BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF041D07

Length=600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFY26882.1|  catalase                                                268   4e-88   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                267   2e-83   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          267   2e-83   Ipomoea batatas [batate]
gb|AFR42412.1|  catalase                                                224   3e-71   Eperua falcata
gb|AFR42410.1|  catalase                                                223   1e-70   Eperua falcata
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      224   7e-67   Nicotiana tomentosiformis
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 219   6e-65   Eucalyptus grandis [rose gum]
dbj|BAH20283.1|  AT1G20620                                              208   7e-65   Arabidopsis thaliana [mouse-ear cress]
gb|AGC65520.1|  catalase                                                219   7e-65   Eriobotrya japonica [loquat]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      219   9e-65   Nicotiana sylvestris
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 217   3e-64   Elaeis guineensis
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             217   3e-64   Prunus persica
emb|CAD42908.1|  catalase                                               217   3e-64   Prunus persica
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      217   4e-64   Prunus mume [ume]
emb|CAB56850.1|  catalase                                               215   6e-64   Prunus persica
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               216   7e-64   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ABY19573.1|  catalase                                                209   7e-64   Manihot esculenta [manioc]
gb|AAX84671.1|  catalase CAT2                                           209   1e-63   Manihot esculenta [manioc]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    216   1e-63   Gossypium raimondii
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                215   1e-63   Citrus sinensis [apfelsine]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      215   2e-63   Eucalyptus grandis [rose gum]
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             215   2e-63   Citrus clementina [clementine]
ref|NP_001289779.1|  catalase isozyme 1                                 215   2e-63   Nelumbo nucifera [Indian lotus]
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 215   2e-63   Nicotiana tomentosiformis
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          215   3e-63   Avicennia marina
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 214   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB88173.1|  catalase                                                209   3e-63   Glycine max [soybeans]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      214   3e-63   
ref|XP_002306976.2|  catalase family protein                            214   4e-63   
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      214   4e-63   
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 214   7e-63   Prunus mume [ume]
gb|AIX10947.1|  putative catalase                                       214   7e-63   Gardenia jasminoides
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      214   7e-63   Populus euphratica
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         214   8e-63   Tarenaya hassleriana [spider flower]
gb|AAM97542.1|  catalase 3                                              214   8e-63   Capsicum annuum
gb|ABR15776.1|  catalase                                                207   1e-62   Litchi
emb|CDP07287.1|  unnamed protein product                                213   1e-62   Coffea canephora [robusta coffee]
dbj|BAF91369.1|  catalase                                               213   1e-62   Capsicum annuum
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 213   2e-62   Nicotiana sylvestris
gb|KJB14249.1|  hypothetical protein B456_002G115900                    209   2e-62   Gossypium raimondii
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      213   2e-62   Elaeis guineensis
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      213   2e-62   Nelumbo nucifera [Indian lotus]
ref|XP_010061175.1|  PREDICTED: catalase-like                           213   2e-62   Eucalyptus grandis [rose gum]
ref|XP_010498496.1|  PREDICTED: catalase-3                              212   3e-62   Camelina sativa [gold-of-pleasure]
gb|AIS20825.1|  CAT                                                     212   3e-62   Pyrus x bretschneideri [bai li]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      212   3e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009110221.1|  PREDICTED: catalase-3                              212   3e-62   Brassica rapa
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      212   3e-62   
emb|CAD42909.1|  catalase                                               211   5e-62   Prunus persica
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           211   5e-62   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    211   5e-62   Capsicum annuum
ref|XP_002301920.1|  catalase family protein                            211   5e-62   Populus trichocarpa [western balsam poplar]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             211   5e-62   Prunus persica
emb|CAI43948.1|  catalase                                               211   5e-62   Populus deltoides
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           211   5e-62   Sesamum indicum [beniseed]
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    211   6e-62   Arabis alpina [alpine rockcress]
ref|NP_001031072.3|  catalase 3                                         208   7e-62   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ73905.1|  CAT1                                                    201   7e-62   Solanum nigrum
dbj|BAC79443.1|  catalase                                               211   7e-62   Acacia ampliceps
emb|CDY31488.1|  BnaC05g15970D                                          211   7e-62   Brassica napus [oilseed rape]
gb|AAA57551.1|  catalase                                                208   8e-62   Nicotiana sylvestris
emb|CDY29519.1|  BnaA06g14510D                                          211   8e-62   Brassica napus [oilseed rape]
emb|CDY33636.1|  BnaC08g19360D                                          211   9e-62   Brassica napus [oilseed rape]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         211   9e-62   Brassica rapa
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 211   9e-62   Populus euphratica
gb|ACJ11733.1|  catalase                                                211   1e-61   Gossypium hirsutum [American cotton]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     213   1e-61   Eucalyptus grandis [rose gum]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          210   1e-61   Soldanella alpina
gb|AGV54297.1|  peroxisomal catalase                                    210   1e-61   Phaseolus vulgaris [French bean]
ref|XP_009149539.1|  PREDICTED: catalase-3                              211   1e-61   Brassica rapa
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             210   2e-61   Phaseolus vulgaris [French bean]
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      210   2e-61   Phoenix dactylifera
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             210   2e-61   Phaseolus vulgaris [French bean]
ref|NP_001237571.1|  catalase-4                                         210   2e-61   Glycine max [soybeans]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 210   2e-61   Phoenix dactylifera
gb|AAR84578.1|  catalase 1a                                             210   2e-61   Lotus japonicus
ref|NP_001268098.1|  catalase                                           210   2e-61   Vitis vinifera
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 210   2e-61   Vitis vinifera
emb|CDP07288.1|  unnamed protein product                                210   2e-61   Coffea canephora [robusta coffee]
emb|CDY01364.1|  BnaA07g11370D                                          211   2e-61   
gb|AJE26131.1|  catalase                                                210   2e-61   Salix matsudana [tortured willow]
gb|AET97564.1|  catalase                                                210   2e-61   Ziziphus jujuba [Chinese jujube]
gb|AAG43363.1|AF151368_1  catalase                                      210   2e-61   Hevea brasiliensis [jebe]
emb|CAA10286.1|  catalase                                               199   2e-61   Cicer arietinum [garbanzo]
emb|CAC04509.1|  catalase                                               203   3e-61   Digitalis lanata [Grecian foxglove]
dbj|BAH20307.1|  AT1G20620                                              209   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001240021.1|  catalase                                           209   3e-61   Glycine max [soybeans]
emb|CCP37650.1|  catalase-1                                             209   3e-61   Nicotiana tabacum [American tobacco]
gb|ACL27272.1|  catalase                                                209   4e-61   Nicotiana benthamiana
gb|AGE15298.2|  catalase 1                                              209   4e-61   Eriobotrya japonica [loquat]
gb|AFU48609.1|  catalase 1                                              209   4e-61   Nicotiana benthamiana
gb|ADC95629.1|  catalase                                                209   4e-61   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      209   4e-61   Nicotiana tomentosiformis
gb|AHF27428.1|  catalase                                                205   4e-61   Cucurbita moschata [ayote]
gb|KHG25152.1|  Catalase isozyme 1                                      209   4e-61   Gossypium arboreum [tree cotton]
emb|CDY31878.1|  BnaC07g15280D                                          209   4e-61   Brassica napus [oilseed rape]
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          209   4e-61   Solanum melongena [aubergine]
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             209   4e-61   Eutrema salsugineum [saltwater cress]
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    209   4e-61   Nicotiana tabacum [American tobacco]
dbj|BAJ33995.1|  unnamed protein product                                209   4e-61   Eutrema halophilum
gb|AAM65021.1|  unknown                                                 209   5e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564120.1|  catalase 3                                            209   5e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAB62892.1|  catalase-1                                              209   5e-61   Nicotiana glutinosa
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      209   5e-61   Vitis vinifera
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      209   5e-61   Nicotiana sylvestris
ref|XP_010530333.1|  PREDICTED: catalase-2                              209   6e-61   Tarenaya hassleriana [spider flower]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    209   6e-61   Gossypium raimondii
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      208   8e-61   Solanum lycopersicum
gb|AAB71764.1|  catalase 1                                              208   8e-61   Nicotiana tabacum [American tobacco]
gb|AEQ30070.1|  catalase                                                208   8e-61   Litchi chinensis [litchi]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               208   1e-60   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|NP_001291326.1|  catalase isozyme 1                                 208   1e-60   Sesamum indicum [beniseed]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          208   1e-60   Amborella trichopoda
gb|ACV30589.1|  catalase                                                198   1e-60   Carica papaya [mamon]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      207   1e-60   Citrus sinensis [apfelsine]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             207   1e-60   Citrus clementina [clementine]
ref|NP_001237556.1|  catalase-1/2                                       207   1e-60   Glycine max [soybeans]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      207   1e-60   Cucumis melo [Oriental melon]
gb|AIA61608.1|  catalase                                                207   2e-60   Gynostemma pentaphyllum [jiaogulan]
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      208   2e-60   
gb|ACJ76836.3|  catalase                                                207   2e-60   Dimocarpus longan [longan]
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             207   2e-60   Capsella rubella
dbj|BAQ21275.1|  catalase                                               207   2e-60   Citrus tamurana
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         207   3e-60   Tarenaya hassleriana [spider flower]
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               207   3e-60   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               206   4e-60   Gossypium hirsutum [American cotton]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      206   4e-60   Nicotiana sylvestris
gb|ACV92695.1|  catalase                                                206   4e-60   Brassica oleracea
ref|XP_007018034.1|  Catalase 2                                         206   4e-60   
prf||2104177A  catalase                                                 206   5e-60
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          206   5e-60   Helianthus annuus
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             206   5e-60   
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 206   6e-60   Solanum tuberosum [potatoes]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 206   6e-60   Manihot esculenta [manioc]
emb|CDX76313.1|  BnaA08g10870D                                          206   6e-60   
gb|AAD37788.1|AF149283_1  catalase 1                                    204   6e-60   Phaseolus vulgaris [French bean]
emb|CAA64220.1|  catalase                                               206   6e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      206   7e-60   Nicotiana tomentosiformis
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             206   7e-60   Capsella rubella
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          206   7e-60   Amborella trichopoda
ref|XP_010094556.1|  Catalase isozyme 1                                 206   7e-60   Morus notabilis
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              206   7e-60   
gb|AAF71742.1|AF248491_1  catalase                                      206   7e-60   Raphanus sativus
gb|AAB86582.2|  catalase                                                206   7e-60   Raphanus sativus
gb|AAD30292.1|AF139539_1  catalase 3                                    206   8e-60   Raphanus sativus
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              206   8e-60   Cicer arietinum [garbanzo]
gb|AAK96854.1|  catalase                                                206   8e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AAR14052.2|  catalase                                                205   8e-60   Solanum tuberosum [potatoes]
prf||1906388A  catalase                                                 206   9e-60
gb|AFU90822.1|  catalase                                                206   9e-60   Populus tomentosa [Chinese white poplar]
gb|AAF19965.1|AF207906_1  catalase 1                                    206   9e-60   Zantedeschia aethiopica [arum-lily]
gb|AAD30291.2|AF139538_1  catalase 2                                    206   9e-60   Raphanus sativus
