BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF041E16

Length=610
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACJ85808.1|  unknown                                                 149   9e-42   Medicago truncatula
ref|XP_009760349.1|  PREDICTED: probable pectin methyltransferase...    157   3e-41   Nicotiana sylvestris
gb|KJB64256.1|  hypothetical protein B456_010G039800                    157   5e-41   Gossypium raimondii
ref|XP_007018751.1|  S-adenosyl-L-methionine-dependent methyltran...    157   5e-41   
ref|XP_007018750.1|  S-adenosyl-L-methionine-dependent methyltran...    157   5e-41   
gb|KHG28112.1|  putative pectin methyltransferase QUA2 -like protein    157   6e-41   Gossypium arboreum [tree cotton]
gb|KJB64260.1|  hypothetical protein B456_010G039800                    157   7e-41   Gossypium raimondii
ref|XP_009629595.1|  PREDICTED: probable pectin methyltransferase...    157   8e-41   Nicotiana tomentosiformis
ref|XP_006367734.1|  PREDICTED: probable pectin methyltransferase...    156   8e-41   Solanum tuberosum [potatoes]
ref|XP_010269315.1|  PREDICTED: probable pectin methyltransferase...    156   9e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010098612.1|  putative pectin methyltransferase QUA2             156   9e-41   Morus notabilis
ref|XP_006581532.1|  PREDICTED: probable pectin methyltransferase...    156   1e-40   Glycine max [soybeans]
gb|KDP41393.1|  hypothetical protein JCGZ_15800                         156   1e-40   Jatropha curcas
gb|KHN08942.1|  Putative pectin methyltransferase QUA2                  156   1e-40   Glycine soja [wild soybean]
gb|KHN19772.1|  Putative pectin methyltransferase QUA2                  156   1e-40   Glycine soja [wild soybean]
ref|XP_003522790.1|  PREDICTED: probable pectin methyltransferase...    156   1e-40   Glycine max [soybeans]
ref|XP_003542374.1|  PREDICTED: probable pectin methyltransferase...    155   2e-40   Glycine max [soybeans]
gb|KEH34953.1|  pectin methyltransferase QUA2, putative                 155   3e-40   Medicago truncatula
ref|XP_010320179.1|  PREDICTED: probable pectin methyltransferase...    154   7e-40   Solanum lycopersicum
ref|XP_007141184.1|  hypothetical protein PHAVU_008G174000g             154   8e-40   Phaseolus vulgaris [French bean]
ref|XP_002513934.1|  S-adenosylmethionine-dependent methyltransfe...    153   9e-40   
ref|XP_004500638.1|  PREDICTED: probable pectin methyltransferase...    153   1e-39   
ref|XP_004500637.1|  PREDICTED: probable pectin methyltransferase...    152   2e-39   Cicer arietinum [garbanzo]
gb|KDO80998.1|  hypothetical protein CISIN_1g005417mg                   150   3e-39   Citrus sinensis [apfelsine]
ref|XP_010269316.1|  PREDICTED: probable pectin methyltransferase...    152   3e-39   Nelumbo nucifera [Indian lotus]
ref|XP_002285784.1|  PREDICTED: probable pectin methyltransferase...    152   3e-39   Vitis vinifera
ref|XP_003544795.1|  PREDICTED: probable pectin methyltransferase...    152   4e-39   Glycine max [soybeans]
gb|KHG17567.1|  putative pectin methyltransferase QUA2 -like protein    152   5e-39   Gossypium arboreum [tree cotton]
ref|XP_006472587.1|  PREDICTED: probable pectin methyltransferase...    151   6e-39   Citrus sinensis [apfelsine]
gb|KDO80995.1|  hypothetical protein CISIN_1g005417mg                   151   6e-39   Citrus sinensis [apfelsine]
ref|XP_002302304.2|  hypothetical protein POPTR_0002s09820g             151   7e-39   Populus trichocarpa [western balsam poplar]
ref|XP_006472585.1|  PREDICTED: probable pectin methyltransferase...    151   7e-39   Citrus sinensis [apfelsine]
gb|KDO80996.1|  hypothetical protein CISIN_1g005417mg                   151   8e-39   Citrus sinensis [apfelsine]
ref|XP_006433967.1|  hypothetical protein CICLE_v10000463mg             151   8e-39   Citrus clementina [clementine]
ref|XP_002306569.2|  hypothetical protein POPTR_0005s17180g             151   8e-39   
gb|KHN13350.1|  Putative pectin methyltransferase QUA2                  150   1e-38   Glycine soja [wild soybean]
gb|KJB59919.1|  hypothetical protein B456_009G280800                    149   3e-38   Gossypium raimondii
gb|KJB59031.1|  hypothetical protein B456_009G236100                    149   3e-38   Gossypium raimondii
gb|KJB59914.1|  hypothetical protein B456_009G280800                    149   4e-38   Gossypium raimondii
gb|KJB59915.1|  hypothetical protein B456_009G280800                    149   4e-38   Gossypium raimondii
ref|XP_003615127.1|  hypothetical protein MTR_5g064080                  149   4e-38   Medicago truncatula
gb|KJB59918.1|  hypothetical protein B456_009G280800                    149   4e-38   Gossypium raimondii
gb|KJB59030.1|  hypothetical protein B456_009G236100                    149   4e-38   Gossypium raimondii
ref|XP_010060014.1|  PREDICTED: probable pectin methyltransferase...    149   5e-38   
ref|XP_010267469.1|  PREDICTED: probable pectin methyltransferase...    148   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_011016595.1|  PREDICTED: probable pectin methyltransferase...    147   2e-37   Populus euphratica
ref|XP_011074193.1|  PREDICTED: probable pectin methyltransferase...    147   3e-37   Sesamum indicum [beniseed]
ref|XP_004490695.1|  PREDICTED: probable pectin methyltransferase...    145   1e-36   Cicer arietinum [garbanzo]
ref|XP_011003042.1|  PREDICTED: probable pectin methyltransferase...    145   2e-36   Populus euphratica
ref|XP_008466224.1|  PREDICTED: probable pectin methyltransferase...    144   2e-36   Cucumis melo [Oriental melon]
ref|XP_009372838.1|  PREDICTED: probable pectin methyltransferase...    145   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_010926316.1|  PREDICTED: probable pectin methyltransferase...    144   2e-36   Elaeis guineensis
ref|XP_004136285.1|  PREDICTED: probable pectin methyltransferase...    144   2e-36   Cucumis sativus [cucumbers]
ref|XP_010926317.1|  PREDICTED: probable pectin methyltransferase...    144   2e-36   Elaeis guineensis
ref|XP_011100984.1|  PREDICTED: probable pectin methyltransferase...    144   2e-36   Sesamum indicum [beniseed]
ref|XP_004300652.1|  PREDICTED: probable pectin methyltransferase...    144   3e-36   Fragaria vesca subsp. vesca
ref|XP_008219451.1|  PREDICTED: probable pectin methyltransferase...    144   3e-36   Prunus mume [ume]
ref|XP_007225175.1|  hypothetical protein PRUPE_ppa002227mg             144   3e-36   Prunus persica
ref|XP_008372670.1|  PREDICTED: probable pectin methyltransferase...    140   5e-35   
ref|XP_009380861.1|  PREDICTED: probable pectin methyltransferase...    139   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009334340.1|  PREDICTED: probable pectin methyltransferase...    140   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_008781887.1|  PREDICTED: probable pectin methyltransferase...    139   1e-34   Phoenix dactylifera
ref|XP_009334333.1|  PREDICTED: probable pectin methyltransferase...    140   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_008383924.1|  PREDICTED: probable pectin methyltransferase...    139   2e-34   Malus domestica [apple tree]
ref|XP_010535445.1|  PREDICTED: probable pectin methyltransferase...    139   2e-34   Tarenaya hassleriana [spider flower]
ref|XP_010676338.1|  PREDICTED: probable pectin methyltransferase...    138   2e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676321.1|  PREDICTED: probable pectin methyltransferase...    138   3e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008790889.1|  PREDICTED: probable pectin methyltransferase...    136   5e-34   
emb|CDP01069.1|  unnamed protein product                                137   1e-33   Coffea canephora [robusta coffee]
ref|XP_006649061.1|  PREDICTED: probable pectin methyltransferase...    135   1e-33   
ref|XP_010939668.1|  PREDICTED: probable pectin methyltransferase...    136   1e-33   Elaeis guineensis
dbj|BAJ94920.1|  predicted protein                                      136   2e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT33652.1|  hypothetical protein F775_26112                         135   2e-33   
ref|XP_008790887.1|  PREDICTED: probable pectin methyltransferase...    136   2e-33   Phoenix dactylifera
dbj|BAJ86389.1|  predicted protein                                      136   2e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009387117.1|  PREDICTED: probable pectin methyltransferase...    136   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY87574.1|  hypothetical protein OsI_08986                          135   2e-33   Oryza sativa Indica Group [Indian rice]
dbj|BAD17245.1|  putative early-responsive to dehydration stress ...    135   2e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ24662.1|  hypothetical protein OsJ_08431                          135   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010937423.1|  PREDICTED: probable pectin methyltransferase...    135   3e-33   Elaeis guineensis
ref|XP_004953963.1|  PREDICTED: probable pectin methyltransferase...    135   3e-33   
ref|XP_009409275.1|  PREDICTED: probable pectin methyltransferase...    135   3e-33   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX88430.1|  BnaC06g38740D                                          135   4e-33   
ref|XP_010521185.1|  PREDICTED: probable pectin methyltransferase...    134   9e-33   Tarenaya hassleriana [spider flower]
ref|XP_010680526.1|  PREDICTED: probable pectin methyltransferase...    134   1e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008811174.1|  PREDICTED: probable pectin methyltransferase...    134   1e-32   Phoenix dactylifera
ref|XP_010916838.1|  PREDICTED: probable pectin methyltransferase...    133   1e-32   Elaeis guineensis
ref|XP_006390005.1|  hypothetical protein EUTSA_v10018220mg             134   2e-32   Eutrema salsugineum [saltwater cress]
emb|CDX87461.1|  BnaA07g34120D                                          133   2e-32   
ref|XP_009106531.1|  PREDICTED: probable pectin methyltransferase...    133   2e-32   Brassica rapa
emb|CDY14622.1|  BnaC02g24910D                                          132   4e-32   Brassica napus [oilseed rape]
ref|XP_002452533.1|  hypothetical protein SORBIDRAFT_04g027500          132   4e-32   
ref|NP_001288873.1|  probable pectin methyltransferase QUA2             132   4e-32   Brassica rapa
ref|XP_009128288.1|  PREDICTED: probable pectin methyltransferase...    132   4e-32   Brassica rapa
emb|CDY26858.1|  BnaA02g18830D                                          132   4e-32   Brassica napus [oilseed rape]
ref|XP_006300626.1|  hypothetical protein CARUB_v10019895mg             132   5e-32   Capsella rubella
emb|CDX79252.1|  BnaC06g20510D                                          132   7e-32   
emb|CDX68025.1|  BnaA07g20650D                                          132   8e-32   
ref|XP_009104583.1|  PREDICTED: probable pectin methyltransferase...    131   9e-32   Brassica rapa
ref|XP_003570613.2|  PREDICTED: probable pectin methyltransferase...    132   1e-31   
gb|AFW73428.1|  hypothetical protein ZEAMMB73_978140                    127   3e-31   
ref|XP_002889181.1|  hypothetical protein ARALYDRAFT_895718             129   5e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_008679296.1|  PREDICTED: probable pectin methyltransferase...    129   6e-31   Zea mays [maize]
gb|AFW64432.1|  hypothetical protein ZEAMMB73_102169                    129   7e-31   
ref|XP_008646287.1|  PREDICTED: probable pectin methyltransferase...    127   2e-30   Zea mays [maize]
ref|XP_010428946.1|  PREDICTED: probable pectin methyltransferase...    128   2e-30   Camelina sativa [gold-of-pleasure]
gb|KJB80353.1|  hypothetical protein B456_013G093300                    127   2e-30   Gossypium raimondii
ref|XP_010416801.1|  PREDICTED: probable pectin methyltransferase...    128   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010472034.1|  PREDICTED: probable pectin methyltransferase...    127   2e-30   Camelina sativa [gold-of-pleasure]
gb|AAG52090.1|AC012680_1  unknown protein, 5' partial; 69506-67937      124   4e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KHG30605.1|  hypothetical protein F383_04558                         127   5e-30   Gossypium arboreum [tree cotton]
gb|EPS65073.1|  hypothetical protein M569_09706                         126   8e-30   Genlisea aurea
ref|XP_006583950.1|  PREDICTED: probable methyltransferase PMT5-like    124   2e-29   Glycine max [soybeans]
ref|NP_177948.3|  putative pectin methyltransferase TSD2                125   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007045897.1|  Quasimodo2 like 2 isoform 2                        122   1e-28   
ref|XP_007045896.1|  Quasimodo2 like 2 isoform 1                        122   1e-28   
ref|XP_007045901.1|  Quasimodo2 like 2 isoform 6                        122   1e-28   
gb|KHG21066.1|  hypothetical protein F383_04870                         122   2e-28   Gossypium arboreum [tree cotton]
gb|KJB50579.1|  hypothetical protein B456_008G177800                    122   2e-28   Gossypium raimondii
gb|KHN20522.1|  Putative methyltransferase PMT4                         119   2e-28   Glycine soja [wild soybean]
ref|XP_006605543.1|  PREDICTED: probable methyltransferase PMT5-like    122   2e-28   Glycine max [soybeans]
emb|CDY45558.1|  BnaC09g21520D                                          121   3e-28   Brassica napus [oilseed rape]
ref|XP_008353088.1|  PREDICTED: probable methyltransferase PMT4         119   3e-28   
gb|KHG00547.1|  hypothetical protein F383_17617                         119   9e-28   Gossypium arboreum [tree cotton]
gb|EMS61645.1|  putative pectin methyltransferase QUA2                  120   1e-27   Triticum urartu
ref|XP_011463023.1|  PREDICTED: probable methyltransferase PMT5         119   1e-27   Fragaria vesca subsp. vesca
ref|XP_008361773.1|  PREDICTED: probable methyltransferase PMT5         119   1e-27   
ref|XP_010554289.1|  PREDICTED: probable methyltransferase PMT5         119   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_009356400.1|  PREDICTED: probable methyltransferase PMT5         119   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_009129088.1|  PREDICTED: probable methyltransferase PMT5         119   2e-27   Brassica rapa
ref|XP_008221508.1|  PREDICTED: probable methyltransferase PMT5         119   2e-27   Prunus mume [ume]
gb|AAD17428.2|  expressed protein                                       117   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007226959.1|  hypothetical protein PRUPE_ppa002650mg             119   3e-27   
ref|XP_009114154.1|  PREDICTED: probable methyltransferase PMT5         118   3e-27   Brassica rapa
ref|XP_007157839.1|  hypothetical protein PHAVU_002G102600g             118   3e-27   Phaseolus vulgaris [French bean]
gb|AAN46794.1|  At2g03480/T4M8.9                                        116   3e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAK63953.1|  At2g03480/T4M8.9                                        116   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009152172.1|  PREDICTED: probable methyltransferase PMT5         118   3e-27   Brassica rapa
ref|XP_004505366.1|  PREDICTED: probable methyltransferase PMT5-like    118   4e-27   Cicer arietinum [garbanzo]
emb|CDY04154.1|  BnaA09g19320D                                          119   5e-27   
ref|XP_006292704.1|  hypothetical protein CARUB_v10018950mg             117   6e-27   
gb|KJB30458.1|  hypothetical protein B456_005G145000                    117   7e-27   Gossypium raimondii
ref|NP_027543.2|  QUASIMODO2 like 2                                     117   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973410.1|  QUASIMODO2 like 2                                     117   9e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006853194.1|  hypothetical protein AMTR_s00038p00207680          117   1e-26   
ref|NP_849656.2|  QUASIMODO2 LIKE 1                                     114   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425141.1|  PREDICTED: probable methyltransferase PMT5 i...    116   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010514117.1|  PREDICTED: probable methyltransferase PMT5         116   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_011018345.1|  PREDICTED: probable methyltransferase PMT5 i...    116   2e-26   Populus euphratica
ref|XP_010425139.1|  PREDICTED: probable methyltransferase PMT5 i...    116   2e-26   
ref|XP_002892777.1|  hypothetical protein ARALYDRAFT_471543             115   2e-26   
ref|XP_002512094.1|  ATP binding protein, putative                      115   3e-26   
ref|XP_002316092.1|  dehydration-responsive family protein              115   3e-26   
gb|AES89995.2|  methyltransferase PMT16, putative                       115   4e-26   Medicago truncatula
ref|XP_011012134.1|  PREDICTED: probable methyltransferase PMT5         115   5e-26   Populus euphratica
ref|XP_010527954.1|  PREDICTED: probable methyltransferase PMT5         115   5e-26   
ref|XP_006484179.1|  PREDICTED: probable methyltransferase PMT5-l...    115   5e-26   Citrus sinensis [apfelsine]
ref|XP_006395700.1|  hypothetical protein EUTSA_v10003873mg             115   5e-26   
ref|XP_010066852.1|  PREDICTED: probable methyltransferase PMT5         115   5e-26   Eucalyptus grandis [rose gum]
ref|XP_003607798.1|  hypothetical protein MTR_4g083030                  115   5e-26   
ref|XP_002875206.1|  predicted protein                                  114   7e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_010502360.1|  PREDICTED: probable methyltransferase PMT5         114   7e-26   Camelina sativa [gold-of-pleasure]
dbj|BAH56871.1|  AT1G13860                                              114   8e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CBI27262.3|  unnamed protein product                                107   8e-26   Vitis vinifera
ref|NP_172839.1|  QUASIMODO2 LIKE 1                                     114   9e-26   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42014.1|  unknown protein                                        114   9e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CAN64162.1|  hypothetical protein VITISV_040645                     107   1e-25   Vitis vinifera
ref|XP_006307032.1|  hypothetical protein CARUB_v10008622mg             114   1e-25   Capsella rubella
ref|XP_010476413.1|  PREDICTED: probable methyltransferase PMT4         113   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006837150.1|  hypothetical protein AMTR_s00110p00151520          113   2e-25   
ref|XP_010495624.1|  PREDICTED: probable methyltransferase PMT4         112   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010458849.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    112   3e-25   
ref|XP_006365135.1|  PREDICTED: probable methyltransferase PMT5-l...    111   6e-25   
ref|XP_007153532.1|  hypothetical protein PHAVU_003G043400g             112   6e-25   Phaseolus vulgaris [French bean]
ref|XP_010320876.1|  PREDICTED: probable methyltransferase PMT5         112   7e-25   
ref|XP_010680718.1|  PREDICTED: probable methyltransferase PMT5         112   7e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006365134.1|  PREDICTED: probable methyltransferase PMT5-l...    111   8e-25   Solanum tuberosum [potatoes]
ref|XP_006573141.1|  PREDICTED: probable methyltransferase PMT5-l...    111   8e-25   Glycine max [soybeans]
gb|KHN03641.1|  Putative methyltransferase PMT4                         111   9e-25   Glycine soja [wild soybean]
ref|XP_006348707.1|  PREDICTED: probable methyltransferase PMT5-l...    111   9e-25   Solanum tuberosum [potatoes]
ref|XP_006348706.1|  PREDICTED: probable methyltransferase PMT5-l...    111   1e-24   Solanum tuberosum [potatoes]
ref|XP_010323873.1|  PREDICTED: probable methyltransferase PMT5         111   1e-24   Solanum lycopersicum
ref|XP_006574934.1|  PREDICTED: probable methyltransferase PMT4-l...    111   1e-24   Glycine max [soybeans]
gb|KHN29999.1|  Putative methyltransferase PMT4                         111   1e-24   Glycine soja [wild soybean]
ref|XP_008446426.1|  PREDICTED: probable methyltransferase PMT5         110   3e-24   Cucumis melo [Oriental melon]
ref|XP_004135150.1|  PREDICTED: probable methyltransferase PMT4-like    110   4e-24   
gb|EYU28853.1|  hypothetical protein MIMGU_mgv1a003065mg                107   2e-23   Erythranthe guttata [common monkey flower]
emb|CDP00420.1|  unnamed protein product                                107   2e-23   Coffea canephora [robusta coffee]
ref|XP_010942462.1|  PREDICTED: probable methyltransferase PMT4 i...    105   3e-23   
ref|XP_010906131.1|  PREDICTED: probable methyltransferase PMT5         107   4e-23   Elaeis guineensis
ref|XP_010649494.1|  PREDICTED: probable methyltransferase PMT5         107   4e-23   Vitis vinifera
ref|XP_009798763.1|  PREDICTED: probable methyltransferase PMT5         107   4e-23   Nicotiana sylvestris
ref|XP_009802931.1|  PREDICTED: probable methyltransferase PMT5         106   5e-23   Nicotiana sylvestris
emb|CDY02989.1|  BnaC07g22380D                                          106   5e-23   
ref|XP_008797047.1|  PREDICTED: probable methyltransferase PMT5 i...    106   7e-23   Phoenix dactylifera
ref|XP_008807815.1|  PREDICTED: probable methyltransferase PMT5         106   8e-23   
ref|XP_009631772.1|  PREDICTED: probable methyltransferase PMT5 i...    105   1e-22   Nicotiana tomentosiformis
ref|XP_009631773.1|  PREDICTED: probable methyltransferase PMT5 i...    105   1e-22   Nicotiana tomentosiformis
ref|XP_009777411.1|  PREDICTED: probable methyltransferase PMT5 i...    105   2e-22   Nicotiana sylvestris
ref|XP_009777410.1|  PREDICTED: probable methyltransferase PMT5 i...    105   2e-22   Nicotiana sylvestris
ref|XP_004237055.1|  PREDICTED: probable methyltransferase PMT5         104   4e-22   
ref|XP_010942457.1|  PREDICTED: probable methyltransferase PMT4 i...    101   7e-22   
ref|XP_006344244.1|  PREDICTED: probable methyltransferase PMT5-l...    102   1e-21   Solanum tuberosum [potatoes]
ref|XP_011075591.1|  PREDICTED: probable methyltransferase PMT5         102   1e-21   Sesamum indicum [beniseed]
ref|XP_008797046.1|  PREDICTED: probable methyltransferase PMT5 i...    102   1e-21   Phoenix dactylifera
ref|XP_004155297.1|  PREDICTED: probable methyltransferase PMT4-like    101   3e-21   
emb|CDY53946.1|  BnaA02g36960D                                        99.8    1e-20   Brassica napus [oilseed rape]
ref|XP_009590890.1|  PREDICTED: probable methyltransferase PMT5       99.4    2e-20   Nicotiana tomentosiformis
ref|XP_010258081.1|  PREDICTED: probable methyltransferase PMT5       99.0    2e-20   
ref|XP_008221505.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  95.1    1e-19   
emb|CDY51215.1|  BnaA06g39940D                                        97.1    1e-19   Brassica napus [oilseed rape]
emb|CDY37197.1|  BnaC02g35050D                                        96.7    2e-19   Brassica napus [oilseed rape]
ref|XP_002993743.1|  hypothetical protein SELMODRAFT_137575           95.1    6e-19   
ref|XP_002987768.1|  hypothetical protein SELMODRAFT_426562           95.1    7e-19   Selaginella moellendorffii
gb|AAF79416.1|AC068197_26  F16A14.7                                   90.9    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ABS83492.1|  early response to drought 3                           82.4    5e-16   Pinus pinaster [cluster pine]
gb|AHY28780.1|  early response to drought 3                           81.3    6e-16   Pinus taeda
gb|KHN02028.1|  Putative pectin methyltransferase QUA2                79.0    8e-16   Glycine soja [wild soybean]
gb|ACB59070.1|  early response to drought 3                           82.0    1e-15   Pinus elliottii [American pitch pine]
ref|XP_010677437.1|  PREDICTED: probable methyltransferase PMT21      85.1    1e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001767424.1|  predicted protein                                84.7    1e-15   
gb|ACO57101.1|  early responsive to dehydration 3                     81.6    1e-15   Pinus halepensis [Aleppo pine]
gb|AHY28778.1|  early response to drought 3                           80.9    2e-15   Pinus elliottii [American pitch pine]
gb|AHY28777.1|  early response to drought 3                           80.9    2e-15   Pinus echinata [shortleaf pine]
gb|AAW72877.1|  early response to drought 3                           81.3    3e-15   Pinus taeda
gb|AAW72868.1|  early response to drought 3                           80.9    3e-15   Pinus taeda
gb|AEW70176.1|  early responsive to dehydration 3                     80.5    3e-15   Pinus densiflora var. densiflora
