BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF041A06

Length=732
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004245197.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    248   3e-75   Solanum lycopersicum
ref|XP_006364268.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   9e-75   Solanum tuberosum [potatoes]
dbj|BAC22609.1|  41 kD chloroplast nucleoid DNA binding protein (...    241   1e-72   Nicotiana sylvestris
ref|XP_009783584.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    241   1e-72   Nicotiana sylvestris
ref|XP_009591885.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    240   4e-72   
gb|KDP33485.1|  hypothetical protein JCGZ_07056                         224   4e-66   Jatropha curcas
ref|XP_011082009.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    222   2e-65   
gb|KDO67375.1|  hypothetical protein CISIN_1g017894mg                   218   3e-65   Citrus sinensis [apfelsine]
ref|XP_006483727.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    220   6e-65   
ref|XP_010049847.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    218   1e-63   Eucalyptus grandis [rose gum]
gb|EYU22027.1|  hypothetical protein MIMGU_mgv1a005281mg                217   1e-63   Erythranthe guttata [common monkey flower]
gb|AHA84134.1|  aspartic proteinase nepenthesin-1                       216   3e-63   Phaseolus vulgaris [French bean]
emb|CDP11359.1|  unnamed protein product                                213   5e-62   Coffea canephora [robusta coffee]
ref|XP_010692959.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    213   7e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011080092.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    213   9e-62   Sesamum indicum [beniseed]
gb|EYU29201.1|  hypothetical protein MIMGU_mgv1a005225mg                211   2e-61   Erythranthe guttata [common monkey flower]
ref|XP_007146522.1|  hypothetical protein PHAVU_006G048000g             211   3e-61   Phaseolus vulgaris [French bean]
ref|XP_006450237.1|  hypothetical protein CICLE_v10008143mg             209   1e-60   Citrus clementina [clementine]
ref|XP_006483511.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    209   1e-60   Citrus sinensis [apfelsine]
gb|KDO67377.1|  hypothetical protein CISIN_1g011600mg                   208   1e-60   Citrus sinensis [apfelsine]
emb|CDP19504.1|  unnamed protein product                                209   2e-60   Coffea canephora [robusta coffee]
ref|XP_003532146.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    208   4e-60   Glycine max [soybeans]
ref|XP_007225640.1|  hypothetical protein PRUPE_ppa004762mg             207   1e-59   Prunus persica
ref|XP_002515388.1|  Aspartic proteinase nepenthesin-2 precursor,...    206   2e-59   
ref|XP_008220631.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    206   4e-59   Prunus mume [ume]
ref|XP_007011665.1|  Eukaryotic aspartyl protease family protein,...    205   5e-59   
ref|XP_007011662.1|  Eukaryotic aspartyl protease family protein,...    205   5e-59   
ref|XP_006483510.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    204   8e-59   Citrus sinensis [apfelsine]
ref|XP_003551807.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    205   8e-59   Glycine max [soybeans]
gb|KDO67374.1|  hypothetical protein CISIN_1g011556mg                   204   9e-59   Citrus sinensis [apfelsine]
ref|XP_002324349.1|  nucleoid DNA-binding family protein                204   2e-58   
ref|XP_004291984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    203   3e-58   Fragaria vesca subsp. vesca
ref|XP_009411894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    201   8e-58   
ref|XP_010108296.1|  Aspartic proteinase nepenthesin-2                  202   1e-57   Morus notabilis
ref|XP_011036733.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    201   2e-57   Populus euphratica
ref|XP_010928894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    201   2e-57   Elaeis guineensis
gb|KGN55408.1|  hypothetical protein Csa_4G651750                       198   3e-57   Cucumis sativus [cucumbers]
ref|XP_008223730.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    200   4e-57   Prunus mume [ume]
gb|KJB55136.1|  hypothetical protein B456_009G065000                    200   5e-57   Gossypium raimondii
ref|XP_004513892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    200   6e-57   Cicer arietinum [garbanzo]
ref|XP_002285593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    199   7e-57   Vitis vinifera
ref|XP_004150866.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    199   1e-56   Cucumis sativus [cucumbers]
ref|XP_003530761.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    199   1e-56   
ref|XP_003532147.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    199   1e-56   Glycine max [soybeans]
ref|XP_008811141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   3e-56   Phoenix dactylifera
ref|XP_010928895.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   6e-56   Elaeis guineensis
ref|XP_008379433.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   6e-56   Malus domestica [apple tree]
ref|XP_010259084.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    196   7e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010555463.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    196   8e-56   Tarenaya hassleriana [spider flower]
ref|XP_009390623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    196   1e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009363292.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   1e-55   Pyrus x bretschneideri [bai li]
gb|KHN12538.1|  Aspartic proteinase nepenthesin-2                       196   1e-55   Glycine soja [wild soybean]
ref|XP_008806169.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    194   1e-55   
gb|KCW63732.1|  hypothetical protein EUGRSUZ_G01378                     193   2e-55   Eucalyptus grandis [rose gum]
gb|KJB55135.1|  hypothetical protein B456_009G064900                    194   6e-55   Gossypium raimondii
ref|XP_002515387.1|  Aspartic proteinase nepenthesin-2 precursor,...    193   9e-55   Ricinus communis
ref|XP_008783095.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    191   1e-54   
ref|XP_008357233.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    196   1e-54   
dbj|BAF01928.1|  nucleoid DNA-binding protein cnd41 - like protein      184   4e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008220632.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    192   5e-54   Prunus mume [ume]
emb|CDY40117.1|  BnaC02g00130D                                          192   5e-54   Brassica napus [oilseed rape]
ref|XP_007226774.1|  hypothetical protein PRUPE_ppa018129mg             191   6e-54   
ref|XP_009359073.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    192   6e-54   
ref|XP_010068511.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    189   9e-54   
ref|XP_008452815.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    191   1e-53   Cucumis melo [Oriental melon]
ref|XP_010068510.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   1e-53   
gb|KFK25359.1|  hypothetical protein AALP_AA8G103100                    191   1e-53   Arabis alpina [alpine rockcress]
ref|XP_008779510.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   1e-53   
ref|XP_010913225.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    190   2e-53   Elaeis guineensis
emb|CDX85746.1|  BnaA02g00670D                                          191   2e-53   
ref|XP_009125277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    190   2e-53   Brassica rapa
gb|KCW63888.1|  hypothetical protein EUGRSUZ_G01561                     189   2e-53   Eucalyptus grandis [rose gum]
ref|XP_009391894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    190   3e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010424699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    185   3e-53   Camelina sativa [gold-of-pleasure]
gb|KHG10166.1|  Asparticase nepenthesin-2                               190   3e-53   Gossypium arboreum [tree cotton]
ref|XP_010065986.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    189   3e-53   Eucalyptus grandis [rose gum]
gb|KEH33912.1|  eukaryotic aspartyl protease family protein             189   4e-53   Medicago truncatula
ref|XP_007223364.1|  hypothetical protein PRUPE_ppa005616mg             189   5e-53   
ref|XP_006399574.1|  hypothetical protein EUTSA_v10013429mg             189   6e-53   Eutrema salsugineum [saltwater cress]
ref|XP_004513891.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    189   7e-53   Cicer arietinum [garbanzo]
ref|XP_010491758.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    189   8e-53   
ref|XP_010066088.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    188   1e-52   Eucalyptus grandis [rose gum]
ref|XP_008776818.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    185   1e-52   
ref|XP_010453111.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    187   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010928159.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    187   3e-52   Elaeis guineensis
ref|XP_007011661.1|  Eukaryotic aspartyl protease family protein,...    187   4e-52   
gb|KCW63886.1|  hypothetical protein EUGRSUZ_G01558                     186   4e-52   Eucalyptus grandis [rose gum]
ref|XP_007224537.1|  hypothetical protein PRUPE_ppa024411mg             187   5e-52   
ref|XP_006287637.1|  hypothetical protein CARUB_v10000848mg             187   5e-52   Capsella rubella
ref|XP_010422809.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    187   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009122022.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   7e-52   Brassica rapa
ref|XP_002873476.1|  hypothetical protein ARALYDRAFT_325615             186   8e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_008220628.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   1e-51   Prunus mume [ume]
emb|CAB96832.1|  nucleoid DNA-binding protein cnd41-like protein        185   1e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97058.1|  BnaC09g45670D                                          186   1e-51   
ref|XP_010258628.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_007223563.1|  hypothetical protein PRUPE_ppa014553mg             184   2e-51   
ref|XP_008220627.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   2e-51   Prunus mume [ume]
ref|NP_196638.2|  aspartyl protease family protein                      185   2e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KJB65924.1|  hypothetical protein B456_010G120300                    184   3e-51   Gossypium raimondii
ref|XP_007226285.1|  hypothetical protein PRUPE_ppa019577mg             184   3e-51   
gb|KCW63890.1|  hypothetical protein EUGRSUZ_G01565                     182   6e-51   Eucalyptus grandis [rose gum]
ref|XP_007224453.1|  hypothetical protein PRUPE_ppa022256mg             181   1e-50   
emb|CDX69804.1|  BnaA10g21530D                                          182   1e-50   
ref|XP_010066094.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   1e-50   Eucalyptus grandis [rose gum]
gb|KJB55134.1|  hypothetical protein B456_009G064800                    183   1e-50   Gossypium raimondii
gb|KCW63730.1|  hypothetical protein EUGRSUZ_G01376                     181   2e-50   Eucalyptus grandis [rose gum]
ref|XP_009122891.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   3e-50   Brassica rapa
gb|KCW63885.1|  hypothetical protein EUGRSUZ_G01557                     180   4e-50   Eucalyptus grandis [rose gum]
gb|KHG03216.1|  Asparticase nepenthesin-2                               181   4e-50   Gossypium arboreum [tree cotton]
ref|XP_007212799.1|  hypothetical protein PRUPE_ppa020165mg             179   6e-50   
ref|XP_010065985.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    180   6e-50   Eucalyptus grandis [rose gum]
ref|XP_010068543.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    179   7e-50   
gb|KCW63736.1|  hypothetical protein EUGRSUZ_G01384                     181   8e-50   Eucalyptus grandis [rose gum]
gb|KCW44809.1|  hypothetical protein EUGRSUZ_L01628                     179   9e-50   Eucalyptus grandis [rose gum]
ref|XP_010068417.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   1e-49   
gb|KDP33483.1|  hypothetical protein JCGZ_07054                         180   1e-49   Jatropha curcas
ref|XP_010066087.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    180   1e-49   Eucalyptus grandis [rose gum]
gb|KCW63938.1|  hypothetical protein EUGRSUZ_G01615                     180   1e-49   Eucalyptus grandis [rose gum]
gb|KCW63937.1|  hypothetical protein EUGRSUZ_G01615                     180   1e-49   Eucalyptus grandis [rose gum]
ref|XP_008379443.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    180   2e-49   Malus domestica [apple tree]
ref|XP_010256103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    179   3e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010040897.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    179   3e-49   Eucalyptus grandis [rose gum]
ref|XP_009359072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    179   3e-49   Pyrus x bretschneideri [bai li]
ref|XP_008377499.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    179   5e-49   
gb|KDP33484.1|  hypothetical protein JCGZ_07055                         178   6e-49   Jatropha curcas
ref|XP_009359074.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    178   7e-49   Pyrus x bretschneideri [bai li]
ref|XP_008777073.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    177   9e-49   Phoenix dactylifera
ref|XP_008386742.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    177   2e-48   
gb|AAM74221.1|AF518565_1  putative chloroplast nucleoid DNA-bindi...    169   2e-48   Brassica oleracea
ref|XP_009122023.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    177   2e-48   
gb|KFK25358.1|  hypothetical protein AALP_AA8G103000                    176   2e-48   Arabis alpina [alpine rockcress]
ref|XP_009122025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    177   2e-48   
ref|XP_008220626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    177   3e-48   Prunus mume [ume]
gb|KDP33482.1|  hypothetical protein JCGZ_07053                         176   3e-48   Jatropha curcas
ref|XP_008386743.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    176   3e-48   
ref|XP_010913226.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    176   4e-48   Elaeis guineensis
gb|KCW64008.1|  hypothetical protein EUGRSUZ_G01690                     174   5e-48   Eucalyptus grandis [rose gum]
ref|XP_006382029.1|  hypothetical protein POPTR_0006s24860g             175   5e-48   
ref|XP_009125279.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    175   6e-48   
ref|XP_009125278.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    176   7e-48   Brassica rapa
ref|XP_007011660.1|  Eukaryotic aspartyl protease family protein,...    175   8e-48   
ref|XP_009409855.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    175   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX85747.1|  BnaA02g00660D                                          175   1e-47   
ref|XP_002283470.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    175   1e-47   Vitis vinifera
ref|XP_002324352.2|  hypothetical protein POPTR_0018s03010g             174   2e-47   
ref|XP_002309515.1|  nucleoid DNA-binding family protein                174   3e-47   Populus trichocarpa [western balsam poplar]
ref|XP_002309514.1|  nucleoid DNA-binding family protein                174   3e-47   Populus trichocarpa [western balsam poplar]
ref|XP_009359069.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    174   3e-47   Pyrus x bretschneideri [bai li]
gb|KEH33910.1|  eukaryotic aspartyl protease family protein             173   3e-47   Medicago truncatula
emb|CDX69805.1|  BnaA10g21540D                                          175   3e-47   
emb|CDY40116.1|  BnaC02g00140D                                          174   4e-47   Brassica napus [oilseed rape]
ref|XP_002454360.1|  hypothetical protein SORBIDRAFT_04g029400          173   5e-47   Sorghum bicolor [broomcorn]
ref|XP_008652856.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    173   5e-47   Zea mays [maize]
ref|XP_011036735.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    173   6e-47   Populus euphratica
gb|ACN85323.1|  aspartic proteinase nepenthesin-1 precursor             168   6e-47   Oryza brachyantha
ref|XP_002324351.1|  nucleoid DNA-binding family protein                173   7e-47   
ref|XP_010068575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    175   8e-47   
ref|XP_006657126.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    168   8e-47   
tpg|DAA61984.1|  TPA: hypothetical protein ZEAMMB73_915310              173   1e-46   
ref|XP_010108293.1|  Aspartic proteinase nepenthesin-2                  174   1e-46   
gb|KHM99525.1|  Aspartic proteinase nepenthesin-1                       172   1e-46   Glycine soja [wild soybean]
emb|CDP18857.1|  unnamed protein product                                171   1e-46   Coffea canephora [robusta coffee]
ref|XP_006660750.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    172   1e-46   Oryza brachyantha
gb|ACN85339.1|  aspartic proteinase nepenthesin-1 precursor             172   2e-46   Oryza meyeriana var. granulata
ref|XP_011019522.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    171   2e-46   Populus euphratica
ref|XP_011019525.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    171   2e-46   Populus euphratica
ref|XP_010266607.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    170   3e-46   Nelumbo nucifera [Indian lotus]
gb|ACN85295.1|  aspartic proteinase nepenthesin-1 precursor             169   2e-45   Oryza coarctata
ref|XP_010256102.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    169   2e-45   Nelumbo nucifera [Indian lotus]
gb|ACN85225.1|  aspartic proteinase nepenthesin-1 precursor             169   2e-45   Oryza punctata
gb|EMT21644.1|  Aspartic proteinase nepenthesin-2                       162   3e-45   
dbj|BAJ99659.1|  predicted protein                                      169   3e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004957153.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    168   4e-45   Setaria italica
gb|ABP93696.1|  unknown protein isoform 1                               165   7e-45   Lemna minor
ref|XP_010913305.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    168   2e-44   
gb|ACN85307.1|  aspartic proteinase nepenthesin-1 precursor             167   2e-44   Oryza ridleyi
ref|XP_009390626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF84853.1|  unknown                                                 159   2e-44   Zea mays [maize]
ref|XP_009390625.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   2e-44   
ref|XP_011463538.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    162   2e-44   Fragaria vesca subsp. vesca
ref|XP_010422811.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    165   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009391129.1|  PREDICTED: aspartic proteinase nepenthesin-2...    165   4e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007021889.1|  Eukaryotic aspartyl protease family protein,...    167   7e-44   
gb|ACN85284.1|  aspartic proteinase nepenthesin-1 precursor             165   7e-44   Oryza australiensis
emb|CDX97054.1|  BnaC09g45710D                                          164   1e-43   
ref|XP_008779067.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    163   1e-43   Phoenix dactylifera
ref|XP_004959561.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    164   2e-43   Setaria italica
gb|ABP93697.1|  unknown protein isoform 2                               161   2e-43   Lemna minor
ref|XP_002515386.1|  Aspartic proteinase nepenthesin-2 precursor,...    162   2e-43   
ref|XP_009390629.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    163   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY70207.1|  BnaA10g30140D                                          163   3e-43   Brassica napus [oilseed rape]
ref|XP_010108295.1|  Aspartic proteinase nepenthesin-2                  161   6e-43   
gb|ACN85278.1|  aspartic proteinase nepenthesin-1 precursor             162   7e-43   Oryza alta
gb|EMT32055.1|  Aspartic proteinase nepenthesin-2                       155   1e-42   
ref|XP_009390624.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    161   1e-42   
gb|ACN29145.1|  unknown                                                 159   1e-42   Zea mays [maize]
gb|ACN85177.1|  aspartic proteinase nepenthesin-1 precursor             162   1e-42   Oryza sativa f. spontanea
gb|ACN85210.1|  aspartic proteinase nepenthesin-1 precursor             161   2e-42   Oryza glaberrima
ref|XP_008679061.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   2e-42   Zea mays [maize]
ref|NP_001058055.1|  Os06g0610800                                       161   2e-42   
gb|ACF88017.1|  unknown                                                 160   3e-42   Zea mays [maize]
ref|XP_002324354.1|  nucleoid DNA-binding family protein                160   3e-42   Populus trichocarpa [western balsam poplar]
gb|AFW63716.1|  aspartic proteinase nepenthesin-2                       160   4e-42   
ref|XP_008776819.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    152   5e-42   
ref|XP_010491756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    159   5e-42   Camelina sativa [gold-of-pleasure]
gb|EAY87323.1|  hypothetical protein OsI_08727                          159   5e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_006287706.1|  hypothetical protein CARUB_v10000913mg             159   6e-42   Capsella rubella
ref|NP_001047954.1|  Os02g0720600                                       159   6e-42   
ref|XP_002460431.1|  hypothetical protein SORBIDRAFT_02g028000          159   1e-41   Sorghum bicolor [broomcorn]
ref|XP_010419657.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    159   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010491757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    159   1e-41   
ref|XP_010491755.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    159   1e-41   Camelina sativa [gold-of-pleasure]
ref|NP_001150335.1|  aspartic proteinase nepenthesin-2 precursor        158   1e-41   Zea mays [maize]
gb|KCW80527.1|  hypothetical protein EUGRSUZ_C01881                     157   1e-41   Eucalyptus grandis [rose gum]
gb|ACN85242.1|  aspartic proteinase nepenthesin-1 precursor             159   1e-41   Oryza minuta
ref|XP_010050793.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    158   2e-41   Eucalyptus grandis [rose gum]
emb|CDX97055.1|  BnaC09g45700D                                          157   2e-41   
ref|XP_008777074.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    157   3e-41   Phoenix dactylifera
dbj|BAJ94237.1|  predicted protein                                      157   4e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92731.1|  predicted protein                                      157   4e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT32054.1|  Aspartic proteinase nepenthesin-2                       157   4e-41   
ref|XP_010491754.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    157   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_011036745.1|  PREDICTED: aspartic proteinase nepenthesin-2...    152   5e-41   Populus euphratica
ref|XP_006287688.1|  hypothetical protein CARUB_v10000896mg             156   1e-40   Capsella rubella
ref|XP_011012151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    155   1e-40   Populus euphratica
dbj|BAJ89995.1|  predicted protein                                      155   1e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT06628.1|  Aspartic proteinase nepenthesin-2                       154   2e-40   
ref|XP_004953759.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    155   2e-40   Setaria italica
ref|XP_004953760.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    155   2e-40   Setaria italica
ref|XP_004295359.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    155   2e-40   Fragaria vesca subsp. vesca
gb|ACN85252.1|  aspartic proteinase nepenthesin-1 precursor             155   2e-40   Oryza officinalis
ref|XP_010422810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    155   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_002437273.1|  hypothetical protein SORBIDRAFT_10g023970          155   3e-40   Sorghum bicolor [broomcorn]
ref|XP_010913303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   3e-40   
ref|XP_010050792.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    153   3e-40   
ref|XP_011012148.1|  PREDICTED: aspartic proteinase nepenthesin-2...    152   5e-40   Populus euphratica
ref|NP_001168472.1|  hypothetical protein                               154   5e-40   Zea mays [maize]
ref|XP_010913304.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    153   5e-40   
gb|KCW44808.1|  hypothetical protein EUGRSUZ_L01627                     152   6e-40   Eucalyptus grandis [rose gum]
gb|ACN85264.1|  aspartic proteinase nepenthesin-1 precursor             154   7e-40   Oryza alta
ref|XP_004965901.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   7e-40   Setaria italica
ref|XP_002454359.1|  hypothetical protein SORBIDRAFT_04g029390          153   8e-40   Sorghum bicolor [broomcorn]
ref|XP_010050794.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   8e-40   Eucalyptus grandis [rose gum]
gb|EMS66296.1|  Aspartic proteinase nepenthesin-1                       153   8e-40   Triticum urartu
gb|KCW80528.1|  hypothetical protein EUGRSUZ_C01882                     153   8e-40   Eucalyptus grandis [rose gum]
gb|EMS67344.1|  Aspartic proteinase nepenthesin-2                       153   9e-40   Triticum urartu
ref|XP_008648080.1|  PREDICTED: uncharacterized protein LOC100382...    154   9e-40   Zea mays [maize]
gb|KCW80526.1|  hypothetical protein EUGRSUZ_C01880                     153   9e-40   Eucalyptus grandis [rose gum]
ref|XP_002452641.1|  hypothetical protein SORBIDRAFT_04g029670          153   9e-40   Sorghum bicolor [broomcorn]
gb|AAN60226.1|  unknown                                                 153   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647806.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    153   1e-39   Oryza brachyantha
gb|EAZ09523.1|  hypothetical protein OsI_31798                          152   3e-39   Oryza sativa Indica Group [Indian rice]
ref|NP_001063501.1|  Os09g0482200                                       152   4e-39   
ref|XP_006294147.1|  hypothetical protein CARUB_v10023140mg             152   4e-39   Capsella rubella
ref|XP_010266604.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    151   6e-39   Nelumbo nucifera [Indian lotus]
ref|XP_010266605.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    151   6e-39   Nelumbo nucifera [Indian lotus]
ref|NP_196637.1|  aspartyl protease family protein                      150   9e-39   Arabidopsis thaliana [mouse-ear cress]
gb|EMS57901.1|  Aspartic proteinase nepenthesin-2                       150   1e-38   Triticum urartu
emb|CDX97061.1|  BnaC09g45640D                                          142   2e-38   
ref|XP_002324933.2|  hypothetical protein POPTR_0018s03000g             149   4e-38   Populus trichocarpa [western balsam poplar]
ref|XP_006289171.1|  hypothetical protein CARUB_v10002609mg             149   5e-38   
gb|EMS67345.1|  Aspartic proteinase nepenthesin-2                       145   8e-38   Triticum urartu
ref|NP_001047953.1|  Os02g0720500                                       140   2e-37   
ref|XP_004973076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    147   2e-37   Setaria italica
ref|XP_010266609.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    146   3e-37   
ref|XP_002453187.1|  hypothetical protein SORBIDRAFT_04g001340          145   8e-37   
gb|EEC71061.1|  hypothetical protein OsI_02803                          144   2e-36   Oryza sativa Indica Group [Indian rice]
gb|EEE54965.1|  hypothetical protein OsJ_02555                          143   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008379455.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    144   3e-36   Malus domestica [apple tree]
ref|XP_003570261.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    144   3e-36   Brachypodium distachyon [annual false brome]
ref|XP_010266613.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   4e-36   Nelumbo nucifera [Indian lotus]
gb|ADG39009.1|  AT5G10770-like protein                                  136   4e-36   Capsella grandiflora
gb|ACF85435.1|  unknown                                                 136   6e-36   Zea mays [maize]
ref|XP_006483509.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    143   7e-36   Citrus sinensis [apfelsine]
ref|NP_001172459.1|  Os01g0608366                                       142   8e-36   
ref|XP_010266606.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   1e-35   
gb|AEN82921.1|  AT5G10770-like protein                                  135   1e-35   Capsella rubella
ref|NP_001056627.2|  Os06g0118000                                       135   1e-35   
gb|ADG39013.1|  AT5G10770-like protein                                  135   1e-35   
dbj|BAK03499.1|  predicted protein                                      142   2e-35   
ref|XP_002454377.1|  hypothetical protein SORBIDRAFT_04g029680          142   2e-35   
gb|ADG39008.1|  AT5G10770-like protein                                  134   2e-35   
ref|XP_006649000.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   3e-35   
dbj|BAD12875.1|  putative chloroplast nucleoid DNA-binding protei...    141   3e-35   
gb|EAY87322.1|  hypothetical protein OsI_08726                          141   3e-35   
ref|NP_001141706.1|  hypothetical protein precursor                     140   4e-35   
ref|XP_004966942.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   4e-35   
ref|XP_010266610.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   5e-35   
ref|XP_006644352.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   5e-35   
gb|EMS59088.1|  Aspartic proteinase nepenthesin-2                       139   7e-35   
emb|CAJ26370.1|  chloroplast nucleoid binding protein                   139   8e-35   
gb|KDO67372.1|  hypothetical protein CISIN_1g011649mg                   139   1e-34   
gb|EMT16675.1|  Aspartic proteinase nepenthesin-2                       139   1e-34   
dbj|BAJ97731.1|  predicted protein                                      139   2e-34   
ref|NP_001056633.1|  Os06g0119600                                       139   2e-34   
gb|EMS54230.1|  Aspartic proteinase nepenthesin-2                       137   2e-34   
dbj|BAJ90582.1|  predicted protein                                      138   3e-34   
ref|XP_003563633.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    138   4e-34   
ref|XP_006483508.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   7e-34   
ref|XP_006483507.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   8e-34   
ref|XP_010266612.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    135   8e-34   
gb|EMT19686.1|  Aspartic proteinase nepenthesin-1                       134   2e-33   
ref|XP_008776166.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    135   3e-33   
gb|EAY99437.1|  hypothetical protein OsI_21406                          134   4e-33   
gb|AFW77036.1|  hypothetical protein ZEAMMB73_461996                    135   4e-33   
ref|XP_002436936.1|  hypothetical protein SORBIDRAFT_10g011730          135   4e-33   
gb|ABK24493.1|  unknown                                                 135   4e-33   
ref|XP_008650536.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    135   4e-33   
gb|EMS62120.1|  Aspartic proteinase nepenthesin-1                       135   5e-33   
ref|XP_002438291.1|  hypothetical protein SORBIDRAFT_10g011210          134   6e-33   
ref|NP_001168410.1|  hypothetical protein precursor                     134   6e-33   
ref|XP_008679060.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   9e-33   
gb|KDO37972.1|  hypothetical protein CISIN_1g011746mg                   134   1e-32   
ref|XP_008791340.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   1e-32   
ref|XP_002460430.1|  hypothetical protein SORBIDRAFT_02g027990          133   2e-32   
ref|XP_003576664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   2e-32   
gb|ABR16115.1|  unknown                                                 133   3e-32   
ref|XP_009395291.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   3e-32   
ref|NP_001140743.1|  uncharacterized protein LOC100272818               131   3e-32   
ref|XP_008647512.1|  PREDICTED: uncharacterized protein LOC100272...    132   3e-32   
ref|XP_006656917.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   3e-32   
gb|EEE65583.1|  hypothetical protein OsJ_21095                          132   4e-32   
dbj|BAD62401.1|  putative nucleoid DNA-binding protein cnd41            132   5e-32   
ref|XP_010229951.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   5e-32   
gb|EAZ35641.1|  hypothetical protein OsJ_19928                          133   6e-32   
ref|XP_006493458.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   6e-32   
ref|XP_006483506.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   6e-32   
gb|KDO67369.1|  hypothetical protein CISIN_1g011804mg                   132   6e-32   
gb|EAZ00664.1|  hypothetical protein OsI_22685                          132   6e-32   
ref|XP_004964380.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   6e-32   
gb|KDO55402.1|  hypothetical protein CISIN_1g011482mg                   132   6e-32   
gb|KHN38526.1|  Aspartic proteinase nepenthesin-2                       129   8e-32   
ref|XP_006427680.1|  hypothetical protein CICLE_v10025395mg             131   9e-32   
gb|EEC79892.1|  hypothetical protein OsI_21411                          133   9e-32   
gb|ACG25562.1|  aspartic proteinase nepenthesin-2 precursor             131   1e-31   
ref|XP_009401063.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   1e-31   
gb|EAZ32412.1|  hypothetical protein OsJ_16623                          130   1e-31   
ref|XP_004241673.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   2e-31   
ref|XP_004507035.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   2e-31   
ref|XP_009609916.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   2e-31   
emb|CAJ86229.1|  H0402C08.5                                             130   2e-31   
ref|XP_004235884.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   3e-31   
emb|CDP18858.1|  unnamed protein product                                129   6e-31   
gb|AFK40245.1|  unknown                                                 129   6e-31   
gb|KEH28580.1|  eukaryotic aspartyl protease family protein             129   6e-31   
ref|XP_006341422.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   7e-31   
ref|XP_006656916.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   9e-31   
ref|XP_003576537.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   1e-30   
ref|XP_003635520.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   1e-30   
ref|XP_010906670.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   1e-30   
ref|XP_010687331.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   1e-30   
ref|XP_007011664.1|  Eukaryotic aspartyl protease family protein ...    127   1e-30   
ref|XP_008796557.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   2e-30   
emb|CDX67980.1|  BnaA07g20200D                                          127   2e-30   
ref|XP_009375476.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   2e-30   
ref|XP_009104505.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   2e-30   
gb|KHN38061.1|  Aspartic proteinase nepenthesin-1                       127   2e-30   
ref|XP_009759386.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   2e-30   
ref|XP_002437730.1|  hypothetical protein SORBIDRAFT_10g001450          127   2e-30   
ref|XP_006366263.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   2e-30   
ref|XP_003531753.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   2e-30   
gb|EMT13758.1|  Aspartic proteinase nepenthesin-2                       125   2e-30   
dbj|BAK06293.1|  predicted protein                                      127   2e-30   
ref|XP_007011663.1|  Eukaryotic aspartyl protease family protein,...    126   3e-30   
gb|KJB56498.1|  hypothetical protein B456_009G122200                    127   3e-30   
ref|XP_010094073.1|  Aspartic proteinase nepenthesin-1                  127   3e-30   
ref|XP_004966945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   3e-30   
ref|XP_006389854.1|  hypothetical protein EUTSA_v10018461mg             127   3e-30   
gb|EMS68715.1|  Aspartic proteinase nepenthesin-2                       128   3e-30   
ref|XP_010252879.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   3e-30   
gb|EMT32056.1|  Aspartic proteinase nepenthesin-2                       126   3e-30   
ref|XP_011040081.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    126   4e-30   
ref|XP_002277380.3|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    126   4e-30   
ref|XP_010229859.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   7e-30   
ref|XP_009774796.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   7e-30   
ref|XP_006373545.1|  hypothetical protein POPTR_0016s00260g             125   7e-30   
emb|CDX87358.1|  BnaA07g35150D                                          125   8e-30   
ref|XP_003546907.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   9e-30   
gb|EMT13228.1|  Aspartic proteinase nepenthesin-1                       125   9e-30   
ref|XP_010417641.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   1e-29   
ref|XP_010648827.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   1e-29   
ref|XP_009391801.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   1e-29   
emb|CDO98251.1|  unnamed protein product                                125   2e-29   
ref|NP_001054261.2|  Os04g0677100                                       124   2e-29   
ref|XP_008791252.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   2e-29   
ref|XP_010472845.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   2e-29   
ref|XP_009106694.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   2e-29   
emb|CDX88562.1|  BnaC06g40060D                                          124   2e-29   
emb|CDY72573.1|  BnaAnng41520D                                          124   2e-29   
ref|XP_002448772.1|  hypothetical protein SORBIDRAFT_06g032900          124   2e-29   
ref|XP_009122026.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   2e-29   
ref|XP_007024419.1|  Eukaryotic aspartyl protease family protein,...    124   2e-29   
ref|XP_010034049.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   2e-29   
emb|CDX79338.1|  BnaC06g19650D                                          124   2e-29   
ref|XP_008228848.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   2e-29   
ref|XP_009615689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   2e-29   
ref|XP_006302129.1|  hypothetical protein CARUB_v10020134mg             124   3e-29   
gb|AFW86431.1|  hypothetical protein ZEAMMB73_038825                    124   3e-29   
emb|CBI21175.3|  unnamed protein product                                123   3e-29   
ref|XP_006653026.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   3e-29   
ref|XP_008660816.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   3e-29   
ref|XP_004964381.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   3e-29   
ref|XP_010908909.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   4e-29   
ref|XP_004964374.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   4e-29   
ref|XP_008668690.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   4e-29   
gb|ACG34391.1|  aspartic proteinase nepenthesin-2 precursor             124   4e-29   
ref|XP_004303222.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   4e-29   
ref|XP_008650537.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   4e-29   
ref|XP_007023525.1|  Eukaryotic aspartyl protease family protein        124   4e-29   
gb|KCW44810.1|  hypothetical protein EUGRSUZ_L01629                     123   4e-29   
ref|XP_010429875.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   5e-29   
ref|XP_002438283.1|  hypothetical protein SORBIDRAFT_10g011110          123   5e-29   
ref|XP_008805509.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   5e-29   
gb|EMT05932.1|  Aspartic proteinase nepenthesin-2                       123   6e-29   
dbj|BAK02683.1|  predicted protein                                      123   7e-29   
ref|XP_011082601.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   7e-29   
gb|KDP41942.1|  hypothetical protein JCGZ_26960                         123   7e-29   
ref|XP_007215297.1|  hypothetical protein PRUPE_ppa005040mg             123   8e-29   
ref|XP_010544842.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   9e-29   
gb|EAZ35653.1|  hypothetical protein OsJ_19940                          122   9e-29   
ref|XP_010265509.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   9e-29   
dbj|BAD68388.1|  putative nucleoid DNA-binding protein cnd41, chl...    122   1e-28   
dbj|BAD68338.1|  putative nucleoid DNA-binding protein cnd41, chl...    122   1e-28   
ref|NP_001056639.2|  Os06g0121800                                       122   1e-28   
gb|AFW86441.1|  hypothetical protein ZEAMMB73_342504                    122   1e-28   
ref|XP_008659488.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   1e-28   
gb|EEC79895.1|  hypothetical protein OsI_21423                          122   1e-28   
emb|CAE05761.2|  OSJNBa0064G10.12                                       122   1e-28   
dbj|BAJ85821.1|  predicted protein                                      122   1e-28   
ref|NP_001141341.1|  uncharacterized protein LOC100273432 precursor     122   1e-28   
ref|NP_001056638.1|  Os06g0121500                                       122   1e-28   
ref|XP_004965303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   1e-28   
ref|NP_565219.1|  eukaryotic aspartyl protease family protein           121   2e-28   
ref|XP_004966930.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   2e-28   
gb|AAM66069.1|  putative aspartyl protease                              121   3e-28   
ref|XP_010453109.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   3e-28   
gb|AAF68120.1|AC010793_15  F20B17.14                                    121   3e-28   
gb|KHN48559.1|  Aspartic proteinase nepenthesin-2                       120   3e-28   
ref|XP_006576102.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   3e-28   
ref|XP_011034591.1|  PREDICTED: aspartic proteinase nepenthesin-1       121   3e-28   
ref|XP_009629719.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   3e-28   
ref|XP_002262837.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   4e-28   
ref|XP_002297678.1|  aspartyl protease family protein                   121   4e-28   
ref|XP_010648782.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   4e-28   
ref|XP_002324355.2|  nucleoid DNA-binding family protein                120   4e-28   
ref|XP_009418540.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   4e-28   
ref|XP_002268758.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   4e-28   
ref|XP_002889266.1|  aspartyl protease family protein                   120   5e-28   
gb|AFK48193.1|  unknown                                                 115   6e-28   
gb|AFW71023.1|  hypothetical protein ZEAMMB73_589717                    118   6e-28   
ref|XP_004956859.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   6e-28   
ref|XP_004964375.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   7e-28   
gb|EMT28036.1|  Aspartic proteinase nepenthesin-1                       120   7e-28   
emb|CAN74676.1|  hypothetical protein VITISV_038368                     119   7e-28   
gb|KHN04198.1|  Aspartic proteinase nepenthesin-1                       120   7e-28   
ref|XP_003530207.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   7e-28   
gb|EYU24570.1|  hypothetical protein MIMGU_mgv1a005585mg                120   8e-28   
ref|XP_010655139.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   1e-27   
emb|CBI25263.3|  unnamed protein product                                119   1e-27   
ref|XP_002437729.1|  hypothetical protein SORBIDRAFT_10g001440          119   1e-27   
gb|EAY99427.1|  hypothetical protein OsI_21398                          119   1e-27   
ref|XP_010537860.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   2e-27   
ref|XP_002458192.1|  hypothetical protein SORBIDRAFT_03g028480          119   2e-27   
ref|NP_001168599.1|  uncharacterized protein LOC100382383               117   2e-27   
ref|XP_010058011.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   2e-27   
ref|NP_001056629.1|  Os06g0118700                                       119   2e-27   
ref|XP_010913256.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   2e-27   
gb|EAY72467.1|  hypothetical protein OsI_00323                          119   2e-27   
gb|KDO67371.1|  hypothetical protein CISIN_1g028157mg                   115   2e-27   
ref|XP_002303865.2|  hypothetical protein POPTR_0003s18330g             118   3e-27   
gb|KHN40751.1|  Aspartic proteinase nepenthesin-2                       118   3e-27   
gb|EPS70865.1|  hypothetical protein M569_03893                         118   3e-27   
ref|XP_003573001.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   3e-27   
ref|XP_006845396.1|  hypothetical protein AMTR_s00019p00061190          118   3e-27   
tpg|DAA53545.1|  TPA: hypothetical protein ZEAMMB73_483039              118   3e-27   
ref|XP_009380958.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   3e-27   
ref|XP_004959563.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   3e-27   
ref|XP_003534754.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   4e-27   
ref|XP_007142110.1|  hypothetical protein PHAVU_008G253400g             118   4e-27   
ref|XP_004236867.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   4e-27   
gb|AFW86438.1|  hypothetical protein ZEAMMB73_078928                    112   5e-27   
ref|NP_001136612.1|  hypothetical protein                               117   5e-27   
gb|EYU40867.1|  hypothetical protein MIMGU_mgv1a023461mg                117   5e-27   
gb|EEE65000.1|  hypothetical protein OsJ_19937                          117   5e-27   
ref|XP_003565317.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   5e-27   
ref|XP_002436929.1|  hypothetical protein SORBIDRAFT_10g011180          117   7e-27   
ref|XP_008445900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   7e-27   
gb|EMT00623.1|  Aspartic proteinase nepenthesin-1                       114   7e-27   
ref|XP_002436939.1|  hypothetical protein SORBIDRAFT_10g011740          117   7e-27   
ref|XP_006847790.1|  hypothetical protein AMTR_s00029p00016750          117   7e-27   
ref|XP_008658159.1|  PREDICTED: hypothetical protein isoform X1         117   8e-27   
gb|EPS61272.1|  hypothetical protein M569_13524                         117   8e-27   
ref|XP_004968151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   9e-27   
ref|XP_001759252.1|  predicted protein                                  116   9e-27   
ref|XP_002873475.1|  hypothetical protein ARALYDRAFT_909036             115   1e-26   
ref|XP_009607692.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   1e-26   
ref|XP_010928184.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   1e-26   
ref|XP_010096516.1|  Aspartic proteinase nepenthesin-2                  116   1e-26   
gb|EMS59090.1|  Aspartic proteinase nepenthesin-2                       115   1e-26   