ref|NP_195235.1|  catalase 2                                            206   9e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CAA45564.1|  catalase                                               206   9e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         206   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     206   1e-59   Sesamum indicum [beniseed]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                205   1e-59   Erythranthe guttata [common monkey flower]
ref|NP_001234186.1|  catalase isozyme 2                                 205   1e-59   
gb|AAD17935.1|  catalase                                                205   1e-59   Brassica juncea [brown mustard]
gb|AFU90823.1|  catalase                                                204   1e-59   Populus x beijingensis
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               205   1e-59   Ricinus communis
emb|CDY40645.1|  BnaA03g53180D                                          205   1e-59   Brassica napus [oilseed rape]
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       205   1e-59   Cucumis sativus [cucumbers]
gb|ABM47415.1|  catalase                                                205   1e-59   Prunus avium [gean]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               205   1e-59   Cucurbita pepo
gb|KFK30147.1|  catalase                                                205   1e-59   Arabis alpina [alpine rockcress]
ref|XP_009138342.1|  PREDICTED: catalase-2                              205   1e-59   Brassica rapa
gb|AAZ29552.1|  catalase-C                                              205   2e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      205   2e-59   Elaeis guineensis
ref|NP_001235974.1|  catalase-3                                         205   2e-59   Glycine max [soybeans]
gb|AAD17936.1|  catalase                                                205   2e-59   Brassica juncea [brown mustard]
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               205   2e-59   Ricinus communis
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             205   2e-59   
gb|AHF21552.1|  catalase                                                205   2e-59   Hylocereus undatus [dragon fruit]
emb|CDP01803.1|  unnamed protein product                                205   2e-59   Coffea canephora [robusta coffee]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               205   2e-59   Gossypium hirsutum [American cotton]
gb|KHG12976.1|  Catalase isozyme 2                                      204   2e-59   Gossypium arboreum [tree cotton]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          204   2e-59   Vigna radiata var. radiata [golden gram]
gb|ACA50528.1|  putative catalase 2                                     204   2e-59   Brassica napus [oilseed rape]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             204   2e-59   Populus trichocarpa [western balsam poplar]
gb|AAC49807.1|  catalase 3                                              204   2e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CDY17510.1|  BnaC03g65530D                                          204   2e-59   Brassica napus [oilseed rape]
emb|CDX72514.1|  BnaC07g45360D                                          204   3e-59   
dbj|BAA34205.1|  catalase                                               204   3e-59   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048861.1|  Os03g0131200                                       204   3e-59   
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      204   3e-59   Solanum tuberosum [potatoes]
dbj|BAA34714.1|  catalase                                               204   4e-59   Oryza sativa [red rice]
ref|XP_011022275.1|  PREDICTED: catalase-like                           203   4e-59   Populus euphratica
gb|AAC48918.1|  salicylic acid binding catalase                         204   4e-59   Nicotiana tabacum [American tobacco]
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      204   4e-59   
gb|AAO17721.1|  catalase                                                204   5e-59   Hypericum perforatum
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      204   5e-59   Phoenix dactylifera
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              203   7e-59   Populus euphratica
ref|XP_009106100.1|  PREDICTED: catalase-2                              203   7e-59   Brassica rapa
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         203   9e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010437527.1|  PREDICTED: catalase-2                              203   9e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 203   1e-58   Tarenaya hassleriana [spider flower]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              203   1e-58   Populus euphratica
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         202   1e-58   Jatropha curcas
gb|AAM97541.1|  catalase 2                                              202   1e-58   Capsicum annuum
gb|AAC19397.1|  leaf catalase                                           202   1e-58   Mesembryanthemum crystallinum
gb|AHF27433.1|  catalase                                                202   1e-58   Cucurbita maxima [Boston marrow]
gb|AHF27430.1|  catalase                                                202   1e-58   Cucurbita moschata [ayote]
gb|ABQ44283.1|  catalase                                                199   1e-58   Saccharum hybrid cultivar NCo 376
gb|AAF79625.1|AC027665_26  F5M15.5                                      208   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ73906.1|  CAT2                                                    197   2e-58   Solanum nigrum
ref|XP_007046520.1|  Catalase 2                                         202   2e-58   Theobroma cacao [chocolate]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 202   2e-58   Cucumis melo [Oriental melon]
ref|NP_001234827.1|  catalase isozyme 1                                 202   2e-58   Solanum lycopersicum
emb|CDY52649.1|  BnaAnng11640D                                          201   2e-58   Brassica napus [oilseed rape]
gb|ACB11496.1|  catalase                                                202   3e-58   Pinus sylvestris [Scotch pine]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         201   3e-58   Oryza brachyantha
dbj|BAJ87148.1|  predicted protein                                      196   4e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW69584.1|  catalase1                                               197   4e-58   
gb|ACJ22771.1|  catalase 1                                              201   5e-58   Jatropha curcas
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         201   5e-58   Camelina sativa [gold-of-pleasure]
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          201   6e-58
gb|ADZ45555.1|  catalase                                                201   6e-58   Vigna radiata [mung bean]
gb|ADZ45556.1|  catalase                                                201   7e-58   Vigna radiata [mung bean]
gb|AFR53082.1|  CAT                                                     201   7e-58   Anthurium andraeanum [flamingo-lily]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 201   7e-58   Oryza brachyantha
gb|KJB17473.1|  hypothetical protein B456_003G002800                    201   7e-58   Gossypium raimondii
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    200   9e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_002890395.1|  F5M15.5                                            206   9e-58   
gb|AAY59707.1|  catalase                                                200   1e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              200   1e-57   
gb|ABK24453.1|  unknown                                                 200   1e-57   Picea sitchensis
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       197   1e-57   Cucumis sativus [cucumbers]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      199   2e-57   Cucumis melo [Oriental melon]
emb|CAG23920.1|  catalase                                               199   2e-57   Festuca arundinacea [tall fescue]
gb|AAD17933.1|  catalase                                                199   2e-57   Brassica juncea [brown mustard]
dbj|BAA34204.1|  catalase                                               199   2e-57   Oryza sativa Japonica Group [Japonica rice]
gb|ABC01913.1|  catalase isozyme 1-like protein                         199   2e-57   Solanum tuberosum [potatoes]
dbj|BAA05494.1|  catalase                                               199   2e-57   Oryza sativa Japonica Group [Japonica rice]
gb|AFN81243.1|  catalase 1                                              199   3e-57   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_002510677.1|  catalase, putative                                 204   3e-57   
ref|NP_001058635.1|  Os06g0727200                                       199   3e-57   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               199   3e-57   Cucurbita pepo
gb|AHF27429.1|  catalase                                                198   3e-57   Cucurbita moschata [ayote]
gb|AHF27432.1|  catalase                                                198   3e-57   Cucurbita maxima [Boston marrow]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       199   4e-57   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 198   4e-57   
gb|ADM96039.1|  catalase                                                199   4e-57   Cucumis sativus [cucumbers]
gb|EMT05040.1|  Catalase-1                                              199   4e-57   
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 199   4e-57   
ref|XP_003558892.1|  PREDICTED: catalase-1                              199   4e-57   Brachypodium distachyon [annual false brome]
gb|AAC17729.1|  catalase 1                                              196   6e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX69111.1|  BnaC01g03420D                                          198   6e-57   
gb|AAC17731.1|  catalase 1                                              198   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564121.1|  catalase 1                                            198   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001241808.1|  catalase isozyme B                                 198   7e-57   Zea mays [maize]
ref|NP_001274863.1|  catalase isozyme 1                                 198   7e-57   Solanum tuberosum [potatoes]
gb|EPS69543.1|  catalase                                                198   7e-57   Genlisea aurea
emb|CAA42720.1|  catalase-1                                             198   7e-57   Zea mays [maize]
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               198   7e-57   Solanum tuberosum [potatoes]
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               198   7e-57   Cucurbita pepo
gb|AIU99479.1|  catalase                                                198   8e-57   Saccharum arundinaceum
emb|CDP01802.1|  unnamed protein product                                197   8e-57   Coffea canephora [robusta coffee]
ref|XP_010692544.1|  PREDICTED: catalase-like                           197   1e-56   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH36312.1|  catalase heme-binding enzyme                            197   1e-56   Medicago truncatula
gb|ACL35349.1|  catalase                                                197   1e-56   Picea glauca
gb|AAR97905.1|  catalase                                                197   1e-56   Solanum tuberosum [potatoes]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         197   1e-56   Setaria italica
emb|CAA85470.1|  catalase                                               197   1e-56   Solanum tuberosum [potatoes]
ref|XP_010692546.1|  PREDICTED: catalase                                197   1e-56   Beta vulgaris subsp. vulgaris [field beet]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               197   1e-56   Solanum tuberosum [potatoes]
gb|AHA50082.1|  catalase                                                197   2e-56   Eleutherococcus senticosus
gb|ADU56199.1|  catalase                                                197   2e-56   Hevea brasiliensis [jebe]
gb|AIU99488.1|  catalase                                                197   2e-56   Saccharum hybrid cultivar ROC22
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                197   2e-56   Erythranthe guttata [common monkey flower]
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    197   2e-56   
gb|AIU99481.1|  catalase                                                197   2e-56   Saccharum spontaneum [fodder cane]
gb|AIM43584.1|  catalase                                                197   2e-56   Saccharum hybrid cultivar Yacheng05-179
gb|AIU99485.1|  catalase                                                197   2e-56   Saccharum spontaneum [fodder cane]
gb|AIU99484.1|  catalase                                                197   2e-56   Saccharum arundinaceum
ref|XP_002521709.1|  catalase, putative                                 197   2e-56   Ricinus communis
gb|ACN36234.1|  unknown                                                 192   3e-56   Zea mays [maize]
dbj|BAJ90861.1|  predicted protein                                      196   3e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          196   3e-56   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               196   3e-56   
gb|AIP93616.1|  CAT1                                                    196   4e-56   
gb|AIZ77475.1|  catalase                                                196   4e-56   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      196   5e-56   
ref|NP_001105415.1|  catalase isozyme 1                                 196   5e-56   
gb|AAK67359.2|AF390210_1  catalase                                      196   5e-56   
ref|XP_009103333.1|  PREDICTED: catalase-1                              196   5e-56   
emb|CDY01363.1|  BnaA07g11360D                                          196   5e-56   
emb|CDY31877.1|  BnaC07g15270D                                          196   6e-56   
gb|AIU99480.1|  catalase                                                196   6e-56   
dbj|BAJ88747.1|  predicted protein                                      196   8e-56   
gb|AAB07026.1|  catalase 1                                              195   8e-56   
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    195   8e-56   
gb|ADU56198.1|  catalase                                                195   9e-56   
gb|AAL00886.1|  catalase                                                189   1e-55   
gb|AAF61732.1|AF243517_1  catalase 2                                    194   1e-55   
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             195   1e-55   
gb|AAG61140.2|AF332973_1  catalase 2                                    194   2e-55   
gb|AIU99486.1|  catalase                                                194   3e-55   
gb|AIU99482.1|  catalase                                                194   3e-55   
gb|AHB72694.1|  catalase                                                194   3e-55   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 194   3e-55   
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 198   4e-55   
gb|AIU99487.1|  catalase                                                193   4e-55   
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      193   5e-55   
emb|CAE82295.1|  catalase                                               193   6e-55   
gb|AAF61733.1|AF243518_1  catalase 3                                    193   7e-55   
gb|AAC19398.1|  root catalase                                           192   7e-55   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             192   1e-54   
tpg|DAA43177.1|  TPA: catalase2                                         192   1e-54   
gb|ABV55108.1|  catalase 2                                              192   1e-54   
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               192   1e-54   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      192   2e-54   