gb|AAW72852.1|  early response to drought 3                           80.9    3e-15   Pinus taeda
gb|AEW70177.1|  early responsive to dehydration 3                     80.5    3e-15   Pinus densiflora var. densiflora
gb|AEW70174.1|  early responsive to dehydration 3                     80.5    4e-15   Pinus densiflora var. ussuriensis
gb|AEW70169.1|  early responsive to dehydration 3                     80.1    4e-15   Pinus sylvestris var. mongolica
gb|AEW70168.1|  early responsive to dehydration 3                     80.1    4e-15   Pinus sylvestris var. mongolica
gb|AIF75711.1|  early response to drought 3                           80.1    4e-15   Pinus hwangshanensis
gb|AIF75714.1|  early response to drought 3                           80.1    4e-15   Pinus hwangshanensis
gb|AIF75712.1|  early response to drought 3                           80.1    4e-15   Pinus hwangshanensis
gb|AEW70171.1|  early responsive to dehydration 3                     79.7    5e-15   Pinus sylvestris var. mongolica
ref|XP_002300064.2|  hypothetical protein POPTR_0001s35650g           82.8    7e-15   
ref|XP_010535872.1|  PREDICTED: probable methyltransferase PMT21      82.8    7e-15   Tarenaya hassleriana [spider flower]
gb|KHN44795.1|  Putative pectin methyltransferase QUA2                82.8    9e-15   Glycine soja [wild soybean]
ref|XP_002867953.1|  early-responsive to dehydration 3                82.4    1e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_008799029.1|  PREDICTED: probable methyltransferase PMT9 i...  81.6    2e-14   Phoenix dactylifera
ref|XP_008799028.1|  PREDICTED: probable methyltransferase PMT9 i...  81.6    2e-14   Phoenix dactylifera
ref|XP_006282955.1|  hypothetical protein CARUB_v10007621mg           81.6    2e-14   Capsella rubella
ref|XP_007046111.1|  S-adenosyl-L-methionine-dependent methyltran...  81.6    2e-14   
gb|ABK25383.1|  unknown                                               81.3    2e-14   Picea sitchensis
gb|KJB64259.1|  hypothetical protein B456_010G039800                  81.6    2e-14   Gossypium raimondii
ref|XP_009136994.1|  PREDICTED: probable methyltransferase PMT21      81.3    2e-14   Brassica rapa
emb|CDY01583.1|  BnaC07g35730D                                        81.6    2e-14   
emb|CDX98606.1|  BnaA03g43910D                                        81.3    3e-14   
emb|CDY09274.1|  BnaC03g63040D                                        80.9    3e-14   Brassica napus [oilseed rape]
gb|AIU48621.1|  quasimodo 3                                           80.5    3e-14   Ricinus communis
ref|XP_008230498.1|  PREDICTED: probable methyltransferase PMT9       80.9    4e-14   Prunus mume [ume]
gb|AIU48633.1|  quasimodo 3                                           80.5    4e-14   Ginkgo biloba [ginkgo]
gb|AIU48594.1|  quasimodo 3                                           80.5    4e-14   Sarcandra glabra
ref|XP_004495377.1|  PREDICTED: probable methyltransferase PMT1-like  81.3    4e-14   
ref|XP_010109369.1|  putative methyltransferase PMT5                  80.5    5e-14   
ref|XP_010275323.1|  PREDICTED: probable methyltransferase PMT14      80.5    5e-14   Nelumbo nucifera [Indian lotus]
ref|NP_567575.1|  putative methyltransferase PMT21                    80.5    5e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KDO49025.1|  hypothetical protein CISIN_1g007165mg                 79.3    7e-14   Citrus sinensis [apfelsine]
emb|CDX76494.1|  BnaA08g09060D                                        80.1    7e-14   
ref|XP_006446646.1|  hypothetical protein CICLE_v10014628mg           79.3    7e-14   
gb|AIU48607.1|  quasimodo 3                                           79.7    7e-14   Pandanus utilis
ref|XP_010439756.1|  PREDICTED: probable methyltransferase PMT21      80.1    7e-14   Camelina sativa [gold-of-pleasure]
ref|XP_002458923.1|  hypothetical protein SORBIDRAFT_03g042770        79.0    7e-14   
ref|XP_010932068.1|  PREDICTED: probable methyltransferase PMT9 i...  80.1    7e-14   
ref|XP_010932066.1|  PREDICTED: probable methyltransferase PMT9 i...  80.1    8e-14   
ref|XP_010932069.1|  PREDICTED: probable methyltransferase PMT9 i...  79.7    8e-14   Elaeis guineensis
ref|XP_010932067.1|  PREDICTED: probable methyltransferase PMT9 i...  79.7    8e-14   Elaeis guineensis
ref|XP_010449394.1|  PREDICTED: probable methyltransferase PMT21      79.7    8e-14   Camelina sativa [gold-of-pleasure]
emb|CDP16620.1|  unnamed protein product                              79.7    8e-14   Coffea canephora [robusta coffee]
ref|XP_003573760.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  79.7    9e-14   
ref|XP_010434448.1|  PREDICTED: probable methyltransferase PMT21      79.7    1e-13   Camelina sativa [gold-of-pleasure]
gb|ACF86888.1|  unknown                                               76.6    1e-13   Zea mays [maize]
dbj|BAJ86710.1|  predicted protein                                    77.8    1e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009108413.1|  PREDICTED: probable methyltransferase PMT21      79.3    1e-13   Brassica rapa
ref|XP_010538339.1|  PREDICTED: probable methyltransferase PMT20      79.3    1e-13   Tarenaya hassleriana [spider flower]
ref|XP_009111460.1|  PREDICTED: probable methyltransferase PMT13      79.3    1e-13   Brassica rapa
ref|XP_010940855.1|  PREDICTED: probable methyltransferase PMT21      79.7    1e-13   
gb|AIF75710.1|  early response to drought 3                           75.9    1e-13   Pinus massoniana [Chinese red pine]
ref|XP_008802976.1|  PREDICTED: probable methyltransferase PMT21 ...  79.3    1e-13   
emb|CDY51142.1|  BnaA09g51770D                                        79.0    1e-13   
ref|XP_007214946.1|  hypothetical protein PRUPE_ppa002968mg           79.0    1e-13   
gb|AIU48603.1|  quasimodo 3                                           78.6    1e-13   
emb|CDY70936.1|  BnaAnng35600D                                        75.5    1e-13   
gb|KDO49024.1|  hypothetical protein CISIN_1g007165mg                 79.0    2e-13   
gb|AAX94055.2|  dehydration-induced protein                           79.0    2e-13   
ref|XP_006446647.1|  hypothetical protein CICLE_v10014628mg           79.0    2e-13   
ref|XP_008802979.1|  PREDICTED: probable methyltransferase PMT21 ...  79.0    2e-13   
gb|KDO49019.1|  hypothetical protein CISIN_1g007165mg                 79.0    2e-13   
gb|KDP46391.1|  hypothetical protein JCGZ_10231                       79.0    2e-13   
ref|XP_010089182.1|  putative methyltransferase PMT9                  79.0    2e-13   
ref|XP_008458833.1|  PREDICTED: probable methyltransferase PMT9       79.0    2e-13   
ref|NP_001152470.1|  ankyrin protein kinase-like                      78.6    2e-13   
ref|XP_008651354.1|  PREDICTED: uncharacterized protein LOC100279...  78.6    2e-13   
dbj|BAK00591.1|  predicted protein                                    78.6    2e-13   
ref|XP_006654336.1|  PREDICTED: probable methyltransferase PMT7-like  78.2    3e-13   
gb|AIU48601.1|  quasimodo 3                                           77.8    3e-13   
gb|EPS60043.1|  hypothetical protein M569_14761                       76.3    3e-13   
gb|AIU48606.1|  quasimodo 3                                           77.8    3e-13   
gb|ACN26954.1|  unknown                                               76.3    3e-13   
ref|XP_011027055.1|  PREDICTED: probable methyltransferase PMT2       78.2    3e-13   
ref|XP_006470210.1|  PREDICTED: probable methyltransferase PMT9-like  77.8    3e-13   
ref|XP_006414006.1|  hypothetical protein EUTSA_v10024718mg           77.8    3e-13   
ref|XP_002974980.1|  hypothetical protein SELMODRAFT_174651           77.8    3e-13   
ref|XP_008379190.1|  PREDICTED: probable methyltransferase PMT9       77.8    3e-13   
ref|XP_003524439.1|  PREDICTED: probable methyltransferase PMT14-...  77.8    3e-13   
ref|XP_011005556.1|  PREDICTED: probable methyltransferase PMT9       77.8    4e-13   
emb|CDM85331.1|  unnamed protein product                              76.3    4e-13   
gb|KJB80180.1|  hypothetical protein B456_013G084900                  77.8    4e-13   
ref|XP_006663417.1|  PREDICTED: probable methyltransferase PMT2-like  75.1    4e-13   
ref|XP_009405339.1|  PREDICTED: probable methyltransferase PMT17 ...  77.8    4e-13   
ref|XP_009405306.1|  PREDICTED: probable methyltransferase PMT17 ...  77.8    4e-13   
ref|XP_008802980.1|  PREDICTED: probable methyltransferase PMT21 ...  77.8    4e-13   
ref|XP_009384739.1|  PREDICTED: probable methyltransferase PMT21      77.8    4e-13   
ref|XP_009612703.1|  PREDICTED: probable methyltransferase PMT9 i...  77.4    4e-13   
ref|XP_009612704.1|  PREDICTED: probable methyltransferase PMT9 i...  77.4    4e-13   
gb|EMS63450.1|  putative methyltransferase PMT21                      77.4    4e-13   
emb|CDX74348.1|  BnaA03g26990D                                        77.4    4e-13   
ref|XP_009134532.1|  PREDICTED: probable methyltransferase PMT13      77.4    5e-13   
gb|AAL86466.1|AC077693_5  hypothetical protein                        77.8    5e-13   
ref|XP_009371893.1|  PREDICTED: probable methyltransferase PMT14 ...  77.4    5e-13   
gb|KJB59033.1|  hypothetical protein B456_009G236100                  77.4    5e-13   
ref|XP_009401770.1|  PREDICTED: probable methyltransferase PMT13      77.4    5e-13   
ref|XP_004509540.1|  PREDICTED: probable methyltransferase PMT21-...  77.4    5e-13   
gb|KJB60757.1|  hypothetical protein B456_009G324300                  77.4    5e-13   
gb|KHG10506.1|  hypothetical protein F383_11349                       77.4    5e-13   
ref|XP_008674698.1|  PREDICTED: probable methyltransferase PMT19      77.4    5e-13   
gb|KHG23981.1|  hypothetical protein F383_09020                       77.4    5e-13   
ref|XP_010053567.1|  PREDICTED: probable methyltransferase PMT14      77.4    5e-13   
gb|ABR16582.1|  unknown                                               77.4    5e-13   
ref|XP_009135853.1|  PREDICTED: probable methyltransferase PMT1       77.4    5e-13   
ref|XP_002460211.1|  hypothetical protein SORBIDRAFT_02g024670        77.4    5e-13   
gb|EMS59100.1|  putative methyltransferase PMT17                      76.6    5e-13   
emb|CDP14936.1|  unnamed protein product                              77.4    5e-13   
ref|NP_001288960.1|  probable methyltransferase PMT9                  77.4    5e-13   
ref|XP_006827213.1|  hypothetical protein AMTR_s00010p00259630        77.4    6e-13   
ref|XP_009757509.1|  PREDICTED: probable methyltransferase PMT9 i...  77.0    6e-13   
ref|XP_008799998.1|  PREDICTED: probable methyltransferase PMT20 ...  77.0    6e-13   
ref|XP_007051915.1|  S-adenosyl-L-methionine-dependent methyltran...  77.0    6e-13   
ref|XP_009612701.1|  PREDICTED: probable methyltransferase PMT9 i...  77.0    6e-13   
emb|CDX91893.1|  BnaC03g31950D                                        77.0    6e-13   
ref|XP_006853043.1|  hypothetical protein AMTR_s00038p00030380        77.0    6e-13   
ref|NP_001063174.1|  Os09g0415700                                     77.0    6e-13   
gb|EAZ09099.1|  hypothetical protein OsI_31366                        77.0    6e-13   
ref|XP_011025778.1|  PREDICTED: probable methyltransferase PMT2       77.0    6e-13   
ref|XP_009370341.1|  PREDICTED: probable methyltransferase PMT9       77.0    6e-13   
ref|XP_010029086.1|  PREDICTED: probable methyltransferase PMT9       77.0    7e-13   
ref|XP_004956815.1|  PREDICTED: probable methyltransferase PMT2-l...  77.0    7e-13   
ref|XP_002511800.1|  conserved hypothetical protein                   76.6    7e-13   
ref|XP_004160003.1|  PREDICTED: probable methyltransferase PMT2-like  76.6    7e-13   
ref|XP_002265127.1|  PREDICTED: probable methyltransferase PMT20      77.0    7e-13   
ref|XP_011021619.1|  PREDICTED: probable methyltransferase PMT2       77.0    7e-13   
emb|CBI37452.3|  unnamed protein product                              77.0    7e-13   
ref|XP_011015217.1|  PREDICTED: probable methyltransferase PMT2       77.0    7e-13   
gb|KHF97731.1|  putative methyltransferase PMT21 -like protein        77.0    7e-13   
gb|EMT27426.1|  hypothetical protein F775_29617                       77.0    7e-13   
ref|XP_006438677.1|  hypothetical protein CICLE_v10030989mg           77.0    7e-13   
gb|EMS49438.1|  putative methyltransferase PMT2                       77.0    7e-13   
ref|XP_009757507.1|  PREDICTED: probable methyltransferase PMT9 i...  77.0    7e-13   
ref|XP_006600888.1|  PREDICTED: probable methyltransferase PMT14 ...  77.0    7e-13   
gb|AEX55231.1|  putative cold-regulated protein                       75.1    7e-13   
gb|KEH31563.1|  methyltransferase PMT14-like protein, putative        77.4    8e-13   
emb|CDX94861.1|  BnaC03g43270D                                        76.6    8e-13   
gb|AIU48637.1|  quasimodo 3                                           76.6    8e-13   
ref|XP_008441700.1|  PREDICTED: probable methyltransferase PMT2       77.0    8e-13   
ref|XP_006660624.1|  PREDICTED: probable methyltransferase PMT2-like  77.0    8e-13   
gb|KJB41229.1|  hypothetical protein B456_007G095900                  76.6    8e-13   
ref|XP_010110847.1|  putative methyltransferase PMT18                 73.9    8e-13   
ref|XP_009402695.1|  PREDICTED: probable methyltransferase PMT19      76.6    9e-13   
ref|XP_008229546.1|  PREDICTED: probable methyltransferase PMT14      76.6    9e-13   
emb|CDY07198.1|  BnaCnng02130D                                        76.6    9e-13   
ref|XP_010912141.1|  PREDICTED: probable methyltransferase PMT19      76.6    9e-13   
dbj|BAF01846.1|  hypothetical protein                                 70.5    9e-13   
gb|ABR16247.1|  unknown                                               76.6    9e-13   
ref|XP_002977398.1|  hypothetical protein SELMODRAFT_151943           76.6    1e-12   
gb|KDO82912.1|  hypothetical protein CISIN_1g0105922mg                75.1    1e-12   
gb|KDO50369.1|  hypothetical protein CISIN_1g020011mg                 74.7    1e-12   
gb|KJB24074.1|  hypothetical protein B456_004G127200                  76.6    1e-12   
ref|XP_006364469.1|  PREDICTED: probable methyltransferase PMT21-...  76.3    1e-12   
ref|XP_002521494.1|  S-adenosylmethionine-dependent methyltransfe...  76.3    1e-12   
gb|KHN21029.1|  Putative methyltransferase PMT14                      76.3    1e-12   
ref|XP_006857872.1|  hypothetical protein AMTR_s00069p00098800        76.3    1e-12   
ref|XP_002310457.2|  hypothetical protein POPTR_0007s02440g           76.3    1e-12   
ref|XP_002315803.2|  hypothetical protein POPTR_0010s10420g           76.3    1e-12   
ref|XP_004138921.1|  PREDICTED: probable methyltransferase PMT2-like  76.3    1e-12   
ref|XP_008799525.1|  PREDICTED: probable methyltransferase PMT13      76.3    1e-12   
ref|XP_010245944.1|  PREDICTED: probable methyltransferase PMT19      76.3    1e-12   
ref|XP_010278811.1|  PREDICTED: probable methyltransferase PMT21      76.3    1e-12   
ref|XP_006357164.1|  PREDICTED: probable methyltransferase PMT9-l...  76.3    1e-12   
ref|XP_011026358.1|  PREDICTED: probable methyltransferase PMT19      76.3    1e-12   
ref|XP_007155749.1|  hypothetical protein PHAVU_003G228500g           76.3    1e-12   
ref|NP_001056669.2|  Os06g0128100                                     73.6    1e-12   
ref|XP_010054055.1|  PREDICTED: probable methyltransferase PMT21      76.3    1e-12   
ref|XP_010023923.1|  PREDICTED: probable methyltransferase PMT3       76.3    1e-12   
dbj|BAH57120.1|  AT1G31850                                            75.5    1e-12   
gb|KJB18847.1|  hypothetical protein B456_003G072700                  75.1    1e-12   
ref|XP_002311593.1|  hypothetical protein POPTR_0008s14720g           76.3    1e-12   
ref|NP_001065447.2|  Os10g0569300                                     75.9    1e-12   
gb|EAZ17038.1|  hypothetical protein OsJ_32528                        75.9    2e-12   
gb|AIU48592.1|  quasimodo 3                                           75.5    2e-12   
ref|XP_010918079.1|  PREDICTED: probable methyltransferase PMT21      75.9    2e-12   
gb|EAY79581.1|  hypothetical protein OsI_34717                        75.9    2e-12   
ref|XP_007156365.1|  hypothetical protein PHAVU_003G280100g           75.9    2e-12   
ref|XP_010683197.1|  PREDICTED: probable methyltransferase PMT2       75.9    2e-12   
gb|AIU48591.1|  quasimodo 3                                           75.5    2e-12   
ref|XP_008802371.1|  PREDICTED: probable methyltransferase PMT19      75.9    2e-12   
gb|KGN51347.1|  hypothetical protein Csa_5G522930                     76.3    2e-12   
gb|EMT28371.1|  hypothetical protein F775_11930                       75.1    2e-12   
ref|XP_004142780.1|  PREDICTED: probable methyltransferase PMT9-like  75.9    2e-12   
ref|XP_011465047.1|  PREDICTED: probable methyltransferase PMT20      75.9    2e-12   
ref|XP_004972291.1|  PREDICTED: probable methyltransferase PMT19-...  75.9    2e-12   
ref|XP_006415288.1|  hypothetical protein EUTSA_v10007126mg           75.9    2e-12   
ref|XP_004156694.1|  PREDICTED: probable methyltransferase PMT9-like  75.9    2e-12   
ref|XP_002530544.1|  S-adenosylmethionine-dependent methyltransfe...  75.9    2e-12   
ref|XP_010232692.1|  PREDICTED: probable methyltransferase PMT19      75.9    2e-12   
ref|XP_002466953.1|  hypothetical protein SORBIDRAFT_01g017340        75.9    2e-12   
ref|XP_011028831.1|  PREDICTED: probable methyltransferase PMT3       75.9    2e-12   
emb|CAH18000.1|  Ankyrin protein kinase-like                          75.9    2e-12   
ref|XP_004245921.1|  PREDICTED: probable methyltransferase PMT21      75.5    2e-12   
gb|AIU48589.1|  quasimodo 3                                           75.5    2e-12   
ref|XP_004982637.1|  PREDICTED: probable methyltransferase PMT18-...  75.9    2e-12   
ref|XP_004982638.1|  PREDICTED: probable methyltransferase PMT18-...  75.9    2e-12   
ref|XP_010542936.1|  PREDICTED: probable methyltransferase PMT3 i...  75.5    2e-12   
dbj|BAJ98075.1|  predicted protein                                    75.5    2e-12   
ref|XP_010518942.1|  PREDICTED: probable methyltransferase PMT20      75.5    2e-12   
gb|KDP35427.1|  hypothetical protein JCGZ_10810                       75.5    2e-12   
ref|XP_010420080.1|  PREDICTED: probable methyltransferase PMT9 i...  75.5    2e-12   
gb|EMT00863.1|  hypothetical protein F775_08090                       75.5    2e-12   
ref|XP_010478606.1|  PREDICTED: probable methyltransferase PMT20      75.5    2e-12   
ref|XP_009365745.1|  PREDICTED: probable methyltransferase PMT21      75.5    2e-12   
ref|XP_009410365.1|  PREDICTED: probable methyltransferase PMT9       75.5    2e-12   
gb|EYU37520.1|  hypothetical protein MIMGU_mgv1a003222mg              75.5    2e-12   
ref|XP_004986789.1|  PREDICTED: probable methyltransferase PMT2-like  75.5    2e-12   
ref|XP_003574187.1|  PREDICTED: probable methyltransferase PMT17 ...  75.5    2e-12   
ref|XP_010542937.1|  PREDICTED: probable methyltransferase PMT3 i...  75.1    2e-12   
ref|XP_004144403.1|  PREDICTED: probable methyltransferase PMT21-...  75.5    2e-12   
ref|XP_010541176.1|  PREDICTED: probable methyltransferase PMT20      75.9    2e-12   
gb|EYU37521.1|  hypothetical protein MIMGU_mgv1a003222mg              75.5    2e-12   
dbj|BAJ96685.1|  predicted protein                                    75.5    2e-12   
ref|XP_010676941.1|  PREDICTED: probable methyltransferase PMT17      75.5    2e-12   
ref|XP_008460424.1|  PREDICTED: probable methyltransferase PMT21      75.5    2e-12   
gb|KJB22349.1|  hypothetical protein B456_004G042500                  75.5    2e-12   
gb|AIU48636.1|  quasimodo 3                                           75.1    2e-12   
ref|XP_010420079.1|  PREDICTED: probable methyltransferase PMT9 i...  75.5    2e-12   
ref|XP_007210880.1|  hypothetical protein PRUPE_ppa003016mg           75.5    2e-12   
ref|XP_010542935.1|  PREDICTED: probable methyltransferase PMT8 i...  75.5    2e-12   
gb|KDO86020.1|  hypothetical protein CISIN_1g007645mg                 74.3    2e-12   
ref|XP_010234899.1|  PREDICTED: probable methyltransferase PMT17 ...  75.5    2e-12   
ref|XP_006307042.1|  hypothetical protein CARUB_v10008629mg           75.5    2e-12   
ref|XP_003580350.1|  PREDICTED: probable methyltransferase PMT13      75.5    2e-12   
gb|EEC67295.1|  hypothetical protein OsI_34283                        75.5    2e-12   
ref|XP_009113612.1|  PREDICTED: probable methyltransferase PMT17      75.5    2e-12   
ref|XP_004304673.1|  PREDICTED: probable methyltransferase PMT9       75.5    2e-12   
ref|NP_001065036.1|  Os10g0510400                                     75.5    2e-12   
dbj|BAJ85549.1|  predicted protein                                    75.5    2e-12   
ref|XP_002271722.2|  PREDICTED: probable methyltransferase PMT9       75.5    3e-12   
ref|XP_002890952.1|  hypothetical protein ARALYDRAFT_473372           75.1    3e-12   
gb|KJB18848.1|  hypothetical protein B456_003G072700                  75.5    3e-12   
ref|NP_174468.1|  putative methyltransferase PMT20                    75.1    3e-12   
ref|XP_008385702.1|  PREDICTED: probable methyltransferase PMT13      75.1    3e-12   
ref|XP_002522425.1|  ATP binding protein, putative                    75.1    3e-12   
gb|AIU48609.1|  quasimodo 3                                           75.1    3e-12   
gb|KJB18849.1|  hypothetical protein B456_003G072700                  75.1    3e-12   
ref|XP_006432561.1|  hypothetical protein CICLE_v10000643mg           74.7    3e-12   
ref|XP_010919246.1|  PREDICTED: probable methyltransferase PMT13 ...  75.1    3e-12   
ref|XP_003547828.1|  PREDICTED: probable methyltransferase PMT20-...  75.1    3e-12   
gb|AAN60317.1|  unknown                                               75.1    3e-12   
gb|KHN47640.1|  Putative methyltransferase PMT21                      74.7    3e-12   
gb|KDO82910.1|  hypothetical protein CISIN_1g0105922mg                74.7    3e-12   
ref|XP_008364478.1|  PREDICTED: probable methyltransferase PMT21      75.1    3e-12   
ref|XP_008373450.1|  PREDICTED: probable methyltransferase PMT21      75.1    3e-12   
ref|XP_010427357.1|  PREDICTED: probable methyltransferase PMT13      75.1    3e-12   
gb|KJB18860.1|  hypothetical protein B456_003G072700                  75.1    3e-12   
ref|XP_004244424.1|  PREDICTED: probable methyltransferase PMT20      75.1    3e-12   
gb|AIU48602.1|  quasimodo 3                                           74.7    3e-12   
ref|XP_009401621.1|  PREDICTED: probable methyltransferase PMT3       75.1    3e-12   
ref|XP_009619970.1|  PREDICTED: probable methyltransferase PMT20      75.1    3e-12   
ref|XP_010453564.1|  PREDICTED: probable methyltransferase PMT9 i...  75.1    3e-12   
ref|XP_004508998.1|  PREDICTED: probable methyltransferase PMT14-...  75.1    3e-12   
ref|XP_011101812.1|  PREDICTED: probable methyltransferase PMT9       75.1    3e-12   
ref|XP_001779831.1|  predicted protein                                75.1    3e-12   
ref|XP_009391596.1|  PREDICTED: probable methyltransferase PMT7       74.7    4e-12   
gb|KJB08228.1|  hypothetical protein B456_001G071800                  74.7    4e-12   
ref|XP_009382296.1|  PREDICTED: probable methyltransferase PMT13      74.7    4e-12   
gb|AIU48595.1|  quasimodo 3                                           74.7    4e-12   
gb|EEE63535.1|  hypothetical protein OsJ_18351                        74.7    4e-12   
ref|XP_010453563.1|  PREDICTED: probable methyltransferase PMT9 i...  74.7    4e-12   
ref|XP_008392677.1|  PREDICTED: probable methyltransferase PMT18      70.9    4e-12   
ref|XP_004228376.1|  PREDICTED: probable methyltransferase PMT2       74.7    4e-12   
gb|KHG13750.1|  hypothetical protein F383_08462                       74.7    4e-12   
ref|XP_010273272.1|  PREDICTED: probable methyltransferase PMT7       74.7    4e-12   
ref|XP_009401236.1|  PREDICTED: probable methyltransferase PMT21      74.7    4e-12   
ref|XP_006599113.1|  PREDICTED: probable methyltransferase PMT20-...  74.7    4e-12   
gb|EAY93110.1|  hypothetical protein OsI_14912                        74.7    4e-12   
ref|XP_006652660.1|  PREDICTED: probable methyltransferase PMT13-...  73.9    4e-12   
ref|XP_002961169.1|  hypothetical protein SELMODRAFT_74065            74.3    4e-12   
ref|XP_002966837.1|  hypothetical protein SELMODRAFT_168608           74.3    4e-12   
ref|XP_002872932.1|  hypothetical protein ARALYDRAFT_490495           74.7    4e-12   
ref|XP_006286484.1|  hypothetical protein CARUB_v10000518mg           74.3    4e-12   
gb|KDO86019.1|  hypothetical protein CISIN_1g007645mg                 74.3    5e-12   



