length=171

 Score =   225 bits (573),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + G+PAGR+V+ LF   VPKTAENFRALCTGEKG GKSGKPLHY+GS FHR+IP FM+
Sbjct  10   ISIAGQPAGRVVMELFADKVPKTAENFRALCTGEKGTGKSGKPLHYEGSTFHRVIPQFML  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENF LKHTGPG+LSMANAGP+TNGSQFFI TV TSWL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFEDENFALKHTGPGVLSMANAGPNTNGSQFFICTVKTSWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ GMDVV  VE  G QSG     V I  SG+L
Sbjct  130  DGKHVVFGQVVEGMDVVQAVEKVGSQSGQTSKPVKIEKSGQL  171



>ref|XP_009829338.1| peptidyl-prolyl cis-trans isomerase [Aphanomyces astaci]
 gb|ETV81480.1| peptidyl-prolyl cis-trans isomerase [Aphanomyces astaci]
Length=202

 Score =   226 bits (576),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + G  AGRIV+GL+GK+VPKT ENFRALCTGEKG+GK+GK L YK S FHRIIP FMI
Sbjct  32   ISIGGHNAGRIVMGLYGKSVPKTVENFRALCTGEKGLGKTGKALWYKDSTFHRIIPDFMI  91

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G G GGESIYGEKF DENFKLKH GPG LSMANAGP+TNGSQFFI TV TSWL
Sbjct  92   QGGDFTHGTGTGGESIYGEKFEDENFKLKHEGPGTLSMANAGPNTNGSQFFICTVKTSWL  151

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFG+V+SG+DVV  VE+ G  SGTP   V I  SGEL
Sbjct  152  DGRHVVFGRVISGLDVVKAVESVGAGSGTPSQTVTIKASGEL  193



>emb|CDJ82690.1| Peptidyl-prolyl cis-trans isomerase domain containing protein 
[Haemonchus contortus]
Length=171

 Score =   225 bits (573),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + GK +GRIV+ L+   VPKTAENFRALCTGEKG+GKSGKPLHYKG  FHRIIP+FMI
Sbjct  10   ITIGGKASGRIVMELYSDIVPKTAENFRALCTGEKGMGKSGKPLHYKGCKFHRIIPNFMI  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFK +HTGPG+LSMANAGP+TNGSQFF+ TV T WL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFPDENFKERHTGPGVLSMANAGPNTNGSQFFLCTVKTEWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V  GMDVV  VE+ G QSG P    +IAD G+L
Sbjct  130  DGKHVVFGRVTEGMDVVKLVESHGSQSGKPSKDCVIADCGQL  171



>emb|CBK20464.2| Peptidyl-prolyl cis-trans isomerase [Blastocystis hominis]
Length=202

 Score =   226 bits (575),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E+DG+  GRIV+GLFG+  P+T ENFRALCTGEKGIG+SG PLHYKG+VFHRIIP  MI
Sbjct  41   IEIDGQKVGRIVMGLFGRTAPRTVENFRALCTGEKGIGRSGMPLHYKGTVFHRIIPHLMI  100

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGD T G+G GGESIYG +F +ENF++KH GPGLLSM N+GP+ NGSQFFITTV   WL
Sbjct  101  QGGDITAGNGTGGESIYGHRFPNENFRMKHVGPGLLSMVNSGPNANGSQFFITTVKAQWL  160

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            D RHVVFG+V+ GM +V  +EA G  +GTP  KV+IADSGEL
Sbjct  161  DRRHVVFGRVIEGMKIVKMIEALGTGNGTPLKKVVIADSGEL  202



>gb|KHJ92301.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Oesophagostomum 
dentatum]
Length=196

 Score =   225 bits (574),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + GK +GRIV+ L+   VPKTAENFRALCTGEKG+GKSGKPLH+KG  FHRIIP+FMI
Sbjct  35   ITIGGKASGRIVMELYSDIVPKTAENFRALCTGEKGMGKSGKPLHFKGCKFHRIIPNFMI  94

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFK +HTGPG+LSMANAGP+TNGSQFF+ TV T WL
Sbjct  95   QGGDFTRGNGTGGESIYGEKFPDENFKERHTGPGVLSMANAGPNTNGSQFFLCTVKTEWL  154

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ GMDVV  +E+ G QSG P    +IAD G+L
Sbjct  155  DGKHVVFGRVIEGMDVVKAIESHGSQSGKPSKDCVIADCGQL  196