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               191   2e-54   
gb|AIU99483.1|  catalase                                                191   2e-54   
prf||1803522A  catalase                                                 191   2e-54
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      191   2e-54   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         191   3e-54   
ref|NP_001105310.1|  catalase isozyme 2                                 191   3e-54   
gb|AAF61734.1|AF243519_1  catalase 4                                    191   3e-54   
gb|ADK25939.1|  catalase                                                184   4e-54   
tpg|DAA43178.1|  TPA: catalase2                                         190   1e-53   
gb|ABY21704.1|  catalase-1 precursor                                    189   1e-53   
emb|CBI29556.3|  unnamed protein product                                178   1e-53   
gb|ACH63223.1|  catalase                                                189   2e-53   
gb|KHG21219.1|  Catalase isozyme 1                                      187   2e-53   
gb|ADN94253.1|  catalase                                                189   2e-53   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             188   2e-53   
gb|AFD29285.1|  catalase                                                188   3e-53   
ref|NP_001031073.1|  catalase 3                                         188   3e-53   
gb|ABB72796.1|  catalase isozyme 1-like protein                         188   3e-53   
dbj|BAH37035.1|  catalase 1                                             188   4e-53   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      188   5e-53   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             186   1e-52   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             186   4e-52   
dbj|BAD07937.1|  catalase catA-like protein                             176   6e-52   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         184   8e-52   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            184   2e-51   
emb|CDY31490.1|  BnaC05g15990D                                          183   2e-51   
emb|CDY29518.1|  BnaA06g14520D                                          183   2e-51   
ref|XP_009149540.1|  PREDICTED: catalase-1                              183   2e-51   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         183   4e-51   
gb|AFI48111.1|  catalase isozyme B                                      172   7e-51   
gb|ACL81498.1|  catalase                                                182   8e-51   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   183   9e-51   
gb|AJF34884.1|  catalase                                                182   9e-51   
ref|XP_010477308.1|  PREDICTED: catalase-1                              182   1e-50   
gb|ABY68159.1|  catalase                                                171   1e-50   
gb|ABY68162.1|  catalase                                                171   1e-50   
gb|ABY68164.1|  catalase                                                171   2e-50   
gb|ABY68158.1|  catalase                                                171   2e-50   
gb|AFK46618.1|  unknown                                                 170   2e-50   
gb|AFI48054.1|  catalase isozyme B                                      170   4e-50   
gb|ABY68160.1|  catalase                                                169   6e-50   
gb|ABY68161.1|  catalase                                                169   9e-50   
ref|XP_001779509.1|  predicted protein                                  178   2e-49   
gb|AFI48101.1|  catalase isozyme B                                      168   2e-49   
dbj|BAD94702.1|  catalase                                               167   3e-49   
gb|AFI48068.1|  catalase isozyme B                                      167   4e-49   
dbj|BAH56915.1|  AT1G20620                                              176   1e-48   
gb|AFI48131.1|  catalase isozyme B                                      165   2e-48   
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              175   3e-48   
ref|XP_010105996.1|  Catalase isozyme 1                                 172   3e-48   
gb|AFI48098.1|  catalase isozyme B                                      164   5e-48   
gb|AAC17730.1|  catalase 2                                              172   6e-48   
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             174   6e-48   
dbj|BAJ92414.1|  predicted protein                                      174   6e-48   
ref|NP_001045673.1|  Os02g0115700                                       174   1e-47   
ref|NP_001031791.1|  catalase 2                                         173   1e-47   
dbj|BAH19523.1|  AT4G35090                                              173   1e-47   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          174   1e-47   
gb|ABN71233.2|  catalase                                                173   1e-47   
gb|ADY02963.1|  catalase                                                173   1e-47   
emb|CAH61266.1|  catalase                                               173   1e-47   
gb|EMS51034.1|  Catalase isozyme 2                                      173   1e-47   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 173   2e-47   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               172   2e-47   
gb|ABY68163.1|  catalase                                                162   2e-47   
gb|AAX88799.1|  catalase                                                172   3e-47   
gb|AFI48130.1|  catalase isozyme B                                      162   4e-47   
ref|XP_001752315.1|  predicted protein                                  172   4e-47   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      171   2e-46   
gb|ADQ28492.1|  catalase                                                171   2e-46   
gb|EMT06167.1|  Catalase isozyme 2                                      172   2e-46   
gb|EMS61345.1|  Catalase isozyme 1                                      171   5e-46   
ref|XP_001784759.1|  predicted protein                                  169   5e-46   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      169   6e-46   
gb|ABK24449.1|  unknown                                                 169   8e-46   
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      168   1e-45   
gb|AGI65617.1|  catalase                                                167   3e-45   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          166   4e-45   
gb|AGT16203.1|  catalase                                                165   2e-44   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    164   3e-44   
emb|CAA43814.1|  catalase                                               164   5e-44   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           164   5e-44
ref|XP_005645077.1|  catalase                                           163   6e-44   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          162   2e-43   
gb|ABR16304.1|  unknown                                                 161   2e-43   
gb|AII23739.1|  catalase                                                161   4e-43   
gb|ABK24543.1|  unknown                                                 161   4e-43   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              159   2e-42   
gb|ABK41476.1|  catalase                                                157   2e-41   
gb|AGT16188.1|  catalase                                                155   4e-41   
gb|AGT16054.1|  catalase                                                155   5e-41   
gb|AGT16310.1|  catalase                                                155   5e-41   
gb|AGT15888.1|  catalase                                                155   5e-41   
gb|AFW66787.1|  catalase3                                               155   6e-41   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               155   6e-41   
gb|AHZ13843.1|  catalase                                                154   1e-40   
gb|AFW66785.1|  catalase3 isoform 1                                     154   4e-40   
gb|KIY96954.1|  catalase                                                150   7e-40   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     152   1e-39   
gb|AID50071.1|  catalase                                                142   4e-39   
gb|ABS72010.1|  putative catalase                                       137   5e-38   
ref|XP_011396830.1|  Catalase isozyme 2                                 147   8e-38   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      146   1e-37   
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656             139   1e-37   
gb|AEY70510.1|  catalase                                                142   3e-37   
ref|XP_008365914.1|  PREDICTED: catalase isozyme 3-like                 135   6e-37   
gb|EMS35721.1|  Catalase isozyme 1                                      140   7e-37   
ref|XP_002950455.1|  catalase                                           143   1e-36   
ref|NP_001105416.1|  catalase isozyme 3                                 143   2e-36   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        142   2e-36   
ref|XP_008348923.1|  PREDICTED: catalase isozyme 3-like                 134   3e-36   
ref|XP_001696763.1|  catalase/peroxidase                                140   2e-35   
emb|CAA73663.1|  catalase                                               140   2e-35   
emb|CAA42026.1|  catalase                                               130   4e-35   
gb|AFW66789.1|  catalase3                                               135   9e-35   
ref|XP_005708279.1|  catalase                                           137   1e-34   
gb|AAB70006.1|  catalase                                                137   3e-34   
gb|AFW66788.1|  catalase3                                               135   1e-33   
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            130   6e-32
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             130   6e-32   
ref|XP_002980252.1|  hypothetical protein SELMODRAFT_112333             121   3e-31   
gb|KJB10391.1|  hypothetical protein B456_001G198700                    127   5e-31   
gb|AAR84577.1|  catalase 1b                                             127   7e-31   
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              127   7e-31   
emb|CDY43951.1|  BnaC04g21590D                                          122   2e-30   
emb|CDY31866.1|  BnaC07g15160D                                          120   4e-30   
gb|KDD77132.1|  catalase                                                125   5e-30   
gb|ABB88582.1|  catalase                                                124   7e-30   
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      124   1e-29   
gb|KJB17474.1|  hypothetical protein B456_003G002800                    120   2e-28   
gb|AGS17821.1|  catalase 2                                              112   4e-26   
ref|XP_005536240.1|  catalase                                           110   5e-25   
gb|AAO16182.1|  catalase-1                                              102   5e-24   
gb|AFN85536.1|  catalase                                                100   8e-24   
gb|ABR25882.1|  catalase isozyme b                                    98.2    6e-23   
gb|AAY34915.1|  catalase                                              97.1    2e-22   
ref|XP_005712277.1|  unnamed protein product                            102   5e-22   
gb|AAP57673.1|  catalase                                                100   6e-22   
gb|ABB51561.1|  truncated catalase 2                                  98.6    8e-21   
gb|AFH53190.1|  catalase                                              95.5    3e-20   
gb|AFH53189.1|  catalase                                              95.5    3e-20   
gb|AFH53187.1|  catalase                                              95.5    3e-20   
ref|XP_002963082.1|  hypothetical protein SELMODRAFT_79329            90.1    1e-19   
gb|KJE89728.1|  catalase isozyme 2                                    96.3    2e-19   
ref|XP_004366029.2|  catalase isozyme 2                               95.9    2e-19   
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                   91.7    1e-18   
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2    92.4    1e-18   
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like               92.4    1e-18   
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like               92.4    2e-18   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg           91.3    3e-18   
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g           88.6    4e-17   
emb|CDP22058.1|  unnamed protein product                              84.3    7e-17   
emb|CCQ26769.2|  perixode catalase                                    81.6    9e-17   
gb|ACU23083.1|  unknown                                               83.2    5e-16   
ref|XP_005647994.1|  catalase-domain-containing protein               84.0    2e-15   
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg           80.5    3e-15   
ref|NP_973873.1|  catalase 3                                          82.8    4e-15   
ref|XP_005644653.1|  catalase-domain-containing protein               83.2    5e-15   
gb|KEH36313.1|  catalase heme-binding enzyme                          79.0    9e-14   
ref|XP_002980255.1|  hypothetical protein SELMODRAFT_112561           72.4    2e-13   
ref|XP_005642928.1|  catalase                                         75.9    1e-12   
gb|KCW44990.1|  hypothetical protein EUGRSUZ_L01419                   75.5    1e-12   
gb|AEA86295.1|  putative catalase                                     72.0    2e-12   
ref|WP_044037961.1|  catalase                                         74.7    3e-12   
ref|WP_032664185.1|  catalase                                         74.7    3e-12   
ref|WP_032632526.1|  catalase                                         73.9    5e-12   
gb|ABS89000.1|  catalase                                              70.5    7e-12   
gb|KIQ35234.1|  catalase                                              73.6    7e-12   
ref|WP_043304355.1|  catalase                                         73.6    7e-12   
ref|WP_004887231.1|  catalase                                         73.6    8e-12   
ref|XP_010320460.1|  PREDICTED: catalase isozyme 3-like               69.3    1e-11   
ref|WP_037022052.1|  catalase                                         72.8    1e-11   
gb|EQM67709.1|  catalase                                              72.8    1e-11   
ref|WP_043244592.1|  catalase                                         72.4    2e-11   
gb|AFA36510.1|  catalase                                              69.7    2e-11   
ref|WP_043830984.1|  catalase                                         71.6    4e-11   
ref|WP_032610664.1|  catalase                                         71.2    4e-11   
ref|WP_032632922.1|  catalase                                         71.2    4e-11   
ref|WP_038401366.1|  catalase                                         71.2    4e-11   
gb|AHG41775.1|  catalase                                              71.2    5e-11   
ref|WP_032884665.1|  catalase                                         70.9    5e-11   
ref|WP_027605312.1|  catalase                                         70.9    7e-11   
ref|WP_043193175.1|  catalase                                         70.5    7e-11   
ref|WP_022641122.1|  catalase                                         70.5    8e-11   
ref|WP_032622880.1|  catalase                                         70.5    8e-11   
gb|EGH29791.1|  catalase                                              68.2    1e-10   
ref|WP_026673818.1|  catalase                                         70.1    1e-10   
gb|EXF12210.1|  catalase family protein                               66.6    1e-10   