>gb|ACJ85808.1| unknown [Medicago truncatula]
Length=153

 Score =   149 bits (377),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A G+L+LE  Q  RC MLDLFIEIDRL RPEGWIIIRDT+PL++
Sbjct  55   WCEAFPTYPRTYDLVHAAGILSLEFSQPLRCTMLDLFIEIDRLLRPEGWIIIRDTIPLIE  114

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
             AR  + +LKW+ARV+EIESNS+EKLL+CQKP  K+ A
Sbjct  115  SARVLAAQLKWEARVIEIESNSEEKLLICQKPFFKKHA  152



>ref|XP_009760349.1| PREDICTED: probable pectin methyltransferase QUA2 [Nicotiana 
sylvestris]
Length=697

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 84/99 (85%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LE  QHSRC M DLFIEIDR+ RPEGW+IIRD+VPL++
Sbjct  600  WCEAFPTYPRTYDLVHANGLLSLEFGQHSRCLMFDLFIEIDRVLRPEGWVIIRDSVPLIE  659

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
            LAR H+ RLKWDARVVE+ES SDEKLL+CQKP  +R AS
Sbjct  660  LARVHAARLKWDARVVEVES-SDEKLLICQKPFSRRQAS  697



>gb|KJB64256.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64257.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64262.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64263.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=669

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE+ QH RC MLDLF EIDRL RPEGWI+IRD  PLV+
Sbjct  571  WCEAFPTYPRTYDMVHADGLLSLETSQHRRCTMLDLFTEIDRLLRPEGWILIRDAAPLVE  630

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
             ARA +TRLKWDAR++EIESNSDE+LL+CQKP  K+ A
Sbjct  631  SARALTTRLKWDARIIEIESNSDERLLICQKPFFKKQA  668



>ref|XP_007018751.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY15976.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=658

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE+ Q+ RC MLDLF EIDRL RPEGW+IIRDT PL++
Sbjct  560  WCEAFPTYPRTYDMVHAEGLLSLETSQNRRCTMLDLFTEIDRLLRPEGWVIIRDTAPLIE  619

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +TRLKWDARVVE ESNS+E+LL+CQKP  KR AS
Sbjct  620  SARALTTRLKWDARVVETESNSEERLLICQKPFFKRQAS  658



>ref|XP_007018750.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY15975.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=695

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE+ Q+ RC MLDLF EIDRL RPEGW+IIRDT PL++
Sbjct  597  WCEAFPTYPRTYDMVHAEGLLSLETSQNRRCTMLDLFTEIDRLLRPEGWVIIRDTAPLIE  656

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +TRLKWDARVVE ESNS+E+LL+CQKP  KR AS
Sbjct  657  SARALTTRLKWDARVVETESNSEERLLICQKPFFKRQAS  695



>gb|KHG28112.1| putative pectin methyltransferase QUA2 -like protein [Gossypium 
arboreum]
Length=697

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE+ QH RC MLDLF EIDRL RPEGWI+IRD  PLV+
Sbjct  599  WCEAFPTYPRTYDMVHADGLLSLETSQHRRCTMLDLFTEIDRLLRPEGWILIRDAAPLVE  658

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
             ARA +TRLKWDAR++EIESNSDE+LL+CQKP  K+ A
Sbjct  659  SARALTTRLKWDARIIEIESNSDERLLICQKPFFKKQA  696



>gb|KJB64260.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=697

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE+ QH RC MLDLF EIDRL RPEGWI+IRD  PLV+
Sbjct  599  WCEAFPTYPRTYDMVHADGLLSLETSQHRRCTMLDLFTEIDRLLRPEGWILIRDAAPLVE  658

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
             ARA +TRLKWDAR++EIESNSDE+LL+CQKP  K+ A
Sbjct  659  SARALTTRLKWDARIIEIESNSDERLLICQKPFFKKQA  696



>ref|XP_009629595.1| PREDICTED: probable pectin methyltransferase QUA2 [Nicotiana 
tomentosiformis]
Length=697

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL++E  QHSRC M DLFIEIDR+ RPEGW+IIRDTVPL++
Sbjct  600  WCEAFPTYPRTYDLVHANGLLSVEFGQHSRCLMFDLFIEIDRVLRPEGWVIIRDTVPLIE  659

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
            LAR H++RLKWDARVVE+ES SDE LL+CQKP  +R AS
Sbjct  660  LARVHASRLKWDARVVEVES-SDENLLICQKPFSRRQAS  697



>ref|XP_006367734.1| PREDICTED: probable pectin methyltransferase QUA2-like [Solanum 
tuberosum]
Length=697

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL++E  QHSRC M DLFIE+DR+ RPEGW+I+RDTVPL++
Sbjct  600  WCEAFPTYPRTYDLVHANGLLSMEFGQHSRCPMFDLFIEMDRVLRPEGWVILRDTVPLIE  659

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
            LAR+H+ RLKWDARV+E+ES SDEKLL+CQKP  +R AS
Sbjct  660  LARSHAARLKWDARVIEVES-SDEKLLICQKPFSRRQAS  697



>ref|XP_010269315.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Nelumbo nucifera]
Length=704

 Score =   156 bits (395),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 68/96 (71%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE+ Q  RC MLDLF E+DRL RPEGW+I+RDTVPL++
Sbjct  606  WCEAFPTYPRTYDMVHAEGLLSLETGQQHRCTMLDLFTEMDRLLRPEGWVILRDTVPLIE  665

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             ARA +TR +WDARVVE+ESNSDE+LL+CQKP  KR
Sbjct  666  SARALATRFRWDARVVELESNSDERLLLCQKPFFKR  701



>ref|XP_010098612.1| putative pectin methyltransferase QUA2 [Morus notabilis]
 gb|EXB75351.1| putative pectin methyltransferase QUA2 [Morus notabilis]
Length=696

 Score =   156 bits (395),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 69/99 (70%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LE+ Q  RC MLDLF EIDR+ RPEGW+IIRD  PL++
Sbjct  598  WCEAFPTYPRTYDLVHAEGLLSLETSQQRRCTMLDLFTEIDRILRPEGWVIIRDRAPLIE  657

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +T LKWDARV+E+ESNSDE+LL+CQKP  KR A+
Sbjct  658  SARALTTLLKWDARVIEMESNSDERLLICQKPFFKRQAN  696



>ref|XP_006581532.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Glycine max]
 ref|XP_006581533.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
 ref|XP_006581534.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X3 [Glycine max]
 ref|XP_006581535.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X4 [Glycine max]
Length=690

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LE  Q  RC MLD+FIEIDRL RPEGWIIIRD VPL++
Sbjct  592  WCEAFPTYPRTYDLVHAAGLLSLEFAQQRRCTMLDMFIEIDRLLRPEGWIIIRDIVPLIE  651

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +TRLKWDARVVEIES+SD++LL+CQKP+ KR A+
Sbjct  652  SARALTTRLKWDARVVEIESDSDQRLLICQKPLFKRQAN  690



>gb|KDP41393.1| hypothetical protein JCGZ_15800 [Jatropha curcas]
Length=690

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LE+ Q  RC MLD+F E+DR+ RPEGW+II DT PL++
Sbjct  592  WCEAFPTYPRTYDLVHAAGLLSLEAGQQRRCTMLDIFTEVDRVLRPEGWVIIHDTAPLIE  651

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +TRLKWDARVVEIESNSDE+LL+CQKP  KR AS
Sbjct  652  SARALATRLKWDARVVEIESNSDERLLICQKPFFKRQAS  690



>gb|KHN08942.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=690

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LE  Q  RC MLD+FIEIDRL RPEGWIIIRD VPL++
Sbjct  592  WCEAFPTYPRTYDLVHAAGLLSLEFAQQRRCTMLDIFIEIDRLLRPEGWIIIRDIVPLIE  651

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +TRLKWDARVVEIES+SD++LL+CQKP+ KR A+
Sbjct  652  SARALTTRLKWDARVVEIESDSDQRLLICQKPLFKRQAN  690



>gb|KHN19772.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=690

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LE  Q   C MLD+FIEIDRL RPEGWIIIRDTVPL++
Sbjct  592  WCEAFPTYPRTYDLVHAAGLLSLEFAQQRSCTMLDMFIEIDRLLRPEGWIIIRDTVPLIE  651

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +TRLKWDARVVEIES+SD++LL+CQKP  KR A+
Sbjct  652  SARALTTRLKWDARVVEIESDSDQRLLICQKPFFKRQAN  690



>ref|XP_003522790.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
1 [Glycine max]
Length=690

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LE  Q   C MLD+FIEIDRL RPEGWIIIRDTVPL++
Sbjct  592  WCEAFPTYPRTYDLVHAAGLLSLEFAQQRSCTMLDMFIEIDRLLRPEGWIIIRDTVPLIE  651

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +TRLKWDARVVEIES+SD++LL+CQKP  KR A+
Sbjct  652  SARALTTRLKWDARVVEIESDSDQRLLICQKPFFKRQAN  690



>ref|XP_003542374.1| PREDICTED: probable pectin methyltransferase QUA2-like isoformX1 
[Glycine max]
 ref|XP_006593562.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
Length=694

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LE+EQH RC MLDLFIEIDR+ RPEGW+IIRDTVPL++
Sbjct  597  WCEAFPTYPRTYDLVHAAGLLSLETEQH-RCSMLDLFIEIDRILRPEGWVIIRDTVPLIE  655

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             AR  + +LKWDARV+EIES+SD++LL+CQKP  KR AS
Sbjct  656  SARPLTAQLKWDARVIEIESDSDQRLLICQKPFFKRQAS  694



>gb|KEH34953.1| pectin methyltransferase QUA2, putative [Medicago truncatula]
Length=693

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A G L+L++ Q  RC MLD+FIEIDRL RPEGWIIIRDTVPL++
Sbjct  595  WCEAFPTYPRTYDLVHAAGFLSLQTSQQYRCTMLDIFIEIDRLLRPEGWIIIRDTVPLIE  654

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             AR  +TRLKWDARV+EIES+SD++LL+CQKP  KR A+
Sbjct  655  SARTLTTRLKWDARVIEIESDSDQRLLICQKPFFKRQAN  693



>ref|XP_010320179.1| PREDICTED: probable pectin methyltransferase QUA2 [Solanum lycopersicum]
Length=697

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 84/99 (85%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL++E  QH RC M DLFIE+DR+ RPEGW+I+RDTVPL++
Sbjct  600  WCEAFPTYPRTYDLVHANGLLSMEFGQHIRCPMFDLFIEMDRVLRPEGWVILRDTVPLIE  659

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
            LAR+H+ RLKWDARV+E+ES SDEKLL+CQKP  +R AS
Sbjct  660  LARSHAARLKWDARVIEVES-SDEKLLICQKPFSRRQAS  697



>ref|XP_007141184.1| hypothetical protein PHAVU_008G174000g [Phaseolus vulgaris]
 gb|ESW13178.1| hypothetical protein PHAVU_008G174000g [Phaseolus vulgaris]
Length=693

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A G L+LE+EQH RC MLD+F+EIDR+ RPEGW+IIRDTVPL++
Sbjct  596  WCEAFPTYPRTYDLVHAAGFLSLETEQH-RCTMLDMFLEIDRILRPEGWVIIRDTVPLIE  654

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA + +LKWDARV+E+ES+SD++LL+CQKP  KR AS
Sbjct  655  SARALTAQLKWDARVIEVESDSDQRLLICQKPFFKRQAS  693



>ref|XP_002513934.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48517.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=656

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LE+ Q  RC MLD+F E+DRL RPEGW+II DT PL++
Sbjct  558  WCEAFPTYPRTYDLVHAAGLLSLETGQQHRCTMLDIFTEVDRLLRPEGWMIIHDTAPLIE  617

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA + RLKWDARV+EIESNSDE+LL+CQKP  K+ AS
Sbjct  618  SARALTARLKWDARVIEIESNSDERLLICQKPFFKKQAS  656



>ref|XP_004500638.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Cicer arietinum]
Length=659

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A G L+LE+ Q  +C + D+FIEIDRL RPEGWIIIRD+VPL++
Sbjct  561  WCEAFPTYPRSYDLVHAAGFLSLETGQQRKCTLFDIFIEIDRLLRPEGWIIIRDSVPLIE  620

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
            +ARA +TRLKWDARV+EI+S+SD++LL+CQKP  KR A+
Sbjct  621  MARALTTRLKWDARVIEIDSDSDQRLLICQKPFFKRQAN  659



>ref|XP_004500637.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Cicer arietinum]
Length=689

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A G L+LE+ Q  +C + D+FIEIDRL RPEGWIIIRD+VPL++
Sbjct  591  WCEAFPTYPRSYDLVHAAGFLSLETGQQRKCTLFDIFIEIDRLLRPEGWIIIRDSVPLIE  650

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
            +ARA +TRLKWDARV+EI+S+SD++LL+CQKP  KR A+
Sbjct  651  MARALTTRLKWDARVIEIDSDSDQRLLICQKPFFKRQAN  689



>gb|KDO80998.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
Length=458

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LES    RC  LD+F EIDR+ RPEGW+IIRDT  L++
Sbjct  360  WCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVIIRDTARLIE  419

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +TRLKWDARV+EIESNSDE+LL+CQKP  KR AS
Sbjct  420  SARALTTRLKWDARVIEIESNSDERLLICQKPFFKRQAS  458



>ref|XP_010269316.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Nelumbo nucifera]
 ref|XP_010269317.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Nelumbo nucifera]
 ref|XP_010269318.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Nelumbo nucifera]
Length=700

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE+ Q  RC MLDLF E+DRL RPEGW+I+RDTVPL++
Sbjct  602  WCEAFPTYPRTYDMVHAEGLLSLETGQQHRCTMLDLFTEMDRLLRPEGWVILRDTVPLIE  661

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             ARA +TR +WDARVVE+ESNSDE+LL+CQKP  KR
Sbjct  662  SARALATRFRWDARVVELESNSDERLLLCQKPFFKR  697



>ref|XP_002285784.1| PREDICTED: probable pectin methyltransferase QUA2 [Vitis vinifera]
 ref|XP_010664337.1| PREDICTED: probable pectin methyltransferase QUA2 [Vitis vinifera]
 emb|CBI19170.3| unnamed protein product [Vitis vinifera]
Length=696

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE+ Q  RC MLDLF EIDRL RPEGW+I+RDTV L+D
Sbjct  598  WCEAFPTYPRTYDMVHAAGLLSLETSQQRRCTMLDLFTEIDRLLRPEGWVILRDTVSLID  657

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             AR   TRLKWDARVVEIESNS+E+LLVCQKP  KR  +
Sbjct  658  SARMLITRLKWDARVVEIESNSNERLLVCQKPFFKRQTN  696



>ref|XP_003544795.1| PREDICTED: probable pectin methyltransferase QUA2-like isoformX1 
[Glycine max]
 ref|XP_006596348.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
Length=693

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LE+E+H RC +LDLFIEIDR+ RPEGW+IIRDTVPL++
Sbjct  596  WCEAFPTYPRTYDLVHAAGLLSLETEKH-RCSILDLFIEIDRILRPEGWVIIRDTVPLIE  654

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             AR  + +LKWDARV+EIES+SD++LL+CQKP  KR AS
Sbjct  655  SARPLTAQLKWDARVIEIESDSDQRLLICQKPFFKRQAS  693



>gb|KHG17567.1| putative pectin methyltransferase QUA2 -like protein [Gossypium 
arboreum]
Length=696

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE+ Q+ RC MLDLF EIDRL RPEGW+II D  PL++
Sbjct  597  WCEAFPTYPRTYDMVHADGLLSLETSQYRRCTMLDLFTEIDRLLRPEGWVIIHDKAPLIE  656

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA + +LKWDARVVEIESNSDE+LL+CQKP  KR A+
Sbjct  657  SARALTVQLKWDARVVEIESNSDERLLICQKPFFKRQAT  695



>ref|XP_006472587.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X3 [Citrus sinensis]
Length=667

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LES    RC  LD+F EIDR+ RPEGW+IIRDT  L++
Sbjct  569  WCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVIIRDTARLIE  628

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +TRLKWDARV+EIESNSDE+LL+CQKP  KR AS
Sbjct  629  SARALTTRLKWDARVIEIESNSDERLLICQKPFFKRQAS  667



>gb|KDO80995.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
Length=667

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LES    RC  LD+F EIDR+ RPEGW+IIRDT  L++
Sbjct  569  WCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVIIRDTARLIE  628

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +TRLKWDARV+EIESNSDE+LL+CQKP  KR AS
Sbjct  629  SARALTTRLKWDARVIEIESNSDERLLICQKPFFKRQAS  667



>ref|XP_002302304.2| hypothetical protein POPTR_0002s09820g [Populus trichocarpa]
 gb|EEE81577.2| hypothetical protein POPTR_0002s09820g [Populus trichocarpa]
Length=694

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDLV A GLLTL++ Q  RC MLDLF EIDRL RPEGW+IIRDT PLV+
Sbjct  594  WCEPFPTYPRSYDLVHAKGLLTLQTHQQRRCTMLDLFTEIDRLLRPEGWVIIRDTAPLVE  653

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
             AR   TRLKWDARV+EIESNSD++LL+CQKP  KR  
Sbjct  654  SARMLITRLKWDARVIEIESNSDDRLLICQKPFFKRQG  691



>ref|XP_006472585.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006472586.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Citrus sinensis]
Length=697

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LES    RC  LD+F EIDR+ RPEGW+IIRDT  L++
Sbjct  599  WCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVIIRDTARLIE  658

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +TRLKWDARV+EIESNSDE+LL+CQKP  KR AS
Sbjct  659  SARALTTRLKWDARVIEIESNSDERLLICQKPFFKRQAS  697



>gb|KDO80996.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
 gb|KDO80997.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
Length=697

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LES    RC  LD+F EIDR+ RPEGW+IIRDT  L++
Sbjct  599  WCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVIIRDTARLIE  658

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +TRLKWDARV+EIESNSDE+LL+CQKP  KR AS
Sbjct  659  SARALTTRLKWDARVIEIESNSDERLLICQKPFFKRQAS  697



>ref|XP_006433967.1| hypothetical protein CICLE_v10000463mg [Citrus clementina]
 gb|ESR47207.1| hypothetical protein CICLE_v10000463mg [Citrus clementina]
Length=697

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LES    RC  LD+F EIDR+ RPEGW+IIRDT  L++
Sbjct  599  WCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVIIRDTARLIE  658

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +TRLKWDARV+EIESNSDE+LL+CQKP  KR AS
Sbjct  659  SARALTTRLKWDARVIEIESNSDERLLICQKPFFKRQAS  697



>ref|XP_002306569.2| hypothetical protein POPTR_0005s17180g [Populus trichocarpa]
 gb|EEE93565.2| hypothetical protein POPTR_0005s17180g [Populus trichocarpa]
Length=718

 Score =   151 bits (382),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 67/96 (70%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDLV A GLL+L++ Q   C MLDLF EIDRL RPEGW+I+RDT PLV+
Sbjct  618  WCEPFPTYPRSYDLVHAEGLLSLQTRQQRWCTMLDLFTEIDRLLRPEGWVIMRDTAPLVE  677

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR  +TRLKWDARV+EIESNSD++LL+CQKP  KR
Sbjct  678  SARRLTTRLKWDARVIEIESNSDDRLLICQKPFFKR  713



>gb|KHN13350.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=693

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDLV A GLL+LE+E+H RC +LDLFIEIDR+ RPEGW+IIRDTVPL++
Sbjct  596  WCETFPTYPRTYDLVHAAGLLSLETEKH-RCSILDLFIEIDRILRPEGWVIIRDTVPLIE  654

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             AR  + +LKWDARV+EIES+SD++LL+CQKP  KR AS
Sbjct  655  SARPLTAQLKWDARVIEIESDSDQRLLICQKPFFKRQAS  693



>gb|KJB59919.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=660

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LES QH RC M+D+F EIDR+ RPEGWIIIRDT  L+D
Sbjct  562  WCEAFPTYPRTYDMVHAEGLLSLESSQHWRCTMVDIFTEIDRMLRPEGWIIIRDTALLID  621