>ref|XP_004245197.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
lycopersicum]
Length=501

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 142/172 (83%), Gaps = 1/172 (1%)
 Frame = -3

Query  730  KRGANGHLTFGKGGA-APVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTI  554
            +RG+NGHL+FGK GA + +++TPFA+ QG SFYFIDV  I+VGGK L+ISP+VFK++GTI
Sbjct  318  RRGSNGHLSFGKNGAKSNLQFTPFASSQGTSFYFIDVLGISVGGKSLAISPMVFKNAGTI  377

Query  553  IDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLN  374
            IDSGTVITRLP  AYS LR+ FR+ MSKYP+AP LS+LDTCYDLS YTT+S+PKISF  N
Sbjct  378  IDSGTVITRLPSTAYSNLRATFREFMSKYPRAPDLSLLDTCYDLSNYTTISIPKISFNFN  437

Query  373  GGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            G   MD+   GI + NGASQVCLAFAGNGD   +GIFGN QQQT E+VYDVA
Sbjct  438  GNTKMDIVPNGIFIVNGASQVCLAFAGNGDDDSIGIFGNTQQQTMEIVYDVA  489



>ref|XP_006364268.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=485

 Score =   246 bits (629),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -3

Query  730  KRGANGHLTFGKGGA-APVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTI  554
            +RG+NGHLTFGK GA + +++TPFA+ QG SFYFIDV  I+VGGK L+ISP+VFK++GTI
Sbjct  302  RRGSNGHLTFGKNGAKSNLQFTPFASSQGTSFYFIDVLGISVGGKALAISPMVFKNAGTI  361

Query  553  IDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLN  374
            IDSGTVITRLP  AY+ +R+ FR+ MSKYP+AP LS+LDTCYDLS YTTVS+PKISF  N
Sbjct  362  IDSGTVITRLPSTAYANMRATFREFMSKYPRAPDLSLLDTCYDLSNYTTVSIPKISFNFN  421

Query  373  GGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            G   MDL   GI   NGASQVCLAFA NGD   +GIFGN QQQT E+VYDVA
Sbjct  422  GNTKMDLVPNGIFFVNGASQVCLAFASNGDDDSIGIFGNTQQQTMEIVYDVA  473



>dbj|BAC22609.1| 41 kD chloroplast nucleoid DNA binding protein (CND41) [Nicotiana 
sylvestris]
Length=502

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 139/178 (78%), Gaps = 8/178 (4%)
 Frame = -3

Query  727  RGANGHLTFGKGGAAP--------VKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVF  572
            RG+NGHLTFG G            + +TPFA+ QGA+FYFIDV  I+VGGK LSISP++F
Sbjct  313  RGSNGHLTFGNGNGVKTSKAVKNGITFTPFASSQGATFYFIDVLGISVGGKALSISPMLF  372

Query  571  KSSGTIIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPK  392
            +++GTIIDSGTVITRLP   Y +L+S F+Q MSKYP APALS+LDTCYDLS YT++S+PK
Sbjct  373  QNAGTIIDSGTVITRLPSTVYGSLKSTFKQFMSKYPTAPALSLLDTCYDLSNYTSISIPK  432

Query  391  ISFVLNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ISF  NG   +DL   GIL+ NGASQVCLAFAGNGD   +GIFGNIQQQT EVVYDVA
Sbjct  433  ISFNFNGNANVDLEPNGILITNGASQVCLAFAGNGDDDTIGIFGNIQQQTLEVVYDVA  490



>ref|XP_009783584.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=515

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 139/178 (78%), Gaps = 8/178 (4%)
 Frame = -3

Query  727  RGANGHLTFGKGGAAP--------VKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVF  572
            RG+NGHLTFG G            + +TPFA+ QGA+FYFIDV  I+VGGK LSISP++F
Sbjct  326  RGSNGHLTFGNGNGVKTSKAVKNGITFTPFASSQGATFYFIDVLGISVGGKALSISPMLF  385

Query  571  KSSGTIIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPK  392
            +++GTIIDSGTVITRLP   Y +L+S F+Q MSKYP APALS+LDTCYDLS YT++S+PK
Sbjct  386  QNAGTIIDSGTVITRLPSTVYGSLKSTFKQFMSKYPTAPALSLLDTCYDLSNYTSISIPK  445

Query  391  ISFVLNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ISF  NG   +DL   GIL+ NGASQVCLAFAGNGD   +GIFGNIQQQT EVVYDVA
Sbjct  446  ISFNFNGNANVDLEPNGILITNGASQVCLAFAGNGDDDTIGIFGNIQQQTLEVVYDVA  503



>ref|XP_009591885.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
 dbj|BAA22813.1| CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum]
Length=502

 Score =   240 bits (612),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 140/178 (79%), Gaps = 8/178 (4%)
 Frame = -3

Query  727  RGANGHLTFGKGGAAP--------VKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVF  572
            RG+NGHLTFG G            + +TPFA+ QG ++YFIDV  I+VGGK LSISP++F
Sbjct  313  RGSNGHLTFGNGNGVKASKAVKNGITFTPFASSQGTAYYFIDVLGISVGGKALSISPMLF  372

Query  571  KSSGTIIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPK  392
            +++GTIIDSGTVITRLP  AY +L+SAF+Q MSKYP APALS+LDTCYDLS YT++S+PK
Sbjct  373  QNAGTIIDSGTVITRLPSTAYGSLKSAFKQFMSKYPTAPALSLLDTCYDLSNYTSISIPK  432

Query  391  ISFVLNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ISF  NG   ++L   GIL+ NGASQVCLAFAGNGD   +GIFGNIQQQT EVVYDVA
Sbjct  433  ISFNFNGNANVELDPNGILITNGASQVCLAFAGNGDDDSIGIFGNIQQQTLEVVYDVA  490



>gb|KDP33485.1| hypothetical protein JCGZ_07056 [Jatropha curcas]
Length=493

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 128/167 (77%), Gaps = 1/167 (1%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFATDQGAS-FYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            G LTFG   +  VKYTP AT  GAS FY +D   I+VGG++LSIS  VF ++G IIDSGT
Sbjct  315  GFLTFGGSPSQSVKYTPLATVSGASSFYGLDFTGISVGGRKLSISQSVFSNAGAIIDSGT  374

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLPPAAYSALRS FRQ MSKYP APALSILDTCYD + Y T+SVPKI F  NGG  +
Sbjct  375  VITRLPPAAYSALRSTFRQQMSKYPTAPALSILDTCYDFTNYKTISVPKIGFFFNGGTEV  434

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            D+ + G+   N  SQVCLAFAGN DA+DV IFGN+QQQT EVVYDVA
Sbjct  435  DIDVTGVFYVNRPSQVCLAFAGNSDATDVAIFGNVQQQTLEVVYDVA  481



>ref|XP_011082009.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Sesamum 
indicum]
Length=490

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 131/169 (78%), Gaps = 1/169 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + GHLT GKGGA+  +K+TPFA+ +G SFYFID+  I+VGG+ L IS  VF ++G+IIDS
Sbjct  310  STGHLTLGKGGASRNLKFTPFASSKGTSFYFIDIIKISVGGQDLPISQTVFDTAGSIIDS  369

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AYSAL +AF+Q M KYP APA SILDTCYD S YTT+++P ISF   G V
Sbjct  370  GTVITRLPPDAYSALSTAFQQQMKKYPSAPAYSILDTCYDFSNYTTLTIPTISFTFGGNV  429

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             +DL   G L+   ++Q CLAFAGNGD +DVGIFGNIQQQ  EVVYDVA
Sbjct  430  KVDLEATGTLVAVSSTQACLAFAGNGDDADVGIFGNIQQQKLEVVYDVA  478



>gb|KDO67375.1| hypothetical protein CISIN_1g017894mg [Citrus sinensis]
Length=364

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  718  NGHLTFGKGGAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
             GHLTFG G    VK+TP ++  QG+SFY +D+  I+VGG++L I+  VF + GTIIDSG
Sbjct  185  TGHLTFGPGIKKSVKFTPLSSAFQGSSFYGLDMTGISVGGEKLPIATTVFSTPGTIIDSG  244

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+ L++AFRQ MSKYP APA+SILDTCYD S++ T+++PKISF  NGGV 
Sbjct  245  TVITRLPPHAYTVLKTAFRQLMSKYPTAPAVSILDTCYDFSEHETITIPKISFFFNGGVE  304

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagGCS  182
            +D+ + GI+    ASQVCLAFAGN D SDVGIFGN+QQ T EVVYDVA G++G  AGGCS
Sbjct  305  VDVDVTGIMFPIRASQVCLAFAGNSDPSDVGIFGNVQQHTLEVVYDVAHGQVGFAAGGCS  364



>ref|XP_006483727.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
Length=458

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 132/167 (79%), Gaps = 1/167 (1%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GHLTFG G    VK+TP ++  QG+SFY +D+  I+VGG++L I+  VF + GTIIDSGT
Sbjct  280  GHLTFGPGIKKSVKFTPLSSAFQGSSFYGLDMTGISVGGEKLPIATTVFSTPGTIIDSGT  339

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLPP AY+ L++AFRQ MSKYP APA+SILDTCYD S++ T+++PKISF  NGGV +
Sbjct  340  VITRLPPHAYTVLKTAFRQLMSKYPTAPAVSILDTCYDFSEHETITIPKISFFFNGGVEV  399

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            D+ + GI+    ASQVCLAFAGN D SDVGIFGN+QQ T EVVYDVA
Sbjct  400  DVDVTGIMFPIRASQVCLAFAGNSDPSDVGIFGNVQQHTLEVVYDVA  446



>ref|XP_010049847.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
 gb|KCW82644.1| hypothetical protein EUGRSUZ_C04028 [Eucalyptus grandis]
Length=483

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 135/169 (80%), Gaps = 3/169 (2%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            GHLTFG+G  A   VK+TP AT  QG +FY I+++ I+VGG +LSIS  +F ++  IIDS
Sbjct  303  GHLTFGRGSGASSSVKFTPLATISQGDNFYGINIEGISVGGTKLSISSSIFSNAPGIIDS  362

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AYSAL SAF++ M++YP APALSILDTCYDLSKY +V++PK+SF+ +GG 
Sbjct  363  GTVITRLPPTAYSALSSAFKKLMTRYPTAPALSILDTCYDLSKYKSVNIPKVSFLFSGGT  422

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             +DL   GIL    ASQVCLAFAGNGD +DV I+GN+QQQ+FEVVYDVA
Sbjct  423  NVDLDPSGILYAASASQVCLAFAGNGDDTDVLIYGNVQQQSFEVVYDVA  471



>gb|EYU22027.1| hypothetical protein MIMGU_mgv1a005281mg [Erythranthe guttata]
Length=490

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 133/174 (76%), Gaps = 6/174 (3%)
 Frame = -3

Query  721  ANGHLTFGK--GGAA----PVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSG  560
            + GHLT GK  GGAA     VK+TPFAT QG+SFYFID+ +I+VGG QL I   VFK++G
Sbjct  305  STGHLTLGKNNGGAALTSSTVKFTPFATSQGSSFYFIDIVSISVGGAQLPIGQSVFKAAG  364

Query  559  TIIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFV  380
             IIDSGTVI+RLPPAAYSA+ SAFRQ M +Y  APA SILDTC+D    T+VS+P ISFV
Sbjct  365  AIIDSGTVISRLPPAAYSAMSSAFRQQMKQYTSAPAYSILDTCFDFGNLTSVSIPTISFV  424

Query  379  LNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             +G + +DL   GIL+   ++Q CLAFAGNGDA DVGIFGN QQ+T EVVYDVA
Sbjct  425  FSGNLRVDLHPSGILVAVSSTQACLAFAGNGDAGDVGIFGNTQQKTLEVVYDVA  478



>gb|AHA84134.1| aspartic proteinase nepenthesin-1 [Phaseolus vulgaris]
Length=481

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 130/168 (77%), Gaps = 1/168 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + GHLTFG+  +  + YTPF+T  +G+SFY +D+ +IAV G +LS++P +F + G IIDS
Sbjct  301  STGHLTFGRATSRHLLYTPFSTISRGSSFYGLDIASIAVSGAKLSLTPALFSTGGAIIDS  360

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AY+ALRSAFRQGMSKYP A  LSILDTCYDLS Y  +S+PK++FV  G V
Sbjct  361  GTVITRLPPTAYAALRSAFRQGMSKYPSAAELSILDTCYDLSAYEVISIPKVNFVFAGSV  420

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            T++L   GIL    A QVCLAFA NGD SD+ IFGN+QQ+T EVVYD+
Sbjct  421  TVELQPQGILYVASAKQVCLAFAANGDDSDITIFGNVQQRTLEVVYDL  468



>emb|CDP11359.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 134/172 (78%), Gaps = 3/172 (2%)
 Frame = -3

Query  724  GANGHLTFGKGGAA-PVKYTPFATDQGASF--YFIDVQAIAVGGKQLSISPVVFKSSGTI  554
            G+NGHLTFGKG     VK+ PF++ +  S   YF+D+Q+I+VGG+ LSIS  VF ++G I
Sbjct  299  GSNGHLTFGKGSVPNTVKFAPFSSSRSQSNSAYFLDIQSISVGGQLLSISASVFHTAGNI  358

Query  553  IDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLN  374
            +DSGTVITRLPPAAYSALRSAFRQ MS+Y  APA +ILDTCYD S  +TV++PKIS   +
Sbjct  359  VDSGTVITRLPPAAYSALRSAFRQQMSQYKTAPAATILDTCYDFSGQSTVTIPKISIFFS  418

Query  373  GGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            G V +DL + G LL +  SQVCLAFAGN  A+DVGI+GN QQQTFEVVYDVA
Sbjct  419  GNVKVDLGIEGTLLASSISQVCLAFAGNSAATDVGIYGNTQQQTFEVVYDVA  470



>ref|XP_010692959.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Beta 
vulgaris subsp. vulgaris]
Length=521

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 130/174 (75%), Gaps = 3/174 (2%)
 Frame = -3

Query  730  KRGANGHLTFGKGG--AAPVKYTPF-ATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSG  560
            K  + GHLTFGKGG  +  + YTP  ++  G SFYFI++Q   VGG++LSISP VF   G
Sbjct  336  KSSSTGHLTFGKGGTYSKSITYTPLTSSSSGPSFYFIELQGFTVGGQKLSISPSVFSEGG  395

Query  559  TIIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFV  380
            T+IDSGTVI+RL P AY+AL+SAF + MSKYP+APALSILDTCYDL+ YTT++VPKI  V
Sbjct  396  TLIDSGTVISRLQPDAYTALQSAFDKAMSKYPKAPALSILDTCYDLTNYTTITVPKIGLV  455

Query  379  LNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             +GG  + LP  GI      SQVCLAFAGN D SDVGI GN+QQ  F+VVYDVA
Sbjct  456  FSGGAEVVLPPSGIFYVKDLSQVCLAFAGNSDPSDVGILGNVQQLGFDVVYDVA  509



>ref|XP_011080092.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=509

 Score =   213 bits (542),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 127/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + GHLT GK G +  VK+TPFA+ QG SFYFID+ +I+VGG+QL IS  VF ++G+IIDS
Sbjct  329  STGHLTLGKSGVSRNVKFTPFASSQGTSFYFIDILSISVGGRQLPISQSVFTTAGSIIDS  388

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPPAAYS + + FR+ M KY  APA SILDTCYDLS  TT+++P ISF   G V
Sbjct  389  GTVITRLPPAAYSTMSAEFRKQMVKYKTAPAYSILDTCYDLSGLTTITIPTISFTFGGSV  448

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             +DL   GILL    S+VCLAFAGN +A DV IFGN QQ+T EVVYDV
Sbjct  449  KVDLAPSGILLAVSTSRVCLAFAGNNNADDVAIFGNTQQKTLEVVYDV  496



>gb|EYU29201.1| hypothetical protein MIMGU_mgv1a005225mg [Erythranthe guttata]
Length=492

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 134/170 (79%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFGK-GGAAPVKYTPFATDQ-GASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + GHLT GK G +  VK+TPF T+Q G+SFYFI++ +I+VGG+QL+IS  VFK+ GTIID
Sbjct  311  STGHLTLGKTGNSRNVKFTPFVTNQQGSSFYFINIVSISVGGRQLAISGSVFKAGGTIID  370

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVI+R+PP AYSAL  AF++ M+KY +APA SILDTCYDLS YT+V+VP +SF   G 
Sbjct  371  SGTVISRIPPTAYSALSGAFKKMMAKYKRAPAYSILDTCYDLSGYTSVTVPTVSFTFGGN  430

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            V +DL   GI++  G ++VCLAFAGN D  DVGIFGN QQ+T EVVYDVA
Sbjct  431  VRVDLDPSGIIVAVGGTRVCLAFAGNSDDGDVGIFGNSQQKTLEVVYDVA  480



>ref|XP_007146522.1| hypothetical protein PHAVU_006G048000g [Phaseolus vulgaris]
 gb|ESW18516.1| hypothetical protein PHAVU_006G048000g [Phaseolus vulgaris]
Length=481

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + GHLTFG+  +  + YTPF+T  + +SFY +D+ +IAV G +LS++P +F + G IIDS
Sbjct  301  STGHLTFGRATSRHLLYTPFSTISRSSSFYGLDIASIAVSGAKLSLTPALFSTGGAIIDS  360

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AY+ALRSAFRQGMSKYP A  LSILDTCYDLS    +S+PK++FV +G V
Sbjct  361  GTVITRLPPTAYAALRSAFRQGMSKYPSAAELSILDTCYDLSANKVISIPKVNFVFSGSV  420

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            T++L   GIL    A QVCLAFA NGD SD+ IFGN+QQ+T EVVYD+
Sbjct  421  TVELQPQGILYVASAKQVCLAFAANGDDSDITIFGNVQQRTLEVVYDL  468



>ref|XP_006450237.1| hypothetical protein CICLE_v10008143mg [Citrus clementina]
 gb|ESR63477.1| hypothetical protein CICLE_v10008143mg [Citrus clementina]
Length=481

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 131/169 (78%), Gaps = 1/169 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + GHLTFG G +  V++TP ++   G+SFY +++  I+VGG++LSI+  VF ++GTIIDS
Sbjct  301  STGHLTFGPGASKSVQFTPLSSISGGSSFYGLEMIGISVGGQKLSIAASVFTTAGTIIDS  360

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AY+ LR+AFRQ MSKYP APALS+LDTCYD SKY+TV++P+IS   +GGV
Sbjct  361  GTVITRLPPDAYTPLRTAFRQFMSKYPTAPALSLLDTCYDFSKYSTVTLPQISLFFSGGV  420

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             + +   GI+  +  SQVCLAFAGN D +DV IFGN QQ T EVVYDVA
Sbjct  421  EVSVDKTGIMYASNISQVCLAFAGNSDPTDVSIFGNTQQHTLEVVYDVA  469



>ref|XP_006483511.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|KDO67376.1| hypothetical protein CISIN_1g011600mg [Citrus sinensis]
Length=481

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 131/169 (78%), Gaps = 1/169 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + GHLTFG G +  V++TP ++   G+SFY +++  I+VGG++LSI+  VF ++GTIIDS
Sbjct  301  STGHLTFGPGASKSVQFTPLSSISGGSSFYGLEMIGISVGGQKLSIAASVFTTAGTIIDS  360

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AY+ LR+AFRQ MSKYP APALS+LDTCYD SKY+TV++P+IS   +GGV
Sbjct  361  GTVITRLPPDAYTPLRTAFRQFMSKYPTAPALSLLDTCYDFSKYSTVTLPQISLFFSGGV  420

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             + +   GI+  +  SQVCLAFAGN D +DV IFGN QQ T EVVYDVA
Sbjct  421  EVSVDKTGIMYASNISQVCLAFAGNSDPTDVSIFGNTQQHTLEVVYDVA  469



>gb|KDO67377.1| hypothetical protein CISIN_1g011600mg [Citrus sinensis]
Length=454

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 131/169 (78%), Gaps = 1/169 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + GHLTFG G +  V++TP ++   G+SFY +++  I+VGG++LSI+  VF ++GTIIDS
Sbjct  274  STGHLTFGPGASKSVQFTPLSSISGGSSFYGLEMIGISVGGQKLSIAASVFTTAGTIIDS  333

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AY+ LR+AFRQ MSKYP APALS+LDTCYD SKY+TV++P+IS   +GGV
Sbjct  334  GTVITRLPPDAYTPLRTAFRQFMSKYPTAPALSLLDTCYDFSKYSTVTLPQISLFFSGGV  393

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             + +   GI+  +  SQVCLAFAGN D +DV IFGN QQ T EVVYDVA
Sbjct  394  EVSVDKTGIMYASNISQVCLAFAGNSDPTDVSIFGNTQQHTLEVVYDVA  442



>emb|CDP19504.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 135/175 (77%), Gaps = 4/175 (2%)
 Frame = -3

Query  730  KRGANGHLTFGKGGAA-PVKYTPFATDQGAS--FYFIDVQAIAVGGKQLSISPVVFKSSG  560
            K G+NGHLTFGKG     VK+ PF++    S  FYF+D+Q+I+VGG+ LSIS  VF ++ 
Sbjct  297  KSGSNGHLTFGKGSVPNTVKFAPFSSSSSQSNSFYFLDIQSISVGGQLLSISASVFLTAR  356

Query  559  TIIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFV  380
             ++DSGTVITRLPPAAYSALRSAFRQ MS+Y  APA SILDTCYD S  +TV +PKIS +
Sbjct  357  NVVDSGTVITRLPPAAYSALRSAFRQQMSQYKTAPAASILDTCYDFSSQSTVKIPKISII  416

Query  379  LNGGVTMDLPLVG-ILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             +G V +DL + G +LL +  SQVCLAFAGN  A+D+GI+GN QQQTF+VVYDVA
Sbjct  417  FSGNVKVDLAIEGTLLLPSSLSQVCLAFAGNSAATDMGIYGNTQQQTFDVVYDVA  471



>ref|XP_003532146.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Glycine max]
Length=488

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 124/168 (74%), Gaps = 1/168 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + G L+FG    + VKYTPF+T  +G+SFY +D+  I+VGG +L +S   F + G IIDS
Sbjct  308  STGRLSFGTTTTSYVKYTPFSTISRGSSFYGLDITGISVGGAKLPVSSSTFSTGGAIIDS  367

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AY+ALRSAFRQGMSKYP A  LSILDTCYDLS Y   S+PKI F   GGV
Sbjct  368  GTVITRLPPTAYTALRSAFRQGMSKYPSAGELSILDTCYDLSGYEVFSIPKIDFSFAGGV  427

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            T+ LP  GIL    A QVCLAFA NGD SDV I+GN+QQ+T EVVYDV
Sbjct  428  TVQLPPQGILYVASAKQVCLAFAANGDDSDVTIYGNVQQKTIEVVYDV  475



>ref|XP_007225640.1| hypothetical protein PRUPE_ppa004762mg [Prunus persica]
 gb|EMJ26839.1| hypothetical protein PRUPE_ppa004762mg [Prunus persica]
Length=492

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 127/171 (74%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP--VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + G+L+FGKGG +   VK+T  +T  QG SFY ++V  I VGG +L IS  VF SSGTII
Sbjct  310  STGYLSFGKGGGSSNAVKFTALSTVSQGDSFYGLNVVGINVGGTKLPISASVFSSSGTII  369

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGTVITRLPP AYS+L++AFRQ M  YP    LSILDTCYD S + TVS PKISFV +G
Sbjct  370  DSGTVITRLPPTAYSSLKAAFRQRMKSYPLTQELSILDTCYDFSSFKTVSYPKISFVFDG  429

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            G+T DL   GIL    A QVCLAFAGNGD SD+GIFGN+QQ+  +VVYD+A
Sbjct  430  GLTQDLDATGILYVASADQVCLAFAGNGDDSDIGIFGNVQQKRLQVVYDIA  480



>ref|XP_002515388.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
 gb|EEF46837.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
Length=494

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            G LTFG   +    +TP AT   G+SFY +D+  I+VGG++L+ISP VF ++GTIIDSGT
Sbjct  316  GFLTFGGSTSKSASFTPLATISGGSSFYGLDLTGISVGGRKLAISPSVFSTAGTIIDSGT  375

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLPPAAYSAL S FR+ MS+YP APALSILDTC+D S + T+SVPKI    +GGV +
Sbjct  376  VITRLPPAAYSALSSTFRKLMSQYPAAPALSILDTCFDFSNHDTISVPKIGLFFSGGVVV  435

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            D+   GI   N  +QVCLAFAGN DASDV IFGN+QQ+T EVVYD A
Sbjct  436  DIDKTGIFYVNDLTQVCLAFAGNSDASDVAIFGNVQQKTLEVVYDGA  482



>ref|XP_008220631.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Prunus mume]
Length=501

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 128/171 (75%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP--VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + G+L+FGKGG +   VK+T  +T  QG SFY ++V  I VGG +L+IS  VF SSGTII
Sbjct  319  STGYLSFGKGGGSSNAVKFTGLSTVSQGDSFYGLNVVGINVGGTKLAISASVFSSSGTII  378

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGTVITRLPP AYSAL++AFRQ M  YP   ALSILDTCYD S + TVS PKISFV + 
Sbjct  379  DSGTVITRLPPTAYSALKAAFRQRMKSYPLTQALSILDTCYDFSSFKTVSYPKISFVFDD  438

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            G+T +L   GIL    A QVCLAFAGNGD SD+GIFGN+QQ+  +VVYD+A
Sbjct  439  GLTQELDATGILYVGSADQVCLAFAGNGDDSDIGIFGNVQQKRLQVVYDIA  489



>ref|XP_007011665.1| Eukaryotic aspartyl protease family protein, putative isoform 
4, partial [Theobroma cacao]
 gb|EOY29284.1| Eukaryotic aspartyl protease family protein, putative isoform 
4, partial [Theobroma cacao]
Length=477

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 132/171 (77%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGG--AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            ++G L FG GG  +  VK+T  +T  QG SFY ID+  I+VGG++LSIS  +F ++GTII
Sbjct  295  SDGFLAFGYGGGVSKSVKFTTLSTVSQGESFYGIDITGISVGGQKLSISASLFTTAGTII  354

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGTVITRLPP AY+ALRS+FRQ M++YP+A AL+ILDTCYD SKY++VS+PKISF  +G
Sbjct  355  DSGTVITRLPPTAYAALRSSFRQKMTQYPRAQALAILDTCYDFSKYSSVSIPKISFFFSG  414

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            GV + +   GIL  N  SQVCLAFAGN D +D+GI GN QQ+T +VVYD A
Sbjct  415  GVEVPIDAKGILYANSISQVCLAFAGNSDDTDIGIVGNTQQKTLQVVYDGA  465



>ref|XP_007011662.1| Eukaryotic aspartyl protease family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY29281.1| Eukaryotic aspartyl protease family protein, putative isoform 
1 [Theobroma cacao]
Length=474

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 132/171 (77%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGG--AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            ++G L FG GG  +  VK+T  +T  QG SFY ID+  I+VGG++LSIS  +F ++GTII
Sbjct  292  SDGFLAFGYGGGVSKSVKFTTLSTVSQGESFYGIDITGISVGGQKLSISASLFTTAGTII  351

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGTVITRLPP AY+ALRS+FRQ M++YP+A AL+ILDTCYD SKY++VS+PKISF  +G
Sbjct  352  DSGTVITRLPPTAYAALRSSFRQKMTQYPRAQALAILDTCYDFSKYSSVSIPKISFFFSG  411

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            GV + +   GIL  N  SQVCLAFAGN D +D+GI GN QQ+T +VVYD A
Sbjct  412  GVEVPIDAKGILYANSISQVCLAFAGNSDDTDIGIVGNTQQKTLQVVYDGA  462



>ref|XP_006483510.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
Length=483

 Score =   204 bits (520),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 127/171 (74%), Gaps = 5/171 (3%)
 Frame = -3

Query  715  GHLTFGK----GGAAPVKYTPFATDQG-ASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            GHLTFGK    G +  +K+TP +T    +SFY +D+  ++VGGK+L I   VF S+G II
Sbjct  301  GHLTFGKAAGNGPSKTIKFTPLSTATADSSFYGLDIIGLSVGGKKLPIPISVFSSAGAII  360