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score =   268 bits (686),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               PVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKC
Sbjct  42   MLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKC  101

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQ
Sbjct  102  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQ  161

Query  236  KVASRLNIRPTM  201
            KVASRLNIRPTM
Sbjct  162  KVASRLNIRPTM  173



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  593  CFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCV  414
              PVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCV
Sbjct  362  LLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCV  421

Query  413  IEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQK  234
            IEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQK
Sbjct  422  IEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQK  481

Query  233  VASRLNIRPTM  201
            VASRLNIRPTM
Sbjct  482  VASRLNIRPTM  492



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  593  CFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCV  414
              PVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCV
Sbjct  362  LLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCV  421

Query  413  IEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQK  234
            IEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQK
Sbjct  422  IEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQK  481

Query  233  VASRLNIRPTM  201
            VASRLNIRPTM
Sbjct  482  VASRLNIRPTM  492



>gb|AFR42412.1| catalase, partial [Eperua falcata]
Length=131

 Score =   224 bits (571),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN YDG+MNF+HRDEE+DYFPS+FD  R+AERFP P  IVTG+R++C+I
Sbjct  2    LPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRFDPVRHAERFPIPPAIVTGKRERCII  61

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKEN+FKQPG+RYRSWAPDRQDRF+ RWV+ L++PRVTHEIRS WISYL+QADRSLGQKV
Sbjct  62   EKENDFKQPGERYRSWAPDRQDRFVRRWVEVLADPRVTHEIRSIWISYLSQADRSLGQKV  121

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  122  ASHLNMRPSI  131



>gb|AFR42410.1| catalase, partial [Eperua falcata]
Length=135

 Score =   223 bits (567),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN YDG+MNF+HRDEE+DYFPS+FD  R+A+RFP P  IVTG+R++C+I
Sbjct  6    LPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRFDPVRHAKRFPIPPAIVTGKRERCII  65

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKEN+FKQPG+RYRSWAPDRQDRF+ RWV+ L++PRVTHEIRS WISYL+QADRSLGQKV
Sbjct  66   EKENDFKQPGERYRSWAPDRQDRFVRRWVEVLADPRVTHEIRSIWISYLSQADRSLGQKV  125

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  126  ASHLNMRPSI  135



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P PLR++TG+RDKC++
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPLRVLTGKRDKCIV  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKI  482

Query  230  ASRLNIRPTM  201
            ASRLNIRPTM
Sbjct  483  ASRLNIRPTM  492



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   219 bits (558),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MN +HRDEE++YFPSKFD  R+AER+P P +IVTG+R+K +I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNIMHRDEEINYFPSKFDPVRHAERYPIPSQIVTGKREKVII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFINRW+K+L+EPRVTHE RS WISY TQAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFINRWIKALTEPRVTHEHRSIWISYWTQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRL+ RP+M
Sbjct  483  ASRLSARPSM  492



>dbj|BAH20283.1| AT1G20620 [Arabidopsis thaliana]
Length=145

 Score =   208 bits (530),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  16   LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  75

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  76   KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  135

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  136  ASRLNVRPSI  145



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS++   R+AE FP P  I+TG+RDKCVI
Sbjct  363  LPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYQPARHAETFPIPSNIITGKRDKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVT+EIRS WISY +QADRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTYEIRSIWISYWSQADRSFGQKL  482

Query  230  ASRLNIRPTM  201
            A+RLN+RP++
Sbjct  483  ATRLNVRPSI  492



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   219 bits (557),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG+RDKC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQHPIPPRVLTGKRDKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD++LGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKTLGQKI  482

Query  230  ASRLNIRPTM  201
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P RI+TGRR+KC
Sbjct  361  LMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPFRILTGRREKC  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VI KENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT+EIR+ WISY +Q DRSLGQ
Sbjct  421  VIHKENNFKQPGERYRSWAPDRQERFICRWVEALSDPRVTYEIRTIWISYWSQCDRSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+A+RLN++P+M
Sbjct  481  KIATRLNVKPSM  492



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P  I++G+R+KC+I
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P  I++G+R+KC+I
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  RNAERFP P  I++G+R+KC+I
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRNAERFPIPPNILSGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVI
Sbjct  294  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVI  353

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  354  EKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKL  413

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  414  ASRLNVRPSI  423



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   216 bits (551),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P  ++TG+RDKC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPCVLTGKRDKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS W SY +QAD++LGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWFSYWSQADKTLGQKI  482

Query  230  ASRLNIRPTM  201
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   209 bits (533),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P  I++GRR+KCVI
Sbjct  132  LPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLPHAIISGRREKCVI  191

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPGDRYRSW PDRQ+RF+ R V +LS+PR+THEIRS W+SY +Q D+SLGQK+
Sbjct  192  EKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVSYWSQCDKSLGQKL  251

Query  230  ASRLNIRPTM  201
            ASRLN+RP  
Sbjct  252  ASRLNVRPNF  261



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P  I++GRR+KCVI
Sbjct  141  LPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLPHAIISGRREKCVI  200

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPGDRYRSW PDRQ+RF+ R V +LS+PR+THEIRS W+SY +Q D+SLGQK+
Sbjct  201  EKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVSYWSQCDKSLGQKL  260

Query  230  ASRLNIRPTM  201
            ASRLN+RP  
Sbjct  261  ASRLNVRPNF  270



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D +R+AERFP P  + TG+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPSRHAERFPIPPALCTGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFINRWV ++S+PRVTHEIRS WI+Y +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFINRWVDAMSDPRVTHEIRSIWITYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC + NN YDG+MNF+HRDEEVDYFPS++D TR+AER+P P  ++TGRR+K  I
Sbjct  348  LPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACI  407

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L +PRVTHE+RS W+SY +QADRSLGQK+
Sbjct  408  EKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKL  467

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  468  ASRLNVRPSI  477



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MNF+HRDEE++YFPSKFD  R+AER+P P +IVTG+R++ +I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEINYFPSKFDPVRHAERYPIPSQIVTGKRERVII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQ G+RYRSWAPDRQ+RFINRW+K+LSEPRVTHE RS WISY TQAD+S+GQK+
Sbjct  423  EKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWISYWTQADKSIGQKL  482

Query  230  ASRLNIRPTM  201
            AS L+ RP+M
Sbjct  483  ASSLSARPSM  492



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC + NN YDG+MNF+HRDEEVDYFPS++D TR+AER+P P  ++TGRR+K  I
Sbjct  364  LPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACI  423

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L +PRVTHE+RS W+SY +QADRSLGQK+
Sbjct  424  EKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKL  483

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  484  ASRLNVRPSI  493



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKCA+HNN ++G+MNF+HR+EEV+YFPS++D  R+AER+P P +I TG+R+KC
Sbjct  361  LLLPANAPKCAHHNNHHEGFMNFLHREEEVNYFPSRYDPVRHAERYPIPPQICTGKREKC  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VIEKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS+PRVTHEIRS WISY +QAD+SLGQ
Sbjct  421  VIEKENNFKQPGERYRSWAPDRQERFIKRWIDALSDPRVTHEIRSIWISYWSQADKSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+ASRLN++P+M
Sbjct  481  KLASRLNVKPSM  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G MNF+HRDEEV+YFPS+FD  R+AE++P P RI+TG+RD+C+I
Sbjct  363  LPVNAPKCAHHNNHHEGVMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS+PRVTHEI + WISY +QAD+SLG+K+
Sbjct  423  EKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIHTIWISYWSQADKSLGEKI  482

Query  230  ASRLNIRPTM  201
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               PVNAPKCAYHNN YDG+MNF+HRDEEVDYFPSK+D TR+AER P P  ++TGRRD+ 
Sbjct  361  LLLPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPSKYDPTRHAERHPIPNAVITGRRDRR  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VIEKE+NFKQ GDRYRSWAPDRQ+RF+ RWV +LS+PR+T EIRS W+SY +QAD+S GQ
Sbjct  421  VIEKEDNFKQAGDRYRSWAPDRQERFLRRWVDALSDPRLTLEIRSIWVSYWSQADKSFGQ  480

Query  236  KVASRLNIRPTM  201
            K+ASRLN+RPTM
Sbjct  481  KLASRLNVRPTM  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P  +VTGRR+K 
Sbjct  361  LMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSSVVTGRREKS  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            +I KENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVTHEIR  WISY +Q D+SLGQ
Sbjct  421  IINKENNFKQPGERYRSWAPDRQERFVHRWVDALSDPRVTHEIRDIWISYWSQCDKSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+A+RLN++PTM
Sbjct  481  KIATRLNVKPTM  492



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I +GRR+KC I
Sbjct  179  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGI  238

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  239  EKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  298

Query  230  ASRLNIRPTM  201
            ASRL++RP +
Sbjct  299  ASRLSMRPNI  308



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WISY +QADRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D +R+AERFP P  + +GRR+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LSEPRVTHE+RS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFVRRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  483  ASHLNVRPSV  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WISY +QADRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I+ G+R+KCVI
Sbjct  363  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPSNILYGKREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN YDGYMN +HRDEE+DYFPS++D  R+AER P P R++TGRR++ VI
Sbjct  363  LPVNAPKCAHHNNHYDGYMNIMHRDEEIDYFPSRYDPVRHAERHPIPTRVLTGRRERRVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQP +RYRSWAPDRQ+RF+ RWV +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPVERYRSWAPDRQERFVRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKI  482

Query  230  ASRLNIRPTM  201
            A RLN+RPTM
Sbjct  483  AFRLNVRPTM  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D +R+AERFP P  + +GRR+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LSEPRVTHE+RS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFVCRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  483  ASHLNVRPSI  492



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AERFP+P  I +GRR+KC+I
Sbjct  363  LPVNAPKCVHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAERFPSPPAICSGRREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF+ RWV++LS+ R THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLKRWVEALSDKRCTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP+ 
Sbjct  483  ASRLNVRPSF  492



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P R++ G+RD+C+I
Sbjct  363  LPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRVLNGKRDRCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPG+RYRSWAPDRQ+RFI RWV +LSEPRVTHEIR+ W+SY +QAD+SLGQK+
Sbjct  423  QKENNFKQPGERYRSWAPDRQERFICRWVDALSEPRVTHEIRTIWLSYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN++PTM
Sbjct  483  ASRLNVKPTM  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+K  I
Sbjct  162  LPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPGRICSGKREKACI  221

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT EIRS W+SY +QAD+SLGQK+
Sbjct  222  EKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSLGQKI  281

Query  230  ASRLNIRPTM  201
            ASRLN+RP +
Sbjct  282  ASRLNVRPNI  291



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P  +++G+RDKCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERHPIPPPVLSGKRDKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+ RVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  QKENNFKQPGERYRSWAPDRQERFICRWVDALSDARVTHEIRSIWISYWSQADKSLGQKI  482

Query  230  ASRLNIRPTM  201
            A+RLN+RPTM
Sbjct  483  ATRLNVRPTM  492



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  230  ASRLNIRPTM  201
            ASRL ++PTM
Sbjct  483  ASRLTVKPTM  492



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G MNF++RDEEV+YFPS+FD  R+AE++P P RI+TG+RD+C+I
Sbjct  363  LPVNAPKCAHHNNHHEGVMNFMYRDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS+PRVTHEIR  WISY +QAD+SLG+K+
Sbjct  423  EKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIRIIWISYWSQADKSLGEKI  482

Query  230  ASRLNIRPTM  201
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  215  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  274

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+
Sbjct  275  EKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKL  334

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  335  ASRLNVRPSI  344



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P RI+TGRR+KC
Sbjct  361  LMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSRILTGRREKC  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VI KENNFKQPG+RYRSW P+RQ+RFI RWV++LS+PRVTHEI+S WISY +Q D+SLGQ
Sbjct  421  VIHKENNFKQPGERYRSWDPNRQERFIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+A+RLN++P M
Sbjct  481  KIATRLNVKPCM  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P RI TG+R+KC
Sbjct  361  LMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERFPIPPRICTGKREKC  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VIEKENNFKQPG+RYRS+ PDRQ+RFI RW  +LS+PRVTHEIRS WISY +QAD+SLGQ
Sbjct  421  VIEKENNFKQPGERYRSFDPDRQERFIKRWFDALSDPRVTHEIRSIWISYWSQADKSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+A+RLN++P+M
Sbjct  481  KLATRLNVKPSM  492



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G MNF+HRDEEV+YFPS+FD+ R+AE+FP P  ++ G+RD+C+I
Sbjct  363  LPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT EIRS WISY TQAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKI  482

Query  230  ASRLNIRPTM  201
            AS LN+RP+M
Sbjct  483  ASCLNVRPSM  492



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT+EIRS WISY +QADRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               PVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  R+AERFP P R++TG+R+KC
Sbjct  361  LMLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERFPIPTRVLTGKREKC  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            +I KENNFKQPG+RYRS++PDRQ+RFI RWV++LS+P+VTHEIRS WISY +Q D+SL Q
Sbjct  421  MISKENNFKQPGERYRSFSPDRQERFIRRWVEALSDPKVTHEIRSIWISYWSQCDKSLSQ  480