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             AR  + RLKW+ARV+EIESN+DE+LL+CQKP  KR  S
Sbjct  622  SARVLTRRLKWEARVIEIESNNDERLLICQKPFFKRQPS  660



>gb|KJB59031.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=608

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE+ Q+ RC MLDL  EIDRL RPEGW+II D  PL++
Sbjct  509  WCEAFPTYPRTYDMVHADGLLSLETSQYRRCTMLDLLTEIDRLLRPEGWVIIHDKAPLIE  568

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA + +LKWDARVVEIESNSDE+LL+CQKP  KR A+
Sbjct  569  SARALTVQLKWDARVVEIESNSDERLLICQKPFFKRQAT  607



>gb|KJB59914.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=712

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LES QH RC M+D+F EIDR+ RPEGWIIIRDT  L+D
Sbjct  614  WCEAFPTYPRTYDMVHAEGLLSLESSQHWRCTMVDIFTEIDRMLRPEGWIIIRDTALLID  673

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             AR  + RLKW+ARV+EIESN+DE+LL+CQKP  KR  S
Sbjct  674  SARVLTRRLKWEARVIEIESNNDERLLICQKPFFKRQPS  712



>gb|KJB59915.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=711

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LES QH RC M+D+F EIDR+ RPEGWIIIRDT  L+D
Sbjct  613  WCEAFPTYPRTYDMVHAEGLLSLESSQHWRCTMVDIFTEIDRMLRPEGWIIIRDTALLID  672

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             AR  + RLKW+ARV+EIESN+DE+LL+CQKP  KR  S
Sbjct  673  SARVLTRRLKWEARVIEIESNNDERLLICQKPFFKRQPS  711



>ref|XP_003615127.1| hypothetical protein MTR_5g064080 [Medicago truncatula]
 gb|AES98085.1| S-adenosylmethionine-dependent methyltransferase, putative [Medicago 
truncatula]
Length=675

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A G+L+LE  Q  RC MLDLFIEIDRL RPEGWIIIRDT+PL++
Sbjct  577  WCEAFPTYPRTYDLVHAAGILSLEFSQPLRCTMLDLFIEIDRLLRPEGWIIIRDTIPLIE  636

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
             AR  + +LKW+ARV+EIESNS+EKLL+CQKP  K+ A
Sbjct  637  SARVLAAQLKWEARVIEIESNSEEKLLICQKPFFKKHA  674



>gb|KJB59918.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=690

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LES QH RC M+D+F EIDR+ RPEGWIIIRDT  L+D
Sbjct  592  WCEAFPTYPRTYDMVHAEGLLSLESSQHWRCTMVDIFTEIDRMLRPEGWIIIRDTALLID  651

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             AR  + RLKW+ARV+EIESN+DE+LL+CQKP  KR  S
Sbjct  652  SARVLTRRLKWEARVIEIESNNDERLLICQKPFFKRQPS  690



>gb|KJB59030.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=696

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE+ Q+ RC MLDL  EIDRL RPEGW+II D  PL++
Sbjct  597  WCEAFPTYPRTYDMVHADGLLSLETSQYRRCTMLDLLTEIDRLLRPEGWVIIHDKAPLIE  656

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA + +LKWDARVVEIESNSDE+LL+CQKP  KR A+
Sbjct  657  SARALTVQLKWDARVVEIESNSDERLLICQKPFFKRQAT  695



>ref|XP_010060014.1| PREDICTED: probable pectin methyltransferase QUA2 [Eucalyptus 
grandis]
 ref|XP_010060015.1| PREDICTED: probable pectin methyltransferase QUA2 [Eucalyptus 
grandis]
 gb|KCW66537.1| hypothetical protein EUGRSUZ_F00334 [Eucalyptus grandis]
Length=695

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD+V A GLL+LE+ Q+ RC MLDLF EIDR+ RPEGW I RDT  L++
Sbjct  597  WCEGFPTYPRTYDMVHASGLLSLENSQNRRCSMLDLFAEIDRILRPEGWAIFRDTTSLIE  656

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
            LARA STR KWDARV+ IESN+DE+LL+CQKP +K+ +S
Sbjct  657  LARALSTRFKWDARVIGIESNTDERLLICQKPFLKKPSS  695



>ref|XP_010267469.1| PREDICTED: probable pectin methyltransferase QUA2 [Nelumbo nucifera]
 ref|XP_010267476.1| PREDICTED: probable pectin methyltransferase QUA2 [Nelumbo nucifera]
Length=700

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+L++ +  RC MLDLF EIDRL RPEGW+I+ DT  L++
Sbjct  602  WCEAFPTYPRTYDMVHAEGLLSLQTSKQHRCTMLDLFAEIDRLLRPEGWVILHDTASLIE  661

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
              RA +TRLKWDARVVE+ESNSDEKLLVCQKP  KR
Sbjct  662  SGRALATRLKWDARVVELESNSDEKLLVCQKPFFKR  697



>ref|XP_011016595.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
 ref|XP_011016602.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
Length=693

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDLV A GLLTL+++Q  RC MLDLF EIDRL RPEGW+I+RDT PLV+
Sbjct  594  WCEPFPTYPRSYDLVHARGLLTLQTQQR-RCTMLDLFTEIDRLIRPEGWVIVRDTAPLVE  652

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
             AR   TRLKWDARV+EIESNSD++LL+CQKP  KR  
Sbjct  653  SARMLITRLKWDARVIEIESNSDDRLLICQKPFFKRQG  690



>ref|XP_011074193.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011074194.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011074195.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
Length=697

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDLV A GLL+LE  +  RC MLDLF EIDR+ RPEGW+I++DT  L++
Sbjct  599  WCEPFPTYPRTYDLVHAEGLLSLEFAEQPRCQMLDLFAEIDRILRPEGWVILKDTARLIE  658

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             AR+ +T+LKWDARVV+IESNSDEKLLVCQKP +K+ AS
Sbjct  659  FARSLTTQLKWDARVVDIESNSDEKLLVCQKPFLKKQAS  697



>ref|XP_004490695.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cicer 
arietinum]
 ref|XP_004505832.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cicer 
arietinum]
Length=683

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LE  Q  RC  LDLF+EIDRL RPEGWII RDT  L++
Sbjct  585  WCEAFPTYPRTYDLVHAAGLLSLEFSQRRRCTTLDLFVEIDRLLRPEGWIIFRDTNLLIE  644

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             ARA +T+LKWDARV++IESNS+EKLL+CQKP  KR
Sbjct  645  SARALTTQLKWDARVIDIESNSEEKLLICQKPFFKR  680



>ref|XP_011003042.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
Length=694

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDLV A GLL+L++ Q   C MLDLF EIDRL RPEGW+I+RDT PLV+
Sbjct  594  WCEPFPTYPRSYDLVHAEGLLSLQTRQQRWCTMLDLFTEIDRLLRPEGWVIMRDTAPLVE  653

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
             AR  + RLKWDARV+EIESNSD++LL+CQKP  KR  
Sbjct  654  SARRLTARLKWDARVIEIESNSDDRLLICQKPFFKRQG  691



>ref|XP_008466224.1| PREDICTED: probable pectin methyltransferase QUA2 [Cucumis melo]
Length=690

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GL++LE+ +  RC MLDLF EIDRL RPEGW+IIRDT  L++
Sbjct  592  WCEAFPTYPRSYDLVHAAGLMSLEASKKPRCSMLDLFSEIDRLLRPEGWVIIRDTTTLIE  651

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
             AR  +T+LKWDARV EIE N+DE++L+CQKP +KR A
Sbjct  652  SARTVTTQLKWDARVTEIEDNNDERVLICQKPFLKRQA  689



>ref|XP_009372838.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009372846.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009372855.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD+V A GLL+LES+   RC +LDLFIEIDRL RPEGW+II D   LV+
Sbjct  597  WCEPFPTYPRTYDMVHAAGLLSLESDHQRRCTILDLFIEIDRLLRPEGWVIIHDKAFLVE  656

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +T LKW+ARVVEIESNSDEKLL+CQKP  K+ A+
Sbjct  657  SARALTTGLKWEARVVEIESNSDEKLLICQKPFFKKQAN  695



>ref|XP_010926316.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Elaeis guineensis]
Length=659

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLLTLE+ Q  RC MLD+F+EIDR+ RPEGW+I+RDT PL++
Sbjct  562  WCEAFPTYPRTYDMVHAEGLLTLETHQQDRCSMLDIFLEIDRILRPEGWVILRDTAPLIE  621

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+L+WDAR++E+ +N DEKLL+CQKP  K+
Sbjct  622  AARSVRTQLRWDARMLELNNNGDEKLLICQKPFFKK  657



>ref|XP_004136285.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cucumis 
sativus]
 ref|XP_004160281.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cucumis 
sativus]
 gb|KGN60218.1| hypothetical protein Csa_3G889740 [Cucumis sativus]
Length=690

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLL+LE+ +  RC MLDLF EIDRL RPEGW+IIRDT  L++
Sbjct  592  WCEAFPTYPRSYDLVHAAGLLSLEAIKKPRCSMLDLFSEIDRLLRPEGWVIIRDTTTLIE  651

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
             AR  +T+LKWDARV+EIE N+DE++L+CQKP +KR A
Sbjct  652  SARTVTTQLKWDARVIEIEDNNDERVLICQKPFLKRQA  689



>ref|XP_010926317.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Elaeis guineensis]
Length=656

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLLTLE+ Q  RC MLD+F+EIDR+ RPEGW+I+RDT PL++
Sbjct  559  WCEAFPTYPRTYDMVHAEGLLTLETHQQDRCSMLDIFLEIDRILRPEGWVILRDTAPLIE  618

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+L+WDAR++E+ +N DEKLL+CQKP  K+
Sbjct  619  AARSVRTQLRWDARMLELNNNGDEKLLICQKPFFKK  654



>ref|XP_011100984.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011100985.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011100986.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
Length=693

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDLV A GLL+LE  +  RC ++DLF EIDRL RPEGW+I+RD+ P+++
Sbjct  595  WCEPFPTYPRTYDLVHAEGLLSLEFAEQPRCQLIDLFAEIDRLLRPEGWVILRDSAPVIE  654

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             AR  +T+LKWDAR+VEIESNS+E+LL+CQKP  KR AS
Sbjct  655  FARPLTTQLKWDARIVEIESNSNERLLICQKPFSKRQAS  693



>ref|XP_004300652.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465516.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465517.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465518.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465519.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
Length=693

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD+V A GLL++E++Q  RC +LDLF EIDRL RPEGW+II D   L++
Sbjct  594  WCEPFPTYPRTYDMVHAQGLLSVETDQQRRCTILDLFTEIDRLLRPEGWVIIHDKASLIE  653

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +T LKWDARVVEIESNSDEKLL+CQKP  K+ ++
Sbjct  654  SARALTTGLKWDARVVEIESNSDEKLLICQKPFFKKQSN  692



>ref|XP_008219451.1| PREDICTED: probable pectin methyltransferase QUA2 [Prunus mume]
 ref|XP_008219452.1| PREDICTED: probable pectin methyltransferase QUA2 [Prunus mume]
Length=698

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDLV A GLL+LE +   RC +LDLF EIDRL RPEGW+II D   LV+
Sbjct  600  WCEPFPTYPRTYDLVHAAGLLSLEVDHQRRCTILDLFTEIDRLLRPEGWVIIHDKAALVE  659

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +T LKWDARVVEIESNSDEKLL+CQKP  K+ A+
Sbjct  660  SARALTTGLKWDARVVEIESNSDEKLLICQKPFFKKQAN  698



>ref|XP_007225175.1| hypothetical protein PRUPE_ppa002227mg [Prunus persica]
 gb|EMJ26374.1| hypothetical protein PRUPE_ppa002227mg [Prunus persica]
Length=698

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDLV A GLL+LE +   RC +LDLF EIDRL RPEGW+II D   LV+
Sbjct  600  WCEPFPTYPRTYDLVHAAGLLSLEVDHQRRCTILDLFTEIDRLLRPEGWVIIHDKAALVE  659

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +T LKWDARVVEIESNSDEKLL+CQKP  K+ A+
Sbjct  660  SARALTTGLKWDARVVEIESNSDEKLLICQKPFFKKQAN  698



>ref|XP_008372670.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
 ref|XP_008372733.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
Length=695

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD+V A GLL+LES+   RC +LDLF EIDRL RPEGW+II D   LV+
Sbjct  597  WCEPFPTYPRTYDMVHAAGLLSLESDHQRRCTILDLFTEIDRLLRPEGWVIIHDKAFLVE  656

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +T LKW+ARVVEIESNSD KLL+CQKP  K+ A+
Sbjct  657  SARALTTGLKWEARVVEIESNSDXKLLICQKPFFKKQAN  695



>ref|XP_009380861.1| PREDICTED: probable pectin methyltransferase QUA2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE+ Q  RC MLD+F+EIDR+ RPEGW+IIRD   LV+
Sbjct  562  WCEAFPTYPRTYDMVHADGLLSLETRQKHRCSMLDIFLEIDRILRPEGWVIIRDAAHLVE  621

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+ +T+L+WDAR+VE++S+SD+KLLVCQKP  ++
Sbjct  622  AARSMTTQLRWDARMVELDSSSDKKLLVCQKPFFRK  657



>ref|XP_009334340.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334341.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334342.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD+V A GLL+LES+   RC +LDLF EIDRL RPEGW+I  D   L++
Sbjct  597  WCEPFPTYPRTYDMVHAAGLLSLESDHQRRCTILDLFTEIDRLLRPEGWVIFHDKAALIE  656

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +T LKW+ARVVEIESNS EKLL+CQKP  K+ A+
Sbjct  657  SARALTTGLKWEARVVEIESNSGEKLLICQKPFFKKQAN  695



>ref|XP_008781887.1| PREDICTED: probable pectin methyltransferase QUA2 [Phoenix dactylifera]
Length=658

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV A GLLTLE+ Q  RC MLD+F+EIDR+ RPEGW+IIRDT PL++
Sbjct  560  WCEAFPTYPRTYDLVHAEGLLTLETYQRHRCSMLDIFLEIDRILRPEGWVIIRDTDPLIE  619

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
              R+  T+L+WDAR++E++++S+EKLLVCQKP  K+
Sbjct  620  AVRSVITQLRWDARMMELDNDSNEKLLVCQKPFFKK  655



>ref|XP_009334333.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334334.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334335.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD+V A GLL+LES+   RC +LDLF EIDRL RPEGW+I  D   L++
Sbjct  597  WCEPFPTYPRTYDMVHAAGLLSLESDHQRRCTILDLFTEIDRLLRPEGWVIFHDKAALIE  656

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +T LKW+ARVVEIESNS EKLL+CQKP  K+ A+
Sbjct  657  SARALTTGLKWEARVVEIESNSGEKLLICQKPFFKKQAN  695



>ref|XP_008383924.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
 ref|XP_008383925.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
Length=695

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD+V A GLL+LES+   RC +LDLF EIDRL RPEGW+I  D   L++
Sbjct  597  WCEPFPTYPRTYDMVHAAGLLSLESDHQRRCTILDLFTEIDRLLRPEGWVIFHDKAALIE  656

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
             ARA +T LKW+ARVVEIESNSDEKLL+CQK   K+ A+
Sbjct  657  SARALTTGLKWEARVVEIESNSDEKLLICQKSFFKKQAN  695



>ref|XP_010535445.1| PREDICTED: probable pectin methyltransferase QUA2 [Tarenaya hassleriana]
Length=689

 Score =   139 bits (349),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQ-HSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCEAFPTYP  YD+V A GLL+L++ Q  SRC ++D+F+EIDRL RPEGW+IIRDT  L+
Sbjct  592  WCEAFPTYPRTYDMVHADGLLSLQTGQARSRCSLMDIFMEIDRLLRPEGWVIIRDTAKLI  651

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            + AR+ +T++KW+ARV+EIES+S+++LL CQKP  +R
Sbjct  652  ETARSMTTQMKWEARVIEIESSSEQRLLFCQKPFTRR  688



>ref|XP_010676338.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=666

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WC+AFPTYP  YDLV A GLLTLE +   RC   D+F+EIDR+ RPEGW+I RD   L++
Sbjct  568  WCDAFPTYPRTYDLVHADGLLTLEKDSQRRCNTFDIFVEIDRILRPEGWVIFRDKANLIE  627

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
              R +  RLKW+ARV+EIESN+DEKLLVCQKP  KR A
Sbjct  628  SIRPYLARLKWEARVIEIESNNDEKLLVCQKPFFKRHA  665



>ref|XP_010676321.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010676329.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=697

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WC+AFPTYP  YDLV A GLLTLE +   RC   D+F+EIDR+ RPEGW+I RD   L++
Sbjct  599  WCDAFPTYPRTYDLVHADGLLTLEKDSQRRCNTFDIFVEIDRILRPEGWVIFRDKANLIE  658

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
              R +  RLKW+ARV+EIESN+DEKLLVCQKP  KR A
Sbjct  659  SIRPYLARLKWEARVIEIESNNDEKLLVCQKPFFKRHA  696



>ref|XP_008790889.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Phoenix dactylifera]
Length=453

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE  Q  RC MLD+F+EIDR+ RPEGW+I  D  PL++
Sbjct  356  WCEAFPTYPRTYDMVHADGLLSLEDHQKHRCSMLDIFLEIDRILRPEGWVIFHDASPLIE  415

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+LKWD R++E + NSDEKLLVCQKP  ++
Sbjct  416  AARSVITKLKWDIRMMEFDGNSDEKLLVCQKPFFRK  451



>emb|CDP01069.1| unnamed protein product [Coffea canephora]
Length=696

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDLV   GLL+LE  +  RC MLD+FIE+DR+ RPEGW+I+RDT  L++
Sbjct  598  WCEAFPTYPRTYDLVHGDGLLSLEFGEKRRCEMLDVFIEMDRILRPEGWVILRDTATLIE  657

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
             AR  +T LKWDARVVE+++NSDE+LL+CQK  +KR A
Sbjct  658  PARTLTTLLKWDARVVEVDNNSDERLLICQKAFVKRPA  695



>ref|XP_006649061.1| PREDICTED: probable pectin methyltransferase QUA2-like, partial 
[Oryza brachyantha]
Length=545

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE  Q  RC  LD+F+E+DR+ RPEGW+IIRDT PL++
Sbjct  449  WCEAFPTYPRTYDMVHADGLLSLEKRQKHRCSTLDIFLEVDRILRPEGWVIIRDTAPLIE  508

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+L+WDAR+++++  SDEKLL+CQKP I++
Sbjct  509  AARSVVTQLRWDARILDLDIASDEKLLICQKPFIRK  544



>ref|XP_010939668.1| PREDICTED: probable pectin methyltransferase QUA2 [Elaeis guineensis]
Length=662

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE  Q  RC MLD+F+EIDR+ RPEGW+I+RDT PL++
Sbjct  565  WCEAFPTYPRTYDMVHADGLLSLEFHQKHRCSMLDIFLEIDRILRPEGWVILRDTAPLIE  624

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+LKWD R++E + NSDEKLLVCQK   ++
Sbjct  625  AARSVITKLKWDIRMMEFDGNSDEKLLVCQKVFFRK  660



>dbj|BAJ94920.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A G L+LE  Q  RC  LD+F+E+DR+ RPEGWIIIRDT PL++
Sbjct  554  WCEAFPTYPRTYDMVHADGFLSLEKRQKRRCSTLDIFLEVDRIVRPEGWIIIRDTAPLIE  613

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+ + +L+WDAR+++++  SDEKLLVCQKP +K+
Sbjct  614  AARSVAAQLRWDARILDLDIASDEKLLVCQKPFLKK  649



>gb|EMT33652.1| hypothetical protein F775_26112 [Aegilops tauschii]
Length=571

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A G L+LE  Q  RC  LD+F+E+DR+ RPEGWIIIRDT PL++
Sbjct  476  WCEAFPTYPRTYDMVHADGFLSLEKRQKRRCSTLDIFLEVDRILRPEGWIIIRDTAPLIE  535

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+ + +L+WDAR+++++  SDEKLLVCQKP +K+
Sbjct  536  AARSVAAQLRWDARILDLDIASDEKLLVCQKPFLKK  571



>ref|XP_008790887.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Phoenix dactylifera]
 ref|XP_008790888.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Phoenix dactylifera]
Length=659

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE  Q  RC MLD+F+EIDR+ RPEGW+I  D  PL++
Sbjct  562  WCEAFPTYPRTYDMVHADGLLSLEDHQKHRCSMLDIFLEIDRILRPEGWVIFHDASPLIE  621

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+LKWD R++E + NSDEKLLVCQKP  ++
Sbjct  622  AARSVITKLKWDIRMMEFDGNSDEKLLVCQKPFFRK  657



>dbj|BAJ86389.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=659

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A G L+LE  Q  RC  LD+F+E+DR+ RPEGWIIIRDT PL++
Sbjct  564  WCEAFPTYPRTYDMVHADGFLSLEKRQKRRCSTLDIFLEVDRIVRPEGWIIIRDTAPLIE  623

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+ + +L+WDAR+++++  SDEKLLVCQKP +K+
Sbjct  624  AARSVAAQLRWDARILDLDIASDEKLLVCQKPFLKK  659



>ref|XP_009387117.1| PREDICTED: probable pectin methyltransferase QUA2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+L + Q  RC MLD+F+EIDR+ RPEGW+IIRDT  L++
Sbjct  562  WCEAFPTYPRTYDMVHAEGLLSLGTHQKQRCSMLDIFLEIDRILRPEGWVIIRDTALLIE  621

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+ +T+L+WDAR++E++ +S+EKLLVCQKP  ++
Sbjct  622  TARSMTTQLRWDARLIELDRSSNEKLLVCQKPYFRK  657



>gb|EAY87574.1| hypothetical protein OsI_08986 [Oryza sativa Indica Group]
Length=660

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A G L+LE  Q  RC  LD+F+E+DR+ RPEGW+IIRDT PL++
Sbjct  564  WCEAFPTYPRTYDMVHADGFLSLEKHQKHRCSTLDIFLEVDRILRPEGWVIIRDTAPLIE  623

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+L+WDAR+++++  SDEKLLVCQKP I++
Sbjct  624  AARSVVTQLRWDARILDLDIASDEKLLVCQKPFIRK  659



>dbj|BAD17245.1| putative early-responsive to dehydration stress protein [Oryza 
sativa Japonica Group]
Length=660

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A G L+LE  Q  RC  LD+F+E+DR+ RPEGW+IIRDT PL++
Sbjct  564  WCEAFPTYPRTYDMVHADGFLSLEKHQKHRCSTLDIFLEVDRILRPEGWVIIRDTAPLIE  623

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+L+WDAR+++++  SDEKLLVCQKP I++
Sbjct  624  AARSVVTQLRWDARILDLDIASDEKLLVCQKPFIRK  659



>gb|EAZ24662.1| hypothetical protein OsJ_08431 [Oryza sativa Japonica Group]
Length=660

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A G L+LE  Q  RC  LD+F+E+DR+ RPEGW+IIRDT PL++
Sbjct  564  WCEAFPTYPRTYDMVHADGFLSLEKHQKHRCSTLDIFLEVDRILRPEGWVIIRDTAPLIE  623

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+L+WDAR+++++  SDEKLLVCQKP I++
Sbjct  624  AARSVVTQLRWDARILDLDIASDEKLLVCQKPFIRK  659



>ref|XP_010937423.1| PREDICTED: probable pectin methyltransferase QUA2 [Elaeis guineensis]
 ref|XP_010937424.1| PREDICTED: probable pectin methyltransferase QUA2 [Elaeis guineensis]
Length=662

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLL+LE  Q  RC MLD+F+EIDR+ RPEGW+I+ DT PL+ 
Sbjct  565  WCEAFPTYPRTYDMVHADGLLSLEKNQKHRCSMLDIFLEIDRILRPEGWVILHDTAPLIQ  624

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR   T+LKWD R++E+  NSDEKLL+CQKP   +
Sbjct  625  AARPVITQLKWDMRMMELNGNSDEKLLICQKPFFMK  660