>gb|EGT45232.1| CBN-CYN-7 protein [Caenorhabditis brenneri]
Length=171

 Score =   224 bits (571),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + GK AGRIV+ L+   VPKTA NFRALCTGEKG+GK GKPLH+KGS FHRIIP FMI
Sbjct  10   ISIGGKAAGRIVMELYDDIVPKTAANFRALCTGEKGVGKEGKPLHFKGSKFHRIIPDFMI  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENF+ KHTGPG+LSMANAGP+TNGSQFF+ TV T+WL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFPDENFREKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V  GMD+V K+E+ G +SG PK+  +IAD G+L
Sbjct  130  DGKHVVFGRVTQGMDIVKKIESFGSESGKPKADCVIADCGQL  171



>gb|ETN78289.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Necator 
americanus]
Length=171

 Score =   224 bits (571),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + GK +GRIV+ L+   VPKTAENFRALCTGEKG+GKSGKPLH+KG  FHRIIP+FMI
Sbjct  10   ITIGGKASGRIVMELYSDIVPKTAENFRALCTGEKGMGKSGKPLHFKGCKFHRIIPNFMI  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFK +HTGPG+LSMANAGP+TNGSQFF+ TV T WL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFPDENFKERHTGPGVLSMANAGPNTNGSQFFLCTVKTEWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ GMDVV  +E+ G QSG P    +IAD G+L
Sbjct  130  DGKHVVFGRVIEGMDVVKTIESHGSQSGKPSKDCVIADCGQL  171



>ref|XP_002632172.1| Hypothetical protein CBG07031 [Caenorhabditis briggsae]
 emb|CAP27313.1| Protein CBG07031 [Caenorhabditis briggsae]
Length=172

 Score =   224 bits (571),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + G+PAGRIV+ L+   VPKTAENFRALCTGEKGIGKSGKPLH+KGS FHRIIP+FMI
Sbjct  10   ITIGGRPAGRIVMELYTDVVPKTAENFRALCTGEKGIGKSGKPLHFKGSKFHRIIPNFMI  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFK  H GPG+LSMANAGP+TNGSQFF+ TV T WL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFPDENFKETHVGPGVLSMANAGPNTNGSQFFLCTVKTEWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V  GMD+V  +E+ G QSG P  +  IAD G+L
Sbjct  130  DGKHVVFGRVKEGMDIVQSIESNGSQSGKPLQECAIADCGQL  171



>ref|XP_007714724.1| hypothetical protein COCCADRAFT_102503 [Bipolaris zeicola 26-R-13]
 gb|EUC30988.1| hypothetical protein COCCADRAFT_102503 [Bipolaris zeicola 26-R-13]
 gb|EUN26048.1| hypothetical protein COCVIDRAFT_102007 [Bipolaris victoriae FI3]
Length=171

 Score =   224 bits (571),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V + G+PAGRIV+ L+   VPKTAENFRALCTGEKG GKSGKPLHY+GSVFHR+IP FM+
Sbjct  10   VSIGGQPAGRIVMELYADKVPKTAENFRALCTGEKGTGKSGKPLHYEGSVFHRVIPQFML  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENF L+HTGPG+LSMANAGP TNGSQFFI TV TSWL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFEDENFNLRHTGPGVLSMANAGPGTNGSQFFICTVKTSWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ GMDVV  VE  G Q+G    +V I  SG+L
Sbjct  130  DGKHVVFGQVVEGMDVVQAVEKVGSQTGKTSKEVKIEKSGQL  171



>gb|KHJ83952.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Oesophagostomum 
dentatum]
Length=196

 Score =   225 bits (573),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V++   PAG+I I LF   VPKTAENFRALCTGEKGIGKSGKPLHYKGS FHRIIP FMI
Sbjct  30   VKIGENPAGKITIELFNDVVPKTAENFRALCTGEKGIGKSGKPLHYKGSAFHRIIPEFMI  89

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFTLGDGRGGESIYG KF DENFK+KHTG G++SMANAGPDTNGSQFFI T  T WL
Sbjct  90   QGGDFTLGDGRGGESIYGHKFEDENFKMKHTGVGVVSMANAGPDTNGSQFFICTADTPWL  149

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V  G+ VV K+E+ G +SG PK KV+I+D GE+
Sbjct  150  DGKHVVFGQVTDGLSVVKKIESMGSRSGRPKEKVVISDCGEI  191