Query  236  KVASRLNIRPTM  201
            K+A+RL+++P+M
Sbjct  481  KLATRLSVKPSM  492



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSNICTGKREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT+EIRS WISY +QADRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVI
Sbjct  363  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
             SRLN+RP++
Sbjct  483  LSRLNVRPSI  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D +R+AER+P P  +++G+R K  I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS+PR+THEIRS W+SY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP M
Sbjct  483  ASRLNVRPAM  492



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS+PR THEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRATHEIRSIWISYLSQADKSCGQKV  482

Query  230  ASRLNIRPTM  201
            ASRL ++PTM
Sbjct  483  ASRLTVKPTM  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVI
Sbjct  363  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
             SRLN+RP++
Sbjct  483  LSRLNVRPSI  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D +R+AER+P P  +++G+R K  I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS+PR+THEIRS W+SY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            AS LN+RPTM
Sbjct  483  ASHLNVRPTM  492



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPVPSKSYTGIRTKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPGDRYRSWAPDRQDRFI RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFIKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score =   208 bits (530),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  248  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  307

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  308  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  367

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  368  ASRLNVRPSI  377



>gb|ACJ73905.1| CAT1 [Solanum nigrum]
Length=168

 Score =   201 bits (512),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P ++ +G+R+KC+I
Sbjct  39   LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEIYPIPSKVCSGKREKCII  98

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ G+RYR++ PDRQ+RF+ RWV+ LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  99   QKENNFKQAGERYRTFTPDRQERFVRRWVEPLSDPRITYEIRSIWISYWSQADKSLGQKL  158

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  159  ASRLNVRPSI  168



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   211 bits (537),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN YDG MNF+HRDEEVDYFPS++D  R+AE+FP P   + GRRD+ +I
Sbjct  363  LPVNAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRYDTARHAEKFPIPPVNLIGRRDRRII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPGD YR+WAPDRQ+RFI RW+  LS+P+VTHE+RS WISYL+QADRSLGQKV
Sbjct  423  EKENNFKQPGDLYRTWAPDRQERFIRRWIGVLSDPKVTHEVRSIWISYLSQADRSLGQKV  482

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  483  ASHLNMRPSI  492



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score =   211 bits (537),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  371  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  430

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  431  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  490

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  491  ASRLNVRPSI  500



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   208 bits (530),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  254  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  313

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKV
Sbjct  314  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  373

Query  230  ASRLNIRPTM  201
            ASRL ++PTM
Sbjct  374  ASRLTLKPTM  383



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   211 bits (536),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   211 bits (536),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   211 bits (536),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWA DRQ+RFI RWV++LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAADRQERFICRWVEALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G MNF+HRDEEV+YFPS+FD+ R+AE+FP P  ++ G+RD+C+I
Sbjct  455  LPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMI  514

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT EIRS WISY TQAD+SLGQK+
Sbjct  515  EKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKI  574

Query  230  ASRLNIRPTM  201
            AS LN+RP+M
Sbjct  575  ASCLNVRPSM  584



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G MNF+HRDEEV+YFPS+FD  R+AER P P  ++TG+RD+C+I
Sbjct  363  LPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPIPPPVLTGKRDRCMI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYR++APDRQ+RF+ RWV +LS+PRVTHEIRS WISY TQAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWTQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D+ R+AE FP P  I +GRR+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  230  ASRLNIRPTM  201
            AS LN+RP +
Sbjct  483  ASHLNMRPNI  492



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  414  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  473

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  474  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  533

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  534  ASRLNVRPSI  543



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -2

Query  587  PVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIE  408
            P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER P P RI+ G+R+KC+IE
Sbjct  364  PANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMIE  423

Query  407  KENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVA  228
            KENNFKQPG+RYRSWA DRQ+RF+ RWV +LSEPRVTHEIRS WISY +QADRSLGQK+A
Sbjct  424  KENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKIA  483

Query  227  SRLNIRPTM  201
            S LN++P++
Sbjct  484  SHLNLKPSI  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE FP P  ++TGRR+KCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSCVLTGRREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRSWAPDRQ RFI RWV++LS+PRVT+EIRS WISY +Q DRSLGQK+
Sbjct  423  HKENNFKQPGERYRSWAPDRQGRFICRWVEALSDPRVTYEIRSIWISYWSQCDRSLGQKI  482

Query  230  ASRLNIRPTM  201
            A+RLN++P+M
Sbjct  483  ATRLNVKPSM  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D+ R+AE FP P  I +GRR+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  230  ASRLNIRPTM  201
            AS LN+RP +
Sbjct  483  ASHLNMRPNI  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P  I +GRR+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERFPIPPAICSGRREKCGI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  230  ASRLNIRPTM  201
            AS L+ RP +
Sbjct  483  ASHLSTRPNI  492



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P RI+TGRR+KCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERCPIPSRILTGRREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPG+RYRSW PDRQ RFI RWV++LS+PRVTHEI+S WISY +Q D+SLG+K+
Sbjct  423  QKENNFKQPGERYRSWDPDRQGRFIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGRKI  482

Query  230  ASRLNIRPTM  201
            A+RLN++P+M
Sbjct  483  ATRLNVKPSM  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I TG R++C I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAICTGSRERCAI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRS+APDRQDRF+ RWV +LS+PRVTHEIRSTWISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSFAPDRQDRFVRRWVDALSDPRVTHEIRSTWISYWSQADRSLGQKI  482

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  483  ASHLNLRPSI  492



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG MNF+HRDEEVDYFPS+FD  R+AE FP P  I  G+R+K VI
Sbjct  363  LPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT+EIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRP  207
            ASRLN++P
Sbjct  483  ASRLNVKP  490



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG MNF+HRDEEVDYFPS+FD  R+AE FP P  I  G+R+K VI
Sbjct  363  LPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT+EIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRP  207
            ASRLN++P
Sbjct  483  ASRLNVKP  490



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS+FD  R+A R P P  ++ G+RD+CVI
Sbjct  363  LPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRFDPVRHAARHPIPSTVLRGKRDRCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQ G+RYRSWAPDRQ+RFI RWV  LS+ RVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  PKENNFKQAGERYRSWAPDRQERFICRWVDILSDARVTHEIRSIWISYWSQADKSLGQKM  482

Query  230  ASRLNIRPTM  201
            A+RLN+RPTM
Sbjct  483  ATRLNVRPTM  492



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  427  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  486

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+
Sbjct  487  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  546

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  547  ASRLNVRPSI  556



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PR THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRATHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  I  G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQHPIPSAIFNGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D  R++ERFP P  I +GRRDKCVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRCDPVRHSERFPIPSTICSGRRDKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNF+QPG+RYRSWAPDRQ+RF+NR V  LS+PR+THE+RS WISY TQ DRSLGQK+
Sbjct  423  EKENNFEQPGERYRSWAPDRQERFLNRMVGCLSDPRITHELRSIWISYWTQCDRSLGQKL  482

Query  230  ASRLNIRPTM  201
            A RLN+RP++
Sbjct  483  AFRLNVRPSI  492



>emb|CAA10286.1| catalase [Cicer arietinum]
Length=125

 Score =   199 bits (505),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  575  PKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENN  396
            PKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPTP   ++G+R++C+  KENN
Sbjct  1    PKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIRPKENN  60

Query  395  FKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLN  216
            FKQPG+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WISY +QADRSLGQK+AS LN
Sbjct  61   FKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLN  120

Query  215  IRPTM  201
            +RP++
Sbjct  121  MRPSI  125



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P   + G+RD+  I
Sbjct  136  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERFPHPPVALNGKRDRICI  195

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG++YRS+ PDRQ+RFI RWV +LS+PR+THEIRS W+SY TQAD+SLGQK+
Sbjct  196  EKENNFKQPGEKYRSFPPDRQERFIKRWVDALSDPRLTHEIRSIWVSYWTQADKSLGQKL  255

Query  230  ASRLNIRPTM  201
            ASRLNIRPTM
Sbjct  256  ASRLNIRPTM  265



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  329  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  388

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  389  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  448

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  449  ASRLNVRPSI  458



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I +GRR+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  230  ASRLNIRPTM  201
            ASRL++RP +
Sbjct  483  ASRLSMRPNI  492



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  423  QKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  423  QKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++   R+AE FP P  I+TG+RDKCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYQPARHAETFPIPSSIITGKRDKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSE RVT+EIRS WISY +QADRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDVLSESRVTYEIRSIWISYWSQADRSFGQKL  482

Query  230  ASRLNIRPTM  201
            A+RLN+RP++
Sbjct  483  ATRLNVRPSI  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  362  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  421

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  422  QKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  481

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  482  ASRLNVRPSI  491



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN +DG+MNF+HRDEEV+Y PS+FD  R+AERFP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYLPSRFDPVRHAERFPIPPAVCTGRREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF +RWV++LS+PRVTHEI S WISY TQ D+ LGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFTHRWVEALSDPRVTHEICSIWISYWTQCDKFLGQKL  482

Query  230  ASRLNIRPTM  201
            A+RLN+RP++
Sbjct  483  ATRLNVRPSI  492



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKV
Sbjct  423  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  482

Query  230  ASRLNIRPTM  201
            ASRL ++PTM
Sbjct  483  ASRLTVKPTM  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD +R+AER+P P  + +G+R++C+I
Sbjct  215  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCII  274

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS+ RVTHEIRS WISY +QADRSLGQK+
Sbjct  275  EKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKL  334

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  335  ASHLNVRPSI  344



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWA DRQ+RFI RWV++ S+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAADRQERFICRWVEAFSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPIPNKSYTGIRTKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  230  ASRLNIRPTM  201
            ASRL ++PTM
Sbjct  483  ASRLLVKPTM  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKV
Sbjct  423  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  482

Query  230  ASRLNIRPTM  201
            ASRL ++PTM
Sbjct  483  ASRLTLKPTM  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  LKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I+TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAILTGRREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  423  PKENNFKQPGERYRSFAPDRQERFIQRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKV
Sbjct  423  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  482

Query  230  ASRLNIRPTM  201
            ASRL ++PTM
Sbjct  483  ASRLTLKPTM  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I +GRR++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPVICSGRRERCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRS+ PDRQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFTPDRQERFIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+
Sbjct  423  EKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G MNF+HRDEEV+Y PS+ D  R+AE++P P R++TG+R+K +I
Sbjct  363  LPVNAPKCAHHNNHHEGLMNFMHRDEEVNYLPSRLDPCRHAEQYPIPPRVLTGKREKVII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+ YRSWAPDRQ+RF+ RWV +LS+PR THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGEHYRSWAPDRQERFLCRWVDALSDPRATHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLNIRPTM
Sbjct  483  ASRLNIRPTM  492



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIR+ WISY +QAD+SLGQK+
Sbjct  423  QKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRTIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               PVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+K 
Sbjct  356  LMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPGRICSGKREKA  415

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
             IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT EIRS W+SY +QAD+SLGQ
Sbjct  416  CIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSLGQ  475

Query  236  KVASRLNIRPTM  201
            K+ASRLN+RP +
Sbjct  476  KIASRLNVRPNI  487



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  356  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  415

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  416  QKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWISYWSQADKSLGQKL  475

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  476  ASRLNVRPSI  485



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D TR++E +P P  +++G+R+K  I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPTRHSEMYPIPPVVLSGKREKRCI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               PVNAPKCA+HNN YDG+MNF HRDEEVDYFPS+FD  R+AER P P ++V+G+R++C
Sbjct  361  LMLPVNAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAERCPLPPQLVSGKRERC  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VIEKENNFKQPGDRYRS+APDRQ+RF+ R V +LS+ RVTHEIRS WISY +Q D+SLGQ
Sbjct  421  VIEKENNFKQPGDRYRSFAPDRQERFVKRIVDALSDTRVTHEIRSIWISYWSQCDKSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+A+RLNI+P M
Sbjct  481  KIATRLNIKPHM  492