>ref|XP_004953963.1| PREDICTED: probable pectin methyltransferase QUA2-like [Setaria 
italica]
Length=656

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLE-SEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCEAFPTYP  YD+V A GLL+LE S +H+RC  LD+F+E+DR+ RPEGW+IIRDT PL+
Sbjct  560  WCEAFPTYPRTYDMVHADGLLSLEKSHKHNRCSTLDIFLEVDRILRPEGWVIIRDTAPLI  619

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            + AR+  T+L+WDAR+++++  SDEKLLVCQKP +++
Sbjct  620  EAARSVVTQLRWDARILDLDIASDEKLLVCQKPFVRK  656



>ref|XP_009409275.1| PREDICTED: probable pectin methyltransferase QUA2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFP YP  YD+V A GLL+LE+ Q  RC +LD+F+EIDR+ RPEGWI+IRDT  LV+
Sbjct  562  WCEAFPAYPRTYDMVHAEGLLSLETHQKHRCSILDIFLEIDRILRPEGWIMIRDTAHLVE  621

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR   T+L+WDAR++E++S+SDEKLLVCQKP  ++
Sbjct  622  TARTVITQLRWDARLMELDSSSDEKLLVCQKPFFRK  657



>emb|CDX88430.1| BnaC06g38740D [Brassica napus]
Length=667

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQH-SRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCEAFP+YP  YDLV A  LL+L++ QH S C +L++F EIDRL RPEGW+IIRDT  LV
Sbjct  568  WCEAFPSYPRTYDLVHADNLLSLQTSQHRSSCSLLNIFTEIDRLLRPEGWVIIRDTAQLV  627

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            + ARA +T+LKW+ARV+E+ES+S+++LL+CQKP  KR +
Sbjct  628  ETARALTTQLKWEARVIEVESSSEQRLLICQKPFTKRQS  666



>ref|XP_010521185.1| PREDICTED: probable pectin methyltransferase QUA2 [Tarenaya hassleriana]
Length=696

 Score =   134 bits (338),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 6/105 (6%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQH--SRCGMLDLFIEIDRLTRPEGWIIIRDTVPL  434
            WCEAFPTYP  YD+V A GLL+L++  H  +RC ++D+FIEIDRL RPEGW+IIRDT  L
Sbjct  592  WCEAFPTYPRSYDMVHADGLLSLQTGHHRRNRCSLMDIFIEIDRLLRPEGWVIIRDTTQL  651

Query  433  VDLARAHSTRLKWDARVVEI----ESNSDEKLLVCQKPIIKRXAS  311
            ++ AR  +TRLKW+ARV+E+     S+SD++LL CQKP  K+ ++
Sbjct  652  IETARTMATRLKWEARVIEMAGSGSSSSDQRLLFCQKPFSKKLSN  696



>ref|XP_010680526.1| PREDICTED: probable pectin methyltransferase QUA2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010680527.1| PREDICTED: probable pectin methyltransferase QUA2 [Beta vulgaris 
subsp. vulgaris]
Length=679

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFP+YP  YD++ A GLL+LE+ QH +C MLDLF++IDRL RPEGWII RDT  +++
Sbjct  582  WCEAFPSYPRTYDMIHADGLLSLETLQHQKCTMLDLFLDIDRLLRPEGWIIFRDTPSMIE  641

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPI  329
            LAR  +TRL+WD R+V++E+N DE++L+C+KP 
Sbjct  642  LARTLATRLRWDVRIVDVEANIDERVLICRKPF  674



>ref|XP_008811174.1| PREDICTED: probable pectin methyltransferase QUA2 [Phoenix dactylifera]
Length=662

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD++ A GLL+LE  Q  RC MLD+F+EIDR+ RPEGW+I+ D+ PL+ 
Sbjct  565  WCEAFPTYPRTYDMMHADGLLSLEKHQKHRCSMLDIFLEIDRILRPEGWVILHDSAPLIQ  624

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+LKWD R++E+  N+DEKLLVCQKP   +
Sbjct  625  EARSVITQLKWDTRMMEVNGNNDEKLLVCQKPFFMK  660



>ref|XP_010916838.1| PREDICTED: probable pectin methyltransferase QUA2 [Elaeis guineensis]
Length=657

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A GLLTLE+ Q  RC MLD+F+EID + RPEGW+IIRD  PL++
Sbjct  559  WCEAFPTYPRTYDMVHAEGLLTLETYQRHRCSMLDIFLEIDHILRPEGWVIIRDKDPLIE  618

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+   +L+WDAR++E++++S++KLLVCQKP  K+
Sbjct  619  AARSVIAQLRWDARMMELDNDSNKKLLVCQKPFFKK  654



>ref|XP_006390005.1| hypothetical protein EUTSA_v10018220mg [Eutrema salsugineum]
 gb|ESQ27291.1| hypothetical protein EUTSA_v10018220mg [Eutrema salsugineum]
Length=684

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQH-SRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCEAFPTYP  YDLV A  LLTL++ Q  S C ++++F EIDRL RPEGW+IIRDT  LV
Sbjct  585  WCEAFPTYPRTYDLVHADNLLTLQTSQRRSSCSLIEIFTEIDRLLRPEGWVIIRDTAQLV  644

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            + ARA +T+LKW+ARV+EIES+S+++LL+CQKP  KR +
Sbjct  645  EAARALTTQLKWEARVIEIESSSEQRLLICQKPFTKRQS  683



>emb|CDX87461.1| BnaA07g34120D [Brassica napus]
Length=658

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQH-SRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCEAFP+YP  YDLV A  LL+L++ QH S C +L++F EIDRL RPEGW+IIRDT  LV
Sbjct  559  WCEAFPSYPRTYDLVHADNLLSLQTSQHRSSCSLLNIFTEIDRLLRPEGWVIIRDTAQLV  618

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            + ARA +T+LKW+ARV+E+E +S+++LL+CQKP  KR +
Sbjct  619  ETARALTTQLKWEARVIEVERSSEQRLLICQKPFTKRQS  657



>ref|XP_009106531.1| PREDICTED: probable pectin methyltransferase QUA2 [Brassica rapa]
Length=658

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQH-SRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCEAFP+YP  YDLV A  LL+L++ QH S C +L++F EIDRL RPEGW+IIRDT  LV
Sbjct  559  WCEAFPSYPRTYDLVHADNLLSLQTSQHRSSCSLLNIFTEIDRLLRPEGWVIIRDTAQLV  618

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            + ARA +T+LKW+ARV+E+E +S+++LL+CQKP  KR +
Sbjct  619  ETARALTTQLKWEARVIEVERSSEQRLLICQKPFTKRQS  657



>emb|CDY14622.1| BnaC02g24910D [Brassica napus]
Length=662

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQH-SRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCEAFPTYP  YDLV A  LL+L++ Q  S C +L +  E+DRL RPEGW+IIRDTV LV
Sbjct  563  WCEAFPTYPRTYDLVHADNLLSLQTSQRRSSCSLLQILTEVDRLLRPEGWVIIRDTVQLV  622

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            + ARA +T+LKW+ARV+E+ES+SD++LL+CQKP  KR +
Sbjct  623  EAARALTTQLKWEARVIEVESSSDQRLLICQKPFTKRQS  661



>ref|XP_002452533.1| hypothetical protein SORBIDRAFT_04g027500 [Sorghum bicolor]
 gb|EES05509.1| hypothetical protein SORBIDRAFT_04g027500 [Sorghum bicolor]
Length=656

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WC+AFPTYP  YD+V A G L+LE     RC  LD+F+E+DR+ RPEGW+IIRDT PL++
Sbjct  561  WCDAFPTYPRTYDMVHADGFLSLEKNHKHRCSTLDIFLEVDRILRPEGWVIIRDTAPLIE  620

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+L+WDAR+++++  SDEKLLVCQKP I++
Sbjct  621  AARSVVTQLRWDARILDLDIASDEKLLVCQKPFIRK  656



>ref|NP_001288873.1| probable pectin methyltransferase QUA2 [Brassica rapa]
 gb|ABV89659.1| dehydration-responsive protein-related [Brassica rapa]
Length=662

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQH-SRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCEAFPTYP  YDLV A  LL+L++ Q  S C +L +  E+DRL RPEGW+IIRDTV LV
Sbjct  563  WCEAFPTYPRTYDLVHADSLLSLQTSQRKSSCSLLQILTEVDRLLRPEGWVIIRDTVQLV  622

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            + ARA +T+LKW+ARV+E+ES+SD++LL+CQKP  KR +
Sbjct  623  EAARALTTQLKWEARVIEVESSSDQRLLICQKPFTKRQS  661



>ref|XP_009128288.1| PREDICTED: probable pectin methyltransferase QUA2 [Brassica rapa]
Length=662

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQH-SRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCEAFPTYP  YDLV A  LL+L++ Q  S C +L +  E+DRL RPEGW+IIRDTV LV
Sbjct  563  WCEAFPTYPRTYDLVHADSLLSLQTSQRKSSCSLLQILTEVDRLLRPEGWVIIRDTVQLV  622

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            + ARA +T+LKW+ARV+E+ES+SD++LL+CQKP  KR +
Sbjct  623  EAARALTTQLKWEARVIEVESSSDQRLLICQKPFTKRQS  661



>emb|CDY26858.1| BnaA02g18830D [Brassica napus]
Length=684

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLE-SEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCEAFPTYP  YDLV A  LL+L+ S++ S C +L +  E+DRL RPEGW+IIRDTV LV
Sbjct  585  WCEAFPTYPRTYDLVHADNLLSLQMSQRKSSCSLLQILTEVDRLLRPEGWVIIRDTVQLV  644

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            + ARA +T+LKW+ARV+E+ES+SD++LL+CQKP  KR +
Sbjct  645  EAARALTTQLKWEARVIEVESSSDQRLLICQKPFTKRQS  683



>ref|XP_006300626.1| hypothetical protein CARUB_v10019895mg [Capsella rubella]
 gb|EOA33524.1| hypothetical protein CARUB_v10019895mg [Capsella rubella]
Length=687

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSR-CGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YDLV A  LL+L++ Q  + C +LD+F EIDRL RPEGW+IIRDT  LV
Sbjct  587  WCEPFPTYPRTYDLVHADNLLSLQTSQRRKGCSLLDMFTEIDRLLRPEGWVIIRDTTLLV  646

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
            + ARA  T+LKW+ARV+E+ES+SD++LL+CQKP+ KR  S
Sbjct  647  EKARALVTQLKWEARVIEVESSSDQRLLICQKPLTKRQQS  686



>emb|CDX79252.1| BnaC06g20510D [Brassica napus]
Length=684

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQ-HSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCEAFP+YP  YDLV A  LLTL++ +  S C  + +F EIDRL RPEGW+IIRDT  LV
Sbjct  585  WCEAFPSYPRTYDLVHADNLLTLQTSKLRSSCSFMQIFTEIDRLLRPEGWVIIRDTAQLV  644

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            + ARA +T+LKW+ARV+E+ES+S+++LLVCQKPI KR +
Sbjct  645  EAARALTTQLKWEARVIEVESSSEQRLLVCQKPITKRQS  683



>emb|CDX68025.1| BnaA07g20650D [Brassica napus]
Length=683

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQ-HSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCEAFP+YP  YDLV A  LLTL++ +  S C  + +F EIDRL RPEGW+IIRDT  LV
Sbjct  584  WCEAFPSYPRTYDLVHADNLLTLQTSKLRSSCSFMQIFTEIDRLLRPEGWVIIRDTAQLV  643

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            + ARA +T+LKW+ARV+E+ES+S+++LLVCQKPI KR +
Sbjct  644  EAARALTTQLKWEARVIEVESSSEQRLLVCQKPITKRQS  682



>ref|XP_009104583.1| PREDICTED: probable pectin methyltransferase QUA2 [Brassica rapa]
 ref|XP_009104584.1| PREDICTED: probable pectin methyltransferase QUA2 [Brassica rapa]
Length=684

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQ-HSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCEAFP+YP  YDLV A  LLTL++ +  S C  + +F EIDRL RPEGW+IIRDT  LV
Sbjct  585  WCEAFPSYPRTYDLVHADNLLTLQTSKLRSSCSFMQIFTEIDRLLRPEGWVIIRDTAQLV  644

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            + ARA +T+LKW+ARV+E+ES+S+++LLVCQKPI KR +
Sbjct  645  EAARALTTQLKWEARVIEVESSSEQRLLVCQKPITKRQS  683



>ref|XP_003570613.2| PREDICTED: probable pectin methyltransferase QUA2 [Brachypodium 
distachyon]
Length=1014

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A G L+LE     RC  LD+F+E+DR+ RPEGWIIIRDT PL++
Sbjct  566  WCEAFPTYPRTYDMVHADGFLSLEKRSKRRCSTLDIFLEVDRILRPEGWIIIRDTAPLIE  625

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
             AR+ + +L+WDAR+++++  SDEKLLVCQKP +++ +
Sbjct  626  AARSVAAQLRWDARILDLDIASDEKLLVCQKPFLRKQS  663



>gb|AFW73428.1| hypothetical protein ZEAMMB73_978140 [Zea mays]
Length=381

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WC+AF TYP  YD+V A G L+LE     RC  LD+F+E+DR+ RPEGW+IIRDT PL++
Sbjct  286  WCDAFATYPRTYDMVHADGFLSLEKTHKHRCSTLDIFLEVDRILRPEGWVIIRDTAPLIE  345

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+L+WDAR+++++  SDEKLLVCQKP +++
Sbjct  346  AARSVVTQLRWDARILDLDIASDEKLLVCQKPFLRK  381



>ref|XP_002889181.1| hypothetical protein ARALYDRAFT_895718 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65440.1| hypothetical protein ARALYDRAFT_895718 [Arabidopsis lyrata subsp. 
lyrata]
Length=683

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSR-CGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YDLV A  LL+L++ Q  + C ++D+F EIDRL RPEGW+IIRDTV LV
Sbjct  584  WCEPFPTYPRTYDLVHADNLLSLQTSQRRKSCRLIDIFTEIDRLLRPEGWVIIRDTVQLV  643

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            + ARA  T+LKW+ARV+E+ES+S+++LL+CQKP  KR +
Sbjct  644  ESARALVTQLKWEARVIEVESSSEQRLLICQKPFTKRQS  682



>ref|XP_008679296.1| PREDICTED: probable pectin methyltransferase QUA2 [Zea mays]
Length=659

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WC+AFPTYP  YD+V A G L+L+     RC  LD+F+E+DR+ RPEGW+IIRD  PL++
Sbjct  564  WCDAFPTYPRTYDMVHADGFLSLQKNHKHRCSTLDIFLEVDRILRPEGWVIIRDAAPLIE  623

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+L+WDARV++++  SDEKLLVCQKP +++
Sbjct  624  AARSVVTQLRWDARVLDLDIASDEKLLVCQKPFLRK  659



>gb|AFW64432.1| hypothetical protein ZEAMMB73_102169 [Zea mays]
Length=699

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WC+AFPTYP  YD+V A G L+L+     RC  LD+F+E+DR+ RPEGW+IIRD  PL++
Sbjct  604  WCDAFPTYPRTYDMVHADGFLSLQKNHKHRCSTLDIFLEVDRILRPEGWVIIRDAAPLIE  663

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+L+WDARV++++  SDEKLLVCQKP +++
Sbjct  664  AARSVVTQLRWDARVLDLDIASDEKLLVCQKPFLRK  699



>ref|XP_008646287.1| PREDICTED: probable pectin methyltransferase QUA2 [Zea mays]
 gb|AFW73498.1| hypothetical protein ZEAMMB73_264626 [Zea mays]
Length=657

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WC+AF TYP  YD+V A G L+LE     RC  LD+F+E+DR+ RPEGW+IIRDT PL++
Sbjct  562  WCDAFATYPRTYDMVHADGFLSLEKTHKHRCSTLDIFLEVDRILRPEGWVIIRDTAPLIE  621

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+  T+L+WDAR+++++  SDEKLLVCQKP +++
Sbjct  622  AARSVVTQLRWDARILDLDIASDEKLLVCQKPFLRK  657



>ref|XP_010428946.1| PREDICTED: probable pectin methyltransferase QUA2 [Camelina sativa]
Length=692

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQH--SRCGMLDLFIEIDRLTRPEGWIIIRDTVPL  434
            WCE FPTYP  YDLV A  LL+L++ Q   S+C ++ +F EIDRL RPEGW+IIRDT  L
Sbjct  591  WCEPFPTYPRTYDLVHADNLLSLQTGQRRRSQCSLMAIFTEIDRLLRPEGWVIIRDTALL  650

Query  433  VDLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
            V+ ARA  T+LKW+ARV+E+ES+S+++LL+CQKP+ KR  S
Sbjct  651  VEKARAMITQLKWEARVIEVESSSEQRLLICQKPLTKRQQS  691



>gb|KJB80353.1| hypothetical protein B456_013G093300 [Gossypium raimondii]
Length=618

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 81/97 (84%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YDL+ A GLL+ L SE   RCG+++LFIE+DR+ RPEGW+++ D + ++
Sbjct  525  WCEPFPTYPRTYDLLHANGLLSHLTSE---RCGLMELFIEMDRILRPEGWVVLSDKLGVI  581

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +LARAH+T+++WDARV+++++ SDE+LLVCQKP +K+
Sbjct  582  ELARAHATQIRWDARVIDLQNGSDERLLVCQKPFLKK  618



>ref|XP_010416801.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Camelina sativa]
 ref|XP_010416802.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Camelina sativa]
Length=689

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 78/101 (77%), Gaps = 2/101 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSR--CGMLDLFIEIDRLTRPEGWIIIRDTVPL  434
            WCE FPTYP  YDLV A  LL+L++ Q  R  C ++ +F EIDRL RPEGW+IIRDT  L
Sbjct  588  WCEPFPTYPRTYDLVHADNLLSLQTTQRRRSPCSLMAIFTEIDRLLRPEGWVIIRDTALL  647

Query  433  VDLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
            V+ ARA  T+LKW+ARV+E+ES+S+++LL+CQKP+ KR  S
Sbjct  648  VEKARAMITQLKWEARVIEVESSSEQRLLICQKPLTKRQQS  688



>ref|XP_010472034.1| PREDICTED: probable pectin methyltransferase QUA2 [Camelina sativa]
Length=688

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 78/101 (77%), Gaps = 2/101 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSR--CGMLDLFIEIDRLTRPEGWIIIRDTVPL  434
            WCE FPTYP  YDLV A  LL+L++ Q  R  C ++ +F EIDRL RPEGW+IIRDT  L
Sbjct  587  WCEPFPTYPRTYDLVHADNLLSLQTTQRRRSPCSLMAIFTEIDRLLRPEGWVIIRDTALL  646

Query  433  VDLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXAS  311
            V+ ARA  T+LKW+ARV+E+ES+S+++LL+CQKP+ KR  S
Sbjct  647  VEKARAMITQLKWEARVIEVESSSEQRLLICQKPLTKRQQS  687



>gb|AAG52090.1|AC012680_1 unknown protein, 5' partial; 69506-67937 [Arabidopsis thaliana]
Length=379

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSR-CGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YDLV A  LL+L++ Q  + C ++D+F EIDRL RPEGW+IIRDT  LV
Sbjct  280  WCEPFPTYPRTYDLVHADNLLSLQTSQPRKTCLLIDIFTEIDRLLRPEGWVIIRDTAQLV  339

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            + AR   T+LKW+ARV+E+ES+S+++LL+CQKP  KR +
Sbjct  340  EKARETITQLKWEARVIEVESSSEQRLLICQKPFTKRQS  378



>gb|KHG30605.1| hypothetical protein F383_04558 [Gossypium arboreum]
Length=673

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 81/97 (84%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YDL+ A GLL+ L SE   RCG+++LFIE+DR+ RPEGW+++ D + ++
Sbjct  580  WCEPFPTYPRTYDLLHANGLLSHLTSE---RCGLMELFIEMDRILRPEGWVVLSDKLGVI  636

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +LARAH+T+++WDARV+++++ SDE+LLVCQ+P +K+
Sbjct  637  ELARAHATQIRWDARVIDLQNGSDERLLVCQRPFVKK  673



>gb|EPS65073.1| hypothetical protein M569_09706, partial [Genlisea aurea]
Length=682

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDLV A GLL+LE  +  RC ++DLF+EIDR+ RPEGW+I++D    ++
Sbjct  585  WCEPFPTYPRTYDLVHAQGLLSLEFNEKPRCRLIDLFVEIDRVLRPEGWVILKDGARAIE  644

Query  427  LARAHSTRLKWDARVVEIESN-SDEKLLVCQKPIIKR  320
            +AR  +T+LKW+AR+VE E N  DE+LL+CQKP  KR
Sbjct  645  VARPVTTQLKWEARIVETEGNGGDERLLICQKPFFKR  681



>ref|XP_006583950.1| PREDICTED: probable methyltransferase PMT5-like [Glycine max]
Length=626

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 79/97 (81%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YD++ AYGL++ L SE   RC M+DLF+E+DR+ RPEGW+I+ DT+  +
Sbjct  533  WCEPFPTYPRTYDMLHAYGLISHLSSE---RCSMVDLFLEMDRILRPEGWVILSDTMGAI  589

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            ++AR  +T+++WDAR+V++++ SD++LLVCQKP +K+
Sbjct  590  EMARMFATQVRWDARIVDLQNGSDQRLLVCQKPFVKK  626



>ref|NP_177948.3| putative pectin methyltransferase TSD2 [Arabidopsis thaliana]
 ref|NP_001154475.1| putative pectin methyltransferase TSD2 [Arabidopsis thaliana]
 sp|Q9C9Q8.2|PMTT_ARATH RecName: Full=Probable pectin methyltransferase QUA2; AltName: 
Full=Protein OVERSENSITIVE TO SUGAR 1; AltName: Full=Protein 
QUASIMODO 2; AltName: Full=Protein TUMOROUS SHOOT DEVELOPMENT 
2 [Arabidopsis thaliana]
 gb|AEE36085.1| putative pectin methyltransferase TSD2 [Arabidopsis thaliana]
 gb|AEE36086.1| putative pectin methyltransferase TSD2 [Arabidopsis thaliana]
Length=684

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSR-CGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YDLV A  LL+L++ Q  + C ++D+F EIDRL RPEGW+IIRDT  LV
Sbjct  585  WCEPFPTYPRTYDLVHADNLLSLQTSQPRKTCLLIDIFTEIDRLLRPEGWVIIRDTAQLV  644

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            + AR   T+LKW+ARV+E+ES+S+++LL+CQKP  KR +
Sbjct  645  EKARETITQLKWEARVIEVESSSEQRLLICQKPFTKRQS  683



>ref|XP_007045897.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045898.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045899.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045900.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045902.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045903.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01729.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01730.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01731.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01732.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01734.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01735.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
Length=619

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+  S +  RC ++DLF+E+DR+ RPEGW+++ D +  ++
Sbjct  526  WCEPFPTYPRTYDMLHANGLLSHLSSE--RCSLMDLFVEMDRILRPEGWVVLSDKLGAIE  583

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             ARAH+T+++WDARV+++++ SD++LLVCQKP +K+
Sbjct  584  WARAHATQIRWDARVIDLQNGSDQRLLVCQKPFVKK  619



>ref|XP_007045896.1| Quasimodo2 like 2 isoform 1 [Theobroma cacao]
 gb|EOY01728.1| Quasimodo2 like 2 isoform 1 [Theobroma cacao]
Length=618

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+  S +  RC ++DLF+E+DR+ RPEGW+++ D +  ++
Sbjct  525  WCEPFPTYPRTYDMLHANGLLSHLSSE--RCSLMDLFVEMDRILRPEGWVVLSDKLGAIE  582

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             ARAH+T+++WDARV+++++ SD++LLVCQKP +K+
Sbjct  583  WARAHATQIRWDARVIDLQNGSDQRLLVCQKPFVKK  618



>ref|XP_007045901.1| Quasimodo2 like 2 isoform 6 [Theobroma cacao]
 gb|EOY01733.1| Quasimodo2 like 2 isoform 6 [Theobroma cacao]
Length=619