>dbj|GAM29016.1| hypothetical protein SAMD00019534_121920 [Acytostelium subglobosum 
LB1]
Length=171

 Score =   224 bits (571),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +E +GK  GRI+  L    VPKTAENFR+LCTGEKG+GKSGKPLHYKG VFHRIIP+FMI
Sbjct  10   IESNGKNLGRIIFELHADVVPKTAENFRSLCTGEKGVGKSGKPLHYKGCVFHRIIPNFMI  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKL+HT PGLLSMANAGP+TNGSQFFITTV  +WL
Sbjct  70   QGGDFTKGNGTGGESIYGEKFNDENFKLRHTTPGLLSMANAGPNTNGSQFFITTVECAWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            D +H VFGKV+ GM+VV  +E++G QSG    K++I+D G+L
Sbjct  130  DNKHTVFGKVIEGMNVVKAMESKGSQSGKTAEKILISDCGQL  171



>ref|WP_014393514.1| peptidylprolyl isomerase [Corallococcus coralloides]
 gb|AFE09954.1| peptidyl-prolyl cis-trans isomerase [Corallococcus coralloides 
DSM 2259]
Length=171

 Score =   224 bits (570),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + G+PAGRIV+ LF   VPKTAENFRALCTGEKG+GKSGK LH+KG+ FHR+IP+FM 
Sbjct  10   MSIGGQPAGRIVMELFSDDVPKTAENFRALCTGEKGVGKSGKALHFKGTPFHRVIPNFMC  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGD TLG+G GGESIYGEKF DENFK KHTGPG+LSMANAGP++NGSQFF+TTV T WL
Sbjct  70   QGGDITLGNGYGGESIYGEKFADENFKHKHTGPGILSMANAGPNSNGSQFFLTTVKTDWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFGKV+ GMDVV K+E  G QSG  +  V I DSG+L
Sbjct  130  DGKHVVFGKVVEGMDVVKKIEGVGSQSGATRQPVKIEDSGQL  171



>gb|KDD76700.1| cyclophilin type peptidyl-prolyl cis-trans isomerase [Helicosporidium 
sp. ATCC 50920]
Length=225

 Score =   226 bits (575),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 139/178 (78%), Gaps = 16/178 (9%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V +DG+ AGRIV+GL+GK VPKTAENFRAL TGEKG+GK GKPLH+KGS FHRIIP+FM+
Sbjct  36   VTIDGESAGRIVMGLYGKTVPKTAENFRALATGEKGMGKLGKPLHFKGSKFHRIIPNFML  95

Query  377  QggdftlgdgrgGESIYGEKF----------------XDENFKLKHTGPGLLSMANAGPD  246
            QGGDFT GDG GGESIYG KF                 DENFKLKHT PG LSMANAGP+
Sbjct  96   QGGDFTNGDGTGGESIYGTKFQARRWTAAPGAQLQCCADENFKLKHTKPGQLSMANAGPN  155

Query  245  TNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            TNGSQFFITTV T WL+GRHVVFG+VLSGMDVV  VE  G QSG P  +VI+AD GEL
Sbjct  156  TNGSQFFITTVKTDWLNGRHVVFGRVLSGMDVVRAVEKIGSQSGKPSKEVIVADCGEL  213



>ref|XP_008220814.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Prunus 
mume]
Length=182

 Score =   224 bits (570),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 133/164 (81%), Gaps = 22/164 (13%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            VE+ GKPAGR+VIGLFGK VPKTAENFRALCTG +       PL ++G            
Sbjct  41   VEIAGKPAGRVVIGLFGKTVPKTAENFRALCTGNQ-------PLIFRGDF----------  83

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
                 TLGDGRGGESIYGEKF DENFKLKHTGPGLLSMANAG DTNGSQFFITTVTT+WL
Sbjct  84   -----TLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGSDTNGSQFFITTVTTNWL  138

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            DGRHVVFGKVLSGMDVVYK+EAEG Q+GTPKSKV+IADSGELPL
Sbjct  139  DGRHVVFGKVLSGMDVVYKIEAEGNQNGTPKSKVVIADSGELPL  182



>gb|AIG55930.1| secreted protein [Achlya hypogyna]
Length=205

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +++  + AGRIV+GL+GK  PKT ENFRALCTGEKG G  GKPL YK S FHRIIP FMI
Sbjct  35   IKIGNRDAGRIVMGLYGKTTPKTVENFRALCTGEKGTGTKGKPLWYKDSAFHRIIPDFMI  94