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGTVITRLPPAAYSALRS F++ MSKYP APALSILDTCYD S YT++SVP ISF  N 
Sbjct  361  DSGTVITRLPPAAYSALRSTFKKFMSKYPTAPALSILDTCYDFSNYTSISVPVISFFFNR  420

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            GV + +    IL+G+   Q+CLAFAGN D SDV I GN+QQ+T EVVYDVA
Sbjct  421  GVEVSIEGSAILIGSSPKQICLAFAGNSDDSDVAIIGNVQQKTLEVVYDVA  471



>ref|XP_003551807.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=490

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 122/169 (72%), Gaps = 2/169 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + GHL+FG       +KYTPF+T  +G+SFY +D+ AIAVGG +L +S   F + G IID
Sbjct  309  STGHLSFGPAATGRYLKYTPFSTISRGSSFYGLDITAIAVGGVKLPVSSSTFSTGGAIID  368

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AY ALRSAFRQGMSKYP A  LSILDTCYDLS Y   S+P I F   GG
Sbjct  369  SGTVITRLPPTAYGALRSAFRQGMSKYPSAGELSILDTCYDLSGYKVFSIPTIEFSFAGG  428

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            VT+ LP  GIL      QVCLAFA NGD SDV I+GN+QQ+T EVVYDV
Sbjct  429  VTVKLPPQGILFVASTKQVCLAFAANGDDSDVTIYGNVQQRTIEVVYDV  477



>gb|KDO67374.1| hypothetical protein CISIN_1g011556mg [Citrus sinensis]
Length=483

 Score =   204 bits (520),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 127/171 (74%), Gaps = 5/171 (3%)
 Frame = -3

Query  715  GHLTFGK----GGAAPVKYTPFATDQG-ASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            GHLTFGK    G +  +K+TP +T    +SFY +D+  ++VGGK+L I   VF S+G II
Sbjct  301  GHLTFGKAAGNGPSKTIKFTPLSTATADSSFYGLDIIGLSVGGKKLPIPISVFSSAGAII  360

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGTVITRLPPAAYSALRS F++ MSKYP APALSILDTCYD S YT++SVP ISF  N 
Sbjct  361  DSGTVITRLPPAAYSALRSTFKKFMSKYPTAPALSILDTCYDFSNYTSISVPVISFFFNR  420

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            GV + +    IL+G+   Q+CLAFAGN D SDV I GN+QQ+T EVVYDVA
Sbjct  421  GVEVSIEGSAILIGSSPKQICLAFAGNSDDSDVAIIGNVQQKTLEVVYDVA  471



>ref|XP_002324349.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEF02914.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=490

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 122/165 (74%), Gaps = 1/165 (1%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            G LTFG   +   K+TP +T   G SFY +D   I+VGGK+L+IS  VF ++G IIDSGT
Sbjct  312  GFLTFGGSASKNAKFTPLSTISAGPSFYGLDFTGISVGGKKLAISASVFSTAGAIIDSGT  371

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLPPAAYSALR++FR  MSKYP   ALSILDTCYD S YTT+SVPKI F  + G+ +
Sbjct  372  VITRLPPAAYSALRASFRNLMSKYPMTKALSILDTCYDFSSYTTISVPKIGFSFSSGIEV  431

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
            D+   GIL  +  SQVCLAFAGN DA+DV IFGN+QQ+T EV YD
Sbjct  432  DIDATGILYASSLSQVCLAFAGNSDATDVFIFGNVQQKTLEVFYD  476



>ref|XP_004291984.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Fragaria 
vesca subsp. vesca]
Length=492

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 117/155 (75%), Gaps = 1/155 (1%)
 Frame = -3

Query  679  VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSA  503
            VK+TP +T  QG SFY + V  I+VGG+QLSI   VF SSGTIIDSGTVITRLP  AYSA
Sbjct  326  VKFTPLSTVSQGGSFYGLSVVGISVGGRQLSIPASVFSSSGTIIDSGTVITRLPATAYSA  385

Query  502  LRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNG  323
            LR AFRQGM  YPQA ALSILDTCYDLS   TVS PKI+F   GGVT+DL   GIL    
Sbjct  386  LRDAFRQGMKSYPQAEALSILDTCYDLSGSKTVSYPKIAFAFGGGVTLDLDATGILYVAS  445

Query  322  ASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             SQVCLAFAGN D SD+ IFGN+QQ+  +VVYDVA
Sbjct  446  VSQVCLAFAGNSDDSDIAIFGNVQQKRLQVVYDVA  480



>ref|XP_009411894.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=452

 Score =   201 bits (512),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 127/170 (75%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFGKG-GAAPVKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+LTFG G  ++ VK+TP  TD    +FY++++ AI+V G++L IS  VF  +GTIID
Sbjct  272  STGYLTFGTGYPSSKVKFTPMVTDASTPTFYYLNLMAISVAGQRLPISAKVFNDAGTIID  331

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AYSALRSAFRQ MS Y  A ALSILDTCYD + ++TVS+P ++    GG
Sbjct  332  SGTVITRLPPTAYSALRSAFRQAMSSYKTASALSILDTCYDFTGHSTVSIPTVALQFGGG  391

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            VTM+L L G L     SQVCLAFA NGD SDVGI GN+QQ+TF VVYDV+
Sbjct  392  VTMELDLSGTLYVGSQSQVCLAFAANGDDSDVGILGNVQQKTFNVVYDVS  441



>ref|XP_010108296.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXC18776.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=491

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 135/182 (74%), Gaps = 4/182 (2%)
 Frame = -3

Query  715  GHLTFGKGGAA---PVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            G+L+FG  G+    P+KYTP +T    ASFY + V  I+VGG +LS+   +F+S+GTIID
Sbjct  310  GYLSFGTTGSKAQYPIKYTPLSTLSASASFYALQVLGISVGGNKLSVPATLFQSAGTIID  369

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AYSAL   F++ MSKYP APALSILDTC++LS Y TV++PKISF   GG
Sbjct  370  SGTVITRLPPTAYSALSGEFKKQMSKYPSAPALSILDTCFNLSAYQTVTIPKISFYFGGG  429

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagG  188
              +DL   GIL     SQVCLAFAGN D  DV IFGN+QQ+T +VVYD+ GG++G G+GG
Sbjct  430  TAVDLDATGILYAASLSQVCLAFAGNSDDGDVAIFGNVQQKTLQVVYDIGGGRIGFGSGG  489

Query  187  CS  182
            CS
Sbjct  490  CS  491



>ref|XP_011036733.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=490

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            G LTFG   +   K+TP +T   G SFY +D   I+VGGK+L+IS  VF ++G IIDSGT
Sbjct  312  GFLTFGGSASKNAKFTPLSTISAGPSFYGLDFTGISVGGKKLAISASVFSTAGAIIDSGT  371

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLPP AYSALR++FR  MSKYP   ALSILDTCYD S YTT+SVPKI F  + G+ +
Sbjct  372  VITRLPPPAYSALRASFRNLMSKYPMTKALSILDTCYDFSNYTTISVPKIGFSFSSGIEV  431

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
            D+   GIL  +  SQVCLAFAGN DA+DV IFGN+QQ+T EV YD
Sbjct  432  DIDATGILYASSISQVCLAFAGNSDATDVFIFGNVQQKTLEVFYD  476



>ref|XP_010928894.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=459

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 127/170 (75%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFGKGG-AAPVKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+LTFG G  ++ VK+TP  TD    S+Y++D+ AI VGG++LSISP VF  +GTIID
Sbjct  279  STGYLTFGGGSISSNVKFTPMLTDPTTPSYYYLDLVAIYVGGQRLSISPTVFSDAGTIID  338

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVI+RLPPAAYSALRSAFRQ MS+Y  APAL ILDTCYD S Y+ VS+P ++    GG
Sbjct  339  SGTVISRLPPAAYSALRSAFRQLMSRYKSAPALEILDTCYDFSGYSQVSIPTVALQFGGG  398

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +T  L   GIL     SQ CLAFAGN DA+DVGI GN+QQ+ F VVYDV+
Sbjct  399  ITTILDGSGILYVASQSQACLAFAGNSDANDVGIIGNVQQRKFNVVYDVS  448



>gb|KGN55408.1| hypothetical protein Csa_4G651750 [Cucumis sativus]
Length=389

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 126/169 (75%), Gaps = 2/169 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAA-PVKYTPFATDQG-ASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+LTFG GG    +KYTP     G A+FY +D+  + VGG Q+ IS  VF +SG IID
Sbjct  209  STGYLTFGGGGGGGALKYTPITKAHGVANFYGVDIVGMKVGGTQIPISSSVFSTSGAIID  268

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AYSAL+SAF +GM+KYP+AP LSILDTCYDLSKY+T+ +PK+ FV  GG
Sbjct  269  SGTVITRLPPDAYSALKSAFEKGMAKYPKAPELSILDTCYDLSKYSTIQIPKVGFVFKGG  328

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
              +DL  +GI+ G   SQVCLAFAGN D S V I GN+QQ+T +VVYDV
Sbjct  329  EELDLDGIGIMYGASTSQVCLAFAGNQDPSTVAIIGNVQQKTLQVVYDV  377



>ref|XP_008223730.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Prunus 
mume]
Length=497

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 126/175 (72%), Gaps = 7/175 (4%)
 Frame = -3

Query  721  ANGHLTFGKG----GAAPVKYTPFAT---DQGASFYFIDVQAIAVGGKQLSISPVVFKSS  563
            + G L+FGK      +  VKYTP AT    + +S Y I++  I VGG++L IS  VFK+S
Sbjct  311  STGFLSFGKEKSRRASKGVKYTPLATLPQKEYSSLYGINLVGITVGGRKLPISTSVFKTS  370

Query  562  GTIIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISF  383
            GTIIDSGTVITRLPP AYSALR AFRQGM  YP+APA+SILDTCYD S Y TV++PKI+F
Sbjct  371  GTIIDSGTVITRLPPQAYSALRDAFRQGMKSYPRAPAISILDTCYDFSSYETVNIPKIAF  430

Query  382  VLNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
               GG+T+DL   GI+    ASQ CLAF+ N + SD+ +FGN+QQ   EVVYDVA
Sbjct  431  SFKGGLTLDLDGTGIIYTVTASQACLAFSANKEDSDIAVFGNVQQLKLEVVYDVA  485



>gb|KJB55136.1| hypothetical protein B456_009G065000 [Gossypium raimondii]
Length=490

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 122/168 (73%), Gaps = 4/168 (2%)
 Frame = -3

Query  715  GHLTFGKG---GAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            G LT GK    G+  VK+TP +T  Q +SFY +D+  I+VGGK+LSIS  VF ++G IID
Sbjct  309  GFLTLGKCRRYGSKSVKFTPLSTSIQDSSFYGLDITGISVGGKRLSISASVFTTAGAIID  368

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AY+ALRS FRQ M +Y     LSILDTCYD SKY +V++PKISF   GG
Sbjct  369  SGTVITRLPPDAYAALRSEFRQRMRRYRMGRELSILDTCYDFSKYKSVNIPKISFFFRGG  428

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
            V + +PLVG L     SQVCLAFA N DASD+ IFGN QQ+T +V+YD
Sbjct  429  VKLTIPLVGTLYVANVSQVCLAFAANSDASDIAIFGNTQQKTLQVIYD  476



>ref|XP_004513892.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=494

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            A GHLTFG      VKYTPF+T    SFY +D+  I V G +L IS  +F + G IIDSG
Sbjct  315  AIGHLTFGATSNNYVKYTPFSTTGSNSFYGLDIVGITVAGTKLPISSSIFSTGGAIIDSG  374

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AYS LR AF++GM KYP A ALS+LDTCYDLS    VSVPKISF   G VT
Sbjct  375  TVITRLPPTAYSVLRDAFKKGMLKYPPASALSLLDTCYDLSGSKVVSVPKISFTFGGDVT  434

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            +DL   GIL      QVCLAFA NGD SD+ IFGN+QQ+T EVVYDV
Sbjct  435  VDLAASGILYVASVKQVCLAFAANGDDSDLTIFGNVQQRTLEVVYDV  481



>ref|XP_002285593.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
Length=481

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 127/171 (74%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGG--AAPVKYTP-FATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + G+LTFG GG  +  VK+TP     QG SFYF+++ AI+VGG++LS S  VF ++GTII
Sbjct  299  STGYLTFGSGGGTSKAVKFTPSLVNSQGPSFYFLNLIAISVGGRKLSTSASVFSTAGTII  358

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGTVI+RLPP AYS LR++F+Q MSKYP+A   SILDTCYD S+Y TV VPKI+   + 
Sbjct  359  DSGTVISRLPPTAYSDLRASFQQQMSKYPKAAPASILDTCYDFSQYDTVDVPKINLYFSD  418

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            G  MDL   GI      SQVCLAFAGN DA+D+ I GN+QQ+TF+VVYDVA
Sbjct  419  GAEMDLDPSGIFYILNISQVCLAFAGNSDATDIAILGNVQQKTFDVVYDVA  469



>ref|XP_004150866.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004157102.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=473

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 126/169 (75%), Gaps = 2/169 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAA-PVKYTPFATDQG-ASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+LTFG GG    +KYTP     G A+FY +D+  + VGG Q+ IS  VF +SG IID
Sbjct  293  STGYLTFGGGGGGGALKYTPITKAHGVANFYGVDIVGMKVGGTQIPISSSVFSTSGAIID  352

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AYSAL+SAF +GM+KYP+AP LSILDTCYDLSKY+T+ +PK+ FV  GG
Sbjct  353  SGTVITRLPPDAYSALKSAFEKGMAKYPKAPELSILDTCYDLSKYSTIQIPKVGFVFKGG  412

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
              +DL  +GI+ G   SQVCLAFAGN D S V I GN+QQ+T +VVYDV
Sbjct  413  EELDLDGIGIMYGASTSQVCLAFAGNQDPSTVAIIGNVQQKTLQVVYDV  461



>ref|XP_003530761.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=485

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 124/169 (73%), Gaps = 4/169 (2%)
 Frame = -3

Query  715  GHLTFGKGGA--APVKYTPFATDQG-ASFYFIDVQAIAVGGKQL-SISPVVFKSSGTIID  548
            GHLTFG   A  A +KYTP +T  G  +FY +D+  I+VGG +L ++S   F + G+IID
Sbjct  304  GHLTFGASAATNANLKYTPLSTISGDNTFYGLDIVGISVGGTKLPAVSSSTFSAGGSIID  363

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRL P AY+ALRSAFRQGM KYP A    + DTCYD S Y  +SVPKI F   GG
Sbjct  364  SGTVITRLAPTAYAALRSAFRQGMEKYPVANEDGLFDTCYDFSGYKEISVPKIDFEFAGG  423

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            VT++LPLVGIL+G  A QVCLAFA NG+ +D+ IFGN+QQ+T EVVYDV
Sbjct  424  VTVELPLVGILIGRSAQQVCLAFAANGNDNDITIFGNVQQKTLEVVYDV  472



>ref|XP_003532147.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=482

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 124/169 (73%), Gaps = 4/169 (2%)
 Frame = -3

Query  715  GHLTFGKGGA--APVKYTPFATDQGA-SFYFIDVQAIAVGGKQL-SISPVVFKSSGTIID  548
            GHLTFG   A  A +KYTPF+T  G  SFY +D+  I+VGG +L ++S   F + G+IID
Sbjct  301  GHLTFGASAATNANLKYTPFSTISGENSFYGLDIVGISVGGTKLPAVSSSTFSAGGSIID  360

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AY+ALRSAFRQ M KYP A    +LDTCYD S Y  +SVP+I F   GG
Sbjct  361  SGTVITRLPPTAYAALRSAFRQFMMKYPVAYGTRLLDTCYDFSGYKEISVPRIDFEFAGG  420

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            V ++LPLVGIL G  A Q+CLAFA NG+ +D+ IFGN+QQ+T EVVYDV
Sbjct  421  VKVELPLVGILYGESAQQLCLAFAANGNGNDITIFGNVQQKTLEVVYDV  469



>ref|XP_008811141.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=464

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 118/166 (71%), Gaps = 1/166 (1%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            G+LTFG G  + VK+TP  T     SFYF+ + AI VGG+QL ISP VF + GT++DSGT
Sbjct  287  GYLTFGGGAPSNVKFTPMLTFSDMPSFYFLSLVAIRVGGEQLPISPTVFSTPGTLLDSGT  346

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLPP+AY ALRS FRQ M KY  APALSILDTCYD + Y TVSVP +  V  GG ++
Sbjct  347  VITRLPPSAYVALRSRFRQQMRKYKTAPALSILDTCYDFTGYETVSVPTVELVFGGGTSI  406

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            +L   GIL     SQ CLAFAGNGD SDV I GN+QQ+   VVYD+
Sbjct  407  NLDFAGILYVAKVSQACLAFAGNGDVSDVTIIGNVQQRRVNVVYDI  452



>ref|XP_010928895.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=464

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGA-APVKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+LTFG G   + VK+TP  T +   S Y++D+ AI VGG++LSISP VF  +GTIID
Sbjct  284  STGYLTFGGGSTFSNVKFTPMLTGRNTPSHYYLDLVAIYVGGQRLSISPTVFSDAGTIID  343

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVI+RLPPAAYSALRSAFRQ MS+Y  APALSILDTCYD S Y+ +S+P ++    GG
Sbjct  344  SGTVISRLPPAAYSALRSAFRQLMSRYKSAPALSILDTCYDFSGYSQISIPTVALQFGGG  403

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +T  L   GIL     SQ CLAFAGN  A DVGI GN+QQ+ F VVYDVA
Sbjct  404  ITTILDSSGILYVASKSQACLAFAGNSGAKDVGIIGNVQQRKFNVVYDVA  453



>ref|XP_008379433.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=504

 Score =   197 bits (502),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = -3

Query  679  VKYTPFA-TDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSA  503
            VK+TP +   QG SFY +DV  I+VGGK+L IS  +F SSGTIIDSGTVITRLPP AY A
Sbjct  338  VKFTPLSDVSQGGSFYGLDVVGISVGGKKLPISGTIFSSSGTIIDSGTVITRLPPTAYKA  397

Query  502  LRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNG  323
            LR AF+QGM  YP APALSILDTCYD S   TV+ PKISF   G  T++L   GI     
Sbjct  398  LRDAFQQGMKSYPSAPALSILDTCYDFSNADTVTFPKISFEFGGRTTLELDPTGIFYAAS  457

Query  322  ASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            A QVCLAFA NGD SD+GIFGN+QQ+  +VVYDVA
Sbjct  458  ADQVCLAFAANGDDSDIGIFGNVQQKRVQVVYDVA  492



>ref|XP_010259084.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=470

 Score =   196 bits (499),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 132/182 (73%), Gaps = 4/182 (2%)
 Frame = -3

Query  715  GHLTFGK---GGAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            G L FG      ++ VKYT   TD +G SFYF+ +  I+V G++L+I P  F SSGTIID
Sbjct  289  GFLAFGNQVGTSSSSVKYTSLLTDSRGNSFYFVPLLGISVKGQRLAIPPTAFTSSGTIID  348

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPPAAY+ALRSAFRQ MSKYP   +LSILDTCYDLS Y TV++P I+    GG
Sbjct  349  SGTVITRLPPAAYAALRSAFRQAMSKYPSTSSLSILDTCYDLSGYNTVTIPTITLHFGGG  408

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagG  188
              + +   GIL+    SQVCLAFAGN D SDV I GN QQQTFEVVYDV GGKLG GAGG
Sbjct  409  TGLAVDSSGILVVASLSQVCLAFAGNSDPSDVAILGNKQQQTFEVVYDVTGGKLGFGAGG  468

Query  187  CS  182
            CS
Sbjct  469  CS  470



>ref|XP_010555463.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Tarenaya 
hassleriana]
Length=478

 Score =   196 bits (499),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 123/166 (74%), Gaps = 2/166 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP ++   G SFY +D+  I+V G++L+I   VF S+G +IDSG
Sbjct  299  GHLTFGSAGLSRSVKFTPLSSVTDGTSFYGLDIVGISVAGQKLTIPSTVFSSAGALIDSG  358

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AYSAL+SAF+  MS+YP APA+SILDTCYDL+ Y TV++PK+ F+ +GGV 
Sbjct  359  TVITRLPPKAYSALKSAFQASMSRYPTAPAVSILDTCYDLTGYRTVAIPKVGFLFSGGVD  418

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
            ++L   GIL     SQVCL FA N D S V IFGN+QQQT EVVYD
Sbjct  419  VELDATGILYALKISQVCLGFASNSDDSSVAIFGNVQQQTLEVVYD  464



>ref|XP_009390623.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=465

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 131/181 (72%), Gaps = 1/181 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + G+LT G+G  +  KYTP  T  +  SFYF+ + AI VGGKQL IS +VF ++ T++DS
Sbjct  285  STGYLTIGRGSRSSTKYTPMLTVPEMPSFYFVRLIAIKVGGKQLPISRMVFSTARTLMDS  344

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP+AY+ LRSAF+Q M++YP APALSILDTCYD + YTTVSVP ++ V +GG 
Sbjct  345  GTVITRLPPSAYAVLRSAFKQKMTQYPPAPALSILDTCYDFTGYTTVSVPTVALVFSGGA  404

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagGC  185
            T+ +   GIL     SQ CLAFAGN +A D  I  N+QQ+T+ VVYDV+  K+G GA  C
Sbjct  405  TLSVDFTGILYVASVSQACLAFAGNDNADDPAIIANVQQRTYNVVYDVSKRKIGFGAKAC  464

Query  184  S  182
            S
Sbjct  465  S  465



>ref|XP_009363292.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Pyrus 
x bretschneideri]
Length=507

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 112/155 (72%), Gaps = 1/155 (1%)
 Frame = -3

Query  679  VKYTPFA-TDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSA  503
            VK+TP A   QG SFY +DV  I+VGGK L I   +F SSGTIIDSGTVITRLPP AY A
Sbjct  341  VKFTPLADVSQGGSFYGLDVVGISVGGKNLPIPGTIFSSSGTIIDSGTVITRLPPTAYKA  400

Query  502  LRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNG  323
            LR AF+QGM  YP APALSILDTCYD S   TV+ PKISF   GG T++L   GI     
Sbjct  401  LRDAFQQGMKSYPSAPALSILDTCYDFSNADTVTFPKISFAFGGGTTLELDPTGIFYAAS  460

Query  322  ASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            A QVCLAFA NGD SD+GI GN+QQ+  +VVYDVA
Sbjct  461  ADQVCLAFAANGDDSDIGIIGNVQQKRVQVVYDVA  495



>gb|KHN12538.1| Aspartic proteinase nepenthesin-2 [Glycine soja]
Length=483

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 124/170 (73%), Gaps = 5/170 (3%)
 Frame = -3

Query  715  GHLTFGKGGA--APVKYTPFATDQG-ASFYFIDVQAIAVGGKQL-SISPVVFKSSGTIID  548
            GHLTFG   A  A +KYTPF+T  G  +FY +D+  I+VGG +L ++S   F + G+IID
Sbjct  301  GHLTFGASAATNANLKYTPFSTISGDNTFYGLDIVGISVGGTKLPAVSSSTFSAGGSIID  360

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTV-SVPKISFVLNG  371
            SGTVITRLPP AY+ALRSAFRQGMSKYP A  LSILDTCYDLS Y  V S+P I F   G
Sbjct  361  SGTVITRLPPTAYAALRSAFRQGMSKYPSAGELSILDTCYDLSGYYKVFSIPTIEFSFAG  420

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            GVT+ LP  GIL      QVCLAFA NGD SDV I+GN+QQ+T EVVYDV
Sbjct  421  GVTVKLPPQGILFVASTKQVCLAFAANGDDSDVTIYGNVQQRTIEVVYDV  470



>ref|XP_008806169.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=405

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 122/169 (72%), Gaps = 1/169 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + G+LT G G  + +++TP  T     SFYF+D+ AI VGGKQL ISP VF ++GT++DS
Sbjct  225  STGYLTLGSGPLSNIQFTPMQTVSDSPSFYFLDLVAIQVGGKQLQISPTVFSNAGTLLDS  284

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVI+RLPP+AY+ALR AF Q M++Y  APALSILDTCYD + Y TVSVP ++ +  GG 
Sbjct  285  GTVISRLPPSAYAALRLAFHQQMTRYKMAPALSILDTCYDFTGYDTVSVPTVALMFGGGT  344

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            T+++   GIL     SQ CLAFA NGDA D GI GN QQ+ F VVYD+A
Sbjct  345  TLNVDFSGILYVPNVSQACLAFAPNGDAKDFGIIGNAQQKRFNVVYDIA  393



>gb|KCW63732.1| hypothetical protein EUGRSUZ_G01378, partial [Eucalyptus grandis]
Length=395

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 122/169 (72%), Gaps = 3/169 (2%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            GHLTFGK G A   V +TP +T  Q + FY I +  I+V G +LSI   VF S G IIDS
Sbjct  215  GHLTFGKDGGASNSVSFTPLSTVPQSSQFYGISIVGISVEGNRLSIPSTVFSSGGAIIDS  274

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVI+RLPP AYSALR+AFR+ M+ Y  APALSILDTCYD SK +TV+VP I+F   GG 
Sbjct  275  GTVISRLPPTAYSALRTAFRKAMANYTTAPALSILDTCYDFSKESTVTVPTITFSFAGGA  334

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             ++L   GI     ASQVCLAFA NG  +D+GI+GN+QQ+TFEVVYDVA
Sbjct  335  DINLDHNGIFYVAKASQVCLAFAANGADTDLGIYGNVQQKTFEVVYDVA  383



>gb|KJB55135.1| hypothetical protein B456_009G064900 [Gossypium raimondii]
Length=485

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 125/168 (74%), Gaps = 2/168 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G L+FG GG +  VK+T   T  QGASFY ID+  I+VGGK+L IS  VF + G IID
Sbjct  304  STGFLSFGYGGVSKFVKFTTLTTLSQGASFYGIDIVGISVGGKKLPISASVFTAGGAIID  363

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AY+AL S FR+ MS+YP+A  LSILDTCYD +K+++VSVPKIS   +GG
Sbjct  364  SGTVITRLPPTAYTALSSEFRKLMSRYPKAQPLSILDTCYDFTKFSSVSVPKISIFFSGG  423

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
            V + +   GIL  N  SQVCLAFAGN D ++VGIFGN QQ+T +VVYD
Sbjct  424  VEVPIAAKGILYVNAISQVCLAFAGNTDDTEVGIFGNTQQKTLQVVYD  471



>ref|XP_002515387.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
 gb|EEF46836.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
Length=463

 Score =   193 bits (491),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 120/168 (71%), Gaps = 1/168 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            + G L+FG   +   K+TP ++   +SFY +D+  I VGG++L+I   VF ++GTIIDSG
Sbjct  285  STGFLSFGSSQSKSAKFTPLSSGP-SSFYNLDLTGITVGGQKLAIPLSVFSTAGTIIDSG  343

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TV+TRLPPAAYSALRSAFR+ M+ YP    LSILDTCYD SKY T+ VPKI    +GGV 
Sbjct  344  TVVTRLPPAAYSALRSAFRKAMASYPMGKPLSILDTCYDFSKYKTIKVPKIVISFSGGVD  403

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +D+   GI + NG  QVCLAFAGN  A D  IFGN QQ+ FEVVYDV+
Sbjct  404  VDVDQAGIFVANGLKQVCLAFAGNTGARDTAIFGNTQQRNFEVVYDVS  451



>ref|XP_008783095.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=379

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFG-KGGAAPVKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+LTFG    ++ VK+TP  T+    +FY++D+ AI VGG++LSISP VF   GTI+D
Sbjct  199  STGYLTFGGSSTSSNVKFTPMLTNPSMPTFYYLDLVAIHVGGRRLSISPTVFSKVGTIMD  258

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AYS+LRSAFR+ MS Y  A ALSILDTCYDL+ Y+ V +PK++    GG
Sbjct  259  SGTVITRLPPVAYSSLRSAFRRLMSCYRSAQALSILDTCYDLTGYSKVRIPKVALQFGGG  318

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +  +L   GIL    ASQ CLAFAGN DA D GI GN+QQ+ F VVYDVA
Sbjct  319  IATNLDTSGILYLANASQACLAFAGNSDAGDSGIIGNMQQKKFNVVYDVA  368



>ref|XP_008357233.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=600

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 121/169 (72%), Gaps = 5/169 (3%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFA--TDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            G+L FGKGG +   VK+TP    +D G SFY ++V  I+VGGK+L IS  VF SSGTIID
Sbjct  420  GYLRFGKGGRSSKGVKFTPLVDVSDSG-SFYGLNVVGISVGGKKLXISGEVFSSSGTIID  478

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRL   AY ALR AFRQ M  Y  APALSILDTCYD S   T + PKISF   GG
Sbjct  479  SGTVITRLQATAYRALRDAFRQQMKSYTSAPALSILDTCYDFSNVKTXTYPKISFAFGGG  538

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            +T+DL   GI+    A QVCLAFAGNGD SDVGIFGN+QQ+  +VVYDV
Sbjct  539  MTLDLDETGIMYVASADQVCLAFAGNGDDSDVGIFGNVQQKRLQVVYDV  587



>dbj|BAF01928.1| nucleoid DNA-binding protein cnd41 - like protein [Arabidopsis 
thaliana]
Length=183

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 119/167 (71%), Gaps = 2/167 (1%)
 Frame = -3

Query  718  NGHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
             GHLTFG  G +  VK+TP +T   G SFY +++ AI VGG++L I   VF + G +IDS
Sbjct  3    TGHLTFGSAGISRSVKFTPISTITDGTSFYGLNIVAITVGGQKLPIPSTVFSTPGALIDS  62

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AY+ALRS+F+  MSKYP    +SILDTC+DLS + TV++PK++F  +GG 
Sbjct  63   GTVITRLPPKAYAALRSSFKAKMSKYPTTSGVSILDTCFDLSGFKTVTIPKVAFSFSGGA  122

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
             ++L   GI      SQVCLAFAGN D S+  IFGN+QQQT EVVYD
Sbjct  123  VVELGSKGIFYVFKISQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYD  169



>ref|XP_008220632.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Prunus mume]
Length=497

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 119/161 (74%), Gaps = 3/161 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP--VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + G+L+FGKGG +   VK+T  +T  QG SFY ++V  I VGG +L+IS  VF SSGTII
Sbjct  319  STGYLSFGKGGGSSNAVKFTGLSTVSQGDSFYGLNVVGINVGGTKLAISASVFSSSGTII  378

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGTVITRLPP AYSAL++AFRQ M  YP   ALSILDTCYD S + TVS PKISFV + 
Sbjct  379  DSGTVITRLPPTAYSALKAAFRQRMKSYPLTQALSILDTCYDFSSFKTVSYPKISFVFDD  438

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQ  248
            G+T +L   GIL    A QVCLAFAGNGD SD+GIFGN+Q 
Sbjct  439  GLTQELDATGILYVGSADQVCLAFAGNGDDSDIGIFGNVQH  479



>emb|CDY40117.1| BnaC02g00130D [Brassica napus]
Length=477

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 124/168 (74%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP +T  +G SFY +D+ AI VGG++L+I+P VF + G +IDSG
Sbjct  298  GHLTFGTAGISRSVKFTPISTITEGTSFYGLDIVAITVGGQKLAIAPAVFSTPGALIDSG  357

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+AL+ AF+  MS+YP A  +SILDTC+DLS   TV++PK++F  +GG  
Sbjct  358  TVITRLPPKAYAALKDAFKAKMSQYPSASGVSILDTCFDLSGLKTVTIPKVAFSFSGGAV  417

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L   G+L     SQVCLAFAGN D ++  IFGN+QQQT EVVYD A
Sbjct  418  VELGSTGVLYAFKMSQVCLAFAGNSDDTNAAIFGNVQQQTLEVVYDGA  465



>ref|XP_007226774.1| hypothetical protein PRUPE_ppa018129mg [Prunus persica]
 gb|EMJ27973.1| hypothetical protein PRUPE_ppa018129mg [Prunus persica]
Length=461

 Score =   191 bits (486),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 126/174 (72%), Gaps = 7/174 (4%)
 Frame = -3

Query  721  ANGHLTFG--KGGAAP--VKYTPFAT---DQGASFYFIDVQAIAVGGKQLSISPVVFKSS  563
            + G L+FG  K G A   VK+T  AT    + +S Y I++  I VGG++L IS  VFK+S
Sbjct  275  STGFLSFGREKRGRASKGVKFTRLATLPQKEYSSLYGINLVGITVGGRKLPISTSVFKTS  334

Query  562  GTIIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISF  383
            GTIIDSGTVITRLPP AYSALR+AF+QGM  YP+APA+SILDTCYD S Y TV++PKI+ 
Sbjct  335  GTIIDSGTVITRLPPQAYSALRAAFQQGMKSYPRAPAISILDTCYDFSSYETVTIPKIAI  394

Query  382  VLNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
               GG+T+DL   GI+    ASQ CLAFA N + SD+ +FGN+QQ  FEVVYDV
Sbjct  395  SFKGGLTLDLDGTGIIYPVTASQACLAFAANKNDSDIAVFGNVQQLKFEVVYDV  448



>ref|XP_009359073.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 2-like [Pyrus x bretschneideri]
Length=497

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 121/169 (72%), Gaps = 5/169 (3%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFA--TDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            G+L FGKGG +   VK+TP    +D G SFY ++V  I+VGGK+L IS  VF SSGTIID
Sbjct  317  GYLRFGKGGQSSKGVKFTPLVDVSDDG-SFYGLNVVGISVGGKKLPISGQVFSSSGTIID  375

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRL   AY ALR AFRQ M  Y  APALSILDTCYD S   T + PKISF   GG
Sbjct  376  SGTVITRLQATAYRALRDAFRQRMKSYTSAPALSILDTCYDFSNVKTPTYPKISFAFGGG  435

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            +T+DL   GI+    A+QVCLAFAGN D SDVGIFGN+QQ+  +VVYDV
Sbjct  436  MTLDLDETGIMYVASANQVCLAFAGNDDDSDVGIFGNVQQKRLQVVYDV  484