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+  S +  RC ++DLF+E+DR+ RPEGW+++ D +  ++
Sbjct  526  WCEPFPTYPRTYDMLHANGLLSHLSSE--RCSLMDLFVEMDRILRPEGWVVLSDKLGAIE  583

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             ARAH+T+++WDARV+++++ SD++LLVCQKP +K+
Sbjct  584  WARAHATQIRWDARVIDLQNGSDQRLLVCQKPFVKK  619



>gb|KHG21066.1| hypothetical protein F383_04870 [Gossypium arboreum]
Length=621

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 79/97 (81%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YDL+ A GLL+ L SE   RC +++LF+E+DR+ RPEGW+++ D +  +
Sbjct  528  WCEPFPTYPRTYDLLHANGLLSHLTSE---RCSLVELFVEMDRILRPEGWVVLSDKLGAI  584

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +LARAH+T+++WDARV+++++ +D++LLVCQKP +K+
Sbjct  585  ELARAHATQVRWDARVIDVQNGNDQRLLVCQKPFVKK  621



>gb|KJB50579.1| hypothetical protein B456_008G177800 [Gossypium raimondii]
Length=618

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 79/97 (81%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YDL+ A GLL+ L SE   RC +++LF+E+DR+ RPEGW+++ D +  +
Sbjct  525  WCEPFPTYPRTYDLLHANGLLSHLTSE---RCSLVELFVEMDRILRPEGWVVLSDKLGAI  581

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +LARAH+T+++WDARV+++++ +D++LLVCQKP +K+
Sbjct  582  ELARAHATQVRWDARVIDVQNGNDQRLLVCQKPFVKK  618



>gb|KHN20522.1| Putative methyltransferase PMT4 [Glycine soja]
Length=297

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 77/96 (80%), Gaps = 4/96 (4%)
 Frame = -1

Query  604  CEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            CE FPTYP  YD++ AYGL++ L SE   RC M+DLF+E+DR+ RPEGW+I+ DT+  ++
Sbjct  205  CEPFPTYPRTYDMLHAYGLISHLSSE---RCSMVDLFLEMDRILRPEGWVILSDTIGAIE  261

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  + +++WDAR++++++ SD++LLVCQKP +K+
Sbjct  262  MARMLAAQVRWDARIIDLQNGSDQRLLVCQKPFVKK  297



>ref|XP_006605543.1| PREDICTED: probable methyltransferase PMT5-like [Glycine max]
Length=624

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ AYGL++  S +  RC M+DLF+E+DR+ RPEGW+I+ DT+  ++
Sbjct  531  WCEPFPTYPRTYDMLHAYGLISHLSSE--RCSMVDLFLEMDRILRPEGWVILSDTIGAIE  588

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  + +++WDAR++++++ SD++LLVCQKP +K+
Sbjct  589  MARMLAAQVRWDARIIDLQNGSDQRLLVCQKPFVKK  624



>emb|CDY45558.1| BnaC09g21520D [Brassica napus]
Length=590

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLTL S +  RC ++DLF+EIDR+ RPEGW++I D + +++
Sbjct  497  WCEPFPTYPRTYDMLHANELLTLLSSE--RCSLMDLFLEIDRILRPEGWVVISDKLGVIE  554

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA +TR++W+ARV++++  SD++LLVCQKP +K+
Sbjct  555  MARALATRVRWEARVIDLQDGSDQRLLVCQKPFLKK  590



>ref|XP_008353088.1| PREDICTED: probable methyltransferase PMT4 [Malus domestica]
Length=417

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+  S +  RCGM+DLF+E+DR+ RPEGW+++ D    ++
Sbjct  324  WCEPFPTYPRTYDLLHADGLLSHLSSE--RCGMMDLFLEMDRILRPEGWVVLCDKKGAIE  381

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  +T+++W+ARV+++E+ SD++LLVCQKP +K+
Sbjct  382  MARMFATQIRWEARVIDLENGSDQRLLVCQKPFVKK  417



>gb|KHG00547.1| hypothetical protein F383_17617 [Gossypium arboreum]
Length=600

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+  S +  RC ++DLF+E+DR+ RPEGW+++ D +  ++
Sbjct  507  WCEPFPTYPRTYDMLHANGLLSHLSSE--RCSLMDLFVEMDRILRPEGWVVLYDKLGAIE  564

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            LARAH+T+++W ARV++I++ SD++LL+CQKP + +
Sbjct  565  LARAHATQIRWGARVIDIQNGSDQRLLICQKPFLTK  600



>gb|EMS61645.1| putative pectin methyltransferase QUA2 [Triticum urartu]
Length=730

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YD+V A G L+LE  Q  RC  LD+F+E+DR+ RPEGWIIIRDT PL++
Sbjct  355  WCEAFPTYPRTYDMVHADGFLSLEKRQKRRCSTLDIFLEVDRILRPEGWIIIRDTAPLIE  414

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPI  329
             AR+ + +L+WDAR+++++  SDEKLL     I
Sbjct  415  AARSVAAQLRWDARILDLDIASDEKLLFIDPTI  447



>ref|XP_011463023.1| PREDICTED: probable methyltransferase PMT5 [Fragaria vesca subsp. 
vesca]
 ref|XP_011463024.1| PREDICTED: probable methyltransferase PMT5 [Fragaria vesca subsp. 
vesca]
 ref|XP_011463025.1| PREDICTED: probable methyltransferase PMT5 [Fragaria vesca subsp. 
vesca]
Length=621

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+L S +  RC M+DLF+E+DR+ RPEGW+++ D V  ++
Sbjct  528  WCEPFPTYPRTYDLLHANGLLSLLSSE--RCSMMDLFLEMDRILRPEGWVVLSDKVGPIE  585

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  +T+++W+ARV++ ++ SD++LLVCQKP +K+
Sbjct  586  MARMFATQVRWEARVIDPQNGSDQRLLVCQKPFVKK  621



>ref|XP_008361773.1| PREDICTED: probable methyltransferase PMT5 [Malus domestica]
Length=620

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+  S +  RCGM+DLF+E+DR+ RPEGW+++ D    ++
Sbjct  527  WCEPFPTYPRTYDLLHADGLLSHLSSE--RCGMMDLFLEMDRILRPEGWVVLCDKKGAIE  584

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  +T+++W+ARV+++E+ SD++LLVCQKP +K+
Sbjct  585  MARMFATQIRWEARVIDLENGSDQRLLVCQKPFVKK  620



>ref|XP_010554289.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
Length=620

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW++I D + +++
Sbjct  527  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVISDKLGVIE  584

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA +TR++W+ARV++I+  SD++LLVCQKP +K+
Sbjct  585  MARAFATRVRWEARVIDIQDGSDQRLLVCQKPFLKK  620



>ref|XP_009356400.1| PREDICTED: probable methyltransferase PMT5 [Pyrus x bretschneideri]
Length=620

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+  S +  RC M+DLF+E+DR+ RPEGW+++ D V  ++
Sbjct  527  WCEPFPTYPRTYDLLHANGLLSHLSSE--RCSMMDLFLEMDRILRPEGWVVLCDKVGAIE  584

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  +T+++W+ARV+++++ SD++LLVCQKP +K+
Sbjct  585  MARVFATQIRWEARVIDLQNGSDQRLLVCQKPFVKK  620



>ref|XP_009129088.1| PREDICTED: probable methyltransferase PMT5 [Brassica rapa]
Length=614

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW++I D V +++
Sbjct  521  WCEPFPTYPRTYDMLHANELLTHVSSE--RCSLMDLFLEMDRILRPEGWVVISDKVGVIE  578

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA +TR++W+ARV++++  SD++LLVCQKP +K+
Sbjct  579  MARALATRVRWEARVIDLQDGSDQRLLVCQKPFLKK  614



>ref|XP_008221508.1| PREDICTED: probable methyltransferase PMT5 [Prunus mume]
Length=620

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+  S +  RC M+DLF+E+DR+ RPEGW+++ D V  ++
Sbjct  527  WCEPFPTYPRTYDLLHANGLLSHLSSE--RCSMMDLFLEMDRILRPEGWVVLCDKVGAIE  584

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  +T+++W+ARV+++++ SD++LLVCQKP +K+
Sbjct  585  MARMFATQIRWEARVIDLQNGSDQRLLVCQKPFVKK  620



>gb|AAD17428.2| expressed protein [Arabidopsis thaliana]
Length=380

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D V +++
Sbjct  287  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKVGVIE  344

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA + R++W+ARV++++  SD++LLVCQKP IK+
Sbjct  345  MARALAARVRWEARVIDLQDGSDQRLLVCQKPFIKK  380



>ref|XP_007226959.1| hypothetical protein PRUPE_ppa002650mg [Prunus persica]
 gb|EMJ28158.1| hypothetical protein PRUPE_ppa002650mg [Prunus persica]
Length=648

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+  S +  RC M+DLF+E+DR+ RPEGW+++ D V  ++
Sbjct  555  WCEPFPTYPRTYDLLHANGLLSHLSSE--RCSMMDLFLEMDRILRPEGWVVLCDKVGAIE  612

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  +T+++W+ARV+++++ SD++LLVCQKP +K+
Sbjct  613  MARMFATQIRWEARVIDLQNGSDQRLLVCQKPFVKK  648



>ref|XP_009114154.1| PREDICTED: probable methyltransferase PMT5 [Brassica rapa]
Length=613

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLTL S +  +C ++DLF+E+DR+ RPEGW++I D + +++
Sbjct  520  WCEPFPTYPRTYDMLHANELLTLLSSE--QCSLMDLFLEMDRILRPEGWVVISDKLGVIE  577

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA +TR++W+ARV++++  SD++LLVCQKP +K+
Sbjct  578  MARALATRVRWEARVIDLQDGSDQRLLVCQKPFLKK  613



>ref|XP_007157839.1| hypothetical protein PHAVU_002G102600g [Phaseolus vulgaris]
 gb|ESW29833.1| hypothetical protein PHAVU_002G102600g [Phaseolus vulgaris]
Length=611

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+  S +  RC M+DLF+E+DR+ RPEGW+I+ DT+  ++
Sbjct  518  WCEPFPTYPRTYDLLHADGLLSHLSSE--RCSMIDLFLEMDRILRPEGWVILSDTMGAIE  575

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            ++R  +T+++W+ARV+++++ SD++LLVCQKP +K+
Sbjct  576  MSRMVATQVRWEARVIDLQNGSDQRLLVCQKPFVKK  611



>gb|AAN46794.1| At2g03480/T4M8.9 [Arabidopsis thaliana]
Length=394

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D V +++
Sbjct  287  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKVGVIE  344

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            +ARA + R++W+ARV++++  SD++LLVCQKP IK  +
Sbjct  345  MARALAARVRWEARVIDLQDGSDQRLLVCQKPFIKNNS  382



>gb|AAK63953.1| At2g03480/T4M8.9 [Arabidopsis thaliana]
Length=394

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D V +++
Sbjct  287  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKVGVIE  344

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKRXA  314
            +ARA + R++W+ARV++++  SD++LLVCQKP IK  +
Sbjct  345  MARALAARVRWEARVIDLQDGSDQRLLVCQKPFIKNNS  382



>ref|XP_009152172.1| PREDICTED: probable methyltransferase PMT5 [Brassica rapa]
Length=620

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW++I D + +++
Sbjct  527  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVISDKLGVIE  584

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA +TR++W+ARV++++  SD++LLVCQKP +K+
Sbjct  585  MARAMATRVRWEARVIDLQDGSDQRLLVCQKPFLKK  620



>ref|XP_004505366.1| PREDICTED: probable methyltransferase PMT5-like [Cicer arietinum]
Length=619

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+    +  RC M+DLF+E+DR+ RPEGW+I  DTV  ++
Sbjct  526  WCEPFPTYPRTYDMLHANGLLSQFISE--RCSMIDLFLEMDRILRPEGWVIFSDTVATIE  583

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  +T+++WDAR++++++ SD++LL+CQKP +K+
Sbjct  584  IARTLATQVRWDARIIDLQNGSDQRLLICQKPFLKK  619



>emb|CDY04154.1| BnaA09g19320D [Brassica napus]
Length=807

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLTL S +  +C ++DLF+E+DR+ RPEGW++I D + +++
Sbjct  714  WCEPFPTYPRTYDMLHANELLTLLSSE--QCSLMDLFLEMDRILRPEGWVVISDKLGVIE  771

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA +TR++W+ARV++++  SD++LLVCQKP +K+
Sbjct  772  MARALATRVRWEARVIDLQDGSDQRLLVCQKPFLKK  807



>ref|XP_006292704.1| hypothetical protein CARUB_v10018950mg [Capsella rubella]
 gb|EOA25602.1| hypothetical protein CARUB_v10018950mg [Capsella rubella]
Length=606

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 76/97 (78%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YD++ A  LLT L SEQ   C ++DLF+E+DR+ RPEGW++I D V ++
Sbjct  513  WCEPFPTYPRTYDMLHANELLTHLSSEQ---CSLMDLFLEMDRILRPEGWVVISDKVEVI  569

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            ++ARA + R++W+ARV++I+  SD++LLVCQKP +K+
Sbjct  570  EVARALAARVRWEARVIDIQDGSDQRLLVCQKPFLKK  606



>gb|KJB30458.1| hypothetical protein B456_005G145000 [Gossypium raimondii]
Length=617

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+  S +  RC ++DLF+E+DR+ RPEGW ++ D +  ++
Sbjct  524  WCEPFPTYPRTYDMLHANGLLSHLSSE--RCSLMDLFVEMDRILRPEGWAVLYDKLGAIE  581

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            LARAH+T+++W ARV+++++ SD++LL+CQKP + +
Sbjct  582  LARAHATQIRWGARVIDLQNGSDQRLLICQKPFLTK  617



>ref|NP_027543.2| QUASIMODO2 like 2 [Arabidopsis thaliana]
 sp|Q3EC77.2|PMT5_ARATH RecName: Full=Probable methyltransferase PMT5 [Arabidopsis thaliana]
 gb|AEC05705.1| QUASIMODO2 like 2 [Arabidopsis thaliana]
Length=606

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D V +++
Sbjct  513  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKVGVIE  570

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA + R++W+ARV++++  SD++LLVCQKP IK+
Sbjct  571  MARALAARVRWEARVIDLQDGSDQRLLVCQKPFIKK  606



>ref|NP_973410.1| QUASIMODO2 like 2 [Arabidopsis thaliana]
 gb|AEC05706.1| QUASIMODO2 like 2 [Arabidopsis thaliana]
Length=595

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D V +++
Sbjct  502  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKVGVIE  559

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA + R++W+ARV++++  SD++LLVCQKP IK+
Sbjct  560  MARALAARVRWEARVIDLQDGSDQRLLVCQKPFIKK  595



>ref|XP_006853194.1| hypothetical protein AMTR_s00038p00207680 [Amborella trichopoda]
 gb|ERN14661.1| hypothetical protein AMTR_s00038p00207680 [Amborella trichopoda]
Length=727

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDL+ A G+++ ++     C +L+LF+E+DR+ RPEGW+I+RDT   ++
Sbjct  632  WCEAFPTYPRTYDLIHAQGIVSFQTASRPWCPILNLFLEMDRILRPEGWVILRDTTLSIE  691

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
              R  + +++WDARVVE+E N++E+LL+CQKP IK+
Sbjct  692  AGRTLAAQMRWDARVVELE-NNEERLLICQKPFIKK  726



>ref|NP_849656.2| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 gb|AEE29074.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
Length=447

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D + +++
Sbjct  354  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKLGVIE  411

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  + R++W+ARV++I+  SD++LLVCQKP++K+
Sbjct  412  MARTLAARVRWEARVIDIQDGSDQRLLVCQKPLLKK  447



>ref|XP_010425141.1| PREDICTED: probable methyltransferase PMT5 isoform X2 [Camelina 
sativa]
Length=620

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D V +++
Sbjct  527  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKVGVIE  584

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA + R++W+ARV++++  SD++LLVCQKP +K+
Sbjct  585  MARALTARVRWEARVIDLQDGSDQRLLVCQKPFLKK  620



>ref|XP_010514117.1| PREDICTED: probable methyltransferase PMT5 [Camelina sativa]
Length=620

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D V +++
Sbjct  527  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKVGVIE  584

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA + R++W+ARV++++  SD++LLVCQKP +K+
Sbjct  585  MARALTARVRWEARVIDLQDGSDQRLLVCQKPFLKK  620



>ref|XP_011018345.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Populus 
euphratica]
 ref|XP_011018353.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Populus 
euphratica]
Length=619

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLLT  S +  RC M+DLF+E+DR+ RPEGW+I  D +  ++
Sbjct  526  WCEPFPTYPRTYDLLHANGLLTHLSSE--RCSMMDLFLEMDRILRPEGWVIFSDKLGAIE  583

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +A+A + ++ W+ARV+++++ SD++LLVCQKP +K+
Sbjct  584  MAQALAMQIHWEARVIDLDNGSDQRLLVCQKPFLKK  619



>ref|XP_010425139.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Camelina 
sativa]
 ref|XP_010425140.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Camelina 
sativa]
Length=621

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D V +++
Sbjct  528  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKVGVIE  585

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA + R++W+ARV++++  SD++LLVCQKP +K+
Sbjct  586  MARALTARVRWEARVIDLQDGSDQRLLVCQKPFLKK  621



>ref|XP_002892777.1| hypothetical protein ARALYDRAFT_471543 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69036.1| hypothetical protein ARALYDRAFT_471543 [Arabidopsis lyrata subsp. 
lyrata]
Length=603

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D + +++
Sbjct  510  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKLGVIE  567

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  + R++W+ARV++IE  SD++LLVCQKP +K+
Sbjct  568  MARTFAARVRWEARVIDIEDGSDQRLLVCQKPFLKK  603



>ref|XP_002512094.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF50763.1| ATP binding protein, putative [Ricinus communis]
Length=620

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+  S +  RC M+DL +E+DR+ RPEGW+++ D +  ++
Sbjct  527  WCEPFPTYPRTYDMLHANGLLSHLSSE--RCSMMDLLLEMDRILRPEGWVVLSDKLGAIE  584

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA +T++ W+ARV+++++ SD++LLVCQKP +K+
Sbjct  585  MARALATQIHWEARVIDLQNGSDQRLLVCQKPFVKK  620



>ref|XP_002316092.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEF02263.1| dehydration-responsive family protein [Populus trichocarpa]
Length=617

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+  S +  RC M+DLF+E+DR+ RPEGW+I  D +  ++
Sbjct  524  WCEPFPTYPRTYDMLHANGLLSHLSSE--RCAMMDLFLEMDRILRPEGWVIFSDKLGAIE  581

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA + ++ W+ARV+++++ SD++LLVCQKP +K+
Sbjct  582  MARALAMQIHWEARVIDLDNGSDQRLLVCQKPFMKK  617



>gb|AES89995.2| methyltransferase PMT16, putative [Medicago truncatula]
Length=606

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+    +  RC M+DLF+E+DR+ RPEGWII+ DTV  ++
Sbjct  513  WCEPFPTYPRTYDLLHANGLLSQFISE--RCSMIDLFLEMDRILRPEGWIILSDTVGTIE  570

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  +T+++W+AR++++++ SD++LLVCQK  +K+
Sbjct  571  MARTLATQVRWEARIIDLQNGSDQRLLVCQKLFLKK  606



>ref|XP_011012134.1| PREDICTED: probable methyltransferase PMT5 [Populus euphratica]
 ref|XP_011012142.1| PREDICTED: probable methyltransferase PMT5 [Populus euphratica]
 ref|XP_011012150.1| PREDICTED: probable methyltransferase PMT5 [Populus euphratica]
Length=619

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+  S +  RC M+DLF+E+DR+ RPEGW++  D +  ++
Sbjct  526  WCEPFPTYPRTYDMLHANGLLSHLSSE--RCAMMDLFLEMDRILRPEGWVVFSDKLGAIE  583

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA + ++ W+ARV+++++ SD++LLVCQKP +K+
Sbjct  584  MARALAMQIHWEARVIDLDNGSDQRLLVCQKPFMKK  619



>ref|XP_010527954.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
 ref|XP_010527955.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
 ref|XP_010527956.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
 ref|XP_010527957.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
Length=619

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC M+DLF+E+DR+ RPEGW+++ D V +++
Sbjct  526  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSMMDLFLEMDRILRPEGWVVMSDKVGVIE  583

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            + R  +TR++W+ARV++++  +D++LLVCQKP +K+
Sbjct  584  MGRELATRVRWEARVIDLQGGNDQRLLVCQKPFLKK  619



>ref|XP_006484179.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Citrus 
sinensis]
 ref|XP_006484180.1| PREDICTED: probable methyltransferase PMT5-like isoform X2 [Citrus 
sinensis]
 ref|XP_006484181.1| PREDICTED: probable methyltransferase PMT5-like isoform X3 [Citrus 
sinensis]
Length=619

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+  S +  RC ++DLF+E+DR+ RPEGW++I D +  ++
Sbjct  526  WCEPFPTYPRTYDMLHANGLLSHLSSE--RCDLMDLFLEMDRILRPEGWVVISDKLGAIE  583

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR   T+++W+ARV+++++ SD++LLVCQKP +K+
Sbjct  584  MARMVVTQMRWEARVIDLQNGSDQRLLVCQKPFLKK  619



>ref|XP_006395700.1| hypothetical protein EUTSA_v10003873mg [Eutrema salsugineum]
 ref|XP_006395701.1| hypothetical protein EUTSA_v10003873mg [Eutrema salsugineum]
 gb|ESQ32986.1| hypothetical protein EUTSA_v10003873mg [Eutrema salsugineum]
 gb|ESQ32987.1| hypothetical protein EUTSA_v10003873mg [Eutrema salsugineum]
Length=595

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D + +++
Sbjct  502  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKLGVIE  559

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA + R++W+ARV++++  SD++LLVCQKP +K+
Sbjct  560  MARALAARVRWEARVIDLQDGSDQRLLVCQKPFLKK  595



>ref|XP_010066852.1| PREDICTED: probable methyltransferase PMT5 [Eucalyptus grandis]
 gb|KCW64894.1| hypothetical protein EUGRSUZ_G02456 [Eucalyptus grandis]
Length=618

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+  S +  RC M+DL +E+DR+ RPEGW+++ D + +++
Sbjct  525  WCEPFPTYPRTYDMLHANGLLSHLSSE--RCSMMDLLLEMDRILRPEGWVVLSDRMGVIE  582

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            LAR  +T+++W+ARV+++++ SD++LLVCQKP +++
Sbjct  583  LARMLATQIRWEARVIDLQNGSDQRLLVCQKPFVRK  618



>ref|XP_003607798.1| hypothetical protein MTR_4g083030 [Medicago truncatula]
Length=628

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+    +  RC M+DLF+E+DR+ RPEGWII+ DTV  ++
Sbjct  535  WCEPFPTYPRTYDLLHANGLLSQFISE--RCSMIDLFLEMDRILRPEGWIILSDTVGTIE  592

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  +T+++W+AR++++++ SD++LLVCQK  +K+
Sbjct  593  MARTLATQVRWEARIIDLQNGSDQRLLVCQKLFLKK  628



>ref|XP_002875206.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51465.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=619

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D V +++
Sbjct  526  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKVGVIE  583

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA + R++W++RV++++  SD++LLVCQKP +K+
Sbjct  584  MARALAARVRWESRVIDLQDGSDQRLLVCQKPFLKK  619



>ref|XP_010502360.1| PREDICTED: probable methyltransferase PMT5 [Camelina sativa]
 ref|XP_010502361.1| PREDICTED: probable methyltransferase PMT5 [Camelina sativa]
Length=620

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D V +++
Sbjct  527  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKVGVIE  584

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA + R++W+ARV++++  SD++LLVC+KP +K+
Sbjct  585  MARALTARVRWEARVIDLQDGSDQRLLVCEKPFLKK  620



>dbj|BAH56871.1| AT1G13860 [Arabidopsis thaliana]
Length=650

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D + +++
Sbjct  510  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKLGVIE  567

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  + R++W+ARV++I+  SD++LLVCQKP++K+
Sbjct  568  MARTLAARVRWEARVIDIQDGSDQRLLVCQKPLLKK  603