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G G GGESIYG++F DENFKLKH GPG LSMANAGP++NGSQFFI TV TSWL
Sbjct  95   QGGDFTHGTGTGGESIYGDRFDDENFKLKHEGPGTLSMANAGPNSNGSQFFICTVKTSWL  154

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFG+V+SGMDVV  VE  G  SGTP  +V IA+SGEL
Sbjct  155  DGRHVVFGRVISGMDVVKAVEKVGSGSGTPSERVTIANSGEL  196



>ref|XP_004254113.1| peptidyl-prolyl cis-trans isomerase CYP20-1 precursor, putative 
[Entamoeba invadens IP1]
 gb|ELP87342.1| peptidyl-prolyl cis-trans isomerase CYP20-1 precursor, putative 
[Entamoeba invadens IP1]
Length=196

 Score =   224 bits (571),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  542  KPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMIQggdf  363
            + A RIV+GL+GK VPKT ENFRALCTGEKG+GKSGKPL YKGS+FHR+IP FMIQGGDF
Sbjct  34   ETAHRIVMGLYGKTVPKTVENFRALCTGEKGLGKSGKPLSYKGSIFHRVIPGFMIQGGDF  93

Query  362  tlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHV  183
            T  DG GGESIYGEKF DENFKL+HT  G+LSMANAG DTNGSQFFIT VTT+WLDGRHV
Sbjct  94   TNFDGTGGESIYGEKFADENFKLRHTKKGILSMANAGKDTNGSQFFITLVTTAWLDGRHV  153

Query  182  VFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGELPL  66
            VFG+V+ G+D+V K+ A G QSG    KV I  SGELP+
Sbjct  154  VFGEVIEGLDIVDKIAAVGSQSGKTSQKVTIIASGELPM  192



>gb|ETP48268.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
P10297]
Length=159

 Score =   223 bits (568),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -1

Query  521  IGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMIQggdftlgdgrg  342
            +GL+GK VPKTAENFRALCTGEKG+GKSGKPLHYK S+FHRIIP+FM+QGGDFT  +G G
Sbjct  1    MGLYGKTVPKTAENFRALCTGEKGVGKSGKPLHYKDSIFHRIIPNFMVQGGDFTNFNGMG  60

Query  341  GESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLS  162
            GESIYGEKF DENFKLKH G G LSMAN+G +TNGSQFFI TV TSWLDGRHVVFG+V+ 
Sbjct  61   GESIYGEKFPDENFKLKHAGKGTLSMANSGANTNGSQFFICTVKTSWLDGRHVVFGRVIK  120

Query  161  GMDVVYKVEAEGMQSGTPKSKVIIADSGELPL*GFLAE  48
            GMDV+  +EA G  SGTP  KV++ +SGEL    F+ E
Sbjct  121  GMDVLDAIEAVGSPSGTPSKKVVVTESGELAADNFVEE  158



>ref|XP_008915854.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
INRA-310]
 gb|ACR82293.1| cyclophilin A [Phytophthora nicotianae]
 gb|ETI55135.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
P1569]
 gb|ETK94967.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica]
 gb|ETL48352.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica]
 gb|ETM01450.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica]
 gb|ETM54648.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica]
 gb|ETM98851.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
INRA-310]
 gb|ETO83875.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
P1976]
 gb|ETP24947.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
CJ01A1]
 gb|ETP52938.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
P10297]
Length=171

 Score =   223 bits (568),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = -1

Query  551  VDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMIQg  372
            V G PAGRI   LF   VPKTAENFRALCTGEKG+G+SGKPLHYKGS FHR+IP+FM QG
Sbjct  12   VGGAPAGRITFELFADKVPKTAENFRALCTGEKGVGRSGKPLHYKGSAFHRVIPNFMCQG  71

Query  371  gdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDG  192
            GDFT G+G GGESIYGEKF DENF LKH G G+LSMANAGP+TNGSQFFI TV TSWLDG
Sbjct  72   GDFTRGNGTGGESIYGEKFPDENFLLKHKGEGILSMANAGPNTNGSQFFICTVETSWLDG  131

Query  191  RHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            +HVVFG+V+ GMDVV  +E+ G QSG  K  V++A+ GEL
Sbjct  132  KHVVFGRVVEGMDVVKAIESVGSQSGQTKKPVVVANCGEL  171



>gb|KHN80348.1| Peptidyl-prolyl cis-trans isomerase 3 [Toxocara canis]
Length=172