>ref|XP_010068511.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Eucalyptus 
grandis]
Length=413

 Score =   189 bits (481),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 119/170 (70%), Gaps = 4/170 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAA--PVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + GHLTFGK G A   V +TP +T +   FY I +Q IAVGG +LSI   VF S G IID
Sbjct  234  STGHLTFGKDGGAVSSVSFTPLSTVR--EFYGISIQGIAVGGNRLSIPSTVFSSGGAIID  291

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AYSALR+AFR  M+ Y  APA S+ DTCYD SK +T++VP I+F   GG
Sbjct  292  SGTVITRLPPTAYSALRTAFRSAMANYTMAPAFSLFDTCYDFSKESTITVPLITFSFAGG  351

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            V  DL   GI     AS+VCLAFA N   S++GI+GN QQ+TFEVVYDVA
Sbjct  352  VDADLDPNGIFFIVNASEVCLAFAPNRADSNLGIYGNTQQKTFEVVYDVA  401



>ref|XP_008452815.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=475

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 124/169 (73%), Gaps = 2/169 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAA-PVKYTPFATDQG-ASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+LTFG GG    +KYTP     G A+FY +D+  I VGG Q+ IS  VF +SG IID
Sbjct  295  STGYLTFGGGGGGGALKYTPITKAHGVANFYGLDIVGIKVGGTQIPISSSVFSTSGAIID  354

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AYSAL+SAF++GM++YP+AP LSILDTCYDLSKY+T+ +PK+  +  G 
Sbjct  355  SGTVITRLPPDAYSALKSAFQKGMARYPKAPELSILDTCYDLSKYSTIQIPKVGIMFKGQ  414

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
              +DL   GI+ G   SQVCLAFAGN D S V I GN+QQ+T +VVYDV
Sbjct  415  EELDLDGTGIMYGASTSQVCLAFAGNQDPSTVAIIGNVQQKTLQVVYDV  463



>ref|XP_010068510.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=281

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 127/183 (69%), Gaps = 3/183 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAA--PVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + GHLTFGK G A   V +TP +T  Q + FY I +Q IAVGGK+LSI   VF S G II
Sbjct  99   STGHLTFGKDGRAVSSVSFTPLSTVRQSSQFYGISIQGIAVGGKRLSIPSTVFSSGGAII  158

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGTVI+RLPP AY AL +AFR  M  Y  APAL +LDTCYD SK +T++VP I+F   G
Sbjct  159  DSGTVISRLPPTAYGALTTAFRNAMKNYTMAPALPLLDTCYDFSKESTITVPLITFSFAG  218

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigag  191
            GV  DL   GI     AS+VCLAFA N   S++ I+GN QQ+TFEVVYDVAGGKLG  + 
Sbjct  219  GVDADLDPNGIFFIVNASEVCLAFAPNQADSNLTIYGNTQQKTFEVVYDVAGGKLGFSSN  278

Query  190  GCS  182
            GCS
Sbjct  279  GCS  281



>gb|KFK25359.1| hypothetical protein AALP_AA8G103100 [Arabis alpina]
Length=475

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 123/168 (73%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG    ++ VK+TP +T   G SFY +D+  I VGG++L+IS  VF + G +IDSG
Sbjct  296  GHLTFGSAAISSSVKFTPISTITDGTSFYGLDIVGITVGGRKLAISSTVFSTPGALIDSG  355

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+ALRSAF+  MSKYP   A+SILDTC++LS Y TV++PK++F  +GG  
Sbjct  356  TVITRLPPKAYAALRSAFKAQMSKYPSTSAVSILDTCFNLSGYKTVTIPKVAFSFSGGAV  415

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L   GIL     SQVCLAFAGN D ++  IFGN+QQQT EVVYD A
Sbjct  416  VELGSKGILYPFKMSQVCLAFAGNSDDNNAAIFGNVQQQTLEVVYDGA  463



>ref|XP_008779510.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=250

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 119/167 (71%), Gaps = 1/167 (1%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            G+LT G    + V++TP  T     SFYF+D+ AI VGGKQL IS  VF ++GT++DSGT
Sbjct  72   GYLTLGSRRLSNVQFTPLRTFSNLPSFYFLDLVAIKVGGKQLPISSKVFSTAGTVLDSGT  131

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VI+RLPP+AY+AL+SAFR+ M++Y   PALSILDTCYD + Y TV VP ++ +  GG T+
Sbjct  132  VISRLPPSAYAALQSAFRKQMTRYKMVPALSILDTCYDFTGYDTVWVPTVALMFGGGTTL  191

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++   GIL     SQ CLAFA NGDA D GI GN QQ+ F VVYD+A
Sbjct  192  NVDFSGILYVPNVSQACLAFAPNGDAKDFGIIGNAQQKRFNVVYDIA  238



>ref|XP_010913225.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=463

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 129/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPF-ATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            ++G+L  G G  + V +TP  A+    SFYF+D+ AI VGGKQL IS  VF ++GT++DS
Sbjct  283  SSGYLKLGGGAPSNVNFTPMRASSSQPSFYFLDLVAIEVGGKQLPISQTVFSNAGTLLDS  342

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP+AY+ALRS FRQ M+ Y  AP  SILDTCYD +   TVSVP ++ V  GG 
Sbjct  343  GTVITRLPPSAYAALRSRFRQLMTMYKMAPPQSILDTCYDFTGNDTVSVPTVALVFGGGA  402

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagGC  185
            T+++   GIL     SQ CLAFAGN DASDVGI GN+QQ+ F+VVYD+   ++G GA GC
Sbjct  403  TLNVDFTGILYVFNMSQACLAFAGNDDASDVGIIGNVQQKRFDVVYDITNSRIGFGANGC  462

Query  184  S  182
            S
Sbjct  463  S  463



>emb|CDX85746.1| BnaA02g00670D [Brassica napus]
Length=477

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 123/168 (73%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP +T  +G SFY +D+  I VGG++L+I+P VF + G +IDSG
Sbjct  298  GHLTFGTAGISRSVKFTPISTITEGTSFYGLDIVGITVGGQKLAIAPTVFSTPGALIDSG  357

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+AL+ AF+  MS+YP A  +SILDTC+DLS   TV++PK++F  +GG  
Sbjct  358  TVITRLPPKAYAALKDAFKAKMSQYPSASGVSILDTCFDLSGLKTVTIPKVAFSFSGGAV  417

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L   G+L     SQVCLAFAGN D ++  IFGN+QQQT EVVYD A
Sbjct  418  VELGSTGVLYAFKMSQVCLAFAGNSDDTNAAIFGNVQQQTLEVVYDGA  465



>ref|XP_009125277.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brassica 
rapa]
Length=477

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 123/168 (73%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP +T  +G SFY +D+  I VGG++L+I+P VF + G +IDSG
Sbjct  298  GHLTFGTAGISRSVKFTPISTITEGTSFYGLDIVGITVGGQKLAIAPTVFSTPGALIDSG  357

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+AL+ AF+  MS+YP A  +SILDTC+DLS   TV++PK++F  +GG  
Sbjct  358  TVITRLPPKAYAALKDAFKAKMSQYPSASGVSILDTCFDLSGLKTVTIPKVAFSFSGGAV  417

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L   G+L     SQVCLAFAGN D ++  IFGN+QQQT EVVYD A
Sbjct  418  VELGSTGVLYAFKMSQVCLAFAGNSDDTNAAIFGNVQQQTLEVVYDGA  465



>gb|KCW63888.1| hypothetical protein EUGRSUZ_G01561 [Eucalyptus grandis]
Length=449

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 119/170 (70%), Gaps = 4/170 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAA--PVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + GHLTFGK G A   V +TP +T +   FY I +Q IAVGG +LSI   VF S G IID
Sbjct  270  STGHLTFGKDGGAVSSVSFTPLSTVR--EFYGISIQGIAVGGNRLSIPSTVFSSGGAIID  327

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AYSALR+AFR  M+ Y  APA S+ DTCYD SK +T++VP I+F   GG
Sbjct  328  SGTVITRLPPTAYSALRTAFRSAMANYTMAPAFSLFDTCYDFSKESTITVPLITFSFAGG  387

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            V  DL   GI     AS+VCLAFA N   S++GI+GN QQ+TFEVVYDVA
Sbjct  388  VDADLDPNGIFFIVNASEVCLAFAPNRADSNLGIYGNTQQKTFEVVYDVA  437



>ref|XP_009391894.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=476

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 117/155 (75%), Gaps = 1/155 (1%)
 Frame = -3

Query  679  VKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSA  503
            VK+TP  TD  + SFYF+D+ AI+VGG++L IS  VF ++GTIIDSGTVI+RLPP AYSA
Sbjct  311  VKFTPMLTDASSPSFYFLDLVAISVGGQRLPISATVFSNAGTIIDSGTVISRLPPTAYSA  370

Query  502  LRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNG  323
            LRSAFRQGMS Y  A   S+LDTCYD + YTTVS+P ++   + GVTM+L   GIL    
Sbjct  371  LRSAFRQGMSSYKAAAPDSLLDTCYDFTGYTTVSIPTVALEFSDGVTMNLDFGGILYALS  430

Query  322  ASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             SQVCLAFA N D  D+GI GN+QQ+TF VVYDV+
Sbjct  431  QSQVCLAFAANSDDGDLGIVGNVQQRTFTVVYDVS  465



>ref|XP_010424699.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=282

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP +T   G+SFY +D+  I VGG++L+I   VF + G +IDSG
Sbjct  103  GHLTFGTAGISRSVKFTPISTITDGSSFYGLDIVGITVGGQKLAIPSTVFSTPGALIDSG  162

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+ALRS F+  MSKYP    +SILDTC+DLS + TV++PK++F  +GG  
Sbjct  163  TVITRLPPKAYAALRSEFKAKMSKYPTTSGVSILDTCFDLSGFKTVTIPKVAFSFSGGAV  222

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L   G+      SQVCLAFAGN D S+  IFGN+QQQT EVVYD A
Sbjct  223  VELGSKGLFYAFKMSQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGA  270



>gb|KHG10166.1| Asparticase nepenthesin-2 [Gossypium arboreum]
Length=478

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 122/166 (73%), Gaps = 2/166 (1%)
 Frame = -3

Query  715  GHLTFGKGGAAP-VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            G L+FG GG +  VK+T   T  QG SFY ID+  I+VGGK+L IS  +F + G+IIDSG
Sbjct  299  GFLSFGYGGVSKFVKFTTLTTISQGTSFYGIDIVGISVGGKKLPISASLFTAGGSIIDSG  358

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+AL S FR+ MS+YP+A  LSILDTCYD +K+++VSVP IS    GGV 
Sbjct  359  TVITRLPPTAYTALSSEFRKLMSQYPKAQPLSILDTCYDFTKFSSVSVPMISIFFRGGVE  418

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
            + +   GIL  N  SQVCLAFAGN D +DVGIFGN QQ+T +VVYD
Sbjct  419  VPIAAKGILYVNTISQVCLAFAGNNDDTDVGIFGNTQQKTLQVVYD  464



>ref|XP_010065986.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
 gb|KCW63735.1| hypothetical protein EUGRSUZ_G01382 [Eucalyptus grandis]
Length=473

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAA--PVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + GHLTFGK G A   V +TP +T  + + FY I +Q IAVGG +LSI   VF S G II
Sbjct  291  STGHLTFGKDGGAVSSVSFTPLSTVPESSEFYGISIQGIAVGGNRLSIPSTVFSSGGAII  350

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGTVITRLPP AYSALR+AFR  M+ Y  APAL +LDTCYD SK +T++ P I+F   G
Sbjct  351  DSGTVITRLPPTAYSALRTAFRNAMANYTMAPALPLLDTCYDFSKESTITFPLITFSFAG  410

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            GV  DL   GI      S+VCLAFA N   SD+GI+GN QQ+TFEV YDVA
Sbjct  411  GVDADLDFYGIFYILNPSEVCLAFAPNRADSDLGIYGNTQQRTFEVAYDVA  461



>gb|KEH33912.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=486

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 123/166 (74%), Gaps = 1/166 (1%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GHLTFG      VKYT F+T  +  SFY +D+  I+VGG +L IS  +F S G IIDSGT
Sbjct  308  GHLTFGASDNKYVKYTSFSTVSRSNSFYGLDIAGISVGGTKLPISSSIFSSGGAIIDSGT  367

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLPP AY++LR +F++GM+KYP APA+SILDTCYDLS Y  VS+PKISF L GGVT+
Sbjct  368  VITRLPPTAYASLRDSFKKGMTKYPVAPAVSILDTCYDLSGYKIVSIPKISFFLGGGVTV  427

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            ++   GIL      Q CLAFA NGD SD+ IFGN+QQ+T EVVYDV
Sbjct  428  EIAAPGILYVASLKQACLAFAPNGDDSDITIFGNVQQRTLEVVYDV  473



>ref|XP_007223364.1| hypothetical protein PRUPE_ppa005616mg [Prunus persica]
 gb|EMJ24563.1| hypothetical protein PRUPE_ppa005616mg [Prunus persica]
Length=451

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 121/172 (70%), Gaps = 4/172 (2%)
 Frame = -3

Query  721  ANGHLTFGKGG--AAPVKYTPFAT--DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTI  554
            + GHLTFG GG  A  VK+T   T  ++ +SFY + +  I+VGG QL ++  VF SSGTI
Sbjct  268  STGHLTFGNGGGSANGVKFTKLTTLSERESSFYGLGLTGISVGGCQLPVASSVFSSSGTI  327

Query  553  IDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLN  374
            IDSGTVITRLP  AY+ALR AFR+GM  Y    + S+LDTCY++S Y TVS P I+F   
Sbjct  328  IDSGTVITRLPATAYTALRDAFREGMKNYTMTMSFSLLDTCYNVSGYETVSFPDIAFGFG  387

Query  373  GGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             GVT+DL   GILL    SQVCLAFAGN D SD+GI GN+QQ+  EVVYDVA
Sbjct  388  DGVTVDLDAAGILLAVSDSQVCLAFAGNKDDSDIGIIGNVQQKRLEVVYDVA  439



>ref|XP_006399574.1| hypothetical protein EUTSA_v10013429mg [Eutrema salsugineum]
 gb|ESQ41027.1| hypothetical protein EUTSA_v10013429mg [Eutrema salsugineum]
Length=475

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 122/168 (73%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VKYTP +T   G SFY +D+  I VGG++L+I   VF + G +IDSG
Sbjct  296  GHLTFGSAGISRSVKYTPISTITDGTSFYGLDIVGITVGGQKLAIPSTVFSTPGALIDSG  355

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVI+RLPP AY+ALRSAF+  MSKYP   A+SILDTC+DL+ + TV++PK++F  +GG  
Sbjct  356  TVISRLPPKAYAALRSAFKAKMSKYPSTSAVSILDTCFDLTGFKTVTIPKVAFSFSGGAV  415

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L   GIL     SQVCLAFAGN D ++  IFGN+QQQT EVVYD A
Sbjct  416  VELGSKGILYPFKVSQVCLAFAGNSDDNNAAIFGNVQQQTLEVVYDGA  463



>ref|XP_004513891.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=478

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 117/166 (70%), Gaps = 0/166 (0%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTV  536
            GHLTFG      VKYTPF+T    +FY +D+  I V G +LSIS   F S G IIDSGTV
Sbjct  301  GHLTFGATSNNYVKYTPFSTAGSNTFYGLDIVGITVAGTKLSISSSTFSSGGAIIDSGTV  360

Query  535  ITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMD  356
            ITRLPP AYS LR AF++GMSKYP A ALS+LDTCYDLS    V +PKISF   G V++D
Sbjct  361  ITRLPPTAYSVLRDAFKKGMSKYPPASALSLLDTCYDLSGSEMVYIPKISFAFGGDVSVD  420

Query  355  LPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            LP  GIL      QVCLAFA N D SD+ IFGN+QQ+T EVVYDV+
Sbjct  421  LPASGILYVVTLKQVCLAFAANHDDSDLTIFGNVQQRTLEVVYDVS  466



>ref|XP_010491758.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010491759.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Camelina sativa]
Length=494

 Score =   189 bits (480),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP +T   G+SFY +D+  I VGG++L+I   VF + G +IDSG
Sbjct  315  GHLTFGTAGISRSVKFTPISTITDGSSFYGLDIVGITVGGQKLAIPSTVFSTPGALIDSG  374

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+ALRS F+  MSKYP A  +SILDTC+DLS + TV++PK++F  +GG  
Sbjct  375  TVITRLPPKAYAALRSEFKAKMSKYPTASGVSILDTCFDLSGFKTVTIPKVAFSFSGGAV  434

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L   GI      SQVCLAFAGN D S+  IFGN+QQQT EVVYD A
Sbjct  435  VELGSKGIFYAFKMSQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGA  482



>ref|XP_010066088.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
 gb|KCW63887.1| hypothetical protein EUGRSUZ_G01559 [Eucalyptus grandis]
Length=473

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 119/171 (70%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAA--PVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + GHLTFGK G A   V +TP +T  Q + FY I +  I VGG +LSI   VF S G II
Sbjct  291  STGHLTFGKDGGAVSSVSFTPLSTVPQSSQFYGISILGITVGGNRLSIPSTVFSSGGAII  350

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGTVI+RLPP AYSALR+AFR  M+ Y  APAL ILDTCYD SK +T++VP I+F   G
Sbjct  351  DSGTVISRLPPTAYSALRTAFRSAMANYTMAPALRILDTCYDFSKESTITVPLITFSFAG  410

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            GV  +L   GI     ASQVCLAFA N   S++GI+GN QQ+TFEVVYDVA
Sbjct  411  GVDAELDPNGIFFIVNASQVCLAFAPNRADSNLGIYGNTQQKTFEVVYDVA  461



>ref|XP_008776818.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Phoenix dactylifera]
Length=365

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 126/179 (70%), Gaps = 1/179 (1%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            G+LT G G  + V++TP  T  +  SFYF+D+ AI VGGKQL IS  VF ++GT++DSGT
Sbjct  187  GYLTLGSGPLSNVQFTPLRTFSKLPSFYFLDLVAIKVGGKQLPISSKVFSTAGTVLDSGT  246

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VI+RLPP+AY+ALR AFR+ M++Y  AP LSILDTCYD + Y TV+VP ++ V  GG T+
Sbjct  247  VISRLPPSAYAALRLAFRKQMTRYKMAPRLSILDTCYDFTGYDTVTVPTVALVFGGGTTL  306

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagGCS  182
            ++   GIL     SQ CLAFA NGD  D GI GN QQ+ F VVYD+   ++G GA  CS
Sbjct  307  NVDFSGILYVPSVSQACLAFAPNGDPRDFGIIGNAQQKRFNVVYDIPNMRIGFGANACS  365



>ref|XP_010453111.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=477

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP +T   G+SFY +D+  I VGG++L+I   VF + G +IDSG
Sbjct  298  GHLTFGTAGISRSVKFTPISTITDGSSFYGLDIVGITVGGQKLAIPSTVFSTPGALIDSG  357

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+ALRS F+  MSKYP    +SILDTC+DLS + TV++PK++F  +GG  
Sbjct  358  TVITRLPPKAYAALRSEFKAKMSKYPTTSGVSILDTCFDLSGFKTVTIPKVAFSFSGGAV  417

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L   GI      SQVCLAFAGN D S+  IFGN+QQQT EVVYD A
Sbjct  418  VELGSKGIFYAFKMSQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGA  465



>ref|XP_010928159.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=470

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = -3

Query  715  GHLTFGKG---GAAPVKYTP-FATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            G+LTFG G     + VK+TP  +     SFYF+ + AI VGG QL ISP VF + GT++D
Sbjct  290  GYLTFGGGGGGATSKVKFTPMLSVSNMPSFYFVSLLAIRVGGTQLRISPRVFSAGGTLLD  349

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP+AY+ALRS FRQ M KY  APALSILDTCYD + Y TV VP +  V  GG
Sbjct  350  SGTVITRLPPSAYAALRSRFRQLMRKYKTAPALSILDTCYDFTGYETVQVPTVQLVFGGG  409

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             ++ + L GIL     SQ CLAFAGNGD  DV I GN+QQ+ F VVYD+A
Sbjct  410  ASLSVDLSGILYVAKMSQACLAFAGNGDVGDVTIIGNVQQRRFNVVYDIA  459



>ref|XP_007011661.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY29280.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=503

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 120/171 (70%), Gaps = 7/171 (4%)
 Frame = -3

Query  715  GHLTFGK----GGAAPVKYTPFATD---QGASFYFIDVQAIAVGGKQLSISPVVFKSSGT  557
            G LTFGK    G +  VK+TP +T    Q +SFY +D+  I+VGG++LSI   VF ++G 
Sbjct  319  GFLTFGKDSGKGSSKSVKFTPLSTAAGLQDSSFYGLDITGISVGGRRLSIRASVFTAAGA  378

Query  556  IIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVL  377
            IIDSGTVITRLPP AY+ALRSAFRQ MS+YP   ALSILDTCYD S Y +V+VPKIS   
Sbjct  379  IIDSGTVITRLPPTAYAALRSAFRQRMSQYPMTDALSILDTCYDFSNYKSVAVPKISLFF  438

Query  376  NGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
            +G V + +  VG +     SQVCLAFA N D  +V IFGN QQ+T +VV+D
Sbjct  439  SGNVEVKITPVGTMYSETVSQVCLAFAPNDDDGEVAIFGNTQQKTVQVVHD  489



>gb|KCW63886.1| hypothetical protein EUGRSUZ_G01558 [Eucalyptus grandis]
Length=446

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAA--PVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + GHLTFGK G A   V +TP +T  Q + FY I +Q IAVGGK+LSI   VF S G II
Sbjct  264  STGHLTFGKDGRAVSSVSFTPLSTVRQSSQFYGISIQGIAVGGKRLSIPSTVFSSGGAII  323

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGTVI+RLPP AY AL +AFR  M  Y  APAL +LDTCYD SK +T++VP I+F   G
Sbjct  324  DSGTVISRLPPTAYGALTTAFRNAMKNYTMAPALPLLDTCYDFSKESTITVPLITFSFAG  383

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            GV  DL   GI     AS+VCLAFA N   S++ I+GN QQ+TFEVVYDVA
Sbjct  384  GVDADLDPNGIFFIVNASEVCLAFAPNQADSNLTIYGNTQQKTFEVVYDVA  434



>ref|XP_007224537.1| hypothetical protein PRUPE_ppa024411mg [Prunus persica]
 gb|EMJ25736.1| hypothetical protein PRUPE_ppa024411mg [Prunus persica]
Length=489

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 116/170 (68%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + GHLTFG GG+A  VK+T   T  Q  SFY + +  I VGG QLSI P VF SSGTIID
Sbjct  308  STGHLTFGDGGSANGVKFTKLITSSQSESFYGLGLAGIKVGGSQLSIEPSVFSSSGTIID  367

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLP  AY+ALR AFR+ M  Y    +  +LDTCYD S   TV+ PKI+F+   G
Sbjct  368  SGTVITRLPATAYAALRGAFREAMKNYTLTESFLLLDTCYDFSGLNTVTYPKIAFMFGDG  427

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +T+D    GILL    SQVCLAFAGN D SD GI GN+QQ+  EVVYDVA
Sbjct  428  LTVDSDATGILLLISPSQVCLAFAGNEDDSDFGIIGNVQQKRLEVVYDVA  477



>ref|XP_006287637.1| hypothetical protein CARUB_v10000848mg [Capsella rubella]
 gb|EOA20535.1| hypothetical protein CARUB_v10000848mg [Capsella rubella]
Length=481

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP +T   G SFY +++  I VGG++L+I   VF + G +IDSG
Sbjct  302  GHLTFGSAGISRSVKFTPISTISDGNSFYGLNIVGITVGGQKLAIPSTVFSTPGALIDSG  361

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+ALRS+F+  MSKYP A  +SILDTC+DLS + TV++PK++F  +GG  
Sbjct  362  TVITRLPPKAYAALRSSFKAQMSKYPTASGVSILDTCFDLSGFKTVTIPKVAFSFSGGAV  421

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L   GI      SQVCLAFAGN D S+  IFGN+QQQT EVVYD A
Sbjct  422  VELGSKGIFYAFKISQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGA  469



>ref|XP_010422809.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=494

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP +T   G+SFY +D+  I VGG++L+I   VF + G +IDSG
Sbjct  315  GHLTFGTAGISRSVKFTPISTITDGSSFYGLDIVGITVGGQKLAIPSTVFSTPGALIDSG  374

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+ALRS F+  MSKYP    +SILDTC+DLS + TV++PK++F  +GG  
Sbjct  375  TVITRLPPKAYAALRSEFKAKMSKYPTTSGVSILDTCFDLSGFKTVTIPKVAFSFSGGAV  434

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L   G+      SQVCLAFAGN D S+  IFGN+QQQT EVVYD A
Sbjct  435  VELGSKGLFYAFKMSQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGA  482



>ref|XP_009122022.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brassica 
rapa]
Length=493

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGGAA-PVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP +T   G SFY +D+  I+VGG++L+I P VF + G +IDSG
Sbjct  314  GHLTFGSAGVSRSVKFTPISTITDGTSFYGLDIVGISVGGQKLAIPPTVFSTPGALIDSG  373

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVI+RLPP AY+ALR AF+  MS+Y    A+SILDTCYDL+   TV++P +SF  NGG  
Sbjct  374  TVISRLPPKAYAALRGAFKAKMSQYKNTSAVSILDTCYDLTGLKTVTIPTVSFYFNGGAV  433

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            + L   G+L     SQVCLAFAGN D ++  IFGN+QQQT EVVYD A
Sbjct  434  VQLGSKGVLYAFKMSQVCLAFAGNSDDNNAAIFGNVQQQTLEVVYDGA  481



>ref|XP_002873476.1| hypothetical protein ARALYDRAFT_325615 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49735.1| hypothetical protein ARALYDRAFT_325615 [Arabidopsis lyrata subsp. 
lyrata]
Length=475

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP +T   G SFY +++ AI VGG++L I   VF + G +IDSG
Sbjct  296  GHLTFGSAGISRSVKFTPISTITDGTSFYGLNIVAITVGGQKLPIPSTVFSTPGALIDSG  355

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+ALRS+F+  MSKYP    +SILDTC+DLS + TV++PK++F  +GG  
Sbjct  356  TVITRLPPKAYAALRSSFKAKMSKYPTTSGVSILDTCFDLSGFKTVTIPKVAFSFSGGAV  415

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L   GI      SQVCLAFAGN D S+  IFGN+QQQT EVVYD A
Sbjct  416  VELGSKGIFYAFKISQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGA  463



>ref|XP_008220628.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Prunus 
mume]
Length=503

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 119/169 (70%), Gaps = 2/169 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + GHLTFG GG+A  V++T   T  Q  SFY + +  I VGG+QLSI+P VF SSGTIID
Sbjct  322  STGHLTFGHGGSANGVQFTKLITSSQSESFYGLGLAGIKVGGRQLSIAPSVFSSSGTIID  381

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLP  AY++LR AFR+ M  Y    + S+LDTCYD+S   T S P+I+FV   G
Sbjct  382  SGTVITRLPATAYASLRGAFREAMKNYTLTKSFSLLDTCYDISGLNTFSYPEIAFVFGDG  441

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            +T+DL   GIL+    SQVCLAFAGN D SD GI GN+QQ+  EVVYDV
Sbjct  442  LTVDLDATGILVLISPSQVCLAFAGNMDDSDFGIIGNVQQKRLEVVYDV  490



>emb|CAB96832.1| nucleoid DNA-binding protein cnd41-like protein [Arabidopsis 
thaliana]
Length=446

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP +T   G SFY +++ AI VGG++L I   VF + G +IDSG
Sbjct  267  GHLTFGSAGISRSVKFTPISTITDGTSFYGLNIVAITVGGQKLPIPSTVFSTPGALIDSG  326

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+ALRS+F+  MSKYP    +SILDTC+DLS + TV++PK++F  +GG  
Sbjct  327  TVITRLPPKAYAALRSSFKAKMSKYPTTSGVSILDTCFDLSGFKTVTIPKVAFSFSGGAV  386

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L   GI      SQVCLAFAGN D S+  IFGN+QQQT EVVYD A
Sbjct  387  VELGSKGIFYVFKISQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGA  434



>emb|CDX97058.1| BnaC09g45670D [Brassica napus]
Length=491

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGGAA-PVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP +T   G SFY +D+  I+VGG++L+I P VF + G +IDSG
Sbjct  312  GHLTFGSAGVSRSVKFTPISTITDGTSFYGLDIVGISVGGQKLAIPPTVFSTPGALIDSG  371

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVI+RLPP AY+ALR AF+  MS+Y  A  +SILDTC+DL+ + TV++P +SF  NGG  
Sbjct  372  TVISRLPPKAYAALRGAFKAKMSQYKNASGVSILDTCFDLTGFKTVTIPTVSFYFNGGAV  431

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L   G+L     S+VCLAFAGN D ++  IFGN+QQQT EVVYD A
Sbjct  432  VELGSKGVLYAFKMSKVCLAFAGNSDDNNAAIFGNVQQQTLEVVYDGA  479



>ref|XP_010258628.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=493

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 122/173 (71%), Gaps = 5/173 (3%)
 Frame = -3

Query  721  ANGHLTFGKGG----AAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGT  557
            + G+L FG+      ++ +++T   T+ Q  SFYF+++ AI+VGG++L +S   F +SGT
Sbjct  309  STGYLAFGREAISSVSSAIQFTSLLTNSQYPSFYFLELTAISVGGRRLPVSASDFANSGT  368

Query  556  IIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVL  377
            IIDSGTVITRLPP+ YSALRSAFRQ MSKY  A ALSILDTCYDL++Y T+ +PKI    
Sbjct  369  IIDSGTVITRLPPSVYSALRSAFRQLMSKYRSAEALSILDTCYDLTRYRTIRIPKIGLHF  428

Query  376  NGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             G + +D+   GIL     SQVCLAFAGN D  DV I GN QQQ  +V+YD+A
Sbjct  429  RGDIVLDVHPNGILYSGNVSQVCLAFAGNDDNGDVTILGNKQQQNLKVIYDLA  481



>ref|XP_007223563.1| hypothetical protein PRUPE_ppa014553mg, partial [Prunus persica]
 gb|EMJ24762.1| hypothetical protein PRUPE_ppa014553mg, partial [Prunus persica]
Length=432

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 126/171 (74%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP--VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + G+L+FGKGG +   VK+T  +T   G SFY ++V  I VGG +L IS  VF SS TII
Sbjct  250  STGYLSFGKGGRSSNAVKFTALSTVPLGHSFYGLNVVGINVGGTKLPISSSVFSSSRTII  309

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGT+ITRLPP AY+AL++AFRQ M  YP   A+SILDTCY+LS + TVS PKISFV +G
Sbjct  310  DSGTLITRLPPTAYNALKAAFRQRMKSYPLTQAVSILDTCYNLSSFKTVSYPKISFVFDG  369

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            G+T +L   GIL G  A QVCLAFAGN D S+VGI GN+QQ+  +VVYDVA
Sbjct  370  GLTQELDATGILYGVSADQVCLAFAGNMDDSEVGIIGNVQQRRLKVVYDVA  420



>ref|XP_008220627.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Prunus 
mume]
Length=502

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 117/173 (68%), Gaps = 5/173 (3%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFAT----DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGT  557
            + GHLTFG GG+   VK+T   T    +  AS Y +D+  I VGG QLSI+P VF SSGT
Sbjct  318  STGHLTFGDGGSPNGVKFTKLITSSQSESAASLYGLDLAGINVGGSQLSIAPSVFSSSGT  377

Query  556  IIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVL  377
            IIDSGTVITRLP  AY+ LR AF++ M  Y      S+LDTCYD S   TVS PKI+FV 
Sbjct  378  IIDSGTVITRLPATAYAVLRGAFQEAMKNYTLTMGYSLLDTCYDFSGLDTVSYPKIAFVF  437

Query  376  NGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
              G+T+DL   GIL+    SQVCLAFAGN D SDVGI GN QQ+  EVVYDVA
Sbjct  438  GDGLTVDLDATGILIPISPSQVCLAFAGNKDDSDVGIIGNFQQRRLEVVYDVA  490



>ref|NP_196638.2| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAL77663.1| AT5g10770/T30N20_40 [Arabidopsis thaliana]
 gb|AAN46758.1| At5g10770/T30N20_40 [Arabidopsis thaliana]
 gb|AED91594.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=474

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP +T   G SFY +++ AI VGG++L I   VF + G +IDSG
Sbjct  295  GHLTFGSAGISRSVKFTPISTITDGTSFYGLNIVAITVGGQKLPIPSTVFSTPGALIDSG  354

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+ALRS+F+  MSKYP    +SILDTC+DLS + TV++PK++F  +GG  
Sbjct  355  TVITRLPPKAYAALRSSFKAKMSKYPTTSGVSILDTCFDLSGFKTVTIPKVAFSFSGGAV  414

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L   GI      SQVCLAFAGN D S+  IFGN+QQQT EVVYD A
Sbjct  415  VELGSKGIFYVFKISQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGA  462



>gb|KJB65924.1| hypothetical protein B456_010G120300 [Gossypium raimondii]
Length=480

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = -3

Query  721  ANGHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G L FG  G +  VK+T  +T   G SFY I + A++VGGK+LSIS  +  + G IID
Sbjct  299  STGFLKFGNDGLSKSVKFTTLSTISGGESFYGITIIAMSVGGKKLSISASILAAGGAIID  358

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AYSALRSAFR+ M++YP A  LSILDTCYD SKY+TVS+PKIS     G
Sbjct  359  SGTVITRLPPTAYSALRSAFRKQMNQYPMAKPLSILDTCYDFSKYSTVSIPKISLFFEKG  418

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
            V + +   GIL  N  SQVCLAFAGN +  DV I+GN QQ+T EVVYD
Sbjct  419  VEVPIDARGILYVNSISQVCLAFAGNTNDFDVLIYGNTQQKTLEVVYD  466