>emb|CBI27262.3| unnamed protein product [Vitis vinifera]
Length=120

 Score =   107 bits (267),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 74/97 (76%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YD++ A GLL+ L SE    C +++L +E+DR+ RPEGW+++ D +  +
Sbjct  27   WCEPFPTYPRTYDMLHANGLLSHLTSEG---CNIMNLLLEMDRILRPEGWVVLSDNMVAI  83

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            + ARA +T+++W+ARV++++  +D++LLVCQKP +K+
Sbjct  84   EKARALATQIRWEARVIDLQKGTDQRLLVCQKPFLKK  120



>ref|NP_172839.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 ref|NP_849657.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 ref|NP_973819.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 sp|Q8GYW9.2|PMT4_ARATH RecName: Full=Probable methyltransferase PMT4 [Arabidopsis thaliana]
 gb|AEE29075.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 gb|AEE29076.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 gb|AEE29077.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
Length=603

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D + +++
Sbjct  510  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKLGVIE  567

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  + R++W+ARV++I+  SD++LLVCQKP++K+
Sbjct  568  MARTLAARVRWEARVIDIQDGSDQRLLVCQKPLLKK  603



>dbj|BAC42014.1| unknown protein [Arabidopsis thaliana]
Length=603

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D + +++
Sbjct  510  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKLGVIE  567

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  + R++W+ARV++I+  SD++LLVCQKP++K+
Sbjct  568  MARTLAARVRWEARVIDIQDGSDQRLLVCQKPLLKK  603



>emb|CAN64162.1| hypothetical protein VITISV_040645 [Vitis vinifera]
Length=148

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 74/97 (76%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YD++ A GLL+ L SE    C +++L +E+DR+ RPEGW+++ D +  +
Sbjct  55   WCEPFPTYPRTYDMLHANGLLSHLTSEG---CNIMNLLLEMDRILRPEGWVVLSDNMVAI  111

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            + ARA +T+++W+ARV++++  +D++LLVCQKP +K+
Sbjct  112  EKARALATQIRWEARVIDLQKGTDQRLLVCQKPFLKK  148



>ref|XP_006307032.1| hypothetical protein CARUB_v10008622mg [Capsella rubella]
 gb|EOA39930.1| hypothetical protein CARUB_v10008622mg [Capsella rubella]
Length=606

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D + +++
Sbjct  513  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKLGVIE  570

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  + R++W+ARV++I+  SD++LLVCQKP +K+
Sbjct  571  MARTLAARVRWEARVIDIQDGSDQRLLVCQKPFLKK  606



>ref|XP_010476413.1| PREDICTED: probable methyltransferase PMT4 [Camelina sativa]
Length=595

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D + +++
Sbjct  502  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKLGVIE  559

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  + R++W+ARV++++  SD++LLVCQKP +K+
Sbjct  560  MARTLAARVRWEARVIDLQDGSDQRLLVCQKPFLKK  595



>ref|XP_006837150.1| hypothetical protein AMTR_s00110p00151520 [Amborella trichopoda]
 gb|ERN00004.1| hypothetical protein AMTR_s00110p00151520 [Amborella trichopoda]
Length=607

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+     +  C +LDLF+E+DR+ RPEGW++I D V +++
Sbjct  513  WCEPFPTYPRTYDMLHARGLLS-HLVHNEGCNILDLFLEMDRILRPEGWVVICDKVQIIE  571

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             ARA +T+++WDAR++E+ S+++++LLVCQKP +K+
Sbjct  572  RARAITTQVRWDARMIELPSDNNQRLLVCQKPFLKK  607



>ref|XP_010495624.1| PREDICTED: probable methyltransferase PMT4 [Camelina sativa]
Length=597

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D + +++
Sbjct  504  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKLGVIE  561

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  + R++W+ARV++++  SD++LLVCQKP +K+
Sbjct  562  MARTLAARVRWEARVIDLQDGSDQRLLVCQKPFLKK  597



>ref|XP_010458849.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT4 
[Camelina sativa]
Length=606

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW+++ D + +++
Sbjct  513  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVLSDKLGVIE  570

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  + R++W+ARV++++  SD++LLVCQKP +K+
Sbjct  571  MARTLAARVRWEARVIDLQDGSDQRLLVCQKPFLKK  606



>ref|XP_006365135.1| PREDICTED: probable methyltransferase PMT5-like isoform X2 [Solanum 
tuberosum]
Length=562

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+  S Q   C ML+L +E+DR+ RPEGWII+ DT+  ++
Sbjct  469  WCEPFPTYPRTYDMIHANGLLSHISSQD--CSMLELLLEMDRILRPEGWIILSDTLGPIE  526

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR  +T+++W+ARV+++++ SD++LLVCQKP  ++
Sbjct  527  KARMLATQIRWEARVIDLQNGSDQRLLVCQKPFTRK  562



>ref|XP_007153532.1| hypothetical protein PHAVU_003G043400g [Phaseolus vulgaris]
 gb|ESW25526.1| hypothetical protein PHAVU_003G043400g [Phaseolus vulgaris]
Length=608

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++   GLL+  + +  RC M++LF+E+DR+ RPEGW+I+ D    ++
Sbjct  515  WCEPFPTYPRTYDMLHGSGLLSHITSE--RCSMMNLFLEMDRILRPEGWVILSDDKRTIE  572

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +ARA + +++W+ARV+++++ SD++LLVCQKP +K+
Sbjct  573  MARALTAQVRWEARVIDLQNGSDQRLLVCQKPFLKK  608



>ref|XP_010320876.1| PREDICTED: probable methyltransferase PMT5 [Solanum lycopersicum]
Length=617

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+  + Q  +C M +L +E+DR+ RPEGWII+ DT+  ++
Sbjct  524  WCEPFPTYPRTYDLLHANGLLSHIASQ--KCSMFELLLEMDRILRPEGWIILSDTLGTIE  581

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR  + +++W+ARV+++++ SD++LLVCQKP +++
Sbjct  582  KARTLAAQIRWEARVIDLQNGSDQRLLVCQKPFVRK  617



>ref|XP_010680718.1| PREDICTED: probable methyltransferase PMT5 [Beta vulgaris subsp. 
vulgaris]
Length=623

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 78/96 (81%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+L S +  +C M+DLF+E+DR+ RPEGW+I+ D V  ++
Sbjct  530  WCEPFPTYPRTYDMLHASGLLSLLSSE--KCSMMDLFLEMDRILRPEGWVILSDNVGAIE  587

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR+H+T+++W+ARV++ ++ SD++LLVCQKP +++
Sbjct  588  MARSHATQIRWEARVIDPQNGSDQRLLVCQKPFLRK  623



>ref|XP_006365134.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Solanum 
tuberosum]
Length=616

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+  S Q   C ML+L +E+DR+ RPEGWII+ DT+  ++
Sbjct  523  WCEPFPTYPRTYDMIHANGLLSHISSQD--CSMLELLLEMDRILRPEGWIILSDTLGPIE  580

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR  +T+++W+ARV+++++ SD++LLVCQKP  ++
Sbjct  581  KARMLATQIRWEARVIDLQNGSDQRLLVCQKPFTRK  616



>ref|XP_006573141.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Glycine 
max]
 ref|XP_006573142.1| PREDICTED: probable methyltransferase PMT5-like isoform X2 [Glycine 
max]
Length=620

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 76/97 (78%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YD++ A G+L+ L SE   RC +++LF+E+DR+ RPEGW+I+ D +  +
Sbjct  527  WCEPFPTYPRTYDMLHANGILSHLTSE---RCSLMNLFLEMDRILRPEGWVILSDNMGAI  583

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            ++AR  + +++W+AR++++++ SD++LLVCQKP +K+
Sbjct  584  EMARTLAAQVRWEARIIDLQNGSDQRLLVCQKPFLKK  620



>gb|KHN03641.1| Putative methyltransferase PMT4 [Glycine soja]
Length=623

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 76/97 (78%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YD++ A G+L+ L SE   RC +++LF+E+DR+ RPEGW+I+ D +  +
Sbjct  530  WCEPFPTYPRTYDMLHANGILSHLTSE---RCSLMNLFLEMDRILRPEGWVILSDNMGAI  586

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            ++AR  + +++W+AR++++++ SD++LLVCQKP +K+
Sbjct  587  EMARTLAAQVRWEARIIDLQNGSDQRLLVCQKPFLKK  623



>ref|XP_006348707.1| PREDICTED: probable methyltransferase PMT5-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+  + Q  +C M +L +E+DR+ RPEGWII+ DT+  ++
Sbjct  523  WCEPFPTYPRTYDLLHANGLLSHIASQ--KCSMFELLLEMDRILRPEGWIILSDTLGTIE  580

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR  + +++W+ARV+++++ SD++LLVCQKP +++
Sbjct  581  KARTLAAQIRWEARVIDLQNGSDQRLLVCQKPFVRK  616



>ref|XP_006348706.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Solanum 
tuberosum]
Length=617

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+  + Q  +C M +L +E+DR+ RPEGWII+ DT+  ++
Sbjct  524  WCEPFPTYPRTYDLLHANGLLSHIASQ--KCSMFELLLEMDRILRPEGWIILSDTLGTIE  581

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR  + +++W+ARV+++++ SD++LLVCQKP +++
Sbjct  582  KARTLAAQIRWEARVIDLQNGSDQRLLVCQKPFVRK  617



>ref|XP_010323873.1| PREDICTED: probable methyltransferase PMT5 [Solanum lycopersicum]
Length=616

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+  S Q   C ML+L +E+DR+ RPEGWII+ DT+  ++
Sbjct  523  WCEPFPTYPRTYDMLHANGLLSHISSQD--CSMLELLLEMDRILRPEGWIILSDTLGPIE  580

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR  +T+++W+ARV+++++ SD++LLVCQKP  ++
Sbjct  581  KARMLATQIRWEARVIDLQNGSDQRLLVCQKPFTRK  616



>ref|XP_006574934.1| PREDICTED: probable methyltransferase PMT4-like isoform X1 [Glycine 
max]
 ref|XP_006574935.1| PREDICTED: probable methyltransferase PMT4-like isoform X2 [Glycine 
max]
 ref|XP_006574936.1| PREDICTED: probable methyltransferase PMT4-like isoform X3 [Glycine 
max]
Length=620

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 76/97 (78%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YD++ A GLL+ L SE   RC +++LF+E+DR+ RPEGW+I+ D +  +
Sbjct  527  WCEPFPTYPRTYDMLHANGLLSHLTSE---RCSLVNLFLEMDRILRPEGWVILSDNMGDI  583

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            ++AR  + +++W+ARV+++++ SD++LLVCQKP +K+
Sbjct  584  EMARTLAAQVRWEARVIDLKNGSDQRLLVCQKPFLKK  620



>gb|KHN29999.1| Putative methyltransferase PMT4 [Glycine soja]
Length=623

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 76/97 (78%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YD++ A GLL+ L SE   RC +++LF+E+DR+ RPEGW+I+ D +  +
Sbjct  530  WCEPFPTYPRTYDMLHANGLLSHLTSE---RCSLVNLFLEMDRILRPEGWVILSDNMGDI  586

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            ++AR  + +++W+ARV+++++ SD++LLVCQKP +K+
Sbjct  587  EMARTLAAQVRWEARVIDLKNGSDQRLLVCQKPFLKK  623



>ref|XP_008446426.1| PREDICTED: probable methyltransferase PMT5 [Cucumis melo]
 ref|XP_008446427.1| PREDICTED: probable methyltransferase PMT5 [Cucumis melo]
Length=649

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+      SRC M+ L +E+DR+ RPEGW++++D V  ++
Sbjct  556  WCEPFPTYPRTYDLLHANGLLS--QLLSSRCNMIGLLLEMDRILRPEGWVVLKDKVGPIE  613

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
              R  +T+++W+ARV++ ++ SD++LLVCQKP +K+
Sbjct  614  KVRMLATQIRWEARVIDFQNGSDQRLLVCQKPFVKK  649



>ref|XP_004135150.1| PREDICTED: probable methyltransferase PMT4-like [Cucumis sativus]
 gb|KGN51971.1| hypothetical protein Csa_5G606620 [Cucumis sativus]
Length=656

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+      SRC M+ L +E+DR+ RPEGW++ +D V  ++
Sbjct  563  WCEPFPTYPRTYDLLHANGLLS--QLLSSRCSMIGLLVEMDRILRPEGWVVFKDKVGPIE  620

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
              R  +T+++W+ARV++ ++ SD++LLVCQKP +K+
Sbjct  621  KVRMLATQIRWEARVIDFQNGSDQRLLVCQKPFVKK  656



>gb|EYU28853.1| hypothetical protein MIMGU_mgv1a003065mg [Erythranthe guttata]
Length=611

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+  + +  +C  +DL  E+DR+ RPEGW+II D V  ++
Sbjct  518  WCEPFPTYPRTYDMLHAKGLLSHLATE--KCSTVDLIFEMDRILRPEGWVIISDKVAPIE  575

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR   T+L+W+ARV++++  SD++LLVCQKP +++
Sbjct  576  AARTLVTQLRWEARVIDLQDGSDQRLLVCQKPFVRK  611



>emb|CDP00420.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+  + Q   C M+DL  E+DR+ RPEGW+I+ D +  ++
Sbjct  523  WCEPFPTYPRTYDLLHANGLLSHIASQG--CSMIDLLFEMDRILRPEGWVILSDKLGPIE  580

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR+ + +++W+ARV+++E+ SD++LL+CQKP +++
Sbjct  581  KARSLAIQIRWEARVIDLENGSDQRLLLCQKPFLRK  616



>ref|XP_010942462.1| PREDICTED: probable methyltransferase PMT4 isoform X2 [Elaeis 
guineensis]
 ref|XP_010942463.1| PREDICTED: probable methyltransferase PMT4 isoform X2 [Elaeis 
guineensis]
Length=405

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+       +C +  L +E+DR+ RPEGW+++ D V +++
Sbjct  311  WCEHFPTYPRTYDLLHAMGLLS-HHLTVEKCNLSALLLEMDRILRPEGWVVLHDKVQVIE  369

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             ARA  T+++WDARV+E +S+S ++LL+CQKP +++
Sbjct  370  KARALVTQIRWDARVIESQSDSHQRLLICQKPFLQK  405



>ref|XP_010906131.1| PREDICTED: probable methyltransferase PMT5 [Elaeis guineensis]
 ref|XP_010906132.1| PREDICTED: probable methyltransferase PMT5 [Elaeis guineensis]
 ref|XP_010906133.1| PREDICTED: probable methyltransferase PMT5 [Elaeis guineensis]
Length=623

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 73/100 (73%), Gaps = 9/100 (9%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLL----TLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTV  440
            WCE FPTYP  YDL+ A GLL    TLE     +C +  L +E+DR+ RPEGW+++ D V
Sbjct  529  WCEPFPTYPRTYDLLHAMGLLSHYLTLE-----KCSLSALLLEMDRILRPEGWVVLHDKV  583

Query  439  PLVDLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             +++ ARA  T+++WDARV+E +++SD++LL+CQKP +++
Sbjct  584  QVIEKARALVTQIRWDARVIESQNDSDQRLLICQKPFLRK  623



>ref|XP_010649494.1| PREDICTED: probable methyltransferase PMT5 [Vitis vinifera]
Length=620

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 74/97 (76%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YD++ A GLL+ L SE    C +++L +E+DR+ RPEGW+++ D +  +
Sbjct  527  WCEPFPTYPRTYDMLHANGLLSHLTSEG---CNIMNLLLEMDRILRPEGWVVLSDNMVAI  583

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            + ARA +T+++W+ARV++++  +D++LLVCQKP +K+
Sbjct  584  EKARALATQIRWEARVIDLQKGTDQRLLVCQKPFLKK  620



>ref|XP_009798763.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana sylvestris]
 ref|XP_009798764.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana sylvestris]
 ref|XP_009798765.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana sylvestris]
Length=617

 Score =   107 bits (266),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+   GLL+  + Q   C +++L +E+DR+ RPEGW+I+ D +  ++
Sbjct  524  WCEPFPTYPRTYDLLHGNGLLSHLASQG--CSIIELLLEMDRILRPEGWVILSDKLGPIE  581

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
              R  +T+++W+ARV+++++ SD++LLVCQKP +++
Sbjct  582  KVRMLATQIRWEARVIDLQNGSDQRLLVCQKPFVRK  617



>ref|XP_009802931.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana sylvestris]
Length=616

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+  + Q   C ML+L +E+DR+ RPEGWII+ DT+  ++
Sbjct  523  WCEPFPTYPRTYDLLHANGLLSRIASQ--GCSMLELLLEMDRILRPEGWIILSDTLGSIE  580

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR  +T++ W+ RV+++++ S+++LLVCQKP  ++
Sbjct  581  KARMLATQIHWETRVIDLQNGSEQRLLVCQKPFTRK  616



>emb|CDY02989.1| BnaC07g22380D [Brassica napus]
Length=619

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW++I D + +++
Sbjct  524  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVISDKLGVIE  581

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKP  332
            +ARA +TR++W+ARV++++  SD++LLV + P
Sbjct  582  MARAMATRVRWEARVIDLQDGSDQRLLVSKLP  613



>ref|XP_008797047.1| PREDICTED: probable methyltransferase PMT5 isoform X2 [Phoenix 
dactylifera]
Length=625

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 71/98 (72%), Gaps = 9/98 (9%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLL----TLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTV  440
            WCE FPTYP  YDL+ A GLL    TLE     +C +  L +E+DR+ RPEGWI++ D V
Sbjct  531  WCEPFPTYPRTYDLLHAMGLLSHHLTLE-----KCDLSALLLEMDRILRPEGWIVLHDKV  585

Query  439  PLVDLARAHSTRLKWDARVVEIESNSDEKLLVCQKPII  326
             +++ ARA  T+++WDARV+E +S+SD++LL+CQKP +
Sbjct  586  QVIEKARALVTQIRWDARVIESQSDSDQRLLICQKPFL  623



>ref|XP_008807815.1| PREDICTED: probable methyltransferase PMT5 [Phoenix dactylifera]
Length=623

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 73/100 (73%), Gaps = 9/100 (9%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLL----TLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTV  440
            WCE FPTYP  YDL+ A GLL    TLE     +C +  L +E+DR+ RPEGW+++ D V
Sbjct  529  WCEPFPTYPRTYDLLHAMGLLSHYLTLE-----KCDLSALLLEMDRILRPEGWVVLHDKV  583

Query  439  PLVDLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             +++ ARA  T+++WDARV+E +S++D++LL+CQKP +++
Sbjct  584  QVIEKARALVTQIRWDARVIESKSDNDQRLLICQKPFLRK  623



>ref|XP_009631772.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Nicotiana 
tomentosiformis]
Length=619

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+    Q  +C M  L +E+DR+ RPEGWII+ DT+  ++
Sbjct  526  WCEPFPTYPRTYDLLHANGLLSHIVSQ--KCSMFQLLLEMDRILRPEGWIILSDTLGPIE  583

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR  + +++W+ARV+++++ S+++LLVCQKP  ++
Sbjct  584  KARTLAAQIRWEARVIDLQNGSEQRLLVCQKPFARK  619



>ref|XP_009631773.1| PREDICTED: probable methyltransferase PMT5 isoform X2 [Nicotiana 
tomentosiformis]
Length=618

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+    Q  +C M  L +E+DR+ RPEGWII+ DT+  ++
Sbjct  525  WCEPFPTYPRTYDLLHANGLLSHIVSQ--KCSMFQLLLEMDRILRPEGWIILSDTLGPIE  582

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR  + +++W+ARV+++++ S+++LLVCQKP  ++
Sbjct  583  KARTLAAQIRWEARVIDLQNGSEQRLLVCQKPFARK  618



>ref|XP_009777411.1| PREDICTED: probable methyltransferase PMT5 isoform X2 [Nicotiana 
sylvestris]
Length=616

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A  LL+    Q  +C M  L +E+DR+ RPEGWII+ DT+  ++
Sbjct  523  WCEPFPTYPRTYDLLHANELLSHIVSQ--KCSMFQLLLEMDRILRPEGWIILSDTLGPIE  580

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR  + +++W+ARV+++++ SD++LLVCQKP +++
Sbjct  581  KARTLAAQIRWEARVIDLQNGSDQRLLVCQKPFVRK  616



>ref|XP_009777410.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Nicotiana 
sylvestris]
Length=617

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A  LL+    Q  +C M  L +E+DR+ RPEGWII+ DT+  ++
Sbjct  524  WCEPFPTYPRTYDLLHANELLSHIVSQ--KCSMFQLLLEMDRILRPEGWIILSDTLGPIE  581

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
             AR  + +++W+ARV+++++ SD++LLVCQKP +++
Sbjct  582  KARTLAAQIRWEARVIDLQNGSDQRLLVCQKPFVRK  617



>ref|XP_004237055.1| PREDICTED: probable methyltransferase PMT5 [Solanum lycopersicum]
 ref|XP_010319469.1| PREDICTED: probable methyltransferase PMT5 [Solanum lycopersicum]
Length=616

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 71/97 (73%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YDL+   GLL+ LES+    C ++++  E+DR+ RPEGWII+ D +  +
Sbjct  523  WCEPFPTYPRTYDLLHGSGLLSHLESQG---CSIVEVLFEMDRILRPEGWIILSDKLGPI  579

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +  R  +T+++W+ARVV++++ SD++LLVCQK  +++
Sbjct  580  EKVRMVATQMRWEARVVDLQNGSDQRLLVCQKSFVRK  616



>ref|XP_010942457.1| PREDICTED: probable methyltransferase PMT4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010942459.1| PREDICTED: probable methyltransferase PMT4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010942460.1| PREDICTED: probable methyltransferase PMT4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010942461.1| PREDICTED: probable methyltransferase PMT4 isoform X1 [Elaeis 
guineensis]
Length=423

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = -1

Query  604  CEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVDL  425
            CE FPTYP  YDL+ A GLL+       +C +  L +E+DR+ RPEGW+++ D V +++ 
Sbjct  330  CEHFPTYPRTYDLLHAMGLLS-HHLTVEKCNLSALLLEMDRILRPEGWVVLHDKVQVIEK  388

Query  424  ARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            ARA  T+++WDARV+E +S+S ++LL+CQKP +++
Sbjct  389  ARALVTQIRWDARVIESQSDSHQRLLICQKPFLQK  423



>ref|XP_006344244.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006344245.1| PREDICTED: probable methyltransferase PMT5-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YDL+   GLL+ LES+    C ++++  E+DR+ RPEGWII+ D +  +
Sbjct  523  WCEPFPTYPRTYDLLHGNGLLSHLESQG---CSIVEVLFEMDRILRPEGWIILSDKLGPI  579

Query  430  DLARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +  R  +T+++W+ARV++++  SD++LLVCQK  +++
Sbjct  580  EKVRMVATQMRWEARVIDLQDGSDQRLLVCQKSFVRK  616



>ref|XP_011075591.1| PREDICTED: probable methyltransferase PMT5 [Sesamum indicum]
Length=615

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = -1

Query  604  CEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVDL  425
            C    TYP  YD++ A GLL+  +    RC ++DL  E+DR+ RPEGWIII D +  V++
Sbjct  523  CTXXXTYPRTYDMLHAKGLLSHIAS--GRCSIIDLLFEMDRILRPEGWIIISDKLGPVEI  580

Query  424  ARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            AR  +TRL+W+ARV+++++ SDE+LLVCQKP +++
Sbjct  581  ARTLATRLRWEARVIDLQNGSDERLLVCQKPFVRK  615



>ref|XP_008797046.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Phoenix 
dactylifera]
Length=643

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 70/97 (72%), Gaps = 9/97 (9%)
 Frame = -1

Query  604  CEAFPTYPXXYDLVXAYGLL----TLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVP  437
            CE FPTYP  YDL+ A GLL    TLE     +C +  L +E+DR+ RPEGWI++ D V 
Sbjct  550  CEPFPTYPRTYDLLHAMGLLSHHLTLE-----KCDLSALLLEMDRILRPEGWIVLHDKVQ  604