>gb|ACV30589.1| catalase [Carica papaya]
Length=170

 Score =   198 bits (504),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 114/131 (87%), Gaps = 1/131 (1%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG-RRDKCV  414
             PVNAPKCA+ NN +DGYMNF+HRDEEV+Y PSKFD   NAER+P P ++ +  +R+KC+
Sbjct  40   LPVNAPKCAHRNNHFDGYMNFMHRDEEVNYHPSKFDPVTNAERYPIPTKVYSACKREKCI  99

Query  413  IEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQK  234
            IEK+N+FKQPG+RYR++ PDRQ+RFINRWVK+LSEPR+THEIRS WI +L++AD SLG+K
Sbjct  100  IEKQNDFKQPGERYRTFEPDRQERFINRWVKALSEPRITHEIRSIWIDWLSRADESLGRK  159

Query  233  VASRLNIRPTM  201
            VA RLNIRP++
Sbjct  160  VAMRLNIRPSI  170



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I
Sbjct  363  LPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+
Sbjct  423  PKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I
Sbjct  363  LPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+
Sbjct  423  PKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE+ P P RI+ G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKVPVPPRILGGKREKCMI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKI  482

Query  230  ASRLNIRPTM  201
            AS LN++P++
Sbjct  483  ASHLNLKPSI  492



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  + TG+R++CVI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAERYPHPPAVCTGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFK+PG+RYRSW PDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRS+GQK+
Sbjct  423  QKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADRSVGQKL  482

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  483  ASHLNVRPSI  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  + TG+R++CVI
Sbjct  363  LPANAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRS+GQK+
Sbjct  423  DKENNFKQPGERYRSWAPDRQERFIRRWVNALSDPRVTHEIRSIWISYWSQADRSVGQKL  482

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  483  ASHLNMRPSI  492



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I
Sbjct  383  LPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCII  442

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+
Sbjct  443  PKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKL  502

Query  230  ASRLNIRPTM  201
            ASRLN+RP +
Sbjct  503  ASRLNVRPNI  512



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               PVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+K 
Sbjct  361  LMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPSRICSGKREKA  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
             IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT E+RS W+SY +QAD+SLGQ
Sbjct  421  CIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFELRSIWVSYWSQADKSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+ASRLN+RP +
Sbjct  481  KIASRLNVRPNI  492



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P    TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTNSYTGIRTKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I
Sbjct  347  LPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCII  406

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS+PRVTHEIR  WISY +QA +SLGQK+
Sbjct  407  PKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKL  466

Query  230  ASRLNIRPTM  201
             +RLN+RP++
Sbjct  467  TARLNVRPSI  476



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD+ R+A ++P P  I +G R KCVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPIPSAICSGERVKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPGDRYRSWAPDRQ+R+ NRWV++LS+ RVT EIR  WISYL+Q+D+SLG KV
Sbjct  423  EKENNFKQPGDRYRSWAPDRQERYANRWVEALSDARVTDEIRGIWISYLSQSDKSLGMKV  482

Query  230  ASRLNIRPTM  201
            A+RLN+RP+ 
Sbjct  483  ANRLNVRPSF  492



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++ GRR+ CVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLNGRREMCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKV
Sbjct  423  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  482

Query  230  ASRLNIRPTM  201
            ASRL ++PTM
Sbjct  483  ASRLTLKPTM  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+
Sbjct  423  EKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKL  482

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  483  ASLLNVRPSI  492



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ GDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  423  QKENNFKQAGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AERFP P  + +GRR+KC+I
Sbjct  363  LPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERFPIPPAVCSGRREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI+Y +QA +SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWITYWSQACKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN++P +
Sbjct  483  ASRLNVKPNI  492



>prf||2104177A catalase
Length=492

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE++P P   ++G+RDKCVI
Sbjct  363  LPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRS++PDRQ+RFINR V  LS+PRVTHE+RS W+SY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKI  482

Query  230  ASRLNIRP  207
            ASRLN++P
Sbjct  483  ASRLNVKP  490



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE++P P   ++G+RDKCVI
Sbjct  363  LPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRS++PDRQ+RFINR V  LS+PRVTHE+RS W+SY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKI  482

Query  230  ASRLNIRP  207
            ASRLN++P
Sbjct  483  ASRLNVKP  490



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIQRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AE++P P R++TG+R+K +I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLDPCRHAEQYPIPPRVLTGKREKVII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+ YRSWAP RQ+RF+ RWV +LS+ R THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGEHYRSWAPGRQERFVCRWVDALSDLRATHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLNIRPTM
Sbjct  483  ASRLNIRPTM  492



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCAYHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P  I +GRR+KCVI
Sbjct  363  LPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERSPIPNAICSGRREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF+ R V +LSEPR+T EIRS W+SY ++ D SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLCRLVNALSEPRITFEIRSIWVSYWSKCDASLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  348  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  407

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+
Sbjct  408  EKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKL  467

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  468  ASRLNVRPSI  477



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  587  PVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIE  408
            P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER P P RI+ G+R+KC+IE
Sbjct  305  PANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMIE  364

Query  407  KENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVA  228
            KENNFKQPG+RYRSWA DRQ+RF+ RWV +LSEPRVTHEIRS WISY +QADRSLGQK+A
Sbjct  365  KENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKIA  424

Query  227  SRLN  216
            S LN
Sbjct  425  SHLN  428



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNF QPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  423  QKENNFNQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKCA+HNN YDG+MNF HRDEEVDYFPS+FD  R+AE+FP P +I +G+R+KC
Sbjct  361  LMLPANAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAEKFPMPPQICSGKREKC  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            +IEKENNFKQPG+RYRS+A DRQ+RFI RWV +LS+PRVTHEI S WISY +Q D+SLGQ
Sbjct  421  MIEKENNFKQPGERYRSFAIDRQERFIKRWVDALSDPRVTHEILSIWISYWSQCDKSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+A+ LN++P M
Sbjct  481  KLATHLNLKPNM  492



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HR+EEV+YFPS++D  R+AER+P P  I TGRR++ VI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPIPSAICTGRRERTVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPG+RYRS++PDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  DKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPTP   ++G+R++C+ 
Sbjct  364  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIR  423

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WISY +QADRSLGQK+
Sbjct  424  PKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKI  483

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  484  ASHLNMRPSI  493



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  362  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  421

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  422  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  481

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  482  ASRLNVRPSI  491



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QAD SLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADASLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPTP   ++G+R++C+ 
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIR  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WISY +QADRSLGQK+
Sbjct  423  PKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKI  482

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  483  ASHLNMRPSI  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I
Sbjct  346  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCII  405

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPG+RYR++ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  406  QKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  465

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  466  ASRLNVRPSI  475



>prf||1906388A catalase
Length=492

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  362  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  421

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  422  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  481

Query  230  ASRLNI  213
            ASRLN+
Sbjct  482  ASRLNV  487



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P RI+ G R+KC
Sbjct  361  LMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQFPIPPRILNGGREKC  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
             I+KENNFKQPG++YRSWAPDRQ+RFI RW+ +LS+PRVTHEIR+ WI+Y +Q D+ LGQ
Sbjct  421  CIQKENNFKQPGEKYRSWAPDRQERFIKRWIDALSDPRVTHEIRTIWITYWSQCDKFLGQ  480

Query  236  KVASRLNIRPTM  201
            K+ASRLNI+PT+
Sbjct  481  KLASRLNIKPTL  492



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPSKSYTGIRTKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSE R+THEIRS WISY +QADRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSELRLTHEIRSIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  + +GRR++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPVPSVVCSGRRERCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRS+ PDR++RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFTPDRKERFIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASR+N+RP +
Sbjct  483  ASRMNVRPNI  492



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN +DG MNF+HRDEEV+YFPS++D  R+AE+FP P  +++G+R K VI
Sbjct  384  LPVNAPKCPHHNNHHDGAMNFMHRDEEVNYFPSRYDPCRHAEKFPIPPVVLSGQRVKTVI  443

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPGDRYRSWAPDRQ+RFI RW+ +LS+PR+T EIRS W+SY TQAD+SLGQK+
Sbjct  444  EKENNFKQPGDRYRSWAPDRQERFIRRWIDALSDPRLTAEIRSIWVSYWTQADKSLGQKL  503

Query  230  ASRLNIRPTM  201
            ASRLN+RP M
Sbjct  504  ASRLNVRPAM  513



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+RD+C I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKHPIPPVVLSGKRDRCCI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYR+++PDRQ+RFI RWV +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRTFSPDRQERFIRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WI+Y +QAD+SLGQK+
Sbjct  423  QKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R++C+I
Sbjct  321  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKRERCII  380

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  381  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  440

Query  230  ASRLNI  213
            ASRLN+
Sbjct  441  ASRLNV  446



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  RNAE FP P  I +G+R+KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPVPSAICSGKREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF+NR V  LS+PR+THE+R+ WISY  Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWISYWIQCDKSLGQKL  482

Query  230  ASRLNIRPTM  201
            A+RLN++P++
Sbjct  483  ATRLNVKPSI  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  356  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  415

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  416  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  475

Query  230  ASRLNIRPTM  201
            ASRLN+RP +
Sbjct  476  ASRLNVRPNI  485



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  + TG+R++CVI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFK+PG+RYRSW PDRQ+RFI RWV +LS+PRVTHEIRS WI+Y +QADRS+GQK+
Sbjct  423  QKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWITYWSQADRSVGQKL  482

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  483  ASHLNVRPSI  492



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN  DG+MNF+HRDEEV+YFPS++D  R+AERFP P  I+TG+R++ VI
Sbjct  363  LPVNAPKCPHHNNHQDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSNILTGKRERRVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RFI R V +LS+PRV+HEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRCVDALSDPRVSHEIRSIWISYWSQADKSLGQKI  482

Query  230  ASRLNIRPTM  201
            A+RLN+RP++
Sbjct  483  ATRLNVRPSI  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD +R+AER+P P  + +G+R++C+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS+ RVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKL  482

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  483  ASHLNVRPSI  492



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDTVRHAEKYPAPPAVCSGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>gb|AAZ29552.1| catalase-C [Oryza sativa Indica Group]
Length=500

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+K 
Sbjct  369  LLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKV  428

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS PR+THEIRS W+SY +QADRSLGQ
Sbjct  429  VIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSGPRLTHEIRSIWLSYWSQADRSLGQ  488

Query  236  KVASRLNIRPTM  201
            K+ASRL+ +P+M
Sbjct  489  KLASRLSAKPSM  500



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P R++TG+R+KC
Sbjct  361  LMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPLPPRVLTGKREKC  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VI KENNFKQPG+RYRS+ P RQ+RF++RWV++LS+ RVTHEIR  WI+Y +Q D+SLGQ
Sbjct  421  VIGKENNFKQPGERYRSFDPARQERFVHRWVEALSDTRVTHEIRGIWITYWSQCDKSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+A+RLN+RP+M
Sbjct  481  KLATRLNMRPSM  492



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P N+PKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P R + G+R+KC+I
Sbjct  363  LPANSPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERVPVPPRTLGGKREKCMI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIRS WISY +QADRSLGQK+
Sbjct  423  EKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKI  482

Query  230  ASRLNIRPTM  201
            AS LN++P++
Sbjct  483  ASHLNLKPSI  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  I +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAICSGKRERCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            A+RLN+RP++
Sbjct  483  ANRLNVRPSI  492



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC YHNN YDG+MNF+HRDEEVDYF S++D  R+AE+ P P  I +GRR+KCVI
Sbjct  363  LPVNAPKCPYHNNHYDGFMNFMHRDEEVDYFQSRYDPVRHAEKVPIPNAICSGRREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKE+NF+QPGDRYRSWAPDRQ+RF+ R V +LSEPR+THEIRS W+S+ TQ D+SLGQK+
Sbjct  423  EKEDNFRQPGDRYRSWAPDRQERFLCRLVNALSEPRITHEIRSIWVSWWTQCDKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  361  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  420