>ref|XP_007226285.1| hypothetical protein PRUPE_ppa019577mg [Prunus persica]
 gb|EMJ27484.1| hypothetical protein PRUPE_ppa019577mg [Prunus persica]
Length=454

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 114/170 (67%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + GHLTFG GG+   VK+T   T  Q  SFY + +  I VGG QLSI+P VF SSGTIID
Sbjct  273  STGHLTFGDGGSPNGVKFTKLITSSQSESFYGLGLAGIKVGGSQLSIAPSVFSSSGTIID  332

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLP  AY+ LR AFR+ M  Y      S+LDTCYD S   TVS PKI+FV   G
Sbjct  333  SGTVITRLPATAYAVLRGAFREAMKNYTLTNGDSLLDTCYDFSGLNTVSYPKIAFVFGDG  392

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +T+DL   GIL     S VCLAFAGN D  DVGI GN+QQ+  EVVYDVA
Sbjct  393  LTVDLDATGILFPISPSHVCLAFAGNKDDRDVGIIGNLQQKRLEVVYDVA  442



>gb|KCW63890.1| hypothetical protein EUGRSUZ_G01565, partial [Eucalyptus grandis]
Length=409

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP--VKYTPFA-TDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + G+LTFGK G AP  V +TP +   Q + FY I +  I+V G  LSI   VF S+G II
Sbjct  227  STGYLTFGKEGRAPSSVSFTPLSKVQQDSEFYGISIVGISVNGIPLSIPSTVFSSAGAII  286

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGT IT+LPP  YSALR+ FR+ M+ Y  APA S +DTCYD SK  TV+VP I+F+  G
Sbjct  287  DSGTTITQLPPTVYSALRTVFRKAMANYTTAPADSTVDTCYDFSKERTVTVPSITFLFAG  346

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            GV +DL   GILL   ASQVCLAF  N   SD+ I+GN+QQ+TFEVVYDVA
Sbjct  347  GVNIDLDRSGILLMVTASQVCLAFTANDADSDLIIYGNVQQRTFEVVYDVA  397



>ref|XP_007224453.1| hypothetical protein PRUPE_ppa022256mg [Prunus persica]
 gb|EMJ25652.1| hypothetical protein PRUPE_ppa022256mg [Prunus persica]
Length=418

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 117/172 (68%), Gaps = 4/172 (2%)
 Frame = -3

Query  721  ANGHLTFGKGG--AAPVKYTPFAT--DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTI  554
            + GHLTFG GG  A  VK+T   T  ++ +SFY + +  I+VGG+QL ++  VF SSGTI
Sbjct  235  STGHLTFGNGGGSANGVKFTKLTTLSERASSFYGLGLTGISVGGRQLPVASSVFSSSGTI  294

Query  553  IDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLN  374
            IDSGTVITRLP  AY+ALR AFR+GM  Y      S+LDTCY+ S   TVS P I+F   
Sbjct  295  IDSGTVITRLPATAYTALRDAFREGMKNYTMTMPFSLLDTCYNFSGNETVSFPDIAFGFA  354

Query  373  GGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             GVT+DL   GILL    SQVCLAFAGN +  D GI GN+QQ+  EVVYDVA
Sbjct  355  DGVTVDLDAAGILLAVSDSQVCLAFAGNKNDRDFGIIGNVQQKRLEVVYDVA  406



>emb|CDX69804.1| BnaA10g21530D [Brassica napus]
Length=476

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 118/168 (70%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGGAA-PVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VK+TP +T   G SFY +D+  I+VGG++L+I P VF + G +IDSG
Sbjct  297  GHLTFGSAGVSRSVKFTPISTITDGTSFYGLDIVGISVGGQKLAIPPTVFSTPGALIDSG  356

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVI+RLPP AY+ALR AF+  MS+Y     +SILDTC+DL+   TV++P +SF  NGG  
Sbjct  357  TVISRLPPKAYAALRGAFKAKMSQYKNTSGVSILDTCFDLTGLKTVTIPTVSFYFNGGAV  416

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            + L   G+L     SQVCLAFAGN D ++  IFGN+QQQT EVVYD A
Sbjct  417  VQLGSKGVLYAFKMSQVCLAFAGNSDDNNAAIFGNVQQQTLEVVYDGA  464



>ref|XP_010066094.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=449

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP--VKYTPFA-TDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + G+LTFGK G AP  V +TP +   Q + FY I +  I+V G  LSI   VF S+G II
Sbjct  267  STGYLTFGKEGRAPSSVSFTPLSKVQQDSEFYGISIVGISVNGIPLSIPSTVFSSAGAII  326

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGT IT+LPP  YSALR+ FR+ M+ Y  APA S +DTCYD SK  TV+VP I+F+  G
Sbjct  327  DSGTTITQLPPTVYSALRTVFRKAMANYTTAPADSTVDTCYDFSKERTVTVPSITFLFAG  386

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            GV +DL   GILL   ASQVCLAF  N   SD+ I+GN+QQ+TFEVVYDVA
Sbjct  387  GVNIDLDRSGILLMVTASQVCLAFTANDADSDLIIYGNVQQRTFEVVYDVA  437



>gb|KJB55134.1| hypothetical protein B456_009G064800 [Gossypium raimondii]
Length=483

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G L+FG  GA+  VK+   +T  Q ++FY ID+  I+VGG++LSI+  VF +   IID
Sbjct  302  STGFLSFGDTGASKSVKFITLSTVSQRSAFYGIDITGISVGGQKLSIAASVFTAGSAIID  361

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AY+AL S F++ MS+YP APA  +LDTCYD +KY++V+VPKISF  +GG
Sbjct  362  SGTVITRLPPTAYAALSSEFKKQMSQYPMAPASKLLDTCYDFTKYSSVNVPKISFFFSGG  421

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            V + +   GI      SQVCLAFA N + +D+GIFGN QQ+T +VVYDVA
Sbjct  422  VEVPIAAEGIFFVRSISQVCLAFARNNNDTDIGIFGNTQQKTLQVVYDVA  471



>gb|KCW63730.1| hypothetical protein EUGRSUZ_G01376 [Eucalyptus grandis]
Length=432

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 115/169 (68%), Gaps = 3/169 (2%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            GHLTFGK G AP  V +TP +T  Q + FY I +  I+V GK LSI   VF ++G +IDS
Sbjct  252  GHLTFGKDGRAPCSVSFTPLSTVPQNSEFYGISIIGISVEGKPLSIPSTVFSNAGAVIDS  311

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AYSALR+  R+ M+ Y  APA+S+ DTCYD SK +TV +P I+F    GV
Sbjct  312  GTVITRLPPTAYSALRTTVRKAMANYTTAPAVSLFDTCYDFSKESTVVIPSITFSFAEGV  371

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             +DL   GI     AS VCLAFA N   SD+ I+GN Q +TFEVVYDVA
Sbjct  372  NIDLDHSGIFYVEDASHVCLAFAANAADSDLVIYGNTQPRTFEVVYDVA  420



>ref|XP_009122891.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brassica 
rapa]
Length=416

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 118/168 (70%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFATDQGAS-FYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG    ++ VK+TP +T Q ++ FY +D+  I+VGG++L I P VF + G IIDSG
Sbjct  237  GHLTFGSARISSSVKFTPMSTVQDSTTFYGLDMIGISVGGRKLEIPPAVFSTPGAIIDSG  296

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TV++RLPP AY+ALRSAF  GMS+YP A    ILDTC+D + Y  V++P++SF  +GGV 
Sbjct  297  TVVSRLPPKAYAALRSAFVAGMSQYPTAAGFLILDTCFDFTGYERVTLPRVSFTFSGGVV  356

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +DL L GIL     S  CLAFAGN D     IFGN+QQQT EVVYD A
Sbjct  357  VDLGLPGILYSPTTSYYCLAFAGNDDDGKAAIFGNVQQQTLEVVYDGA  404



>gb|KCW63885.1| hypothetical protein EUGRSUZ_G01557 [Eucalyptus grandis]
Length=419

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 113/169 (67%), Gaps = 3/169 (2%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            GHL FGK   AP  V +TP +T  Q + FY I +  I V GK LSI   VF +   IIDS
Sbjct  239  GHLAFGKDSTAPSSVSFTPLSTVPQSSQFYGISIVGIRVEGKPLSIPSTVFSNGSAIIDS  298

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AYSALR+  R+ M+ Y  APA+S+LDTCYD SK +TV +P I+F    GV
Sbjct  299  GTVITRLPPTAYSALRTTVRKAMANYTTAPAVSLLDTCYDFSKESTVVIPSITFSFAEGV  358

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             +DL   GI     AS VCLAFA NG  SD+ I+GN QQ+TFEVVYDVA
Sbjct  359  NIDLDPTGIFYVEDASHVCLAFAANGADSDLVIYGNTQQRTFEVVYDVA  407



>gb|KHG03216.1| Asparticase nepenthesin-2 [Gossypium arboreum]
Length=480

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 117/168 (70%), Gaps = 2/168 (1%)
 Frame = -3

Query  721  ANGHLTFGKGG-AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G L FG  G +  VK+T  +T   G SFY I + A++VGGK+LSIS  V  + G IID
Sbjct  299  STGFLKFGNDGLSKSVKFTTLSTIPGGESFYGITIIAMSVGGKKLSISASVLAAGGAIID  358

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AYS LRSAFR+ M+ YP A +LSILDTCYD SKY+TVS+PKIS      
Sbjct  359  SGTVITRLPPTAYSVLRSAFRKQMNHYPMAKSLSILDTCYDFSKYSTVSIPKISLFFEKD  418

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
            V + +   GIL  N  SQVCLAFAGN +  DV I+GN QQ+T EVVYD
Sbjct  419  VEVPIDARGILYVNSISQVCLAFAGNSNDFDVLIYGNTQQKTLEVVYD  466



>ref|XP_007212799.1| hypothetical protein PRUPE_ppa020165mg [Prunus persica]
 gb|EMJ13998.1| hypothetical protein PRUPE_ppa020165mg [Prunus persica]
Length=386

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 113/165 (68%), Gaps = 3/165 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAA--PVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + G+L FGK   A  PVK+TP  T  Q  SFY +++  I+VGG +L ISP VF SSGTII
Sbjct  209  STGYLGFGKHRRAFKPVKFTPLTTVSQDPSFYGLNLVGISVGGHKLWISPSVFLSSGTII  268

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            D+GTVITRLP AAYSALR  FRQ ++KYP   ALS+LD CYDLS Y TV  P I+F   G
Sbjct  269  DTGTVITRLPAAAYSALRDVFRQALTKYPLTRALSVLDKCYDLSSYVTVKYPHIAFYFQG  328

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFE  236
            G+ + L   GI   + ASQVCLAFAGN   +   + GN+QQ+TFE
Sbjct  329  GLKLKLDATGIFYSSSASQVCLAFAGNDANNKFAVLGNVQQKTFE  373



>ref|XP_010065985.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
 gb|KCW63734.1| hypothetical protein EUGRSUZ_G01380 [Eucalyptus grandis]
Length=419

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 113/169 (67%), Gaps = 3/169 (2%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            GHL FGK   AP  V +TP +T  Q + FY I +  I V GK LSI   VF +   IIDS
Sbjct  239  GHLAFGKDSTAPSSVSFTPLSTVPQSSQFYGISIVGIRVEGKPLSIPSTVFSNGSAIIDS  298

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AYSALR+  R+ M+ Y  APA+S+ DTCYD SK +TV +P I+F    GV
Sbjct  299  GTVITRLPPTAYSALRTTVRKAMANYTTAPAVSLFDTCYDFSKESTVVIPSITFSFAEGV  358

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             +DL  +GI     AS VCLAFA NG  SD+ I+GN QQ+TFEVVYDVA
Sbjct  359  NIDLDPIGIFYVEDASHVCLAFAANGADSDLVIYGNTQQRTFEVVYDVA  407



>ref|XP_010068543.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=417

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 122/171 (71%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGG--AAPVKYTPFA-TDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + G+LTFGKG   +A V +TP +   Q + FY ID+  I+VGGK LSI   VF ++GTII
Sbjct  235  STGYLTFGKGSVTSASVSFTPISMVSQSSIFYGIDIIGISVGGKPLSIPSTVFSNAGTII  294

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGT IT+LPP AYSALRSAFRQ M+KY  +   S  DTCYDLS  T V+VP I+F  NG
Sbjct  295  DSGTTITQLPPTAYSALRSAFRQAMTKYKMSTPASSFDTCYDLSGSTMVTVPVITFSFNG  354

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             + ++L   G+L+    S+VCLAFA +GD  D+ I+GNIQQ++FEVVYDVA
Sbjct  355  PIDINLDPSGVLILVDPSKVCLAFASSGDDRDLSIYGNIQQRSFEVVYDVA  405



>gb|KCW63736.1| hypothetical protein EUGRSUZ_G01384 [Eucalyptus grandis]
Length=470

 Score =   181 bits (458),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 117/169 (69%), Gaps = 3/169 (2%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFA-TDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            G+LTFGK G AP  V +TP +   Q + FY I +  I+V G  LSI   VF S+G IIDS
Sbjct  290  GYLTFGKEGRAPSSVSFTPLSKVQQDSEFYGISIVGISVNGIPLSIPSTVFSSAGAIIDS  349

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GT IT+LPP  YSALR+ FR+ M+ Y  APA S +DTCYD SK  TV+VP I+F+  GGV
Sbjct  350  GTTITQLPPTVYSALRTVFRKAMANYTTAPADSTVDTCYDFSKERTVTVPSITFLFAGGV  409

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             +DL   GIL+   ASQVCLAF  N   SD+ I+GN+QQ+TFEVVYDVA
Sbjct  410  NIDLDRSGILVMVTASQVCLAFTANDADSDLIIYGNVQQRTFEVVYDVA  458



>gb|KCW44809.1| hypothetical protein EUGRSUZ_L01628 [Eucalyptus grandis]
Length=419

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 112/169 (66%), Gaps = 3/169 (2%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            GHLTFGK   AP  V +TP +T  Q + FY I +  I V GK LSI   VF +   IIDS
Sbjct  239  GHLTFGKDSTAPSSVSFTPLSTVPQSSQFYGISIVGIRVEGKPLSIPSTVFSNGSAIIDS  298

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AYSALR+  R+ M+ Y  APA S+ DTCYD SK +TV +P I+F    GV
Sbjct  299  GTVITRLPPTAYSALRTTVRKAMANYTTAPAASLFDTCYDFSKESTVVIPSITFSFAEGV  358

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             +DL   GI     AS VCLAFA NG  SD+ I+GN QQ+TFEVVYDVA
Sbjct  359  NIDLDPSGIFYVEDASHVCLAFAANGADSDLVIYGNTQQRTFEVVYDVA  407



>ref|XP_010068417.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Eucalyptus grandis]
Length=597

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 117/169 (69%), Gaps = 3/169 (2%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFA-TDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            G+LTFGK G AP  V +TP +   Q + FY I +  I+V G  LSI   VF S+G IIDS
Sbjct  173  GYLTFGKEGRAPSSVSFTPLSKVQQDSEFYGISIVGISVNGIPLSIPSTVFSSAGAIIDS  232

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GT IT+LPP  YSALR+ FR+ M+ Y  APA S +DTCYD SK  TV+VP I+F+  GGV
Sbjct  233  GTTITQLPPTVYSALRTVFRKAMANYTTAPADSTVDTCYDFSKERTVTVPSITFLFAGGV  292

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             +DL   GIL+   ASQVCLAF  N   SD+ I+GN+QQ+TFEVVYDVA
Sbjct  293  NIDLDRSGILVMVTASQVCLAFTANDADSDLIIYGNVQQRTFEVVYDVA  341



>gb|KDP33483.1| hypothetical protein JCGZ_07054 [Jatropha curcas]
Length=464

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 117/168 (70%), Gaps = 1/168 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            + G L+ G   +   K+ P ++   + FYF+D+  I VGG++LSI   VF +SGTIIDSG
Sbjct  286  STGFLSLGASQSNSAKFVPLSS-TSSDFYFLDLTGITVGGRKLSIPNSVFSTSGTIIDSG  344

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPPAAYSAL+SAF++ MS+YP+A  L  LDTCYD S + TV+VPKI    +G   
Sbjct  345  TVITRLPPAAYSALQSAFQELMSQYPKAQPLPTLDTCYDFSNFQTVNVPKIVLSFSGATD  404

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +++   GI L NGA+QVCLAFA N D     IFGN QQ T+EV+YDV+
Sbjct  405  VEVAQSGIFLSNGAAQVCLAFAPNSDPRQKAIFGNKQQLTYEVIYDVS  452



>ref|XP_010066087.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=476

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 113/169 (67%), Gaps = 3/169 (2%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            GHL FGK   AP  V +TP +T  Q + FY I +  I V GK LSI   VF +   IIDS
Sbjct  296  GHLAFGKDSTAPSSVSFTPLSTVPQSSQFYGISIVGIRVEGKPLSIPSTVFSNGSAIIDS  355

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AYSALR+  R+ M+ Y  APA+S+LDTCYD SK +TV +P I+F    GV
Sbjct  356  GTVITRLPPTAYSALRTTVRKAMANYTTAPAVSLLDTCYDFSKESTVVIPSITFSFAEGV  415

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             +DL   GI     AS VCLAFA NG  SD+ I+GN QQ+TFEVVYDVA
Sbjct  416  NIDLDPTGIFYVEDASHVCLAFAANGADSDLVIYGNTQQRTFEVVYDVA  464



>gb|KCW63938.1| hypothetical protein EUGRSUZ_G01615 [Eucalyptus grandis]
Length=480

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 122/171 (71%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGG--AAPVKYTPFA-TDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + G+LTFGKG   +A V +TP +   Q + FY ID+  I+VGGK LSI   VF ++GTII
Sbjct  298  STGYLTFGKGSVTSASVSFTPISMVSQSSIFYGIDIIGISVGGKPLSIPSTVFSNAGTII  357

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGT IT+LPP AYSALRSAFRQ M+KY  +   S  DTCYDLS  T V+VP I+F  NG
Sbjct  358  DSGTTITQLPPTAYSALRSAFRQAMTKYKMSTPASSFDTCYDLSGSTMVTVPVITFSFNG  417

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             + ++L   G+L+    S+VCLAFA +GD  D+ I+GNIQQ++FEVVYDVA
Sbjct  418  PIDINLDPSGVLILVDPSKVCLAFASSGDDRDLSIYGNIQQRSFEVVYDVA  468



>gb|KCW63937.1| hypothetical protein EUGRSUZ_G01615 [Eucalyptus grandis]
Length=481

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 122/171 (71%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGG--AAPVKYTPFA-TDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + G+LTFGKG   +A V +TP +   Q + FY ID+  I+VGGK LSI   VF ++GTII
Sbjct  299  STGYLTFGKGSVTSASVSFTPISMVSQSSIFYGIDIIGISVGGKPLSIPSTVFSNAGTII  358

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGT IT+LPP AYSALRSAFRQ M+KY  +   S  DTCYDLS  T V+VP I+F  NG
Sbjct  359  DSGTTITQLPPTAYSALRSAFRQAMTKYKMSTPASSFDTCYDLSGSTMVTVPVITFSFNG  418

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             + ++L   G+L+    S+VCLAFA +GD  D+ I+GNIQQ++FEVVYDVA
Sbjct  419  PIDINLDPSGVLILVDPSKVCLAFASSGDDRDLSIYGNIQQRSFEVVYDVA  469



>ref|XP_008379443.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=488

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 116/172 (67%), Gaps = 4/172 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAA--PVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + G+L FG  G +   VK+TP  T  Q A+FY +D+  I +G +QL IS  VF  SGT+I
Sbjct  305  STGYLKFGPDGGSGNAVKFTPLKTLSQSATFYALDLVGITIGSRQLKISASVFSKSGTVI  364

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALS-ILDTCYDLSKYTTVSVPKISFVLN  374
            DSGTVITRLP   Y+ALR AFR+ M KYP A + S +LDTCYD S   TVS PKI FV  
Sbjct  365  DSGTVITRLPATPYAALRVAFRKAMEKYPFAKSKSALLDTCYDFSGLKTVSYPKIGFVFG  424

Query  373  GGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            GGVT+DL   GIL     SQ CLAFAGN D + VGI GN+QQ+  +VVYDVA
Sbjct  425  GGVTVDLDATGILFQTSGSQFCLAFAGNKDDNSVGIIGNVQQKRLQVVYDVA  476



>ref|XP_010256103.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=476

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 117/171 (68%), Gaps = 4/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP---VKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTI  554
            + G+L FG    A    + YTP  TD +  SFYFI +  I+VGG++L+I   VF SSGTI
Sbjct  292  STGYLAFGDQAGASSSSLLYTPLLTDSRRPSFYFIKLVGISVGGRRLTIPSTVFTSSGTI  351

Query  553  IDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLN  374
            ID+GTVITRL P+AY+ALRSAFRQ M  YP A A+ + DTCYDLS +  V++PKI     
Sbjct  352  IDTGTVITRLQPSAYAALRSAFRQAMLNYPSASAVFLFDTCYDLSGFNIVAIPKIMLHFE  411

Query  373  GGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            GG  +DL L GI++ +G S+VCLAFAGN D     I GN QQQT EVVYDV
Sbjct  412  GGAGIDLGLPGIIVTDGLSRVCLAFAGNDDPGKAAIIGNKQQQTLEVVYDV  462



>ref|XP_010040897.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=476

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 112/169 (66%), Gaps = 3/169 (2%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            GHLTFGK   AP  V +TP +T  Q + FY I +  I V GK LSI   VF +   IIDS
Sbjct  296  GHLTFGKDSTAPSSVSFTPLSTVPQSSQFYGISIVGIRVEGKPLSIPSTVFSNGSAIIDS  355

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AYSALR+  R+ M+ Y  APA S+ DTCYD SK +TV +P I+F    GV
Sbjct  356  GTVITRLPPTAYSALRTTVRKAMANYTTAPAASLFDTCYDFSKESTVVIPSITFSFAEGV  415

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             +DL   GI     AS VCLAFA NG  SD+ I+GN QQ+TFEVVYDVA
Sbjct  416  NIDLDPSGIFYVEDASHVCLAFAANGADSDLVIYGNTQQRTFEVVYDVA  464



>ref|XP_009359072.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Pyrus 
x bretschneideri]
Length=496

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = -3

Query  700  GKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRL  524
            G+ G A VK+TP  T  QGASFY + +  I +GG QL IS  VF +SGTIIDSGTVITRL
Sbjct  323  GRSGNA-VKFTPLTTLSQGASFYGLGLVGINIGGSQLPISASVFSTSGTIIDSGTVITRL  381

Query  523  PPAAYSALRSAFRQGMSKYPQA-PALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPL  347
            P  AY+ALR AFR+ M +YP A P  S+LDTCYD S + T+++P I FV   GVT+D+  
Sbjct  382  PATAYTALRDAFREAMKRYPTAKPIFSVLDTCYDFSGFKTITLPTIGFVFGNGVTVDVDA  441

Query  346  VGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             GIL    ASQ CLAFAGN D S  GI GN+QQ+  +VVYDVA
Sbjct  442  TGILFPQSASQFCLAFAGNKDDSSFGIIGNVQQKRLQVVYDVA  484



>ref|XP_008377499.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=497

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 115/168 (68%), Gaps = 2/168 (1%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GH   G+ G   VK+ P  T  QG S+Y + +  I +GG QL IS  VF +SGTIIDSGT
Sbjct  318  GHSDNGRSGYNAVKFVPLTTLSQGESYYGLGLVGINIGGSQLPISASVFSTSGTIIDSGT  377

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALS-ILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            VITRLP  AY+ALR AFR+ M +YP A ++S +LDTCYD + + T++ PKI FV   GVT
Sbjct  378  VITRLPATAYTALRDAFREAMKRYPTARSISSLLDTCYDFNGFKTITFPKIGFVFGNGVT  437

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +D+   GIL+   ASQ CLAFAGN D   VGI GN+QQ+  +VVYDVA
Sbjct  438  VDVDATGILVQQSASQFCLAFAGNKDDRSVGIIGNVQQKRLQVVYDVA  485



>gb|KDP33484.1| hypothetical protein JCGZ_07055 [Jatropha curcas]
Length=465

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            + G+L+FG   +   K+ P  T   + FY++ +  I VGG++LSI   VF ++GTIIDSG
Sbjct  287  STGYLSFGASQSKSAKFVPLLT-TSSDFYYLSLTGITVGGQKLSIPTSVFSTAGTIIDSG  345

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPPAAYSALRSAF++ M+KYP A  LSILDTC+D SK  T++ PKI    +G   
Sbjct  346  TVITRLPPAAYSALRSAFKKKMAKYPVAAPLSILDTCFDFSKTQTITFPKIVLSFSGTTD  405

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            +++   G     G  Q CLAFA NGDA D  I GN QQ+T+EV+YD+
Sbjct  406  VEVDKTGTFFATGVDQACLAFAANGDAGDKAILGNTQQRTYEVIYDI  452



>ref|XP_009359074.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Pyrus 
x bretschneideri]
Length=497

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 116/163 (71%), Gaps = 2/163 (1%)
 Frame = -3

Query  700  GKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRL  524
            G+ G   VK+TP  T  +GA +Y +++  I++GG QL IS  VF +SGTIIDSGTVITRL
Sbjct  323  GRSGYNAVKFTPLTTLSRGALYYGLELVGISIGGSQLPISASVFSTSGTIIDSGTVITRL  382

Query  523  PPAAYSALRSAFRQGMSKYPQAPALS-ILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPL  347
            P  AY+ALR+AFR+ M +YP A ++S +LDTCYD S   T++ PKI FV   GVT+D+  
Sbjct  383  PATAYTALRNAFREAMKRYPTATSISSLLDTCYDFSGIKTITFPKIGFVFGNGVTVDVDA  442

Query  346  VGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             GIL+   ASQ CLAFAGN D   VGI GN+QQ+  +VVYDVA
Sbjct  443  TGILVQQSASQFCLAFAGNKDDRSVGIIGNVQQKRLQVVYDVA  485



>ref|XP_008777073.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=445

 Score =   177 bits (449),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 119/170 (70%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+LT G  G AP V++TP  T+  A SFYF+++  ++VGGK LSI P  F  +GTIID
Sbjct  264  STGYLTLGASGPAPNVRFTPMLTEPAAPSFYFVELIGLSVGGKNLSILPSTFADTGTIID  323

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLP ++YSALR  FR+ M+ Y  AP LSI DTCY+ +   ++S+P +    +GG
Sbjct  324  SGTVITRLPSSSYSALRDEFRRQMANYSMAPPLSIFDTCYNFTGVGSISLPSVGLRFSGG  383

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            VT+D+   GIL     SQ CLAFAGN D S + I GN+QQ+T+++VYDVA
Sbjct  384  VTLDVDPSGILYIASISQACLAFAGNSDPSSISIIGNMQQRTYDIVYDVA  433



>ref|XP_008386742.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=496

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 117/174 (67%), Gaps = 6/174 (3%)
 Frame = -3

Query  721  ANGHLTFG----KGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGT  557
            + G+L+ G    +     VK+TP  T  QGAS+Y + +  I +GG QL IS  VF  SGT
Sbjct  311  STGYLSLGNSDNRXSGNAVKFTPLTTLSQGASYYSLGLVGINIGGSQLPISASVFSXSGT  370

Query  556  IIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALS-ILDTCYDLSKYTTVSVPKISFV  380
            IIDSGTVITRLP  AY+ALR AFR+ M +YP A ++S +LDTCYD S + T++ P I FV
Sbjct  371  IIDSGTVITRLPATAYTALRDAFREXMKRYPTAKSISSLLDTCYDFSGFKTITFPTIGFV  430

Query  379  LNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
               GVT+D+   GIL    ASQ CLAFAGN D S VGI GN+QQ+  +VVYDVA
Sbjct  431  FGNGVTVDVDATGILFQQSASQFCLAFAGNKDDSSVGIIGNVQQKRLQVVYDVA  484



>gb|AAM74221.1|AF518565_1 putative chloroplast nucleoid DNA-binding protein [Brassica oleracea]
Length=165

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 117/165 (71%), Gaps = 1/165 (1%)
 Frame = -3

Query  673  YTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSALR  497
            +TP +T   G SFY +D+  I+VGG++L+I   VF + G +IDSGTVI+RLPP AY+ALR
Sbjct  1    FTPISTITDGTSFYGLDIVGISVGGQKLAIPQTVFSTPGALIDSGTVISRLPPKAYAALR  60

Query  496  SAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNGAS  317
             AF+  MS+Y    A+SILDTC+DL+ + TV++P +SF  NGG  ++L   G+L     S
Sbjct  61   GAFKAKMSQYKNTSAVSILDTCFDLTGFKTVTIPTVSFYFNGGAVVELGSKGVLYAFKMS  120

Query  316  QVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagGCS  182
            QVCLAFAGN D ++  IFGN+QQQT EVVYD A G++G    GCS
Sbjct  121  QVCLAFAGNSDDNNAAIFGNVQQQTLEVVYDGAAGRVGFAPNGCS  165



>ref|XP_009122023.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Brassica rapa]
Length=476

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 114/167 (68%), Gaps = 3/167 (2%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT--DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            GHLTFG GG +  VKYT  +T   + ASFY +D+  I+V  K+L I   VF + G IIDS
Sbjct  296  GHLTFGSGGLSNAVKYTSISTVVHESASFYGLDILGISVDDKELEIPVTVFSTPGAIIDS  355

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AY+ALR+AF++ MS Y  A   S+ DTCYD +   +V +PK+SF   GG 
Sbjct  356  GTVITRLPPTAYAALRTAFKEKMSNYKTALGRSLFDTCYDFTGLESVEIPKVSFSFKGGT  415

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
             ++L L G+L     SQVCLAFAGN +  DV IFGN+QQ+T +VVYD
Sbjct  416  VVELDLKGVLYVFDVSQVCLAFAGNSNDEDVAIFGNVQQRTMQVVYD  462



>gb|KFK25358.1| hypothetical protein AALP_AA8G103000 [Arabis alpina]
Length=469

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 117/168 (70%), Gaps = 4/168 (2%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GHLTFG  G +  VK+TP ++   ASFY +D+  I+V  K+L I   VF + G+IIDSGT
Sbjct  288  GHLTFGSAGISNSVKFTPVSSTTFASFYGLDIVGISVDDKKLEIPLTVFSTPGSIIDSGT  347

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLS--KYTTVSVPKISFVLNGGV  365
            V+TRLP  AY ALR+AF++ MS Y     LS+LDTCYD +     TV+ PKISF  NG +
Sbjct  348  VVTRLPLKAYEALRTAFKEKMSNYKTTTGLSLLDTCYDFTGVDLETVTFPKISFTFNGDI  407

Query  364  TMD-LPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
             +D L  VGILL +  SQVCLAFAGN + SDV IFGNIQQ+T +VVYD
Sbjct  408  VVDLLNPVGILLASNISQVCLAFAGNSNESDVAIFGNIQQKTMQVVYD  455



>ref|XP_009122025.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Brassica rapa]
Length=473

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 114/167 (68%), Gaps = 3/167 (2%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT--DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            GHLTFG GG +  VKYT  +T   + ASFY +D+  I+V  K+L I   VF + G IIDS
Sbjct  293  GHLTFGSGGLSNAVKYTSISTVVHESASFYGLDILGISVDDKELEIPVTVFSTPGAIIDS  352

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AY+ALR+AF++ MS Y  A   S+ DTCYD +   +V +PK+SF   GG 
Sbjct  353  GTVITRLPPTAYAALRTAFKEKMSNYKTALGRSLFDTCYDFTGLESVEIPKVSFSFKGGT  412

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
             ++L L G+L     SQVCLAFAGN +  DV IFGN+QQ+T +VVYD
Sbjct  413  VVELDLKGVLYVFDVSQVCLAFAGNSNDEDVAIFGNVQQRTMQVVYD  459



>ref|XP_008220626.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Prunus 
mume]
Length=485

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 117/172 (68%), Gaps = 4/172 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP--VKYTPFAT--DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTI  554
            + GHLTFGKGG +   VK+T   T   + +SFY + +  I+V  +QL ++  VF SSGTI
Sbjct  302  STGHLTFGKGGGSADGVKFTKLTTLSKRASSFYGLGLTGISVNRRQLQVASSVFSSSGTI  361

Query  553  IDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLN  374
            IDSGTVITRLP  AY ALR AFR+GM  Y    + S+LDTCY++S Y TVS P I+F   
Sbjct  362  IDSGTVITRLPATAYRALRDAFREGMKNYKMTMSFSLLDTCYNISGYKTVSYPGIAFRFG  421

Query  373  GGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             GVT+DL   GIL    +SQ CLAFAG+ D + +GI GN+QQ+  EVVYDVA
Sbjct  422  DGVTVDLDPAGILYMVSSSQACLAFAGHKDDTGLGIIGNVQQKRLEVVYDVA  473



>gb|KDP33482.1| hypothetical protein JCGZ_07053 [Jatropha curcas]
Length=475

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 124/182 (68%), Gaps = 2/182 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + GHL+FG      VK+TP + D Q   +Y ID+  I+VGG +L++S  V++++G IIDS
Sbjct  294  STGHLSFGGNIGKTVKFTPMSPDFQSTPYYGIDITGISVGGDKLAVSASVYQTAGAIIDS  353

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP  YSAL S F++ M++YP     SILDTCYD S + TV+VPKIS    GGV
Sbjct  354  GTVITRLPPTVYSALSSKFQEMMTEYPMTDGFSILDTCYDFSDFDTVTVPKISVFFKGGV  413

Query  364  TMDLPLVGILL-GNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagG  188
             +D+ + GIL+  +G  +VCLAFA N   S+  IFGN QQQT+EV++D+A  ++G     
Sbjct  414  EVDIYVTGILIVVDGIEKVCLAFAPNQKDSEFAIFGNTQQQTYEVLHDLAKERVGFAPAA  473

Query  187  CS  182
            CS
Sbjct  474  CS  475



>ref|XP_008386743.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Malus domestica]
Length=435