 Score =   223 bits (568),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + GK AGRIV+ LF   VP+TAENFRALCTGEKG+GKSGKPLHYKGS FHR+IP+FM 
Sbjct  10   ITIGGKAAGRIVMELFSDIVPRTAENFRALCTGEKGVGKSGKPLHYKGSKFHRVIPNFMC  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFK KHTGPG+LSMANAGP+TNGSQFF+ TV T WL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFDDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTDWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V  GM+VV ++E+ G Q+G     V+IAD G+L
Sbjct  130  DGKHVVFGRVTEGMNVVKEIESVGSQNGKTSRDVVIADCGQL  171



>gb|AEP37836.1| cyclophilin a [Plasmopara viticola]
Length=171

 Score =   223 bits (567),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = -1

Query  551  VDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMIQg  372
            V G PAGRI   LF   VPKTAENFRALCTGEKG+G+SGKPLHYKGS FHR+IP+FM QG
Sbjct  12   VGGAPAGRITFELFADKVPKTAENFRALCTGEKGVGRSGKPLHYKGSAFHRVIPNFMCQG  71

Query  371  gdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDG  192
            GDFT G+G GGESIYGEKF DENF LKH G G+LSMANAGP+TNGSQFFI TV TSWLDG
Sbjct  72   GDFTRGNGTGGESIYGEKFPDENFVLKHKGEGILSMANAGPNTNGSQFFICTVETSWLDG  131

Query  191  RHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            +HVVFG+V+ GM VV  +EA G QSG  K  V++AD G+L
Sbjct  132  KHVVFGRVVDGMKVVKDIEAVGSQSGQTKKPVVVADCGQL  171



>gb|EMD94092.1| hypothetical protein COCHEDRAFT_1201904 [Bipolaris maydis C5]
 gb|ENI07606.1| hypothetical protein COCC4DRAFT_30972 [Bipolaris maydis ATCC 
48331]
Length=171

 Score =   223 bits (567),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V + G PAGRIV+ L+   VPKTAENFRALCTGEKG GKSGKPLHY+GSVFHR+IP FM+
Sbjct  10   VSIGGDPAGRIVMELYADKVPKTAENFRALCTGEKGTGKSGKPLHYEGSVFHRVIPQFML  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFKL HTGPG+LSMANAGP TNGSQFFI TV TSWL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFEDENFKLSHTGPGVLSMANAGPGTNGSQFFICTVKTSWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ GMDVV  VE  G Q+G     V I  SG+L
Sbjct  130  DGKHVVFGQVVEGMDVVQAVEKVGSQTGKTSKVVKIEKSGQL  171



>ref|XP_002638373.1| C. briggsae CBR-CYN-3 protein [Caenorhabditis briggsae]
 emb|CAP35999.1| Protein CBR-CYN-3 [Caenorhabditis briggsae]
Length=171

 Score =   223 bits (567),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            + + GK +GRIV+ L+   VP TAENFRALCTGEKG GKSGKPLH+KGS FHRIIP+FMI
Sbjct  10   ITIGGKASGRIVMELYNDIVPNTAENFRALCTGEKGTGKSGKPLHFKGSKFHRIIPNFMI  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFK KHTGPG+LSMANAGP+TNGSQFF+ TV T WL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ GMDVV  VE+ G QSG P     IAD G+L
Sbjct  130  DGKHVVFGRVVEGMDVVKAVESNGSQSGKPLKDCAIADCGQL  171



>ref|XP_008604422.1| peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [Saprolegnia 
diclina VS20]
 gb|EQC41853.1| peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [Saprolegnia 
diclina VS20]
Length=203

 Score =   224 bits (570),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +++  + AGR+V+GL+GK  PKT ENFRALCTGEKG G  GKPL YK S FHRIIP FMI
Sbjct  33   IKIGNRDAGRVVMGLYGKTTPKTVENFRALCTGEKGTGTKGKPLWYKDSAFHRIIPDFMI  92

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G G GGESIYG++F DENFKLKH GPG LSMANAGP++NGSQFFI TV TSWL
Sbjct  93   QGGDFTHGTGTGGESIYGDRFDDENFKLKHEGPGTLSMANAGPNSNGSQFFICTVKTSWL  152

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DGRHVVFG+V+SGMDVV  VE  G  SGTP  +V IA+SGEL
Sbjct  153  DGRHVVFGRVISGMDVVKAVEKIGSGSGTPSERVTIANSGEL  194