Query  436  LVDLARAHSTRLKWDARVVEIESNSDEKLLVCQKPII  326
            +++ ARA  T+++WDARV+E +S+SD++LL+CQKP +
Sbjct  605  VIEKARALVTQIRWDARVIESQSDSDQRLLICQKPFL  641



>ref|XP_004155297.1| PREDICTED: probable methyltransferase PMT4-like [Cucumis sativus]
Length=653

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+      SRC M+ L +E+DR+ RPEGW++ +D V  ++
Sbjct  563  WCEPFPTYPRTYDLLHANGLLS--QLLSSRCSMIGLLVEMDRILRPEGWVVFKDKVGPIE  620

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQK  335
              R  +T+++W+ARV++ ++ SD++LLVCQ 
Sbjct  621  KVRMLATQIRWEARVIDFQNGSDQRLLVCQN  651



>emb|CDY53946.1| BnaA02g36960D [Brassica napus]
Length=615

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 68/93 (73%), Gaps = 8/93 (9%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW++I D V +++
Sbjct  522  WCEPFPTYPRTYDMLHANELLTHVSSE--RCSLMDLFLEMDRILRPEGWVVISDKVGVIE  579

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPI  329
            +ARA +TR++W+ARV++++       ++C KPI
Sbjct  580  MARALATRVRWEARVIDLQD------VICSKPI  606



>ref|XP_009590890.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana tomentosiformis]
 ref|XP_009590891.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana tomentosiformis]
 ref|XP_009590893.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana tomentosiformis]
Length=617

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 69/96 (72%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE F TYP  YDL+   GLL+  + Q   C +++L +E+DR+ RPEGW+I+ D +  ++
Sbjct  524  WCEPFLTYPRTYDLLHGNGLLSHIASQG--CNIIELLLEMDRILRPEGWVILSDKLGPIE  581

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
              R  +T+++W+ARV+++++ SD++LLVCQKP + +
Sbjct  582  KVRTLATQIRWEARVIDLQNGSDQRLLVCQKPFVGK  617



>ref|XP_010258081.1| PREDICTED: probable methyltransferase PMT5 [Nelumbo nucifera]
 ref|XP_010258082.1| PREDICTED: probable methyltransferase PMT5 [Nelumbo nucifera]
 ref|XP_010258083.1| PREDICTED: probable methyltransferase PMT5 [Nelumbo nucifera]
Length=621

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A GLL+     +S C + +L +E+DR+ RPEGW+++ D + +++
Sbjct  528  WCEPFPTYPRTYDMLHANGLLS--HIINSECDISNLLLEMDRILRPEGWVVLCDKLHVIE  585

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
              RA  T+++W+ARV+++++++D  LLVCQKP +K+
Sbjct  586  KTRALVTQVRWEARVIQLQNDNDRLLLVCQKPFLKK  621



>ref|XP_008221505.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT5 
[Prunus mume]
Length=372

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 15/96 (16%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YDL+ A GLL+  S +  RC M DLF+E+DR+ RPE             
Sbjct  292  WCEPFPTYPRTYDLLHANGLLSHLSSE--RCSMTDLFLEMDRILRPE-------------  336

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
            +AR  +T+++W+ARV+++++ SD++LLVC KP +K+
Sbjct  337  MARMFATQIRWEARVIDLQNGSDQRLLVCHKPFVKK  372



>emb|CDY51215.1| BnaA06g39940D [Brassica napus]
Length=631

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW++I D + +++
Sbjct  526  WCEPFPTYPRTYDMLHANELLTHLSSE--RCSLMDLFLEMDRILRPEGWVVISDKLGVIE  583

Query  427  LARAHSTRLKWDARVVEIESNSDE  356
            +ARA +TR++W+ARV++++ + D+
Sbjct  584  MARAMATRVRWEARVIDLQDDPDD  607



>emb|CDY37197.1| BnaC02g35050D [Brassica napus]
Length=604

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 67/93 (72%), Gaps = 8/93 (9%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE FPTYP  YD++ A  LLT  S +  RC ++DLF+E+DR+ RPEGW++I D V +++
Sbjct  511  WCEPFPTYPRTYDMLHANELLTHVSSE--RCSLMDLFLEMDRILRPEGWVVISDKVGVIE  568

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPI  329
            +ARA +TR++W+ARV++++       ++C K I
Sbjct  569  MARALATRVRWEARVIDLQD------VICSKQI  595



>ref|XP_002993743.1| hypothetical protein SELMODRAFT_137575 [Selaginella moellendorffii]
 gb|EFJ05162.1| hypothetical protein SELMODRAFT_137575 [Selaginella moellendorffii]
Length=626

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDL+ A  LL+ E ++   C +  + +E+DR+ RPEGW++++D   +++
Sbjct  532  WCEAFPTYPRSYDLLYARSLLSQELQKPKPCTLAVIVLEMDRILRPEGWVLLQDETQVIE  591

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQK  335
             AR+   +++W+AR++EI  + D++LLV QK
Sbjct  592  TARSLLVQIRWEARIIEIPGHGDQRLLVGQK  622



>ref|XP_002987768.1| hypothetical protein SELMODRAFT_426562 [Selaginella moellendorffii]
 gb|EFJ11071.1| hypothetical protein SELMODRAFT_426562 [Selaginella moellendorffii]
Length=682

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAFPTYP  YDL+ A  LL+ E ++   C +  + +E+DR+ RPEGW++++D   +V+
Sbjct  588  WCEAFPTYPRSYDLLYARSLLSQELQKPKPCTLAVIVLEMDRILRPEGWVLLQDETQVVE  647

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQK  335
             AR+   +++W+AR++EI  + D++LL+ QK
Sbjct  648  TARSLLVQIRWEARIIEIPGHGDQRLLIGQK  678



>gb|AAF79416.1|AC068197_26 F16A14.7 [Arabidopsis thaliana]
Length=724

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 62/82 (76%), Gaps = 4/82 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLT-LESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLV  431
            WCE FPTYP  YD++ A  LLT L SE   RC ++DLF+E+DR+ RPEGW+++ D + ++
Sbjct  510  WCEPFPTYPRTYDMLHANELLTHLSSE---RCSLMDLFLEMDRILRPEGWVVLSDKLGVI  566

Query  430  DLARAHSTRLKWDARVVEIESN  365
            ++AR  + R++W+ARV++I+ +
Sbjct  567  EMARTLAARVRWEARVIDIQDD  588



>gb|ABS83492.1| early response to drought 3 [Pinus pinaster]
Length=183

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 59/93 (63%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  83   WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  139

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +T ++W+   R  E  +N DEKLL+CQK
Sbjct  140  SVKNLATGMRWNCHQRDTEDANNGDEKLLICQK  172



>gb|AHY28780.1| early response to drought 3, partial [Pinus taeda]
Length=124

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  24   WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  80

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +T ++W+   R  E   N D+KLL+CQK
Sbjct  81   SVKNLATGMRWNCHQRDTEDAKNGDQKLLICQK  113



>gb|KHN02028.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=51

 Score = 79.0 bits (193),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -1

Query  511  MLDLFIEIDRLTRPEGWIIIRDTVPLVDLARAHSTRLKWDARVVEIESNSD  359
            MLDLFIEIDR+  PEGW+IIRDT+PL++ AR  + +LKWDARV+EIES+SD
Sbjct  1    MLDLFIEIDRILHPEGWVIIRDTIPLIESARPLTAQLKWDARVIEIESDSD  51



>gb|ACB59070.1| early response to drought 3, partial [Pinus elliottii]
Length=207

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   VD
Sbjct  107  WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVD  163

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +T ++W+   R  E   N D+KLL+CQK
Sbjct  164  SVKNLATGMRWNCHQRDTEDAKNGDQKLLICQK  196



>ref|XP_010677437.1| PREDICTED: probable methyltransferase PMT21 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010677438.1| PREDICTED: probable methyltransferase PMT21 [Beta vulgaris subsp. 
vulgaris]
Length=605

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 57/92 (62%), Gaps = 4/92 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE F TYP  YDL+ A GL T ES    RC M  + +E+DR+ RP G+ IIR+    VD
Sbjct  507  WCEPFSTYPRTYDLLHADGLFTAESH---RCDMKYVLLEMDRILRPNGYAIIRENNYFVD  563

Query  427  LARAHSTRLKWDARVVEIESNS-DEKLLVCQK  335
              +A +  +KWD R  E   NS +EK+LVCQK
Sbjct  564  AIKAIAKGMKWDCRKEETGYNSENEKILVCQK  595



>ref|XP_001767424.1| predicted protein [Physcomitrella patens]
 gb|EDQ67748.1| predicted protein, partial [Physcomitrella patens]
Length=506

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 60/95 (63%), Gaps = 5/95 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE F TYP  YDL+ A GLLT E +   RC +  + +E+DR+ RP GW+++R+T  +V 
Sbjct  412  WCEPFDTYPRTYDLLHAVGLLTQEDK---RCNIAHIVLEMDRILRPGGWVLVRETNDMVY  468

Query  427  LARAHSTRLKWDARVVEIESN--SDEKLLVCQKPI  329
               A +  ++W  R++E ES     +KLL CQKP+
Sbjct  469  RVEALAKSVRWKTRILETESGPFGKDKLLSCQKPL  503



>gb|ACO57101.1| early responsive to dehydration 3 [Pinus halepensis]
Length=201

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  101  WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  157

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +T ++W+   R  E   N DEKLL+CQK
Sbjct  158  SVKNLATGMRWNCHQRDTEDAKNGDEKLLICQK  190



>gb|AHY28778.1| early response to drought 3, partial [Pinus elliottii]
Length=171

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  71   WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  127

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +T ++W+   R  E   N D+KLL+CQK
Sbjct  128  SVKNLATGMRWNCHQRDTEDAKNGDQKLLICQK  160



>gb|AHY28777.1| early response to drought 3, partial [Pinus echinata]
 gb|AHY28779.1| early response to drought 3, partial [Pinus palustris]
Length=188

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  88   WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  144

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +T ++W+   R  E   N D+KLL+CQK
Sbjct  145  SVKNLATGMRWNCHQRDTEDAKNGDQKLLICQK  177



>gb|AAW72877.1| early response to drought 3, partial [Pinus taeda]
Length=207

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 59/93 (63%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  107  WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  163

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +T ++W+   R  E   N+D+KLL+CQK
Sbjct  164  SVKNLATGMRWNCHQRDTEDAKNADQKLLICQK  196



>gb|AAW72868.1| early response to drought 3, partial [Pinus taeda]
Length=207

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  107  WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  163

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +T ++W+   R  E   N D+KLL+CQK
Sbjct  164  SVKNLATGMRWNCHQRDTEDAKNGDQKLLICQK  196



>gb|AEW70176.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. densiflora]
 gb|AEW70179.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. ussuriensis]
 gb|AEW70180.1| early responsive to dehydration 3, partial [Pinus densiflora]
Length=185

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  85   WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  141

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +  ++W+   R  E   N DEKLL+CQK
Sbjct  142  SVKNLAAGMRWNCHQRDTEDAKNGDEKLLICQK  174



>gb|AAW72852.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72853.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72854.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72855.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72856.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72857.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72858.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72859.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72860.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72861.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72862.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72863.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72864.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72865.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72866.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72867.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72869.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72870.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72871.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72872.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72873.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72874.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72875.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72876.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72878.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72879.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72880.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72881.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72882.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72883.1| early response to drought 3, partial [Pinus taeda]
 gb|ACB59068.1| early response to drought 3, partial [Pinus radiata]
 gb|ACB59069.1| early response to drought 3, partial [Pinus radiata]
 gb|ACB59071.1| early response to drought 3, partial [Pinus elliottii]
Length=207

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  107  WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  163

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +T ++W+   R  E   N D+KLL+CQK
Sbjct  164  SVKNLATGMRWNCHQRDTEDAKNGDQKLLICQK  196



>gb|AEW70177.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. densiflora]
Length=185

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  85   WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  141

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +  ++W+   R  E   N DEKLL+CQK
Sbjct  142  SVKNLAAGMRWNRHQRDTEDAKNGDEKLLICQK  174



>gb|AEW70174.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. ussuriensis]
 gb|AEW70178.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. ussuriensis]
 gb|AEW70181.1| early responsive to dehydration 3, partial [Pinus densiflora]
 gb|AEW70182.1| early responsive to dehydration 3, partial [Pinus densiflora]
Length=185

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  85   WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  141

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +  ++W+   R  E   N DEKLL+CQK
Sbjct  142  SVKNLAAGMRWNCHQRDTEDAKNGDEKLLICQK  174



>gb|AEW70169.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
 gb|AEW70170.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
 gb|AEW70172.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
Length=185

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  85   WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  141

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +  ++W+   R  E   N DEKLL+CQK
Sbjct  142  SVKNLAAGMRWNCHQRDTEDAKNGDEKLLICQK  174



>gb|AEW70168.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
 gb|AEW70173.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
 gb|AEW70175.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. densiflora]
Length=185

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  85   WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  141

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +  ++W+   R  E   N DEKLL+CQK
Sbjct  142  SVKNLAAGMRWNCHQRDTENARNGDEKLLICQK  174



>gb|AIF75711.1| early response to drought 3, partial [Pinus hwangshanensis]
Length=188

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  88   WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  144

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +  ++W+   R  E   N DEKLL+CQK
Sbjct  145  SVKNLAAGMRWNCHQRDTEDAKNGDEKLLICQK  177



>gb|AIF75714.1| early response to drought 3, partial [Pinus hwangshanensis]
Length=188

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  88   WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  144

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +  ++W+   R  E   N DEKLL+CQK
Sbjct  145  SVKNLAAGMRWNCHQRDTEDAKNGDEKLLICQK  177



>gb|AIF75712.1| early response to drought 3, partial [Pinus hwangshanensis]
 gb|AIF75713.1| early response to drought 3, partial [Pinus hwangshanensis]
 gb|AIF75715.1| early response to drought 3, partial [Pinus hwangshanensis]
Length=188

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  88   WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  144

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +  ++W+   R  E   N DEKLL+CQK
Sbjct  145  SVKNLAAGMRWNCHQRDTEDAKNGDEKLLICQK  177



>gb|AEW70171.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
Length=185

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL + ES    RC M  + +E+DR+ RP G++I+R++   V+
Sbjct  85   WCEAFSTYPRTYDLLHVDGLFSAESH---RCEMKYVLLEMDRILRPAGYVIMRESPHFVN  141

Query  427  LARAHSTRLKWD--ARVVEIESNSDEKLLVCQK  335
              +  +  ++W+   R  E   N DEKLL+CQK
Sbjct  142  SVKNLAAGMRWNCHQRDTEDARNGDEKLLICQK  174



>ref|XP_002300064.2| hypothetical protein POPTR_0001s35650g [Populus trichocarpa]
 gb|EEE84869.2| hypothetical protein POPTR_0001s35650g [Populus trichocarpa]
Length=609

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 63/96 (66%), Gaps = 2/96 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+ A+G+ + E ++H  CG+ DL IE+DR+ RP+G++IIRD   +++
Sbjct  505  WCEAFSTYPRTYDLLHAWGVFS-EIQEHG-CGVEDLLIEMDRILRPDGFVIIRDKPVIIN  562

Query  427  LARAHSTRLKWDARVVEIESNSDEKLLVCQKPIIKR  320
              R   T L+WD  + E+E  SD   L  ++ +I R
Sbjct  563  YIRKFVTALRWDRWLSEVEPRSDALSLSEERVLIAR  598



>ref|XP_010535872.1| PREDICTED: probable methyltransferase PMT21 [Tarenaya hassleriana]
 ref|XP_010535879.1| PREDICTED: probable methyltransferase PMT21 [Tarenaya hassleriana]
 ref|XP_010535887.1| PREDICTED: probable methyltransferase PMT21 [Tarenaya hassleriana]
Length=598

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 57/94 (61%), Gaps = 4/94 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL T ES    RC M  + +E+DR+ RP G+ IIR++   VD
Sbjct  500  WCEAFSTYPRTYDLLHLAGLFTAESH---RCEMKYVMLEMDRILRPNGYAIIRESSYFVD  556

Query  427  LARAHSTRLKWDARVVEIESNS-DEKLLVCQKPI  329
                 +  ++W  R  E ES S DEKLL+CQK +
Sbjct  557  AIANVAKGMRWSCRKEETESKSEDEKLLICQKKL  590



>gb|KHN44795.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=670

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIII  452
            WCEAFPTYP  YDLV A GLL+LE+EQH RC MLDLFIEIDR+ RPE  +++
Sbjct  597  WCEAFPTYPRTYDLVHAAGLLSLETEQH-RCSMLDLFIEIDRILRPEAALLL  647



>ref|XP_002867953.1| early-responsive to dehydration 3 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44212.1| early-responsive to dehydration 3 [Arabidopsis lyrata subsp. 
lyrata]
Length=600

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 59/94 (63%), Gaps = 4/94 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL T ES+   RC M  + +E+DR+ RP G+ IIR++   VD
Sbjct  499  WCEAFSTYPRTYDLLHVDGLFTSESQ---RCDMKYVMLEMDRILRPNGYAIIRESSYFVD  555

Query  427  LARAHSTRLKWDARVVEIESNS-DEKLLVCQKPI  329
               + +  L+W  R  + ES S +EKLL+CQK +
Sbjct  556  TIASVAKELRWSCRKEQTESESANEKLLICQKKL  589



>ref|XP_008799029.1| PREDICTED: probable methyltransferase PMT9 isoform X2 [Phoenix 
dactylifera]
Length=619

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 8/101 (8%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE+F TYP  YDL+ A+ LL  E E+   C + DL IE+DR+ RP G+IIIRD VP+++
Sbjct  518  WCESFSTYPRTYDLLHAW-LLFSEIEKQG-CNLEDLLIEMDRMLRPSGFIIIRDKVPVIN  575

Query  427  LARAHSTRLKWDARVVEIE------SNSDEKLLVCQKPIIK  323
              R   T LKWD    E+E      S+ +E++L+ +K + K
Sbjct  576  YVRMFLTSLKWDLWSSEVEPKVDALSSGEERVLIVRKKLWK  616



>ref|XP_008799028.1| PREDICTED: probable methyltransferase PMT9 isoform X1 [Phoenix 
dactylifera]
Length=620

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 8/101 (8%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCE+F TYP  YDL+ A+ LL  E E+   C + DL IE+DR+ RP G+IIIRD VP+++
Sbjct  519  WCESFSTYPRTYDLLHAW-LLFSEIEKQG-CNLEDLLIEMDRMLRPSGFIIIRDKVPVIN  576

Query  427  LARAHSTRLKWDARVVEIE------SNSDEKLLVCQKPIIK  323
              R   T LKWD    E+E      S+ +E++L+ +K + K
Sbjct  577  YVRMFLTSLKWDLWSSEVEPKVDALSSGEERVLIVRKKLWK  617



>ref|XP_006282955.1| hypothetical protein CARUB_v10007621mg [Capsella rubella]
 gb|EOA15853.1| hypothetical protein CARUB_v10007621mg [Capsella rubella]
Length=600

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 59/94 (63%), Gaps = 4/94 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL T ES+   RC M  + +E+DR+ RP G+ IIR++    D
Sbjct  499  WCEAFSTYPRTYDLLHVDGLFTSESQ---RCDMKYVMLEMDRILRPSGYAIIRESSYFAD  555

Query  427  LARAHSTRLKWDARVVEIES-NSDEKLLVCQKPI  329
               + +  L+W  R  + ES +S+EKLL+CQK +
Sbjct  556  TIASVAKELRWSCRKEQTESESSNEKLLICQKKL  589



>ref|XP_007046111.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY01943.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=616

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/93 (42%), Positives = 59/93 (63%), Gaps = 5/93 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+ AYGL +L  +   RC + D+ +E+DR+ RPEG +I RD V ++ 
Sbjct  514  WCEAFSTYPRTYDLIHAYGLFSLYKD---RCNVEDILLEMDRILRPEGAVIFRDEVDVLI  570

Query  427  LARAHSTRLKWDARVVEIESNS--DEKLLVCQK  335
              +  +  ++WDA++++ E      EK+LV  K
Sbjct  571  KVKKIAAGMRWDAKMIDHEDGPLVPEKILVAVK  603



>gb|ABK25383.1| unknown [Picea sitchensis]
Length=601

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 57/96 (59%), Gaps = 5/96 (5%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTL---ESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVP  437
            WCEAF TYP  YD + A G+ +L    S    RC ++DL IE+DR+ RPEG +++RDT  
Sbjct  496  WCEAFSTYPRTYDFIHAIGIESLIRDLSRGGDRCSLVDLMIEMDRILRPEGTVVVRDTPK  555

Query  436  LVDLARAHSTRLKWDARV--VEIESNSDEKLLVCQK  335
            ++D     ++ + W   V   E ESN  EKLLV  K
Sbjct  556  VIDRVAKIASAIHWSTEVYDTEPESNGKEKLLVATK  591



>gb|KJB64259.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=691

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPE  467
            WCEAFPTYP  YD+V A GLL+LE+ QH RC MLDLF EIDRL RPE
Sbjct  599  WCEAFPTYPRTYDMVHADGLLSLETSQHRRCTMLDLFTEIDRLLRPE  645



>ref|XP_009136994.1| PREDICTED: probable methyltransferase PMT21 [Brassica rapa]
 ref|XP_009136995.1| PREDICTED: probable methyltransferase PMT21 [Brassica rapa]
Length=601

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 59/94 (63%), Gaps = 4/94 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL T ES+   RC M  + +E+DR+ RP G+ IIR++   VD
Sbjct  500  WCEAFSTYPRTYDLLHVDGLFTSESQ---RCEMKYVMLEMDRILRPNGYAIIRESSYFVD  556

Query  427  LARAHSTRLKWDARVVEIESNS-DEKLLVCQKPI  329
               + +  L+W  R  + ES S +EKLL+CQK +
Sbjct  557  NIASVAKGLRWSCRKEQTESESENEKLLICQKKL  590



>emb|CDY01583.1| BnaC07g35730D [Brassica napus]
Length=657

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 59/94 (63%), Gaps = 4/94 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL T ES+   RC M  + +E+DR+ RP G+ IIR++   VD
Sbjct  556  WCEAFSTYPRTYDLLHVDGLFTSESQ---RCEMKYVMLEMDRILRPNGYAIIRESSYFVD  612

Query  427  LARAHSTRLKWDARVVEIESNS-DEKLLVCQKPI  329
               + +  L+W  R  + ES S +EKLL+CQK +
Sbjct  613  NIASVAKGLRWSCRKEQTESESENEKLLICQKKL  646



>emb|CDX98606.1| BnaA03g43910D [Brassica napus]
Length=664

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 59/94 (63%), Gaps = 4/94 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL T ES+   RC M  + +E+DR+ RP G+ IIR++   VD
Sbjct  563  WCEAFSTYPRTYDLLHVDGLFTSESQ---RCEMKYVMLEMDRILRPNGYAIIRESSYFVD  619

Query  427  LARAHSTRLKWDARVVEIESNS-DEKLLVCQKPI  329
               + +  L+W  R  + ES S +EKLL+CQK +
Sbjct  620  NIASVAKGLRWSCRKEQTESESENEKLLICQKKL  653



>emb|CDY09274.1| BnaC03g63040D [Brassica napus]
Length=591

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 58/94 (62%), Gaps = 4/94 (4%)
 Frame = -1

Query  607  WCEAFPTYPXXYDLVXAYGLLTLESEQHSRCGMLDLFIEIDRLTRPEGWIIIRDTVPLVD  428
            WCEAF TYP  YDL+   GL T ES+   RC M  + +E+DR+ RP G+ IIR++    D
Sbjct  494  WCEAFSTYPRTYDLLHVDGLFTSESQ---RCEMKYVMLEMDRILRPNGYAIIRESSYFAD  550

Query  427  LARAHSTRLKWDARVVEIESNS-DEKLLVCQKPI  329
               + +  L+W  R  + ES S +EKLLVCQK +
Sbjct  551  TIASVAKGLRWSCRKEQTESESENEKLLVCQKKL  584



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230