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = -3

Query  721  ANGHLTFG----KGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGT  557
            + G+L+ G    +     VK+TP  T  QGAS+Y + +  I +GG QL IS  VF +SGT
Sbjct  250  STGYLSLGNSDNRRSGNAVKFTPLTTLSQGASYYSLGLVGINIGGSQLPISASVFSTSGT  309

Query  556  IIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALS-ILDTCYDLSKYTTVSVPKISFV  380
            IIDSGTVITRLP  AY+ALR AFR+ M +YP A ++S +LDTCYD S + T++ P I FV
Sbjct  310  IIDSGTVITRLPATAYTALRDAFREAMKRYPTAKSISSLLDTCYDFSGFKTITFPTIGFV  369

Query  379  LNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
               GVT+D+   GI++   ASQ CLAFAGN D  +VGI GN+QQ+  +VVYDVA
Sbjct  370  FGNGVTVDVDATGIVVPQSASQFCLAFAGNKDDRNVGIIGNVQQKRLQVVYDVA  423



>ref|XP_010913226.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=468

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 118/169 (70%), Gaps = 3/169 (2%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            G+L  G G  + V +TP        SFYF+D+ AI VGG+QL I+  VF +  T++DSGT
Sbjct  288  GYLKLGGGAPSNVHFTPMRKFHSQPSFYFLDLVAIKVGGEQLPIAQTVFSNDRTLLDSGT  347

Query  538  VITRLPPAAYSALRSAFRQGMSK--YPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            VITRLPP+AY+ALRS F++ M+K  Y +AP LSILDTCYD + Y  VSVP ++ +    V
Sbjct  348  VITRLPPSAYTALRSRFQKQMAKKKYKRAPPLSILDTCYDFTGYNIVSVPTVALLFGSRV  407

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            T+++   GIL  +  SQ CLAFAGN +ASD GI GN+QQ+ F+VVYD+A
Sbjct  408  TLNVDFTGILYVSSVSQACLAFAGNDNASDPGIIGNVQQKRFDVVYDIA  456



>gb|KCW64008.1| hypothetical protein EUGRSUZ_G01690, partial [Eucalyptus grandis]
Length=413

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 121/171 (71%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGG--AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + G+LTFGKG   +A V +TP +T  +   FY ID+  I+VGGK LSI   VF ++GTII
Sbjct  231  STGYLTFGKGSVTSASVSFTPISTVSRSPIFYGIDIIGISVGGKPLSIPSTVFSNAGTII  290

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGT IT+LPP AYSALRSAFRQ M+KY  +   S LDTCYDLS  T V+VP I+F   G
Sbjct  291  DSGTTITQLPPTAYSALRSAFRQAMTKYKMSTPASPLDTCYDLSGSTMVTVPVITFSFKG  350

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             + ++L   G+L     S+VCLAFA + D +++ I+GNIQQ++FEVVYDVA
Sbjct  351  PIDINLDPSGVLFPVDPSKVCLAFASSSDDTNLSIYGNIQQRSFEVVYDVA  401



>ref|XP_006382029.1| hypothetical protein POPTR_0006s24860g [Populus trichocarpa]
 gb|ERP59826.1| hypothetical protein POPTR_0006s24860g [Populus trichocarpa]
Length=443

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 120/181 (66%), Gaps = 2/181 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            + G+L FG   +    +TP +    +SFY ID+  I+VGG QL I P +F  SG IIDSG
Sbjct  264  STGYLNFGGKVSQTAGFTPISP-AFSSFYGIDIVGISVGGSQLPIDPSIFTKSGAIIDSG  322

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY AL+ AF + MS YP+     +LDTCYD S YTTVS PK+S    GGV 
Sbjct  323  TVITRLPPTAYKALKEAFDEKMSNYPKTNGDELLDTCYDFSNYTTVSFPKVSVSFKGGVE  382

Query  361  MDLPLVGIL-LGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagGC  185
            +D+   GIL L NG   VCLAFA N D S +GIFGN QQ+T+EVVYD A G +G  AGGC
Sbjct  383  VDINASGILYLVNGLKMVCLAFAANKDDSKIGIFGNHQQKTYEVVYDGAKGMVGFAAGGC  442

Query  184  S  182
            S
Sbjct  443  S  443



>ref|XP_009125279.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Brassica rapa]
Length=449

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GHLTFG  G ++ VKYTP  +      Y +D+ +I VGGK+L I   VF     IIDSGT
Sbjct  271  GHLTFGSTGISSSVKYTPIKSLPKTHLYGLDIVSITVGGKKLEIPSTVFSHPRAIIDSGT  330

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLPP AY+ALR AF++ M  Y  A A+ +LDTCYD   + T+SVPK+SF   GG T+
Sbjct  331  VITRLPPKAYAALRGAFKENMKNYTTASAVELLDTCYDPKGFDTMSVPKVSFSFGGGTTV  390

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +L L GIL    AS VCLAFAGN +  D+ IFG+ QQ T +VVYD A
Sbjct  391  ELGLNGILYPLNASHVCLAFAGNDNDGDLAIFGSFQQMTLQVVYDTA  437



>ref|XP_009125278.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Brassica rapa]
Length=478

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GHLTFG  G ++ VKYTP  +      Y +D+ +I VGGK+L I   VF     IIDSGT
Sbjct  300  GHLTFGSTGISSSVKYTPIKSLPKTHLYGLDIVSITVGGKKLEIPSTVFSHPRAIIDSGT  359

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLPP AY+ALR AF++ M  Y  A A+ +LDTCYD   + T+SVPK+SF   GG T+
Sbjct  360  VITRLPPKAYAALRGAFKENMKNYTTASAVELLDTCYDPKGFDTMSVPKVSFSFGGGTTV  419

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +L L GIL    AS VCLAFAGN +  D+ IFG+ QQ T +VVYD A
Sbjct  420  ELGLNGILYPLNASHVCLAFAGNDNDGDLAIFGSFQQMTLQVVYDTA  466



>ref|XP_007011660.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY29279.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=469

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 115/167 (69%), Gaps = 4/167 (2%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            G+LTFG G   P  +K+TP +   +   FY +D+  I VGG+++ I   VF ++G IIDS
Sbjct  290  GYLTFG-GTKLPKTIKFTPMSKSFRNTPFYGLDIIGINVGGQRVPIKSSVFTTAGAIIDS  348

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AY+ L+S+F++ M+ YP+APALSILDTCYD S    +  P IS V NGGV
Sbjct  349  GTVITRLPPTAYAQLKSSFQKYMTSYPRAPALSILDTCYDFSGSDVIITPTISIVFNGGV  408

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
             +D+   GI      SQ CLAFA N DA DV IFGN+QQ+T+EVVYD
Sbjct  409  EVDIDFSGIFYIRKVSQACLAFAANKDARDVAIFGNVQQKTYEVVYD  455



>ref|XP_009409855.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=466

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFGKG-GAAPVKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+L FG G  ++ +++TP  +   + +FY++ + AI+VGG+QL + P VF  +GTIID
Sbjct  286  STGYLRFGGGYPSSDLRFTPMLSGASSPTFYYLTLTAISVGGQQLLVPPTVFSVAGTIID  345

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AYSALRSAFRQ M+ Y  APALSILDTCYDLS    V+VP+++  L GG
Sbjct  346  SGTVITRLPPTAYSALRSAFRQEMTTYKSAPALSILDTCYDLSGLDKVTVPEVALHLGGG  405

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             T+ L +  IL     SQ CLAFA N   +D+GI GN+QQ+  +VVYDV+
Sbjct  406  ATIHLDITRILYIASLSQACLAFAANRADTDLGIIGNVQQRGLDVVYDVS  455



>emb|CDX85747.1| BnaA02g00660D [Brassica napus]
Length=478

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GHLTFG  G ++ VKYTP  +      Y +D+ +I VGGK+L I   VF     IIDSGT
Sbjct  300  GHLTFGSTGISSSVKYTPIKSLPKTHLYGLDIVSITVGGKKLEIPSTVFSHPRAIIDSGT  359

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLPP AY+ALR AF++ M  Y  A A+ +LDTCYD   + T+SVPK+SF   GG T+
Sbjct  360  VITRLPPKAYAALRGAFKENMKNYTTASAVELLDTCYDPKGFDTMSVPKVSFSFGGGTTV  419

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +L L GIL    AS VCLAFAGN +  D  IFG+ QQ T +VVYD A
Sbjct  420  ELGLNGILYPLNASHVCLAFAGNDNDGDFAIFGSFQQMTLQVVYDTA  466



>ref|XP_002283470.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Vitis 
vinifera]
Length=490

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 115/169 (68%), Gaps = 3/169 (2%)
 Frame = -3

Query  715  GHLTFGKGG--AAPVKYTPFATDQG-ASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            G+L+FG G   +  VK+TP   +    SFYF+D+  I+VG ++L I   VF ++GTIIDS
Sbjct  310  GYLSFGSGDGDSKAVKFTPSEVNSDYPSFYFLDMVGISVGERKLPIPKSVFSTAGTIIDS  369

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVI+RLPP  YS+++  FR+ MS YP+   +SILDTCYDLSKY TV VPKI    +GG 
Sbjct  370  GTVISRLPPTVYSSVQKVFRELMSDYPRVKGVSILDTCYDLSKYKTVKVPKIILYFSGGA  429

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             MDL   GI+     SQVCLAFAGN D  +V I GN+QQ+T  VVYD A
Sbjct  430  EMDLAPEGIIYVLKVSQVCLAFAGNSDDDEVAIIGNVQQKTIHVVYDDA  478



>ref|XP_002324352.2| hypothetical protein POPTR_0018s03010g [Populus trichocarpa]
 gb|EEF02917.2| hypothetical protein POPTR_0018s03010g [Populus trichocarpa]
Length=472

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 114/170 (67%), Gaps = 3/170 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + G+L+ G   +  VK+TP + D     FY +D+  ++VGG+QLSI    F S+GT+IDS
Sbjct  292  SKGYLSLGGQVSKSVKFTPLSADFDSTPFYGLDITGLSVGGRQLSIDESAF-SAGTVIDS  350

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRL P AYS L SAF+  M+ YP     SI DTCYD SKY TV +PK+     GGV
Sbjct  351  GTVITRLSPTAYSELSSAFQNLMTDYPSTSGYSIFDTCYDFSKYDTVRIPKVGVTFKGGV  410

Query  364  TMDLPLVGILLG-NGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             MD+ + GIL   NG  +VCLAFAGN D SD  IFGN+QQ+T++VVYD A
Sbjct  411  EMDIDVSGILYPVNGLKKVCLAFAGNDDDSDTSIFGNVQQRTYQVVYDGA  460



>ref|XP_002309515.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEE93038.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=473

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 115/170 (68%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + G+L+FG   +  VK+TP + D +   FY +D+  ++VGG +LSI   +F +SGT+IDS
Sbjct  292  SKGYLSFGGQVSKTVKFTPLSEDFKSTPFYGLDITELSVGGNKLSIDASIFSTSGTVIDS  351

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLP  AYSAL SAF++ M+ YP     SI DTCYD SK  T+ +PK+     GGV
Sbjct  352  GTVITRLPSTAYSALSSAFQKLMTDYPSTDGYSIFDTCYDFSKNETIKIPKVGVSFKGGV  411

Query  364  TMDLPLVGILLG-NGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             MD+ + GIL   NG  +VCLAFAGNGD     IFGN QQ+T++VVYD A
Sbjct  412  EMDIDVSGILYPVNGLKKVCLAFAGNGDDVKAAIFGNTQQKTYQVVYDDA  461



>ref|XP_002309514.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEE93037.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=474

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 119/181 (66%), Gaps = 2/181 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            + G+L FG   +    +TP +    +SFY ID+  I+V G QL I P +F +SG IIDSG
Sbjct  295  STGYLNFGGKVSQTAGFTPISP-AFSSFYGIDIVGISVAGSQLPIDPSIFTTSGAIIDSG  353

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY AL+ AF + MS YP+     +LDTCYD S YTTVS PK+S    GGV 
Sbjct  354  TVITRLPPTAYKALKEAFDEKMSNYPKTNGDELLDTCYDFSNYTTVSFPKVSVSFKGGVE  413

Query  361  MDLPLVGIL-LGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagGC  185
            +D+   GIL L NG   VCLAFA N D S+ GIFGN QQ+T+EVVYD A G +G  AG C
Sbjct  414  VDIDASGILYLVNGVKMVCLAFAANKDDSEFGIFGNHQQKTYEVVYDGAKGMIGFAAGAC  473

Query  184  S  182
            S
Sbjct  474  S  474



>ref|XP_009359069.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Pyrus 
x bretschneideri]
Length=496

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 115/168 (68%), Gaps = 3/168 (2%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            G+   G+ G A VK+TP     Q ASFY + +  I +GG QL IS  VF +SGTIIDSGT
Sbjct  318  GNSDNGRSGNA-VKFTPLTRLSQDASFYGLGLVGINIGGSQLPISASVFSTSGTIIDSGT  376

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQA-PALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            VITRLP  AY+ALR AFR+ M +YP A P  S+LDTCYD S + T+++P I FV   GVT
Sbjct  377  VITRLPATAYTALRDAFREAMKRYPTAKPISSLLDTCYDFSGFKTITLPTIGFVFGNGVT  436

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +D+   GIL+   ASQ CLAFAGN D   VGI GN+QQ+  +VVYDVA
Sbjct  437  VDVDETGILVQQRASQFCLAFAGNKDDRSVGIIGNVQQKRLQVVYDVA  484



>gb|KEH33910.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=467

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 118/171 (69%), Gaps = 6/171 (4%)
 Frame = -3

Query  715  GHLTFG-----KGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTI  554
            GHLTFG     K     VKYTP +T  +  SFY +D+  I++   +LSIS  +F S G I
Sbjct  284  GHLTFGATDNYKVANNTVKYTPLSTISRSNSFYGLDIVGISIAKTKLSISSSIFSSGGAI  343

Query  553  IDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLN  374
            IDSGTVITRLPP+ Y++LR+AFR+ M+KYP A   SILDTCYDL     V VPKISFV  
Sbjct  344  IDSGTVITRLPPSTYASLRNAFRKEMAKYPAASGFSILDTCYDLRGRNNVVVPKISFVFG  403

Query  373  GGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            GGVT++L   G+L    + QVCLAFA N D SD+ IFGN+QQ+T EVVYDV
Sbjct  404  GGVTVELGAHGVLFTVSSRQVCLAFAANRDDSDITIFGNVQQRTLEVVYDV  454



>emb|CDX69805.1| BnaA10g21540D [Brassica napus]
Length=570

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 113/167 (68%), Gaps = 3/167 (2%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT--DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            GHLTFG GG +  VKYT  +T   + ASFY +D+  I+V GK+L I   VF ++G I+DS
Sbjct  271  GHLTFGSGGLSNAVKYTSISTVVHESASFYGLDIVGISVAGKKLEIPVTVFSTAGAIMDS  330

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AY+ALR+AF++ MS Y       +LDTCYD +   TV +PK+SF   GG 
Sbjct  331  GTVITRLPPKAYAALRTAFKKKMSNYKTTLGSRLLDTCYDFTGQETVDIPKVSFSFKGGT  390

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
             ++L   GIL     SQVCLAFA N +  +V IFGN+QQ+T +VVYD
Sbjct  391  VVELHSKGILFAYDVSQVCLAFAKNSNVGNVAIFGNVQQKTLQVVYD  437



>emb|CDY40116.1| BnaC02g00140D [Brassica napus]
Length=479

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GHLTFG  G ++ VK+TP  +      Y +D+  I VGGK+L I   VF     IIDSGT
Sbjct  301  GHLTFGSTGISSSVKFTPIKSVPKTHLYGLDIVGITVGGKKLEIPSTVFSHPRAIIDSGT  360

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLPP AY+ALRSAF++ M  Y    A+ +LDTCYD   + T+SVPK+SF   GG T+
Sbjct  361  VITRLPPKAYAALRSAFKENMKNYTTTSAVELLDTCYDPKGFDTMSVPKVSFSFGGGTTV  420

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +L L GIL    AS VCLAFAGN +  D  IFG++QQ T +VVYD A
Sbjct  421  ELGLNGILYPLNASHVCLAFAGNDNDGDFAIFGSVQQMTLQVVYDKA  467



>ref|XP_002454360.1| hypothetical protein SORBIDRAFT_04g029400 [Sorghum bicolor]
 gb|EES07336.1| hypothetical protein SORBIDRAFT_04g029400 [Sorghum bicolor]
Length=466

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 117/167 (70%), Gaps = 1/167 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            ++G LT G G +  VK     + Q  +FY + +QAI VGG+QLSI   VF S+GTI+DSG
Sbjct  289  SSGFLTLGAGTSGFVKTPMLRSSQVPTFYGVRIQAIRVGGRQLSIPTSVF-SAGTIMDSG  347

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TV+TRLPP AYSAL SAF+ GM +YP AP   ILDTC+D S  ++VS+P ++ V +GG  
Sbjct  348  TVLTRLPPTAYSALSSAFKAGMKQYPSAPPSGILDTCFDFSGQSSVSIPTVALVFSGGAV  407

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            +D+   GI+L    S +CLAFA N D S +GI GN+QQ+TFEV+YDV
Sbjct  408  VDIASDGIMLQTSNSILCLAFAANSDDSSLGIIGNVQQRTFEVLYDV  454



>ref|XP_008652856.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Zea 
mays]
Length=469

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 124/182 (68%), Gaps = 2/182 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            A G+L+ G   A P  ++T   T     SFY++D+  I V G+ + ++P VFK+ GT+ID
Sbjct  288  AEGYLSLGSAAAPPHAQFTAMVTRSDTPSFYYLDLVGIKVAGRTVRVAPAVFKAPGTVID  347

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLP  AYSALRS+F   M +Y +APALSILDTCYD +  T V +P ++ + +GG
Sbjct  348  SGTVITRLPSRAYSALRSSFAGFMRRYKRAPALSILDTCYDFTGRTKVQIPSVALLFDGG  407

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagG  188
             T++L   G+L     SQ CLAFA NGD + VGI GN+QQ+TF VVYD+A  K+G GA G
Sbjct  408  ATLNLGFGGVLYVANRSQACLAFASNGDDTSVGILGNMQQKTFAVVYDLANQKIGFGAKG  467

Query  187  CS  182
            CS
Sbjct  468  CS  469



>ref|XP_011036735.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Populus 
euphratica]
Length=469

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 114/170 (67%), Gaps = 3/170 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + G+L+ G   +  VK+TP + D     FY +D+  ++VGG++LSI    F S+GT+IDS
Sbjct  289  SKGYLSLGGKVSKSVKFTPLSADFDSTPFYGLDITGLSVGGRELSIDESAF-SAGTVIDS  347

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRL P AYS L SAF+  M+ YP     SI DTCYD SKY TV +PK+     GGV
Sbjct  348  GTVITRLSPTAYSELSSAFQNLMTDYPSTSGYSIFDTCYDFSKYDTVRIPKVGVTFKGGV  407

Query  364  TMDLPLVGILLG-NGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             MD+ + GIL   NG  +VCLAFAGN D SD  IFGN+QQ+T++VVYD A
Sbjct  408  EMDIDVSGILYPVNGLKRVCLAFAGNEDDSDTSIFGNVQQRTYQVVYDGA  457



>gb|ACN85323.1| aspartic proteinase nepenthesin-1 precursor [Oryza brachyantha]
Length=287

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 116/177 (66%), Gaps = 6/177 (3%)
 Frame = -3

Query  730  KRGANGHLTFGKGGA----APVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSS  563
            +    G+L FG G +    A +  TP   D G +FY++ +  I VGGK L I   VF ++
Sbjct  100  RSSGTGYLEFGPGSSPAVSAKLSTTPMLIDTGPTFYYVGMTGIRVGGKLLPIPQSVFAAA  159

Query  562  GTIIDSGTVITRLPPAAYSALRSAFRQGMSK--YPQAPALSILDTCYDLSKYTTVSVPKI  389
            GTI+DSGTVITRLPPAAYS+LRSAF   M+   Y +APALS+LDTCYDL+  + V++P +
Sbjct  160  GTIVDSGTVITRLPPAAYSSLRSAFAASMAARGYKRAPALSLLDTCYDLTGASEVAIPTV  219

Query  388  SFVLNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            S +  GGV++D+   GI+     SQ CL FAGN  A DV I GN Q +TF VVYD+A
Sbjct  220  SLLFQGGVSLDVDASGIIYAASVSQACLGFAGNEAADDVAIVGNTQLKTFGVVYDIA  276



>ref|XP_002324351.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEF02916.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=472

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 114/170 (67%), Gaps = 3/170 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + G+L+ G   +  VK+TP + D     FY +D+  ++VGG++LSI    F S+GT+IDS
Sbjct  292  SKGYLSLGGQVSKSVKFTPLSADFDSTPFYGLDITGLSVGGRKLSIDESAF-SAGTVIDS  350

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRL P AYS L SAF+  M+ YP     SI DTCYD SKY TV +PK+     GGV
Sbjct  351  GTVITRLSPTAYSELSSAFQNLMTDYPSTSGYSIFDTCYDFSKYDTVRIPKVGVTFKGGV  410

Query  364  TMDLPLVGILLG-NGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             MD+ + GIL   NG  +VCLAFAGN D SD  IFGN+QQ+T++VVYD A
Sbjct  411  EMDIDVSGILYPVNGLKKVCLAFAGNDDDSDTSIFGNVQQRTYQVVYDGA  460



>ref|XP_010068575.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=709

 Score =   175 bits (443),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 121/171 (71%), Gaps = 3/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGG--AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            + G+LTFGKG   +A V +TP +T  +   FY ID+  I+VGGK LSI   VF ++GTII
Sbjct  527  STGYLTFGKGSVTSASVSFTPISTVSRSPIFYGIDIIGISVGGKPLSIPSTVFSNAGTII  586

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGT IT+LPP AYSALRSAFRQ M+KY  +   S LDTCYDLS  T V+VP I+F   G
Sbjct  587  DSGTTITQLPPTAYSALRSAFRQAMTKYKMSTPASPLDTCYDLSGSTMVTVPVITFSFKG  646

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             + ++L   G+L     S+VCLAFA + D +++ I+GNIQQ++FEVVYDVA
Sbjct  647  PIDINLDPSGVLFPVDPSKVCLAFASSSDDTNLSIYGNIQQRSFEVVYDVA  697



>ref|XP_006657126.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Oryza 
brachyantha]
Length=302

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 116/177 (66%), Gaps = 6/177 (3%)
 Frame = -3

Query  730  KRGANGHLTFGKGGA----APVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSS  563
            +    G+L FG G +    A +  TP   D G +FY++ +  I VGGK L I   VF ++
Sbjct  115  RSSGTGYLEFGPGSSPAVSAKLSTTPMLIDTGPTFYYVGMTGIRVGGKLLPIPQSVFAAA  174

Query  562  GTIIDSGTVITRLPPAAYSALRSAFRQGMSK--YPQAPALSILDTCYDLSKYTTVSVPKI  389
            GTI+DSGTVITRLPPAAYS+LRSAF   M+   Y +APALS+LDTCYDL+  + V++P +
Sbjct  175  GTIVDSGTVITRLPPAAYSSLRSAFAASMAARGYKRAPALSLLDTCYDLTGASEVAIPTV  234

Query  388  SFVLNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            S +  GGV++D+   GI+     SQ CL FAGN  A DV I GN Q +TF VVYD+A
Sbjct  235  SLLFQGGVSLDVDASGIIYAASVSQACLGFAGNEAADDVAIVGNTQLKTFGVVYDIA  291



>tpg|DAA61984.1| TPA: hypothetical protein ZEAMMB73_915310 [Zea mays]
Length=523

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 124/182 (68%), Gaps = 2/182 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            A G+L+ G   A P  ++T   T     SFY++D+  I V G+ + ++P VFK+ GT+ID
Sbjct  342  AEGYLSLGSAAAPPHAQFTAMVTRSDTPSFYYLDLVGIKVAGRTVRVAPAVFKAPGTVID  401

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLP  AYSALRS+F   M +Y +APALSILDTCYD +  T V +P ++ + +GG
Sbjct  402  SGTVITRLPSRAYSALRSSFAGFMRRYKRAPALSILDTCYDFTGRTKVQIPSVALLFDGG  461

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagG  188
             T++L   G+L     SQ CLAFA NGD + VGI GN+QQ+TF VVYD+A  K+G GA G
Sbjct  462  ATLNLGFGGVLYVANRSQACLAFASNGDDTSVGILGNMQQKTFAVVYDLANQKIGFGAKG  521

Query  187  CS  182
            CS
Sbjct  522  CS  523



>ref|XP_010108293.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXC18773.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=579

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 115/171 (67%), Gaps = 2/171 (1%)
 Frame = -3

Query  727  RGANGHLTFG-KGGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTI  554
            R + G L+FG +      K+TP ++  +   FY +D+  I+VGGK L I+  VF  +GT+
Sbjct  397  RSSTGFLSFGYRRPRKAFKFTPLSSLTKDTQFYGLDMTGISVGGKTLPITASVFSKAGTV  456

Query  553  IDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLN  374
            IDSGTVITRLPP AY A+R AFRQ MS Y  A + SILDTCYD +   +V VPKISF  +
Sbjct  457  IDSGTVITRLPPKAYDAVRKAFRQLMSDYKAAQSYSILDTCYDFTGVESVFVPKISFFFS  516

Query  373  GGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            GGV +++ + GI+     SQVCLA AGNGD SDVGIFGN Q   +EV YDV
Sbjct  517  GGVEVEVDVSGIIYAVSQSQVCLALAGNGDDSDVGIFGNFQHLKWEVAYDV  567



>gb|KHM99525.1| Aspartic proteinase nepenthesin-1 [Glycine soja]
Length=484

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 114/169 (67%), Gaps = 10/169 (6%)
 Frame = -3

Query  715  GHLTFGKGGA--APVKYTPFATDQG-ASFYFIDVQAIAVGGKQL-SISPVVFKSSGTIID  548
            GHLTFG   A  A +KYTP +T  G  +FY +D+  I+VGG +L ++S   F + G+IID
Sbjct  309  GHLTFGASAATNANLKYTPLSTISGDNTFYGLDIVGISVGGTKLPAVSSSTFSAGGSIID  368

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRL P        +FRQGM KYP A    + DTCYD S Y  +SVPKI F   GG
Sbjct  369  SGTVITRLAPTV------SFRQGMEKYPVANEDGLFDTCYDFSGYKEISVPKIDFEFAGG  422

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            VT++LPLVGI     A QVCLAFA NG+ +D+ IFGN+QQ+T EVVYDV
Sbjct  423  VTVELPLVGIFYVVSAQQVCLAFAANGNENDITIFGNVQQKTLEVVYDV  471



>emb|CDP18857.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 110/142 (77%), Gaps = 3/142 (2%)
 Frame = -3

Query  730  KRGANGHLTFGKGGAA-PVKYTPFATDQGA--SFYFIDVQAIAVGGKQLSISPVVFKSSG  560
            K G+NGHLTFGKG     VK+ PF++      +FYF+D+Q+I+VGG+ LSIS  VF+++G
Sbjct  270  KSGSNGHLTFGKGSVPNTVKFAPFSSSSSQSNAFYFLDIQSISVGGQLLSISASVFQTAG  329

Query  559  TIIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFV  380
             ++DSGTVITRLPPAAYSALRSAFRQ MS+Y  APALSILDTCYD S  +TV +PKIS V
Sbjct  330  NVVDSGTVITRLPPAAYSALRSAFRQQMSQYKTAPALSILDTCYDFSSQSTVKIPKISIV  389

Query  379  LNGGVTMDLPLVGILLGNGASQ  314
             +G V +DL + GILL + +SQ
Sbjct  390  FSGNVKVDLGIEGILLASSSSQ  411



>ref|XP_006660750.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Oryza 
brachyantha]
Length=483

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 115/169 (68%), Gaps = 2/169 (1%)
 Frame = -3

Query  718  NGHLTFGKGGAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSG-TIIDS  545
            NG+L+ G    A  ++T   T+    SFY++++  I VGG+++ +   VF ++G T+IDS
Sbjct  303  NGYLSLGDAAPANAQFTAMVTNSDNPSFYYLNLVGIKVGGREIRVPTTVFSTAGGTVIDS  362

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AY+ALRSAF + M +Y +APALSILDTCYD + + T  +PK++ +  GG 
Sbjct  363  GTVITRLPPRAYAALRSAFARYMGQYKKAPALSILDTCYDFTGHATAQIPKVALLFEGGA  422

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            TM L   G+L  +  SQ CLAFA NGD + + I GN QQ+TF V YDVA
Sbjct  423  TMSLDFTGVLYVSQVSQACLAFASNGDDTSIAILGNTQQKTFAVAYDVA  471



>gb|ACN85339.1| aspartic proteinase nepenthesin-1 precursor [Oryza granulata]
Length=521

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 116/175 (66%), Gaps = 5/175 (3%)
 Frame = -3

Query  730  KRGANGHLTFGKGGAAPV---KYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSG  560
            +    G+L FG G  A V   + TP  TD G +FY++ +  I VGG+ LSI   VF ++G
Sbjct  335  RSSGTGYLDFGPGSPAAVGARQTTPMLTDNGPTFYYVGMTGIRVGGQLLSIPQSVFSTAG  394

Query  559  TIIDSGTVITRLPPAAYSALRSAFRQGMSK--YPQAPALSILDTCYDLSKYTTVSVPKIS  386
            TI+DSGTVITRLPPAAYS+LRSAF   M+   Y +APALS+LDTCYD +  + V++PK+S
Sbjct  395  TIVDSGTVITRLPPAAYSSLRSAFASAMAARGYKKAPALSLLDTCYDFTGMSEVAIPKVS  454

Query  385  FVLNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             +  GG  +D+   GI+     SQVCL FA N D  DVGI GN Q +TF VVYD+
Sbjct  455  LLFQGGAYLDVNASGIMYAASLSQVCLGFAANEDDDDVGIVGNTQLKTFGVVYDI  509



>ref|XP_011019522.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Populus euphratica]
 ref|XP_011019526.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Populus euphratica]
 ref|XP_011019528.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Populus euphratica]
Length=474

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 111/167 (66%), Gaps = 2/167 (1%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTV  536
            G+L FG   +    +TP +    +SFY ID+  ++VGG QL I P +F +SG IIDSGTV
Sbjct  297  GYLNFGGKVSQTAGFTPISP-ASSSFYGIDIVGMSVGGSQLPIDPSIFTTSGAIIDSGTV  355

Query  535  ITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMD  356
            ITRLPP AY AL+ AF + MS YP+     +LDTCYD S YTTVS P +S    GGV +D
Sbjct  356  ITRLPPTAYKALKEAFDEKMSNYPKTNGDELLDTCYDFSNYTTVSFPMVSVSFKGGVEVD  415

Query  355  LPLVGILLG-NGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +   GIL   NG   +CLAFA N D S++GIFGN QQ+T+EVVYD A
Sbjct  416  IDASGILYPVNGVKTMCLAFAANKDDSEIGIFGNHQQKTYEVVYDGA  462



>ref|XP_011019525.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Populus euphratica]
 ref|XP_011019527.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Populus euphratica]
 ref|XP_011019529.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Populus euphratica]
Length=472

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 111/167 (66%), Gaps = 2/167 (1%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTV  536
            G+L FG   +    +TP +    +SFY ID+  ++VGG QL I P +F +SG IIDSGTV
Sbjct  295  GYLNFGGKVSQTAGFTPISP-ASSSFYGIDIVGMSVGGSQLPIDPSIFTTSGAIIDSGTV  353

Query  535  ITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMD  356
            ITRLPP AY AL+ AF + MS YP+     +LDTCYD S YTTVS P +S    GGV +D
Sbjct  354  ITRLPPTAYKALKEAFDEKMSNYPKTNGDELLDTCYDFSNYTTVSFPMVSVSFKGGVEVD  413

Query  355  LPLVGILLG-NGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +   GIL   NG   +CLAFA N D S++GIFGN QQ+T+EVVYD A
Sbjct  414  IDASGILYPVNGVKTMCLAFAANKDDSEIGIFGNHQQKTYEVVYDGA  460



>ref|XP_010266607.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=417

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 115/169 (68%), Gaps = 4/169 (2%)
 Frame = -3

Query  715  GHLTFGK--GGAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            G+L  GK     + VKYT   TD    ++YFI +  I+VGGK+LS+SP VF   GT+IDS
Sbjct  235  GYLALGKQPSTTSAVKYTKLVTDSHSPNYYFIPLIGISVGGKRLSLSPSVFTKPGTVIDS  294

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTV++RLPP AY+ LRS FR+ MS YP AP  +ILDTCY+LS+  TV+VP +     GG 
Sbjct  295  GTVVSRLPPLAYTILRSEFRRAMSNYPSAPPQAILDTCYNLSRNATVNVPPVMLHFGGGT  354

Query  364  TMDL-PLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             + L P  G+L+   AS  CL FA N + +DVGI GN+QQ+T+EVVYD+
Sbjct  355  DVQLDPFSGVLVKLDASIYCLGFAPNQNQTDVGILGNLQQRTYEVVYDL  403



>gb|ACN85295.1| aspartic proteinase nepenthesin-1 precursor [Oryza coarctata]
Length=500

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 114/175 (65%), Gaps = 5/175 (3%)
 Frame = -3

Query  730  KRGANGHLTFGKGGAAPVK---YTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSG  560
            +    G+L FG G    V     TP   D G +FY++ +  I VGGK LSI   VF +SG
Sbjct  314  RSSGTGYLDFGPGSLPAVSAKLTTPMLVDNGPTFYYVGLTGIRVGGKLLSIPQSVFTTSG  373

Query  559  TIIDSGTVITRLPPAAYSALRSAFRQGMSK--YPQAPALSILDTCYDLSKYTTVSVPKIS  386
            TI+DSGTVITRLPPAAYS+LRSAF   M++  Y +APALS+LDTCYD +  + V++P +S
Sbjct  374  TIVDSGTVITRLPPAAYSSLRSAFASAMAERGYKKAPALSLLDTCYDFTGMSEVAIPTVS  433