>gb|ERG80132.1| peptidyl-prolyl cis-trans isomerase 3 [Ascaris suum]
Length=199

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V + GK AGRIV+ LF   VPKTAENFR LCTGE+G+GKSGKPL YKGS FHR+IP+FM+
Sbjct  38   VTIGGKGAGRIVMELFSDIVPKTAENFRCLCTGERGMGKSGKPLTYKGSKFHRVIPNFML  97

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENF+ KHTGPG+LSMANAGP+TNGSQFFI TV T WL
Sbjct  98   QGGDFTRGNGTGGESIYGEKFADENFQEKHTGPGVLSMANAGPNTNGSQFFICTVKTEWL  157

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ GMDVV  +EA+G QSG   + ++IAD G+L
Sbjct  158  DGKHVVFGRVVEGMDVVKAIEAKGSQSGKTSTDIVIADCGQL  199



>ref|NP_001289049.1| peptidyl-prolyl cis-trans isomerase CYP18-3 [Brassica rapa]
 gb|AHV84999.1| peptidylprolyl isomerase [Brassica rapa]
 emb|CDY12100.1| BnaC03g60160D [Brassica napus]
 emb|CDX90292.1| BnaA08g16920D [Brassica napus]
Length=172

 Score =   222 bits (566),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = -1

Query  551  VDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMIQg  372
            VDGKPAGRIV+ L+    PKTAENFRALCTGEKG+G  GKPLH+KGS FHR+IP+FM QG
Sbjct  12   VDGKPAGRIVMELYTDKTPKTAENFRALCTGEKGVGSKGKPLHFKGSSFHRVIPNFMCQG  71

Query  371  gdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDG  192
            GDFT G+G GGESIYGEKF DENF+ KHTGPG+LSMANAGP+TNGSQFFI TV T WLDG
Sbjct  72   GDFTAGNGTGGESIYGEKFADENFERKHTGPGILSMANAGPNTNGSQFFICTVKTDWLDG  131

Query  191  RHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            +HVVFG+V+ G+DVV  +E  G  SG P   V++AD G+L
Sbjct  132  KHVVFGQVVEGLDVVKAIEKVGSASGKPSKPVVVADCGQL  171



>ref|XP_002591341.1| hypothetical protein BRAFLDRAFT_216533 [Branchiostoma floridae]
 gb|EEN47352.1| hypothetical protein BRAFLDRAFT_216533, partial [Branchiostoma 
floridae]
Length=172

 Score =   222 bits (566),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            V + G PAGRIV  L    VP+TAENF +LCTGE+GIG+SGKPLHYKGS FHR+IP+FM 
Sbjct  6    VTIGGVPAGRIVFELRFDVVPRTAENFLSLCTGERGIGQSGKPLHYKGSRFHRVIPNFMA  65

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT  DG GGESIYGE F DENF L HTGPG+LSMANAGPDTNGSQFFIT V T+WL
Sbjct  66   QGGDFTTEDGMGGESIYGEDFADENFVLNHTGPGVLSMANAGPDTNGSQFFITFVVTAWL  125

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFG+V+ GMDV+Y++EA G QSG     VIIADSG L
Sbjct  126  DGKHVVFGRVVEGMDVLYQIEAVGSQSGATSKDVIIADSGHL  167



>ref|XP_001700372.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Chlamydomonas 
reinhardtii]
 gb|EDO98214.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Chlamydomonas 
reinhardtii]
Length=172

 Score =   222 bits (566),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  557  VEVDGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSVFHRIIPSFMI  378
            +  DG P GRI + L+   VPKTAENFRALCTGEKG+G+SGKPLH+KGS FHR+IP+FM 
Sbjct  10   ITADGAPVGRIEMELYADDVPKTAENFRALCTGEKGVGRSGKPLHFKGSTFHRVIPNFMC  69

Query  377  QggdftlgdgrgGESIYGEKFXDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWL  198
            QGGDFT G+G GGESIYGEKF DENFK +HTGPG+LSMANAGP+TNGSQFF+ TV T+WL
Sbjct  70   QGGDFTRGNGTGGESIYGEKFPDENFKHRHTGPGVLSMANAGPNTNGSQFFLCTVETAWL  129

Query  197  DGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVIIADSGEL  72
            DG+HVVFGKV  GMDVV KVE  G  SG  ++ + IAD G+L
Sbjct  130  DGKHVVFGKVCKGMDVVKKVEGYGSSSGKTRATIAIADCGQL  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800