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  421  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  480

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  481  ASHLNMRPSI  490



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN YDG MNF+HRDEE+DYFPSKFD  R AE++P   ++ TG+R+K VI
Sbjct  363  LPVNAPKCAHHNNQYDGVMNFMHRDEEIDYFPSKFDPARQAEKYPILTKVYTGKREKTVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPGDRYRSW P RQ+RF+ RWV  LS+PRVT E+RS W+SYL+Q DRSLG KV
Sbjct  423  PKENNFKQPGDRYRSWDPARQERFVKRWVDVLSDPRVTLELRSIWVSYLSQCDRSLGMKV  482

Query  230  ASRLNIRPTM  201
            A+RLN+RPTM
Sbjct  483  ATRLNMRPTM  492



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN +DG+MNF+HRDEEVDYFPS++D  R+AE  P P  ++TGRR+K +I
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVDYFPSRYDPVRHAEMHPIPSAVLTGRREKTII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  423  PKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLNIRP++
Sbjct  483  ASRLNIRPSI  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  GKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKI  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  GKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKI  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  + +GRR+K 
Sbjct  361  LLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAVFSGRREKI  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
             IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSLGQ
Sbjct  421  AIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+AS LN+RP +
Sbjct  481  KIASHLNMRPNI  492



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNF+QPG+RYRSW  DRQ+RF+ R+V++L+EPRVTHEIRS WISY TQAD+SLGQK+
Sbjct  423  EKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWISYWTQADKSLGQKL  482

Query  230  ASRLNIRP  207
            ASRLN+RP
Sbjct  483  ASRLNVRP  490



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  483  ASHLNMRPSI  492



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  W SY  +ADRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWTSYWLKADRSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  348  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  407

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+
Sbjct  408  EKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKL  467

Query  230  ASRLNIRPTM  201
            AS LN+RP++
Sbjct  468  ASHLNVRPSI  477



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MN +HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  351  LPVNAPKCAHHNNHHEGFMNVMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  410

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  411  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  470

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  471  ASRLNVRPSI  480



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+K 
Sbjct  361  LLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKV  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+SY +QADRSLGQ
Sbjct  421  VIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+ASRL+ +P+M
Sbjct  481  KLASRLSAKPSM  492



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+K 
Sbjct  361  LLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKV  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+SY +QADRSLGQ
Sbjct  421  VIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+ASRL+ +P+M
Sbjct  481  KLASRLSAKPSM  492



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPG+RYR++ PDRQ+RFI RWV++LS+PR+T+EIRS WI+Y +QAD+SLGQK+
Sbjct  423  QKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -2

Query  587  PVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIE  408
            P NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+K VI 
Sbjct  364  PANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVIA  423

Query  407  KENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVA  228
            KENNFKQPG+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+A
Sbjct  424  KENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLA  483

Query  227  SRLNIRPTM  201
            SRL+ +P+M
Sbjct  484  SRLSAKPSM  492



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  347  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  406

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  407  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  466

Query  230  ASRLNIRPTM  201
            AS LN+RP +
Sbjct  467  ASHLNMRPGI  476



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  360  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  419

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WI  L+QAD+S GQKV
Sbjct  420  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWICSLSQADKSCGQKV  479

Query  230  ASRLNIRPTM  201
            ASRL ++PTM
Sbjct  480  ASRLTLKPTM  489



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               PVNAPKCA+HNN +DG MNF+ R+EEVDYFPS+ D  R+AERFP P R+VTG+R+K 
Sbjct  361  LMLPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPIPSRVVTGKREKI  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VI K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL  P+V+HE+RS WI+YLTQ D SLGQ
Sbjct  421  VIPKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWITYLTQCDVSLGQ  480

Query  236  KVASRLNIRPTM  201
            KVA+RLN++P+M
Sbjct  481  KVANRLNVKPSM  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   204 bits (518),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P  ++ GRR+KC+I
Sbjct  363  LPVNAPKSAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPVVLNGRREKCMI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRS++PDRQ+RF+NRW+ SLS+PRVTHEIR+ W++Y  QAD+SLGQK+
Sbjct  423  AKENNFKQPGERYRSFSPDRQERFLNRWISSLSDPRVTHEIRAIWVTYWYQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP M
Sbjct  483  ASRLNVRPNM  492



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   204 bits (518),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               PVNAPKCA+HNN +DG MNF+ R+EEVDYFPS+ D  R+AERFP P R+VTG+R+K 
Sbjct  361  LMLPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPIPSRVVTGKREKT  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VI K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL  P+V+HE+RS WI+YLTQ D SLGQ
Sbjct  421  VIPKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWITYLTQCDVSLGQ  480

Query  236  KVASRLNIRPTM  201
            KVA+RLN++P+M
Sbjct  481  KVANRLNVKPSM  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            AS LN+RP +
Sbjct  483  ASHLNMRPGI  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVN+PKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   203 bits (516),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  AKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   203 bits (516),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  AKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD+ R+A ++P P  + +G R KCVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPIPSAVCSGERIKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+R+  RWV++LS+ RVT EIR  WISYL+Q+D+SLG KV
Sbjct  423  EKENNFKQPGERYRSWAPDRQERYAKRWVEALSDARVTDEIRGVWISYLSQSDKSLGMKV  482

Query  230  ASRLNIRPTM  201
            A+RLN+RP+ 
Sbjct  483  ANRLNVRPSF  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  382  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  441

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  442  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  501

Query  230  ASRLNIRPTM  201
            AS LN+RP +
Sbjct  502  ASHLNMRPGI  511



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P  ++TGRR+K VI
Sbjct  363  LPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPPVLTGRREKTVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRS+ PDR+DRFI RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+
Sbjct  423  PKENNFKQPGERYRSFTPDRKDRFIRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKI  482

Query  230  ASRLNIRPTM  201
            AS LN+RPTM
Sbjct  483  ASHLNMRPTM  492



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I
Sbjct  355  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAENYPIPTTVCSGKREKCII  414

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNF+QPG+RYRS++ DRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+
Sbjct  415  QKENNFQQPGERYRSFSADRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  474

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  475  ASRLNVRPSI  484



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN YDG MNF+HRD+EVDYFPS++D  R+AER+P P  ++ G RD+ +I
Sbjct  363  LPVNAPKCAHHNNHYDGQMNFMHRDDEVDYFPSRYDPVRHAERYPIPPNVLNGNRDRQII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQPG+RYRSW P RQ+RFI RWV +LS+PR+THEIR+ WISY +QAD+S+G K+
Sbjct  423  QKENNFKQPGERYRSWDPARQERFICRWVDALSDPRITHEIRNIWISYWSQADKSVGMKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RPTM
Sbjct  483  ASRLNVRPTM  492



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  ++TG+R++CVI
Sbjct  362  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVI  421

Query  410  EKENN-FKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQK  234
             KENN FKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK
Sbjct  422  PKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWISYWSQADRSLGQK  481

Query  233  VASRLNIRPTM  201
            +ASRLN+RP +
Sbjct  482  IASRLNVRPNI  492



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  ++TG+R++CVI
Sbjct  362  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVI  421

Query  410  EKENN-FKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQK  234
             KENN FKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK
Sbjct  422  PKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWISYWSQADRSLGQK  481

Query  233  VASRLNIRPTM  201
            +ASRLN+RP +
Sbjct  482  IASRLNVRPNI  492



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  +NA R+P P   +TGRRDK 
Sbjct  208  LLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKNAPRYPIPTVHITGRRDKT  267

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VI KENNFKQPG+RYR+  P RQ+RFI RWV +LS+PR+THEIRS W+S  +QADRSLGQ
Sbjct  268  VIAKENNFKQPGERYRAMDPARQERFIKRWVDALSDPRLTHEIRSIWLSNWSQADRSLGQ  327

Query  236  KVASRLNIRPTM  201
            K+ASRL+ +P+M
Sbjct  328  KLASRLSAKPSM  339



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  402  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  461

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  462  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  521

Query  230  ASRLNIRPT  204
            ASRLN+RP+
Sbjct  522  ASRLNVRPS  530


 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  590   FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
              PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D  R+AE++PT   + +G R+KC I
Sbjct  884   LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIVCSGNREKCFI  943

Query  410   EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
              KENNFKQPG+RYRSW  DRQ+RF+ R+V++LSEPRVTHEIRS WISY +QAD+SLGQK+
Sbjct  944   GKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKL  1003

Query  230   ASRLNIRP  207
             A+RLN+RP
Sbjct  1004  ATRLNVRP  1011



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNNS DG MNF+HRDEEVDY PS+FD  R AE++P P  ++ G R  CV 
Sbjct  186  LPVNAPKCAHHNNSRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLNGPRTMCVT  245

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS+PRVTHEI S WISYL+QAD+S GQKV
Sbjct  246  PKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVTHEIPSIWISYLSQADKSCGQKV  305

Query  230  ASRLNIRPTM  201
            ASRL ++P M
Sbjct  306  ASRLTVKPPM  315



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P  I +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAEKYPIPTAICSGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNF+QPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY ++AD+SLGQK+
Sbjct  423  DKENNFQQPGERYRSFAPDRQERFIYRWVDALSDPRVTYEIRSIWISYWSKADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRL++RP++
Sbjct  483  ASRLSVRPSI  492



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D   +AER+P P  + TG+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRIDPAHHAERYPQPPAVYTGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIR+ WISY +QAD+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWPADRQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGQKL  482

Query  230  ASRLNIR  210
            ASRLN++
Sbjct  483  ASRLNVK  489



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI
Sbjct  363  LPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPSCVLNGRRTNCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  230  ASRLNIRPTM  201
            ASRL ++PTM
Sbjct  483  ASRLTVKPTM  492



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVN+PKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  320  LPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  379

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+R +RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  380  EKENNFKEPGERYRSFTPERLERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  439

Query  230  ASRLNIRPTM  201
            ASRLN+RP +
Sbjct  440  ASRLNVRPNI  449



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P    TG+R+KC
Sbjct  361  LMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHTGKREKC  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VIEKENNFKQPG+RYRS+AP+RQ+RF+ RWV +LS+PRVTHEI S WISY +Q D+SLGQ
Sbjct  421  VIEKENNFKQPGERYRSFAPERQERFVKRWVAALSDPRVTHEICSIWISYWSQCDKSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+A+RLN++  M
Sbjct  481  KIAARLNMKANM  492



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+K 
Sbjct  361  LLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSVNLTGRREKT  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VI KENNFKQPG+RYRSW P RQ+RFI RW+ +LS+PR+THEIRS W+SY +QADRSLGQ
Sbjct  421  VIPKENNFKQPGERYRSWDPARQERFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+ASRL+ +P+M
Sbjct  481  KLASRLSAKPSM  492



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P P R+++G R+KC+I
Sbjct  173  LPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCII  232

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+SY +Q D SLGQK+
Sbjct  233  DKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKL  292

Query  230  ASRLNIRPTM  201
            ASRL I+P M
Sbjct  293  ASRLKIKPNM  302



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   197 bits (502),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  224  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCII  283

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WISY +Q D +LGQK+
Sbjct  284  QKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKL  343

Query  230  ASRLNIRPTM  201
            ASRLN++P+M
Sbjct  344  ASRLNLKPSM  353



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN YDG+MNF+HRDEE+DYF S++D  R+AER+P P  I++GRR+KCVI
Sbjct  363  LPVNAPKCPHHNNHYDGFMNFMHRDEEIDYFQSRYDPVRHAERYPIPNAIISGRREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRSW PDRQ+RF+ R V +LS+PR+THEIR  W+SY +Q D+SLGQK+
Sbjct  423  PKENNFKQPGERYRSWTPDRQERFLCRLVNALSDPRITHEIRGIWVSYWSQCDQSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP +
Sbjct  483  ASRLNVRPNI  492