Query  385  FVLNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             +  GG ++D+   GI+     SQ CL FAGN +  DVGI GN Q +TF VVYD+
Sbjct  434  LLFQGGASLDVHASGIIYAASVSQACLGFAGNKEDDDVGIVGNTQLKTFGVVYDI  488



>ref|XP_010256102.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=483

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 131/184 (71%), Gaps = 4/184 (2%)
 Frame = -3

Query  721  ANGHLTFGKGG---AAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTI  554
            + G L FG      ++ VKYT   TD +G SFYF  +  I+VGG++LSI   VF SSGTI
Sbjct  300  STGFLAFGDQAGTSSSGVKYTSLLTDSRGPSFYFASLNGISVGGQRLSIPTTVFTSSGTI  359

Query  553  IDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLN  374
            IDSGTVITRLPPAAYSALRSAFRQ  S YP AP+ SILDTC++    +T+ +PKI     
Sbjct  360  IDSGTVITRLPPAAYSALRSAFRQATSSYPSAPSYSILDTCFNPGGQSTIRIPKIVLHFA  419

Query  373  GGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgiga  194
            GGV +D+   GI++   +SQ+CLAFAGN   S V I GN QQ+TFEVVYDVAGGKLG GA
Sbjct  420  GGVDLDVDASGIVILASSSQLCLAFAGNSSPSSVAILGNTQQKTFEVVYDVAGGKLGFGA  479

Query  193  gGCS  182
            GGCS
Sbjct  480  GGCS  483



>gb|ACN85225.1| aspartic proteinase nepenthesin-1 precursor [Oryza punctata]
 gb|ACN85232.1| aspartic proteinase nepenthesin-1 precursor [Oryza minuta]
Length=516

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 113/169 (67%), Gaps = 3/169 (2%)
 Frame = -3

Query  718  NGHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
             G+L FG G  AA +  TP   D G +FY++ +  I VGG+ L I   VF ++GTI+DSG
Sbjct  336  TGYLDFGAGSPAARLTTTPMLVDNGPTFYYVGLTGIRVGGRLLYIPQSVFATAGTIVDSG  395

Query  541  TVITRLPPAAYSALRSAFRQGMSK--YPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            TVITRLPPAAYS+LRSAF   MS   Y +APA+S+LDTCYD +  + V++P +S +  GG
Sbjct  396  TVITRLPPAAYSSLRSAFAAAMSARGYKKAPAVSLLDTCYDFAGMSQVAIPTVSLLFQGG  455

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
              +D+   GI+    ASQVCLAFA N D  DVGI GN Q +TF V YD+
Sbjct  456  ARLDVDASGIMYAASASQVCLAFAANEDGGDVGIVGNTQLKTFGVAYDI  504



>gb|EMT21644.1| Aspartic proteinase nepenthesin-2 [Aegilops tauschii]
Length=213

 Score =   162 bits (409),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 112/169 (66%), Gaps = 3/169 (2%)
 Frame = -3

Query  718  NGHLTFGKGGAAP-VKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
             G+L FG G A    + TP  TD+G +FY++ +  I VGG+Q+ I+  VF ++GT++DSG
Sbjct  33   TGYLDFGPGSAGNNARLTPMLTDKGPTFYYVGMTGIRVGGQQVPIAESVFSTAGTLVDSG  92

Query  541  TVITRLPPAAYSALRSAFRQGMSK--YPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            TVITRLP  AY+AL  AF  GMS   Y  APA SILDTCYD +  + V++P +S V  GG
Sbjct  93   TVITRLPATAYTALSKAFATGMSASGYKTAPAYSILDTCYDFTGLSDVALPTVSLVFQGG  152

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
              +D+ + GI+     +QVCLAFA NGD   V I GN QQ+T+ V+YD+
Sbjct  153  ACLDVDVSGIVYAISQAQVCLAFASNGDDESVAIVGNTQQKTYGVLYDL  201



>dbj|BAJ99659.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=484

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 122/183 (67%), Gaps = 3/183 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            A G+L+ G    A  ++T   T   + SFY++ +  + V G+ + +SP+VF ++GT+IDS
Sbjct  302  AAGYLSLGGPAPANARFTAMETRHDSPSFYYVRLVGVKVAGRTVRVSPIVFSAAGTVIDS  361

Query  544  GTVITRLPPAAYSALRSAFRQGMSKY--PQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            GTVITRLPP  Y+ALRSAF + M +Y   +APALSILDTCYD + +TTV +P ++ V  G
Sbjct  362  GTVITRLPPRVYAALRSAFARSMGRYGYKRAPALSILDTCYDFTGHTTVRIPSVALVFAG  421

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigag  191
            G  + L   G+L     SQ CLAFA NGD +D GI GN QQ+T  VVYDVA  K+G GA 
Sbjct  422  GAAVGLDFSGVLYVAKVSQACLAFAPNGDGADAGIIGNTQQKTLAVVYDVARQKIGFGAN  481

Query  190  GCS  182
            GCS
Sbjct  482  GCS  484



>ref|XP_004957153.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=472

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -3

Query  715  GHLTFGKGGAAPVKYTPF-ATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            G+L+ G    +  ++T   A     SFY++D+ AI V G+ +SI   V K+ GT+IDSGT
Sbjct  294  GYLSLGGAAPSNAQFTAMVARSDTPSFYYLDLVAIKVAGRTVSIPAAVLKAPGTVIDSGT  353

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLP  AY ALRS+F   M +Y +APALS+LDTCYD + + TV +P ++ V +GGVT+
Sbjct  354  VITRLPDTAYRALRSSFAGFMRRYKRAPALSLLDTCYDFTGHRTVQIPSVALVFSGGVTV  413

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             L   G+L  +  SQ CLAFA NGD + +GI GN QQ+TF VVYDVA
Sbjct  414  SLDFSGVLYVSKVSQACLAFASNGDDTSIGILGNTQQKTFAVVYDVA  460



>gb|ABP93696.1| unknown protein isoform 1 [Lemna minor]
Length=350

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 114/169 (67%), Gaps = 3/169 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            A G+L  G     P  YT   T+  A + YFID+  I+VGG +L++S  VF+S GTIIDS
Sbjct  172  ATGYLNIGNPLRTP-GYTAMLTNSRAPTLYFIDLIGISVGGTRLALSSTVFQSVGTIIDS  230

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AY ALR+AFR  M++Y +A A SILDTCYD S+ TTV+ P I      G+
Sbjct  231  GTVITRLPPTAYGALRTAFRAAMTQYTRAAAASILDTCYDFSRTTTVTFPTIKLHYT-GL  289

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             + +P  G+     +SQVCLAFAGN D++ +GI GN+QQ+T EV YD A
Sbjct  290  DVTIPGAGVFYVISSSQVCLAFAGNSDSTQIGIIGNVQQRTMEVTYDNA  338



>ref|XP_010913305.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=636

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 113/170 (66%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+LT G  G +P VK+TP  T+  A SFYF+++  + VG K LSI    F   GTIID
Sbjct  455  STGYLTLGASGPSPNVKFTPMLTEPAAPSFYFVELMGLRVGEKNLSIPSSTFTDVGTIID  514

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLP + YSALR  FR+ M+ Y  AP LSI DTCY+ +   +VS+P +  + +GG
Sbjct  515  SGTVITRLPSSGYSALRDEFRRQMANYSMAPPLSIFDTCYNFTGVVSVSLPPVGLLFSGG  574

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            VT+D+   GIL     SQ CLAFA N D   + I GN+QQ+T+++VYDVA
Sbjct  575  VTLDVDPSGILYVVSMSQACLAFAANDDPGSISIIGNVQQRTYDIVYDVA  624


 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 105/169 (62%), Gaps = 2/169 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+L  G     P +K+TP  T+    SFYF+++  + V GK LSI   VF + G IID
Sbjct  45   STGYLMLGAAMNPPNIKFTPMPTESNNPSFYFVELIGLTVRGKDLSIPSSVFTNVGNIID  104

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLP   Y+ALRS FRQ MS Y       ILDTCY+ + Y+ +++P ++   + G
Sbjct  105  SGTVITRLPTETYTALRSEFRQHMSSYQLVQPYDILDTCYNFTGYSRITIPAVALQFSNG  164

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            V++++   GIL     SQ CLAFAG  D + V I GN+ Q+TF VVYDV
Sbjct  165  VSLNVDASGILYFASPSQACLAFAGKDDENFVSIVGNMLQRTFHVVYDV  213



>gb|ACN85307.1| aspartic proteinase nepenthesin-1 precursor [Oryza ridleyi]
Length=525

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 114/175 (65%), Gaps = 5/175 (3%)
 Frame = -3

Query  730  KRGANGHLTFGKGGAAPVKY---TPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSG  560
            +    G+L FG G +  V     TP   D G +FY++ +  I VGGK LSI P VF ++G
Sbjct  339  RSSGTGYLDFGPGSSPAVSTKLTTPMLVDNGLTFYYVGLTGIRVGGKLLSIPPSVFTTAG  398

Query  559  TIIDSGTVITRLPPAAYSALRSAFRQGMSK--YPQAPALSILDTCYDLSKYTTVSVPKIS  386
            TI+DSGTVITRLPPAAYS+LRSAF   ++   Y +APALS+LDTCYD +  + V++P +S
Sbjct  399  TIVDSGTVITRLPPAAYSSLRSAFASAIAARGYKKAPALSLLDTCYDFTGMSQVAIPTVS  458

Query  385  FVLNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             +  GG ++D+   GI+     SQ CL FA N +  DVGI GN Q +TF VVYD+
Sbjct  459  LLFQGGASLDVDASGIIYAASVSQACLGFAANEEDDDVGIVGNTQLKTFGVVYDI  513



>ref|XP_009390626.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=445

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 118/182 (65%), Gaps = 9/182 (5%)
 Frame = -3

Query  721  ANGHLTFGK-GGAAPVKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G L  G+ G A+   YT   T     SFYF+D+  I+VGG+QL ISP VF S GTIID
Sbjct  271  STGFLKLGEPGDASNTVYTRMQTSSNHPSFYFLDLIGISVGGQQLDISPSVFSSRGTIID  330

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGT ITRLP +AY ALRSAFR  MS+YP AP   +LDTCYD S Y T++VPK++ + + G
Sbjct  331  SGTTITRLPASAYGALRSAFRCYMSQYPAAPPTRVLDTCYDFSGYETITVPKVALLFD-G  389

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagG  188
            VTMDL + GIL+       CLAF G       GI GN+QQQTFEVVYD+   ++G     
Sbjct  390  VTMDLDISGILMHG-----CLAFTGY-KGGRFGIIGNVQQQTFEVVYDLGNERIGFVPQA  443

Query  187  CS  182
            CS
Sbjct  444  CS  445



>gb|ACF84853.1| unknown [Zea mays]
 gb|ACF85941.1| unknown [Zea mays]
Length=208

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 107/153 (70%), Gaps = 6/153 (4%)
 Frame = -3

Query  679  VKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSAL  500
            VK     + Q  +FY + +QAI VGG+QLSI   VF S+GT++DSGTVITRLPP AYSAL
Sbjct  50   VKTPMLRSSQVPTFYGVRLQAIRVGGRQLSIPASVF-SAGTVMDSGTVITRLPPTAYSAL  108

Query  499  RSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNGA  320
             SAF+ GM +YP A    ILDTC+D S  ++VS+P ++ V +GG  + L   GI+L N  
Sbjct  109  SSAFKAGMKQYPPAQPSGILDTCFDFSGQSSVSIPSVALVFSGGAVVSLDASGIILSN--  166

Query  319  SQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
               CLAFAGN D S +GI GN+QQ+TFEV+YDV
Sbjct  167  ---CLAFAGNSDDSSLGIIGNVQQRTFEVLYDV  196



>ref|XP_009390625.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=450

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 118/182 (65%), Gaps = 9/182 (5%)
 Frame = -3

Query  721  ANGHLTFGK-GGAAPVKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G L  G+ G A+   YT   T     SFYF+D+  I+VGG+QL ISP VF S GTIID
Sbjct  276  STGFLKLGEPGDASNTVYTRMQTSSNHPSFYFLDLIGISVGGQQLDISPSVFSSRGTIID  335

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGT ITRLP +AY ALRSAFR  MS+YP AP   +LDTCYD S Y T++VPK++ + + G
Sbjct  336  SGTTITRLPASAYGALRSAFRCYMSQYPAAPPTRVLDTCYDFSGYETITVPKVALLFD-G  394

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagG  188
            VTMDL + GIL+       CLAF G       GI GN+QQQTFEVVYD+   ++G     
Sbjct  395  VTMDLDISGILMHG-----CLAFTGY-KGGRFGIIGNVQQQTFEVVYDLGNERIGFVPQA  448

Query  187  CS  182
            CS
Sbjct  449  CS  450



>ref|XP_011463538.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Fragaria 
vesca subsp. vesca]
Length=313

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 112/174 (64%), Gaps = 6/174 (3%)
 Frame = -3

Query  721  ANGHLTFGK---GGAAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTI  554
            + G+L+FG       A +KYT   T   G+++Y +++  I V G++LSI   VF S GTI
Sbjct  129  STGYLSFGSPTGASNAAIKYTRLTTLSSGSTYYGLNLVGINVNGQKLSIPASVFSSPGTI  188

Query  553  IDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLN  374
            IDSGTVI+RLPP A+SALR AF+  M+ YP  P    LDTCYDL+   TV+ PKI FV  
Sbjct  189  IDSGTVISRLPPTAFSALRDAFQAAMTSYPSVPGDGFLDTCYDLNCNPTVTYPKIEFVFG  248

Query  373  GGVTMDLPLVGI--LLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             GVT+ L   GI  LL     QVCLAF GN DA ++ IFGN QQ+  EV+YDVA
Sbjct  249  DGVTLTLDATGIVYLLDGTMKQVCLAFVGNDDADELTIFGNTQQKNMEVLYDVA  302



>ref|XP_010422811.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=467

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 108/167 (65%), Gaps = 3/167 (2%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GHLTFG  G +  VKYTP ++   +S Y ID+  I VG K+L I+P  F + G IIDSGT
Sbjct  291  GHLTFGSAGISESVKYTPISSFPSSSLYGIDIVGIRVGDKELEITPTSFSTDGAIIDSGT  350

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLP   Y+ + S F++ MS Y      SILDTCYD +   TV++P I+F  +GG  +
Sbjct  351  VITRLPTKVYAEMSSVFKEKMSSYKTTSGRSILDTCYDFTGLATVTIPTIAFTFSGGTVV  410

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             L  +GIL     SQVCLAFAG+ D   + IFGN+QQ T E+VYDVA
Sbjct  411  KLDGIGILYQITQSQVCLAFAGDDDI--LAIFGNVQQTTLEIVYDVA  455



>ref|XP_009391129.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 118/182 (65%), Gaps = 9/182 (5%)
 Frame = -3

Query  721  ANGHLTFGK-GGAAPVKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G L  G+ G A+   YT   T     SFYF+D+  I+VGG+QL+ISP VF S GTIID
Sbjct  303  STGFLKLGEPGDASNTVYTRMQTSSNHPSFYFVDLIGISVGGQQLAISPSVFSSRGTIID  362

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGT ITRLP +AY ALRSAFR  MS+YP AP   +LDTCYD S Y T+SVPK++   + G
Sbjct  363  SGTTITRLPASAYGALRSAFRSYMSQYPAAPPTRVLDTCYDFSGYETISVPKVALHFD-G  421

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagG  188
            VT+DL   GIL        CLAFAG    S  GI GN+QQQTFEVVYD+   ++G     
Sbjct  422  VTLDLDTSGIL-----RHGCLAFAGYQGGS-FGIIGNVQQQTFEVVYDLGNERIGFVPQA  475

Query  187  CS  182
            CS
Sbjct  476  CS  477



>ref|XP_007021889.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY13414.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=685

 Score =   167 bits (422),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 115/170 (68%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFG-KGGAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+L FG K   + V++TP ++  QG  +Y +D+  I VGG++LSI   VF +SGT+ID
Sbjct  504  STGYLRFGDKNLPSSVQFTPMSSSFQGTHYYGLDIVDIGVGGERLSIDRSVFTTSGTVID  563

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            S ++ITRLPPAAYS +R AF   M+KYP+APA   L TC+D S  T+V +P IS   +GG
Sbjct  564  SASLITRLPPAAYSRVRRAFEVRMTKYPRAPAFESLGTCFDFSGNTSVVMPTISLYFDGG  623

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            + M +   GIL  N  SQ CLAFA NGD SDV I GN QQ+ +EVVYD A
Sbjct  624  LEMPIDARGILYVNKISQACLAFAKNGDDSDVMILGNFQQKGYEVVYDDA  673


 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 111/170 (65%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFG-KGGAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+L FG K   + V++TP +   QG  +Y +D+  I VGG++LSI   VF +SG +ID
Sbjct  94   STGYLRFGDKNLPSSVQFTPMSNSFQGTHYYGLDIVDIGVGGERLSIDRSVFTTSGAVID  153

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            S ++ITRLPPAAYS +R AF   M+KYP+APA   L TC+D S  T+V +P IS    GG
Sbjct  154  SASLITRLPPAAYSRVRRAFEVRMTKYPRAPAFESLGTCFDFSGNTSVVMPTISLYFEGG  213

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            + M +   GIL  N  SQ CLAFA N D SDV I GN QQ+ +EVVYD A
Sbjct  214  LEMPIDARGILYVNKISQACLAFAKNSDDSDVMILGNFQQKGYEVVYDDA  263



>gb|ACN85284.1| aspartic proteinase nepenthesin-1 precursor [Oryza australiensis]
Length=519

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 112/175 (64%), Gaps = 5/175 (3%)
 Frame = -3

Query  730  KRGANGHLTFGKGGAAPVK---YTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSG  560
            +    G+L FG G  A       TP  TD G +FY++ +  I VGG+ LSI   VF ++G
Sbjct  333  RSSGTGYLDFGPGSPAAAGARLTTPMLTDNGPTFYYVGMTGIRVGGQLLSIPQSVFTTAG  392

Query  559  TIIDSGTVITRLPPAAYSALRSAFRQGMSK--YPQAPALSILDTCYDLSKYTTVSVPKIS  386
            TI+DSGTVITRLPPAAYS+LRSAF   M+   Y +APA+S+LDTCYD +  + V++P +S
Sbjct  393  TIVDSGTVITRLPPAAYSSLRSAFASAMAARGYKKAPAVSLLDTCYDFTGMSQVAIPTVS  452

Query  385  FVLNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             +  GG  +D+   GI+     SQVCL FA N D  DVGI GN Q +TF V YD+
Sbjct  453  LLFQGGARLDVDASGIMYAASVSQVCLGFAANEDGGDVGIVGNTQLKTFGVAYDI  507



>emb|CDX97054.1| BnaC09g45710D [Brassica napus]
Length=473

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 111/166 (67%), Gaps = 6/166 (4%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPF-ATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G +  VKYTP  A    ASFY +D+  I+V  KQL I      ++G +IDSG
Sbjct  298  GHLTFGSAGLSNSVKYTPISAVPYSASFYGLDIVGISVDDKQLEIP----STTGAVIDSG  353

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLPP AY+ALR+AF++ MS Y      SILDTCYD +   T+++PK+SF   GG  
Sbjct  354  TVITRLPPMAYAALRTAFKEKMSNYKTTLGRSILDTCYDFTGQETMNIPKVSFSFKGGTV  413

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
            ++L  +G+L     S VCLAFAGN +  DV IFGN+QQ+T +VVYD
Sbjct  414  VELDSIGVLYVFNKSTVCLAFAGNSNDDDVTIFGNVQQKTMQVVYD  459



>ref|XP_008779067.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Phoenix dactylifera]
Length=442

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 113/170 (66%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP-VKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+LT G  G AP V++TP  T+    SFY++++  ++VGGK L I P  F  +GTIID
Sbjct  261  STGYLTLGASGPAPNVRFTPMLTNPAKPSFYYVELIGLSVGGKNLPIPPSTFTDTGTIID  320

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVIT LP + YSALR  FR+ M+ Y  AP L +LDTCY+ +   ++S+P +    +GG
Sbjct  321  SGTVITYLPSSGYSALRDEFRRQMANYSMAPPLPMLDTCYNFTGVGSISLPSVGLRFSGG  380

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            VT+D+   GIL     SQ CLAF+GN D S + I GN  Q+T+++VYDVA
Sbjct  381  VTLDVDPSGILYPASISQACLAFSGNSDPSSISIIGNTVQRTYDIVYDVA  430



>ref|XP_004959561.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=486

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 111/170 (65%), Gaps = 5/170 (3%)
 Frame = -3

Query  721  ANGHLTFGKGGAAP---VKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            A G+L FG  GAAP    ++T        S Y++D+  I V G++L I P VF + GTII
Sbjct  306  AEGYLAFG--GAAPPPNAQFTEMVNGAEPSSYYLDLVGIKVAGRELEIPPAVFAAGGTII  363

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            D+GTVI+RLPP AY+ALRSAF + M+ Y +APALS+LDTCY+ + +T V +P  + V  G
Sbjct  364  DTGTVISRLPPRAYAALRSAFVRSMAAYRRAPALSLLDTCYNFTGHTRVRIPSAALVFAG  423

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            G T+ L   G+L  +  SQ CL FA  GD + V I GN QQ+TF V+YDV
Sbjct  424  GTTVSLNARGLLFVSTVSQTCLGFASTGDETTVNILGNTQQKTFTVIYDV  473



>gb|ABP93697.1| unknown protein isoform 2 [Lemna minor]
Length=351

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 114/168 (68%), Gaps = 5/168 (3%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            A G+L  G     P  YT   TD    + YFID+  I+VGG +LS+S  VF+S GTIIDS
Sbjct  173  ATGYLNIGNPQNTP-GYTAMLTDTRVPTLYFIDLIGISVGGTRLSLSSTVFQSVGTIIDS  231

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLN-GG  368
            GTVITRLPP AYSAL++A R  M++Y  APA++ILDTCYD S+ T+V  P I  VL+  G
Sbjct  232  GTVITRLPPTAYSALKTAVRAAMTQYTLAPAVTILDTCYDFSRTTSVVYPVI--VLHFAG  289

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
            + + +P  G+     +SQVCLAFAGN D++ +GI GN+QQ T EV YD
Sbjct  290  LDVRIPATGVFFVFNSSQVCLAFAGNTDSTMIGIIGNVQQLTMEVTYD  337



>ref|XP_002515386.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
 gb|EEF46835.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
Length=387

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 110/170 (65%), Gaps = 2/170 (1%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            + GHLT G      VK+TP +   +   FY ID++ ++VGG  L I   VF ++G IIDS
Sbjct  206  STGHLTLGGQVPKSVKFTPLSPAFKNTPFYGIDIKGLSVGGHVLPIDASVFSNAGAIIDS  265

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRL P  YSAL S F+Q M  YP+    SILDTCYD S   ++SVP+ISF   GGV
Sbjct  266  GTVITRLQPTVYSALSSKFQQLMKDYPKTDGFSILDTCYDFSGNESISVPRISFFFKGGV  325

Query  364  TMDLPLVGIL-LGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             +D+   GIL + N   +VCLAFA N D  D  +FGN QQQT++VV+D+A
Sbjct  326  EVDIKFFGILTVINAWDKVCLAFAPNDDDGDFVVFGNSQQQTYDVVHDLA  375



>ref|XP_009390629.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=442

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 119/180 (66%), Gaps = 9/180 (5%)
 Frame = -3

Query  715  GHLTFGK-GGAAPVKYTPFATD-QGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            G L  G+   A+   YT   T  +  SFYF+D+  I+V G+QL+ISP VF+S GTI+DSG
Sbjct  270  GFLKLGEPSDASNTVYTRMQTSSKYPSFYFVDLIGISVAGEQLAISPSVFRSGGTILDSG  329

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            T ITRLPP+AY ALRSAFR+ MS YP  P   +LDTCYD S Y T++VPK++   + GVT
Sbjct  330  TTITRLPPSAYEALRSAFREHMSAYPLKPTNGLLDTCYDFSGYKTITVPKVALHFD-GVT  388

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagGCS  182
            +DL + GIL  +     CLAF+G      +GI GN+QQ+TFEVVYDV   ++G     CS
Sbjct  389  LDLNVSGILRHD-----CLAFSGK-QVDRLGIIGNVQQRTFEVVYDVGNERIGFAPHACS  442



>emb|CDY70207.1| BnaA10g30140D [Brassica napus]
Length=472

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 108/167 (65%), Gaps = 3/167 (2%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            GHLTFG  G +   +KYTP +T    +S Y +D+  I+V  K+L I   VF + G IIDS
Sbjct  292  GHLTFGSAGLSNSLLKYTPVSTVKDSSSLYGLDIVGISVDDKELKIPLTVFSTPGAIIDS  351

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GTVITRLPP AY+ALR+AF++ MS Y  A  L  LDTCYD +   ++ VPK+SF   GG 
Sbjct  352  GTVITRLPPKAYAALRTAFKEKMSNYTAAAGLPPLDTCYDFTGVESIDVPKVSFSFKGGT  411

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYD  224
             ++L  +G+L     SQVCLAF  N    DV I GN+QQ+T +VVYD
Sbjct  412  VVELEPIGVLFVADRSQVCLAFIANDKDDDVAILGNVQQKTLQVVYD  458



>ref|XP_010108295.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXC18775.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=433

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 115/173 (66%), Gaps = 7/173 (4%)
 Frame = -3

Query  721  ANGHLTFGK-GGAAPVKYTPFATDQG--ASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            ++G+LTFG  GG   V+YTP  T  G  +SFY +++  I+VGG++L I    F+S GT+I
Sbjct  249  SSGYLTFGNSGGGGSVQYTPLLTPSGGLSSFYVLNLVGISVGGRRLEIPATAFQS-GTVI  307

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYT--TVSVPKISFVL  377
            DSGTVI+RLPPA Y ALR+ FR+ MS+YP      +LDTCYD S     TV +P I+F+ 
Sbjct  308  DSGTVISRLPPAVYDALRTEFRKDMSRYPLVSGDRLLDTCYDFSGSANGTVEIPNITFLF  367

Query  376  NGGVTMDLPLVGILLG-NGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             GG ++DL     L G +   + CLAFAGN    D+ IFGN+QQ TF+VVYDV
Sbjct  368  GGGTSVDLGPENTLFGVSNPQRFCLAFAGNDKDDDIAIFGNVQQLTFQVVYDV  420



>gb|ACN85278.1| aspartic proteinase nepenthesin-1 precursor [Oryza alta]
Length=518

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 111/175 (63%), Gaps = 5/175 (3%)
 Frame = -3

Query  730  KRGANGHLTFGKGGAAPVK---YTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSG  560
            +    G+L FG G  A       TP  TD G +FY++ +  I VGG+ LSI   VF ++G
Sbjct  332  RSSGTGYLDFGPGSPAAAGARLTTPMLTDNGPTFYYVGMTGIRVGGQLLSIPQSVFATAG  391

Query  559  TIIDSGTVITRLPPAAYSALRSAFRQGMSK--YPQAPALSILDTCYDLSKYTTVSVPKIS  386
            TI+DSGTVITRLPP AYS+LRSAF   M+   Y +APA+S+LDTCYD +  + V++P +S
Sbjct  392  TIVDSGTVITRLPPPAYSSLRSAFVSAMAARGYKKAPAVSLLDTCYDFTGMSQVAIPTVS  451

Query  385  FVLNGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             +  GG  +D+   GI+     SQVCL FA N D  DVGI GN Q +TF V YD+
Sbjct  452  LLFQGGAILDVDASGIMYAASVSQVCLGFAANEDGGDVGIVGNTQLKTFGVAYDI  506



>gb|EMT32055.1| Aspartic proteinase nepenthesin-2 [Aegilops tauschii]
Length=232

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 110/165 (67%), Gaps = 11/165 (7%)
 Frame = -3

Query  700  GKGGAA---PVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVIT  530
            G GGA     VK     + Q  +FYF+ ++AI VGGKQL+I   VF S+G+I+DSGT+IT
Sbjct  61   GLGGATLGFTVKTPMLRSKQLPTFYFVQLEAIRVGGKQLNIPTSVF-SAGSIMDSGTIIT  119

Query  529  RLPPAAYSALRSAFRQGMSKYP--QAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMD  356
            RLP  AYSAL SAF+ GM  YP  Q  A  ILDTC+D S  +TV++P ++ V +GG  +D
Sbjct  120  RLPRTAYSALSSAFKAGMKHYPPAQPRARGILDTCFDFSGQSTVNIPSVTLVFSGGAVID  179

Query  355  LPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            L   GI+L N     CLAFA N D S +G  GN+QQQTFEV+YDV
Sbjct  180  LAFNGIILDN-----CLAFAANRDDSSLGTIGNVQQQTFEVLYDV  219



>ref|XP_009390624.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=443

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 116/180 (64%), Gaps = 8/180 (4%)
 Frame = -3

Query  715  GHLTFGK-GGAAPVKYTPFATDQG-ASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            G L  G+ G A+   YT   T     S+YF+D+  I+V G+QL+ISP VF+S GT +DSG
Sbjct  270  GFLKLGETGDASNTVYTGMLTSSNDPSYYFVDLIGISVAGEQLAISPSVFRSGGTFLDSG  329

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            T ITRLPP+AY ALRSAFR+ MS YP  P   +LDTCYDLS Y T++VP I+     G+T
Sbjct  330  TTITRLPPSAYEALRSAFREHMSAYPLKPTNGLLDTCYDLSGYETITVPSIALQFGDGIT  389

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigagGCS  182
            +D+   GIL  +     CLAF+ N     +GI GN+QQ+T+EVVYDV   ++G     CS
Sbjct  390  LDVDSSGILFHD-----CLAFSAN-QVGGLGIIGNVQQRTYEVVYDVGNERIGFAPNACS  443



>gb|ACN29145.1| unknown [Zea mays]
 gb|AFW63717.1| hypothetical protein ZEAMMB73_445506 [Zea mays]
Length=385

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 107/153 (70%), Gaps = 6/153 (4%)
 Frame = -3

Query  679  VKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSAL  500
            VK     + Q  +FY + +QAI VGG+QLSI   VF S+GT++DSGTVITRLPP AYSAL
Sbjct  227  VKTPMLRSSQVPTFYGVRLQAIRVGGRQLSIPASVF-SAGTVMDSGTVITRLPPTAYSAL  285

Query  499  RSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNGA  320
             SAF+ GM +YP A    ILDTC+D S  ++VS+P ++ V +GG  + L   GI+L N  
Sbjct  286  SSAFKAGMKQYPPAQPSGILDTCFDFSGQSSVSIPSVALVFSGGAVVSLDASGIILSN--  343

Query  319  SQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
               CLAFAGN D S +GI GN+QQ+TFEV+YDV
Sbjct  344  ---CLAFAGNSDDSSLGIIGNVQQRTFEVLYDV  373



>gb|ACN85177.1| aspartic proteinase nepenthesin-1 precursor [Oryza nivara]
 gb|ACN85193.1| aspartic proteinase nepenthesin-1 precursor [Oryza rufipogon]
Length=515

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 112/168 (67%), Gaps = 2/168 (1%)
 Frame = -3

Query  718  NGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
             G+L FG G       TP  T  G +FY++ +  I VGG+ L I+P VF ++GTI+DSGT
Sbjct  336  TGYLDFGAGSPPATTTTPMLTGNGPTFYYVGMTGIRVGGRLLPIAPSVFAAAGTIVDSGT  395

Query  538  VITRLPPAAYSALRSAFRQGMSK--YPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            VITRLPPAAYS+LRSAF   M+   Y +A A+S+LDTCYD +  + V++P +S +  GG 
Sbjct  396  VITRLPPAAYSSLRSAFAAAMAARGYRKAAAVSLLDTCYDFTGMSQVAIPTVSLLFQGGA  455

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             +D+   GI+    ASQVCLAFAGN D  DVGI GN Q +TF V YD+
Sbjct  456  ALDVDASGIMYTVSASQVCLAFAGNEDGGDVGIVGNTQLKTFGVAYDI  503



>gb|ACN85210.1| aspartic proteinase nepenthesin-1 precursor [Oryza glaberrima]
Length=516

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 112/168 (67%), Gaps = 2/168 (1%)
 Frame = -3

Query  718  NGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
             G+L FG G       TP  T  G +FY++ +  I VGG+ L I+P VF ++GTI+DSGT
Sbjct  337  TGYLDFGAGSPPATTTTPMLTGNGPTFYYVGMTGIRVGGRLLPIAPSVFAAAGTIVDSGT  396

Query  538  VITRLPPAAYSALRSAFRQGMSK--YPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            VITRLPPAAYS+LRSAF   M+   Y +A A+S+LDTCYD +  + V++P +S +  GG 
Sbjct  397  VITRLPPAAYSSLRSAFAAAMAARGYRKAAAVSLLDTCYDFTGMSQVAIPTVSLLFQGGA  456

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             +D+   GI+    ASQVCLAFAGN D  DVGI GN Q +TF V YD+
Sbjct  457  ALDVDASGIMYTVSASQVCLAFAGNEDGGDVGIVGNTQLKTFGVAYDI  504



>ref|XP_008679061.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Zea 
mays]
 gb|AFW63714.1| hypothetical protein ZEAMMB73_300584 [Zea mays]
Length=458

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 116/168 (69%), Gaps = 1/168 (1%)
 Frame = -3

Query  724  GANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            G++G LT G G +  VK     + Q  ++Y + +++I VG +QL++   VF S+G+++DS
Sbjct  280  GSSGFLTLGTGSSGFVKTPMLRSTQIPTYYVVLLESIKVGSQQLNLPTSVF-SAGSLMDS  338

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GT+ITRLPP AYSAL SAF+ GM +YP A    ILDTC+D S  +++S+P ++ V +GG 
Sbjct  339  GTIITRLPPTAYSALSSAFKAGMQQYPPATPSGILDTCFDFSGQSSISIPTVTLVFSGGA  398

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             +DL   GI+L   +S  CLAF  NGD S +GI GN+QQ+TFEV+YDV
Sbjct  399  AVDLAFDGIMLEISSSIRCLAFTPNGDDSSLGIIGNVQQRTFEVLYDV  446