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G R++CVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPAPPAVCSGTRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  423  AKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score =   201 bits (511),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  230  ASRL  219
            ASRL
Sbjct  483  ASRL  486



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   201 bits (510),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  I +GRR+K 
Sbjct  361  LLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKI  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
             IEKENNFKQ G+R+RSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQ
Sbjct  421  AIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+AS L++RP +
Sbjct  481  KIASHLSMRPNI  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  I +GRR+K 
Sbjct  361  LLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKI  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
             IEKENNFKQ G+R+RSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQ
Sbjct  421  AIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+AS L++RP +
Sbjct  481  KIASHLSMRPNI  492



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               PVNAPKCA+ N+ YDG MNF+HRDEEV+YFPS+ D  R+AER+P   RIVTGRR+KC
Sbjct  361  LMLPVNAPKCAHKNSHYDGLMNFMHRDEEVNYFPSRHDPLRHAERYPINNRIVTGRREKC  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            +IEK+N+FKQPGDRYRSWA DRQ+RF+ RWV++L+ P+V+HE+RS W+SYL+++D SLGQ
Sbjct  421  IIEKQNDFKQPGDRYRSWAHDRQERFVRRWVEALAHPKVSHEVRSIWVSYLSKSDVSLGQ  480

Query  236  KVASRLNIRPTM  201
            KVA+RLN++P+M
Sbjct  481  KVANRLNMKPSM  492



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGTMNFMHRDEEVNYFPSRFDAARHAEKVPVPPRVLTGCREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PR+THE+R  WISY +Q D SLGQK+
Sbjct  423  NKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVYSGKREKCII  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+ RVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  GKENNFKQPGERYRSFSADRQERFINRWIDALSDSRVTHEIRSIWISYWSQADKSLGQKI  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   200 bits (509),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+
Sbjct  423  DKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   206 bits (523),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P    TG R KCVI
Sbjct  370  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPIPTNSYTGIRTKCVI  429

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+
Sbjct  430  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  489

Query  230  ASRLNIRPT  204
            ASRLN+RP+
Sbjct  490  ASRLNVRPS  498


 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D  R+AE++PT   + TG R+KC I
Sbjct  852  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIVCTGNREKCFI  911

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNF+QPG+RYRSW  DRQ+RF+ R+V++LSEPRVTHEIRS WISY +QAD+SLGQK+
Sbjct  912  GKENNFQQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKL  971

Query  230  ASRLNIRP  207
            A+RLN+RP
Sbjct  972  ATRLNVRP  979



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+
Sbjct  423  DKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 118/134 (88%), Gaps = 4/134 (3%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPD----RQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  243
            EKENNFK+PG RYRS+ PD    RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++L
Sbjct  423  EKENNFKEPGGRYRSFTPDSFDFRQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTL  482

Query  242  GQKVASRLNIRPTM  201
            GQK+ASRLN+RP++
Sbjct  483  GQKLASRLNVRPSI  496



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P    +G R+KC
Sbjct  361  LMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHSGMREKC  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VIEKENNFKQPG+RYRS+ PDRQ+RF+ RWV +LS+PRVTHEI S WISY +Q+D+SLGQ
Sbjct  421  VIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWISYWSQSDKSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+A+RLN++  M
Sbjct  481  KIAARLNMKANM  492



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCAYHNN +DG+MNF+ RDEE++YFPS+ D TR+AER+P P  + TG+R++CVI
Sbjct  276  LPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHAERYPQPSAVYTGKRERCVI  335

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIR+ WISY +QAD+SLG K+
Sbjct  336  EKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGHKL  395

Query  230  ASRLNIR  210
            AS  N++
Sbjct  396  ASHFNLK  402



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  +++G+R++CVI
Sbjct  362  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLSGKRERCVI  421

Query  410  EKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQK  234
             KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK
Sbjct  422  PKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWISYWSQADRSLGQK  481

Query  233  VASRLNIRPTM  201
            +ASR+N+RP++
Sbjct  482  IASRMNVRPSI  492



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKC++HNN YDG MNF+HRDEEVDYFPS+FD   +A R+P P R + GRR+K 
Sbjct  361  LLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPATDAPRYPIPSRTLNGRREKM  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+SY +QADRSLGQ
Sbjct  421  VIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADRSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+A RL+++P+M
Sbjct  481  KLAGRLSVKPSM  492



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 119/134 (89%), Gaps = 4/134 (3%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPD----RQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  243
            EKENNFK+PG+RYRS+ P+    RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++L
Sbjct  423  EKENNFKEPGERYRSFTPESFDFRQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTL  482

Query  242  GQKVASRLNIRPTM  201
            GQK+ASRLN+RP++
Sbjct  483  GQKLASRLNVRPSI  496



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+
Sbjct  423  DKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI
Sbjct  363  LPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKV
Sbjct  423  PKENNFKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  230  ASRLNIRPTM  201
            ASRL ++PTM
Sbjct  483  ASRLTVKPTM  492



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+
Sbjct  423  DKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYRS+ P+RQ+RFI RW+++L +PR+THEIRS WI Y +QAD++ GQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIRRWIEALFDPRITHEIRSIWIFYWSQADKTFGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN+RP++
Sbjct  483  ASRLNVRPSI  492



>ref|XP_002510677.1| catalase, putative [Ricinus communis]
 gb|EEF52864.1| catalase, putative [Ricinus communis]
Length=974

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  RNAE FP P  I +G+R+KCVI
Sbjct  845  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPVPSAICSGKREKCVI  904

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFKQPG+RYRSWAPDRQ+RF+NR V  LS+PR+THE+R+ WISY  Q D+SLGQK+
Sbjct  905  EKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWISYWIQCDKSLGQKL  964

Query  230  ASRLNIRPTM  201
            A+RLN++P++
Sbjct  965  ATRLNVKPSI  974


 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC YHNN YDG+MNF+HRDEEVDYF S++D  R+AE+ P P  I +GRR+KCVI
Sbjct  363  LPVNAPKCPYHNNHYDGFMNFMHRDEEVDYFQSRYDPVRHAEKVPIPNAICSGRREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKE+NF+QPGDRYRSWAPDRQ+RF+ R V +LSEPR+THEIRS W+S+ TQ D+SLGQK+
Sbjct  423  EKEDNFRQPGDRYRSWAPDRQERFLCRLVNALSEPRITHEIRSIWVSWWTQCDKSLGQKL  482

Query  230  ASRLNIRPT  204
            ASRLN RP+
Sbjct  483  ASRLNNRPS  491



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+
Sbjct  423  DKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  230  ASRLNIRPTM  201
            ASRLN++P M
Sbjct  483  ASRLNLKPNM  492



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  ++TG+R++CVI
Sbjct  362  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVI  421

Query  410  EKENN-FKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQK  234
             KENN FKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVT E+R+ WISY +QADRSLGQK
Sbjct  422  PKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTDEVRNIWISYWSQADRSLGQK  481

Query  233  VASRLNIRPTM  201
            +ASRLN+RP +
Sbjct  482  IASRLNVRPNI  492



>gb|AHF27429.1| catalase, partial [Cucurbita moschata]
Length=461

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P  +++G+R++CVI
Sbjct  331  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDACRHAEKYPMPPNVLSGKRERCVI  390

Query  410  EKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQK  234
             KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++LS+ +VTHE+R+ WISY TQADRSLGQK
Sbjct  391  PKENHNFKQAGDRYRSWAPDRQERFVNRFVEALSDSKVTHEVRNIWISYWTQADRSLGQK  450

Query  233  VASRLNIRPTM  201
            +ASR+N RP M
Sbjct  451  IASRMNARPNM  461



>gb|AHF27432.1| catalase, partial [Cucurbita maxima]
Length=461

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P  +++G+R++CVI
Sbjct  331  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDACRHAEKYPMPPNVLSGKRERCVI  390

Query  410  EKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQK  234
             KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++LS+ +VTHE+R+ WISY TQADRSLGQK
Sbjct  391  PKENHNFKQAGDRYRSWAPDRQERFVNRFVEALSDSKVTHEVRNIWISYWTQADRSLGQK  450

Query  233  VASRLNIRPTM  201
            +ASR+N RP M
Sbjct  451  IASRMNARPNM  461



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKC++HNN YDG MNF+HRDEEVDYFPS+FD  ++A R+P P R + GRR+K 
Sbjct  361  LLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSRTLNGRREKM  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+SY +QAD+SLGQ
Sbjct  421  VIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADKSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+ASRL+ +P+M
Sbjct  481  KLASRLSSKPSM  492



>ref|XP_004144240.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
Length=483

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  +++G+R++CVI
Sbjct  353  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLSGKRERCVI  412

Query  410  EKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQK  234
             KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK
Sbjct  413  PKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWISYWSQADRSLGQK  472

Query  233  VASRLNIRPTM  201
            +ASR+N+RP +
Sbjct  473  IASRMNVRPNI  483



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  +++G+R++CVI
Sbjct  362  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLSGKRERCVI  421

Query  410  EKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQK  234
             KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK
Sbjct  422  PKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWISYWSQADRSLGQK  481

Query  233  VASRLNIRPTM  201
            +ASR+N+RP +
Sbjct  482  IASRMNVRPNI  492



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKC++HNN YDG MNF+HRDEEVDYFPS+FD  ++A R+P P R + GRR+K 
Sbjct  395  LLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSRTLNGRREKM  454

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+SY +QAD+SLGQ
Sbjct  455  VIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADKSLGQ  514

Query  236  KVASRLNIRPTM  201
            K+ASRL+ +P+M
Sbjct  515  KLASRLSSKPSM  526



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  +++G+R++CVI
Sbjct  362  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLSGKRERCVI  421

Query  410  EKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQK  234
             KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK
Sbjct  422  PKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWISYWSQADRSLGQK  481

Query  233  VASRLNIRPTM  201
            +ASR+N+RP +
Sbjct  482  IASRMNVRPNI  492



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  596  CCFPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKC  417
               P NAPKCA+HNN YDG MNF+HRDEEVDYFPS+FD  ++A R+P P     GRR+K 
Sbjct  361  LLLPANAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSSTCNGRREKM  420

Query  416  VIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQ  237
            VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI+S W+SY +QADRSLGQ
Sbjct  421  VIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKSIWLSYWSQADRSLGQ  480

Query  236  KVASRLNIRPTM  201
            K+ASRL+ +P+M
Sbjct  481  KLASRLSAKPSM  492



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   196 bits (498),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P P R+++G R+KC+I
Sbjct  269  LPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCII  328

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            +KENNFKQ G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+SY +Q D SLGQK+
Sbjct  329  DKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKL  388

Query  230  ASRLNIRPTM  201
            ASRL I+P M
Sbjct  389  ASRLKIKPNM  398



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+++  R+AE++PTP  +  G+R++CVI
Sbjct  351  LPVNAPKCGHHNNHHEGFMNFMHRDEEVNYFPSRYNPVRHAEKYPTPPAVCAGKRERCVI  410

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
            EKENNFK+PG+RYR + P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+
Sbjct  411  EKENNFKEPGERYRYFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  470

Query  230  ASRLNIRPTM  201
            AS LN+RP +
Sbjct  471  ASHLNVRPNI  480



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D  R+AE++PT   + +G R+KC I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIVCSGNREKCFI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRSW  DRQ+RF+ R+V++LSEPRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  RKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            A+RLN+RP  
Sbjct  483  ATRLNVRPNF  492



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  590  FPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  411
             PVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D  R+AE++PT   + +G R+KC I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIVCSGNREKCFI  422

Query  410  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  231
             KENNFKQPG+RYRSW  DRQ+RF+ R+V++LSEPRVTHEIRS WISY +QAD+SLGQK+
Sbjct  423  GKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  230  ASRLNIRPTM  201
            A+RLN+RP  
Sbjct  483  ATRLNVRPNF  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940