>ref|NP_001058055.1| Os06g0610800 [Oryza sativa Japonica Group]
 dbj|BAD35493.1| putative nucleoid DNA-binding protein cnd41, chloroplast [Oryza 
sativa Japonica Group]
 dbj|BAF19969.1| Os06g0610800 [Oryza sativa Japonica Group]
 gb|EEC80962.1| hypothetical protein OsI_23679 [Oryza sativa Indica Group]
Length=519

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 112/168 (67%), Gaps = 2/168 (1%)
 Frame = -3

Query  718  NGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
             G+L FG G       TP  T  G +FY++ +  I VGG+ L I+P VF ++GTI+DSGT
Sbjct  340  TGYLDFGAGSPPATTTTPMLTGNGPTFYYVGMTGIRVGGRLLPIAPSVFAAAGTIVDSGT  399

Query  538  VITRLPPAAYSALRSAFRQGMSK--YPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            VITRLPPAAYS+LRSAF   M+   Y +A A+S+LDTCYD +  + V++P +S +  GG 
Sbjct  400  VITRLPPAAYSSLRSAFAAAMAARGYRKAAAVSLLDTCYDFTGMSQVAIPTVSLLFQGGA  459

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             +D+   GI+    ASQVCLAFAGN D  DVGI GN Q +TF V YD+
Sbjct  460  ALDVDASGIMYTVSASQVCLAFAGNEDGGDVGIVGNTQLKTFGVAYDI  507



>gb|ACF88017.1| unknown [Zea mays]
Length=461

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 107/153 (70%), Gaps = 6/153 (4%)
 Frame = -3

Query  679  VKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSAL  500
            VK     + Q  +FY + +QAI VGG+QLSI   VF S+GT++DSGTVITRLPP AYSAL
Sbjct  303  VKTPMLRSSQVPTFYGVRLQAIRVGGRQLSIPASVF-SAGTVMDSGTVITRLPPTAYSAL  361

Query  499  RSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNGA  320
             SAF+ GM +YP A    ILDTC+D S  ++VS+P ++ V +GG  + L   GI+L N  
Sbjct  362  SSAFKAGMKQYPPAQPSGILDTCFDFSGQSSVSIPSVALVFSGGAVVSLDASGIILSN--  419

Query  319  SQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
               CLAFAGN D S +GI GN+QQ+TFEV+YDV
Sbjct  420  ---CLAFAGNSDDSSLGIIGNVQQRTFEVLYDV  449



>ref|XP_002324354.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEF02919.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=471

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 114/171 (67%), Gaps = 4/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            + GHL+FG G +   K+TP  T +    Y +DV  I+VGG++L I P VF+++GTIIDSG
Sbjct  291  STGHLSFGGGVSQAAKFTPI-TSKIPELYGLDVSGISVGGRKLPIDPSVFRTAGTIIDSG  349

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYT--TVSVPKISFVLNGG  368
            T +T LP  A+SAL SAF++ M+ Y      S L  CYD SK+    +++P+IS    GG
Sbjct  350  TTLTYLPSTAHSALSSAFQEMMTNYTLTKGTSGLQPCYDFSKHANDNITIPQISIFFEGG  409

Query  367  VTMDLPLVGILL-GNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            V +D+   GI +  NG  +VCLAF  NG+ +DV IFGN+QQ+T+EVVYDVA
Sbjct  410  VEVDIDDSGIFIAANGLEEVCLAFKDNGNDTDVAIFGNVQQKTYEVVYDVA  460



>gb|AFW63716.1| aspartic proteinase nepenthesin-2 [Zea mays]
Length=531

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 107/153 (70%), Gaps = 6/153 (4%)
 Frame = -3

Query  679  VKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSAL  500
            VK     + Q  +FY + +QAI VGG+QLSI   VF S+GT++DSGTVITRLPP AYSAL
Sbjct  373  VKTPMLRSSQVPTFYGVRLQAIRVGGRQLSIPASVF-SAGTVMDSGTVITRLPPTAYSAL  431

Query  499  RSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNGA  320
             SAF+ GM +YP A    ILDTC+D S  ++VS+P ++ V +GG  + L   GI+L N  
Sbjct  432  SSAFKAGMKQYPPAQPSGILDTCFDFSGQSSVSIPSVALVFSGGAVVSLDASGIILSN--  489

Query  319  SQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
               CLAFAGN D S +GI GN+QQ+TFEV+YDV
Sbjct  490  ---CLAFAGNSDDSSLGIIGNVQQRTFEVLYDV  519



>ref|XP_008776819.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=176

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 104/155 (67%), Gaps = 2/155 (1%)
 Frame = -3

Query  679  VKYTPFATDQG-ASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSA  503
            +K TP  T+   +SFYFI++  ++VGGK LSI   VF +  TIIDSGT +T LPPAAYSA
Sbjct  11   IKLTPMTTESDMSSFYFIELIGMSVGGKDLSIPSAVFAAIRTIIDSGTTVTWLPPAAYSA  70

Query  502  LRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNG  323
            LRS FRQ MSKY    A  ILDTCY+ + Y+ + VP ++   + GVT+++   GILL   
Sbjct  71   LRSEFRQHMSKYSPVAAFEILDTCYNFTGYSRIRVPAVALQFSAGVTLNVDASGILLFAS  130

Query  322  ASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             SQ CLAFA + D     I  N+QQ+TF+VVYDVA
Sbjct  131  PSQRCLAFA-SVDEDGFSIVRNMQQRTFDVVYDVA  164



>ref|XP_010491756.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Camelina sativa]
Length=417

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 106/167 (63%), Gaps = 2/167 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GHLTFG  G +   K+TPF +    S Y I +  I+VG K+L I+P  F + G IIDSGT
Sbjct  240  GHLTFGSDGISGSAKFTPFTSFPIPSLYGITIVGISVGDKKLEITPTTFSTYGAIIDSGT  299

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLP   Y+ LRS F++ MS Y         DTCYD +   T+++PKI+F   GG  +
Sbjct  300  VITRLPTKVYAELRSVFKEKMSSYKATSGNGYFDTCYDFTGLDTITIPKIAFFFAGGTVV  359

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            DLP +GIL     SQVCLAFAG+ +     IFGN+QQ+T E+VYDVA
Sbjct  360  DLPGIGILYPLTRSQVCLAFAGDNEHIPA-IFGNVQQKTMEIVYDVA  405



>gb|EAY87323.1| hypothetical protein OsI_08727 [Oryza sativa Indica Group]
Length=463

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 102/141 (72%), Gaps = 6/141 (4%)
 Frame = -3

Query  643  SFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSALRSAFRQGMSKYP  464
            +FY   +Q IAVGGKQL +SP VF ++G+++DSGT+ITRLPP AYSAL SAF+ GM +Y 
Sbjct  317  TFYGARLQDIAVGGKQLGLSPSVF-AAGSVVDSGTIITRLPPTAYSALSSAFKAGMKQYR  375

Query  463  QAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNGASQVCLAFAGNGD  284
             APA SILDTC+D +  T +S+P ++ V +GG  +DL   GI+ GN     CLAFA  GD
Sbjct  376  SAPARSILDTCFDFAGQTQISIPTVALVFSGGAAIDLDPNGIMYGN-----CLAFAATGD  430

Query  283  ASDVGIFGNIQQQTFEVVYDV  221
                GI GN+QQ+TFEV+YDV
Sbjct  431  DGTTGIIGNVQQRTFEVLYDV  451



>ref|XP_006287706.1| hypothetical protein CARUB_v10000913mg [Capsella rubella]
 gb|EOA20604.1| hypothetical protein CARUB_v10000913mg [Capsella rubella]
Length=461

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 108/167 (65%), Gaps = 3/167 (2%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GHLTFG  G +  VK+TP ++    S Y ID+  I+VG  +L I+P  F   G IIDSGT
Sbjct  285  GHLTFGSAGISNSVKFTPVSSFPSPSSYGIDIVGISVGDNELEITPTSFSRDGAIIDSGT  344

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLP   Y+ LRS F++ MS Y   P  SILDTCYD +   TV++P I+F + GG  +
Sbjct  345  VITRLPTKVYAELRSVFKEKMSSYKSTPGRSILDTCYDFTGLDTVTLPTIAFSMGGGTVV  404

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +L  +GIL     SQVCLAFAG  D     IFGN+QQ+T E+VYDVA
Sbjct  405  ELDGMGILYPLTQSQVCLAFAGEDDIP--AIFGNVQQKTMEIVYDVA  449



>ref|NP_001047954.1| Os02g0720600 [Oryza sativa Japonica Group]
 dbj|BAD12876.1| putative 41 kD chloroplast nucleoid DNA binding protein (CND41) 
[Oryza sativa Japonica Group]
 dbj|BAD12996.1| putative 41 kD chloroplast nucleoid DNA binding protein (CND41) 
[Oryza sativa Japonica Group]
 dbj|BAF09868.1| Os02g0720600 [Oryza sativa Japonica Group]
 gb|EAZ24423.1| hypothetical protein OsJ_08176 [Oryza sativa Japonica Group]
 dbj|BAG97484.1| unnamed protein product [Oryza sativa Japonica Group]
Length=463

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 102/141 (72%), Gaps = 6/141 (4%)
 Frame = -3

Query  643  SFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSALRSAFRQGMSKYP  464
            +FY   +Q IAVGGKQL +SP VF ++G+++DSGT+ITRLPP AYSAL SAF+ GM +Y 
Sbjct  317  TFYGARLQDIAVGGKQLGLSPSVF-AAGSVVDSGTIITRLPPTAYSALSSAFKAGMKQYR  375

Query  463  QAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNGASQVCLAFAGNGD  284
             APA SILDTC+D +  T +S+P ++ V +GG  +DL   GI+ GN     CLAFA  GD
Sbjct  376  SAPARSILDTCFDFAGQTQISIPTVALVFSGGAAIDLDPNGIMYGN-----CLAFAATGD  430

Query  283  ASDVGIFGNIQQQTFEVVYDV  221
                GI GN+QQ+TFEV+YDV
Sbjct  431  DGTTGIIGNVQQRTFEVLYDV  451



>ref|XP_002460431.1| hypothetical protein SORBIDRAFT_02g028000 [Sorghum bicolor]
 gb|EER96952.1| hypothetical protein SORBIDRAFT_02g028000 [Sorghum bicolor]
Length=481

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 119/183 (65%), Gaps = 3/183 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            A G+L+ G       ++T   T     SFY++++  I V G+ + +SP VF++ GT+IDS
Sbjct  299  AEGYLSLGSAAPPNARFTAMVTRSDTPSFYYLNLVGIKVAGRTVRVSPAVFRTPGTVIDS  358

Query  544  GTVITRLPPAAYSALRSAFRQGMSKY--PQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            GTVITRLP  AY+ALRS+F   M +Y   +APALSILDTCYD +    V +P ++ + +G
Sbjct  359  GTVITRLPSRAYAALRSSFAGLMRRYSYKRAPALSILDTCYDFTGRNKVQIPSVALLFDG  418

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVAggklgigag  191
            G T++L    +L     SQ CLAFA NGD + + I GN+QQ+TF VVYDVA  K+G GA 
Sbjct  419  GATLNLGFGEVLYVANKSQACLAFASNGDDTSIAILGNMQQKTFAVVYDVANQKIGFGAK  478

Query  190  GCS  182
            GCS
Sbjct  479  GCS  481



>ref|XP_010419657.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=469

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 106/167 (63%), Gaps = 2/167 (1%)
 Frame = -3

Query  715  GHLTFGKGGAA-PVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GHLTFG  G +   K+TPF +    S Y I +  I+VG K+L I+P  F + G IIDSGT
Sbjct  292  GHLTFGSAGVSGSAKFTPFTSFPIPSLYGITIVGISVGDKKLEITPTTFSTYGAIIDSGT  351

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLP   Y+ LRS F++ MS Y       I DTCYD +   T+++PKI+F   GG  +
Sbjct  352  VITRLPTKVYAELRSVFKEKMSSYKATSGRDIFDTCYDFTGLDTITIPKIAFSFAGGTVV  411

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            DL  +GIL     SQVCLAFAG+ +     IFGN+QQ+T E+VYDVA
Sbjct  412  DLAGIGILYPLTRSQVCLAFAGDNEHIP-AIFGNVQQKTIEIVYDVA  457



>ref|XP_010491757.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X3 [Camelina sativa]
Length=469

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 106/167 (63%), Gaps = 2/167 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GHLTFG  G +   K+TPF +    S Y I +  I+VG K+L I+P  F + G IIDSGT
Sbjct  292  GHLTFGSDGISGSAKFTPFTSFPIPSLYGITIVGISVGDKKLEITPTTFSTYGAIIDSGT  351

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLP   Y+ LRS F++ MS Y         DTCYD +   T+++PKI+F   GG  +
Sbjct  352  VITRLPTKVYAELRSVFKEKMSSYKATSGNGYFDTCYDFTGLDTITIPKIAFFFAGGTVV  411

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            DLP +GIL     SQVCLAFAG+ +     IFGN+QQ+T E+VYDVA
Sbjct  412  DLPGIGILYPLTRSQVCLAFAGDNEHIPA-IFGNVQQKTMEIVYDVA  457



>ref|XP_010491755.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Camelina sativa]
Length=468

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 106/167 (63%), Gaps = 2/167 (1%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GHLTFG  G +   K+TPF +    S Y I +  I+VG K+L I+P  F + G IIDSGT
Sbjct  291  GHLTFGSDGISGSAKFTPFTSFPIPSLYGITIVGISVGDKKLEITPTTFSTYGAIIDSGT  350

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLP   Y+ LRS F++ MS Y         DTCYD +   T+++PKI+F   GG  +
Sbjct  351  VITRLPTKVYAELRSVFKEKMSSYKATSGNGYFDTCYDFTGLDTITIPKIAFFFAGGTVV  410

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            DLP +GIL     SQVCLAFAG+ +     IFGN+QQ+T E+VYDVA
Sbjct  411  DLPGIGILYPLTRSQVCLAFAGDNEHIPA-IFGNVQQKTMEIVYDVA  456



>ref|NP_001150335.1| aspartic proteinase nepenthesin-2 precursor [Zea mays]
 gb|ACG38714.1| aspartic proteinase nepenthesin-2 precursor [Zea mays]
Length=461

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 106/153 (69%), Gaps = 6/153 (4%)
 Frame = -3

Query  679  VKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSAL  500
            VK     + Q  +FY + +QAI VGG+QLSI   VF S+GT++DSGTVITRLPP AYSAL
Sbjct  303  VKTPMLRSSQVPTFYGVRLQAIRVGGRQLSIPASVF-SAGTVMDSGTVITRLPPTAYSAL  361

Query  499  RSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNGA  320
             SAF+ GM +YP A    ILDTC+D S  ++VS+P ++ V +GG  + L   GI+L N  
Sbjct  362  SSAFKAGMKQYPPAQPSGILDTCFDFSGQSSVSIPSVALVFSGGAVVSLDASGIILSN--  419

Query  319  SQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
               CLAFA N D S +GI GN+QQ+TFEV+YDV
Sbjct  420  ---CLAFAANSDDSSLGIIGNVQQRTFEVLYDV  449



>gb|KCW80527.1| hypothetical protein EUGRSUZ_C01881, partial [Eucalyptus grandis]
Length=413

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 112/168 (67%), Gaps = 3/168 (2%)
 Frame = -3

Query  715  GHLTFGKGG--AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            G+LTFG+G   +A + +TP  T  Q   FY I++  I+VGG  LSI   VF ++G IIDS
Sbjct  233  GYLTFGRGTVTSASLNFTPMVTIAQNPLFYGINITGISVGGNPLSIPSTVFSNAGAIIDS  292

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GT +T LPP AY+AL+SAF++ M+ Y  AP +   DTCYD S ++T++VP I+F  +G +
Sbjct  293  GTTLTSLPPTAYTALQSAFQKAMANYTSAPPIYPFDTCYDFSMFSTITVPVITFSFDGPI  352

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             ++L   G+     AS+VCLAF  N   +D  I+GN QQ+TFEV+YDV
Sbjct  353  NVNLDWSGMFYWVNASEVCLAFVANNADTDGVIYGNTQQRTFEVIYDV  400



>gb|ACN85242.1| aspartic proteinase nepenthesin-1 precursor [Oryza minuta]
Length=519

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 110/171 (64%), Gaps = 5/171 (3%)
 Frame = -3

Query  718  NGHLTFGKGGAAPVK---YTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
             G+L FG G  A  +    TP  T+ G +FY++ +  I VGG+ LSI   VF ++GTI+D
Sbjct  337  TGYLDFGAGSLAAARARLTTPMLTENGPTFYYVGMTGIRVGGQLLSIPQSVFATAGTIVD  396

Query  547  SGTVITRLPPAAYSALR--SAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLN  374
            SGTVITRLPPAAYS+LR   A       Y +APA+S+LDTCYD +  + V++P +S +  
Sbjct  397  SGTVITRLPPAAYSSLRYAFAAAMAARGYKKAPAVSLLDTCYDFTGMSQVAIPTVSLLFQ  456

Query  373  GGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            GG  +D+   GI+    ASQVCLAFA N D  DVGI GN Q +TF V YD+
Sbjct  457  GGARLDVDASGIMYAASASQVCLAFAANEDGGDVGIVGNTQLKTFGVAYDI  507



>ref|XP_010050793.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=469

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 112/168 (67%), Gaps = 3/168 (2%)
 Frame = -3

Query  715  GHLTFGKGG--AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            G+LTFG+G   +A + +TP  T  Q   FY I++  I+VGG  LSI   VF ++G IIDS
Sbjct  289  GYLTFGRGTVTSASLNFTPMVTIAQNPLFYGINITGISVGGNPLSIPSTVFSNAGAIIDS  348

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GT +T LPP AY+AL+SAF++ M+ Y  AP +   DTCYD S ++T++VP I+F  +G +
Sbjct  349  GTTLTSLPPTAYTALQSAFQKAMANYTSAPPIYPFDTCYDFSMFSTITVPVITFSFDGPI  408

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             ++L   G+     AS+VCLAF  N   +D  I+GN QQ+TFEV+YDV
Sbjct  409  NVNLDWSGMFYWVNASEVCLAFVANNADTDGVIYGNTQQRTFEVIYDV  456



>emb|CDX97055.1| BnaC09g45700D [Brassica napus]
Length=419

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 112/173 (65%), Gaps = 8/173 (5%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFAT---DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            GHLTFG GG +  VKYTP  T   + G SFY +D+  I+V  K L+I   VF ++  IID
Sbjct  234  GHLTFGSGGISNSVKYTPSFTLLVNSGGSFYSLDIVGISVANKDLNIPLGVFSNATAIID  293

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGT ITRLPP AY+ALR+AF++ MS Y         DTCYD +   T+S+PKISF  +GG
Sbjct  294  SGTTITRLPPVAYAALRTAFKEKMSNYKTTLGPPPFDTCYDFTGLRTMSIPKISFSFDGG  353

Query  367  VTMDLPLVGIL----LGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
              +DL   G+L    +  G S+ CL FAGN   ++V +FG++QQ+T E+VYDV
Sbjct  354  TVVDLDSKGVLYMYGMSKGMSKGCLGFAGNTYNNNVAVFGSLQQKTLEIVYDV  406



>ref|XP_008777074.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=437

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 110/172 (64%), Gaps = 2/172 (1%)
 Frame = -3

Query  730  KRGANGHLTFGKGGAAP-VKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGT  557
            +  + G+L  G     P +K+T   T+  A SFYF+++  + VGG+ LSI+  VF + GT
Sbjct  253  RSSSTGYLMLGAATQTPNIKFTTMPTESYAPSFYFVELTGLTVGGRDLSIASSVFSNVGT  312

Query  556  IIDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVL  377
            IIDSGTVITRLP  AY+ALRS FRQ M+KY       ILDTCY+ + Y  +++P +    
Sbjct  313  IIDSGTVITRLPMQAYTALRSEFRQHMTKYQLVQPFVILDTCYNFTGYNHITIPAVVLQF  372

Query  376  NGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            + GV++ +   GIL     SQ CLAFAGN D + V I GN+QQ+TF VVYDV
Sbjct  373  SNGVSLYVDASGILYFASLSQACLAFAGNDDENAVSIVGNMQQRTFNVVYDV  424



>dbj|BAJ94237.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00611.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 111/169 (66%), Gaps = 3/169 (2%)
 Frame = -3

Query  718  NGHLTFGKGGAAP-VKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
             G+L FG G A    + TP  TD+G +FY++ +  I VGG+Q+ ++  VF ++GT++DSG
Sbjct  319  TGYLDFGPGSAGNNARLTPMLTDKGQTFYYVGMTGIRVGGQQVPVAESVFSTAGTLVDSG  378

Query  541  TVITRLPPAAYSALRSAFRQGM--SKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            TVITRLP  AY+AL SAF + M    Y +AP  SILDTCYD +  + V +P +S V  GG
Sbjct  379  TVITRLPATAYTALSSAFDKVMLARGYKKAPGYSILDTCYDFTGLSDVELPTVSLVFQGG  438

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
              +D+ + GI+     +QVCLAFA NGD   V I GN QQ+T+ V+YD+
Sbjct  439  ACLDVDVSGIVYAISEAQVCLAFASNGDDESVAIVGNTQQKTYGVLYDL  487



>dbj|BAJ92731.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 111/169 (66%), Gaps = 3/169 (2%)
 Frame = -3

Query  718  NGHLTFGKGGAAP-VKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
             G+L FG G A    + TP  TD+G +FY++ +  I VGG+Q+ ++  VF ++GT++DSG
Sbjct  319  TGYLDFGPGSAGNNARLTPMLTDKGQTFYYVGMTGIRVGGQQVPVAESVFSTAGTLVDSG  378

Query  541  TVITRLPPAAYSALRSAFRQGM--SKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            TVITRLP  AY+AL SAF + M    Y +AP  SILDTCYD +  + V +P +S V  GG
Sbjct  379  TVITRLPATAYTALSSAFDKVMLARGYKKAPGYSILDTCYDFTGLSDVELPTVSLVFQGG  438

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
              +D+ + GI+     +QVCLAFA NGD   V I GN QQ+T+ V+YD+
Sbjct  439  ACLDVDVSGIVYAISEAQVCLAFASNGDDESVAIVGNTQQKTYGVLYDL  487



>gb|EMT32054.1| Aspartic proteinase nepenthesin-2 [Aegilops tauschii]
Length=461

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 113/168 (67%), Gaps = 6/168 (4%)
 Frame = -3

Query  724  GANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            G+ G LT G   +  VK     + Q  ++Y + +QAI VGGKQLSI   VF S+G+I+DS
Sbjct  288  GSPGFLTLGAATSGFVKTPMLRSSQVPAYYGVRLQAIRVGGKQLSIPTSVF-SAGSIMDS  346

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GT+ITRLP  AYSAL SAF+ GM +YP A  + I DTC+D S  ++VS+P +  V +GGV
Sbjct  347  GTIITRLPATAYSALSSAFKAGMKQYPPAQPMGIFDTCFDFSGQSSVSIPTVVLVFSGGV  406

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             ++L   GI+LG+     CLAFA N D S +GI GN+QQ+T EV+YDV
Sbjct  407  AVNLASDGIILGS-----CLAFAANSDDSSLGIIGNVQQRTLEVLYDV  449



>ref|XP_010491754.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=468

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 111/169 (66%), Gaps = 4/169 (2%)
 Frame = -3

Query  715  GHLTFGKGG--AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G  +  VK+TP  + + +  Y I++  I+VG K+L I+P  F ++G IIDSG
Sbjct  289  GHLTFGSAGIISKSVKFTPVYSFRSSPHYGINIVGISVGDKKLEITPSTFSTNGAIIDSG  348

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLP   Y+ LRS F+  MS Y       I DTCYDL+   T+++PKI+F L GG+ 
Sbjct  349  TVITRLPTKVYAELRSVFKAKMSSYKATSGRGIFDTCYDLTGLNTMTIPKIAFSLGGGIV  408

Query  361  MDLPLVGILLGN-GASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            + L  +G++L     SQVCLAFAG+ D     IFGN+QQ+T E+VYDVA
Sbjct  409  VKLDRIGMVLYPFTRSQVCLAFAGDDDHIP-AIFGNVQQKTMEIVYDVA  456



>ref|XP_011036745.1| PREDICTED: aspartic proteinase nepenthesin-2-like, partial [Populus 
euphratica]
Length=238

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 111/172 (65%), Gaps = 5/172 (3%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            + GHL+FG G +   K+TP  T +    Y +DV  I+VGG++L I P VF++SGTIIDSG
Sbjct  57   STGHLSFGGGVSQAAKFTPITT-KIPELYGLDVSGISVGGRKLLIDPSVFRTSGTIIDSG  115

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYT--TVSVPKISFVLNGG  368
            T +T LP  A+SAL SAF++ M+ Y      S L  CYD SK     + +P+IS    GG
Sbjct  116  TTLTFLPSTAHSALSSAFQEMMTNYTLTNGTSGLQPCYDFSKNANDNIPLPQISIFFEGG  175

Query  367  VTMDLPLVGILL--GNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            V +D+   GIL+    G  ++CLAF  NG+  D+ IFGN+QQ+T+EVVYDVA
Sbjct  176  VEVDIDDSGILISVNGGLEEMCLAFIDNGNDKDLAIFGNLQQKTYEVVYDVA  227



>ref|XP_006287688.1| hypothetical protein CARUB_v10000896mg [Capsella rubella]
 gb|EOA20586.1| hypothetical protein CARUB_v10000896mg [Capsella rubella]
Length=465

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 108/167 (65%), Gaps = 3/167 (2%)
 Frame = -3

Query  715  GHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGT  539
            GHLTFG  G +  VK+TP ++    S Y I++  I+VG K+L I+P  F + G IIDSGT
Sbjct  289  GHLTFGSAGISNSVKFTPISSFPSPSSYGINIVGISVGDKELEITPASFSTKGAIIDSGT  348

Query  538  VITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTM  359
            VITRLP   Y+ LR  F++ MS Y      SI DTCYD +   T+++PKI+F L GG  +
Sbjct  349  VITRLPTKVYAELRRVFKEKMSSYKATSGRSIFDTCYDFTGVDTMTIPKIAFSLGGGTVV  408

Query  358  DLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            +L  +GIL     SQVCLAFAG  D     IFGN+QQ+T E+VYDVA
Sbjct  409  ELGRMGILYPLTQSQVCLAFAGEDDLP--AIFGNVQQKTLEIVYDVA  453



>ref|XP_011012151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Populus euphratica]
Length=405

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 112/171 (65%), Gaps = 4/171 (2%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            + GHL+FG G +   K+TP  T +    Y +DV  I+VGG++L I P VF++SGTIIDSG
Sbjct  225  STGHLSFGGGVSQAAKFTPITT-KIPELYGLDVSGISVGGRKLLIDPSVFRTSGTIIDSG  283

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYT--TVSVPKISFVLNGG  368
            T +T LP  A+SAL SAF++ M+ Y      S L  CYD SK     + +P+IS    GG
Sbjct  284  TTLTFLPSTAHSALSSAFQEMMTNYTLTNGTSGLQPCYDFSKNANDNIPLPQISIFFEGG  343

Query  367  VTMDLPLVGILLG-NGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            V +D+   GIL+  NG  ++CLAF  NG+  D+ IFGN+QQ+T+EVVYDVA
Sbjct  344  VEVDIDDSGILISVNGLEEMCLAFIDNGNDKDLAIFGNLQQKTYEVVYDVA  394



>dbj|BAJ89995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=456

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 115/169 (68%), Gaps = 7/169 (4%)
 Frame = -3

Query  724  GANGHLTFGKGGAAPVKYTP-FATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            G++G LT G   +  V  TP   + Q  S+Y + +QAI VGG+QL+I    F S+G+I+D
Sbjct  282  GSSGFLTLGASTSGFVVKTPMLRSTQVPSYYGVLLQAIRVGGRQLNIPASAF-SAGSIMD  340

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGT+ITRLP  AYSAL SAF+ GM +YP A  + I DTC+D S  ++VS+P ++ V +GG
Sbjct  341  SGTIITRLPRTAYSALSSAFKAGMKQYPPAQPMGIFDTCFDFSGQSSVSIPTVALVFSGG  400

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
              +DL   GI+LG+     CLAFA N D + +GI GN+QQ+TFEV+YDV
Sbjct  401  AVVDLASDGIILGS-----CLAFAANSDDTSLGIIGNVQQRTFEVLYDV  444



>gb|EMT06628.1| Aspartic proteinase nepenthesin-2 [Aegilops tauschii]
Length=398

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 104/145 (72%), Gaps = 6/145 (4%)
 Frame = -3

Query  658  TDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSALRSAFRQG  479
            ++Q  +FY + +Q I VGG+QLS++P VF S+G+++DSGT+ITRLPP AY+AL++AF+ G
Sbjct  247  SEQAPTFYGVLLQGIKVGGEQLSVAPSVF-SAGSVMDSGTIITRLPPTAYTALKTAFKDG  305

Query  478  MSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNGASQVCLAF  299
            M +YP AP+ SILDTC+D S    V++P ++ + +GG  +DL   GI+ G+     CLAF
Sbjct  306  MKQYPAAPSRSILDTCFDFSGQDNVTIPTVALMFDGGAVVDLDANGIIFGS-----CLAF  360

Query  298  AGNGDASDVGIFGNIQQQTFEVVYD  224
             G  D    GI GN+QQ+T EV+YD
Sbjct  361  TGTDDDESTGIIGNVQQRTLEVLYD  385



>ref|XP_004953759.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Setaria italica]
Length=455

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 116/169 (69%), Gaps = 8/169 (5%)
 Frame = -3

Query  721  ANGHLTFGKG-GAAPVKYTP-FATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            ++G LT G G G++    TP   + Q  +FY + +QAI VGG+QL+I    F S+G I+D
Sbjct  281  SSGFLTLGAGTGSSGFVRTPMLRSSQVLTFYGVRLQAIRVGGRQLNIPSSAF-SAGEIMD  339

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRL   AYSAL SAF+ GM +YP+AP+  ILDTC+D S   ++++P ++ V +GG
Sbjct  340  SGTVITRLQRTAYSALSSAFKAGMKQYPRAPSSGILDTCFDFSGQRSITIPTVALVFSGG  399

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
              ++L   GI+LG+     CLAFAGN D S  GI GN+QQ+TFEV+YDV
Sbjct  400  AVVNLDANGIILGS-----CLAFAGNSDDSSFGIIGNVQQRTFEVLYDV  443



>ref|XP_004953760.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Setaria italica]
Length=456

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 116/169 (69%), Gaps = 8/169 (5%)
 Frame = -3

Query  721  ANGHLTFGKG-GAAPVKYTP-FATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            ++G LT G G G++    TP   + Q  +FY + +QAI VGG+QL+I    F S+G I+D
Sbjct  282  SSGFLTLGAGTGSSGFVRTPMLRSSQVLTFYGVRLQAIRVGGRQLNIPSSAF-SAGEIMD  340

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRL   AYSAL SAF+ GM +YP+AP+  ILDTC+D S   ++++P ++ V +GG
Sbjct  341  SGTVITRLQRTAYSALSSAFKAGMKQYPRAPSSGILDTCFDFSGQRSITIPTVALVFSGG  400

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
              ++L   GI+LG+     CLAFAGN D S  GI GN+QQ+TFEV+YDV
Sbjct  401  AVVNLDANGIILGS-----CLAFAGNSDDSSFGIIGNVQQRTFEVLYDV  444



>ref|XP_004295359.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Fragaria 
vesca subsp. vesca]
Length=478

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 108/174 (62%), Gaps = 6/174 (3%)
 Frame = -3

Query  721  ANGHLTFGK---GGAAPVKYTPFATDQGASFYF-IDVQAIAVGGKQLSISPVVFKSSGTI  554
            + G+LTFG       A +KYT   T   +S Y+ +++  I V G++LSI    F S GTI
Sbjct  294  STGYLTFGSPTGASNAAIKYTRLTTLSSSSTYYGLNLVGINVNGQKLSIPASEFSSPGTI  353

Query  553  IDSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLN  374
            IDSGTVI+RL P A+SALR AF+  M  YP  P    LDTCYDLS Y TV+ PKI F   
Sbjct  354  IDSGTVISRLSPTAFSALRDAFQVEMKSYPSVPGDGFLDTCYDLSGYPTVTYPKIEFAFG  413

Query  373  GGVTMDLPLVGIL-LGNGA-SQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             GV + L   GI+ L +G   QVCLAF GN DA  V IFGN QQ+  EV+YDVA
Sbjct  414  DGVMLTLDATGIVYLADGTMKQVCLAFVGNDDADKVTIFGNTQQKNMEVLYDVA  467



>gb|ACN85252.1| aspartic proteinase nepenthesin-1 precursor [Oryza officinalis]
Length=519

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 102/152 (67%), Gaps = 2/152 (1%)
 Frame = -3

Query  670  TPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSALR--  497
            TP  TD G +FY++ +  I VGG+ LSI   VF ++GTI+DSGTVITRLPPAAYS+LR  
Sbjct  356  TPMLTDNGPTFYYVGMTGIRVGGQLLSIPQSVFATAGTIVDSGTVITRLPPAAYSSLRYA  415

Query  496  SAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNGAS  317
             A       Y +APA+S+LDTCYD +  + V++P +S +  GG  +D+   GI+    AS
Sbjct  416  FAAAMAARGYKKAPAVSLLDTCYDFTGMSQVAIPTVSLLFQGGARLDVDASGIMYAASAS  475

Query  316  QVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            QVCLAFA N D  DVGI GN Q +TF V YD+
Sbjct  476  QVCLAFAANEDGGDVGIVGNTQLKTFGVAYDI  507



>ref|XP_010422810.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=469

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 110/169 (65%), Gaps = 4/169 (2%)
 Frame = -3

Query  715  GHLTFGKGG--AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            GHLTFG  G  +  VK+TP  + + +  Y I +  I+VG K+L I+P  F ++G IIDSG
Sbjct  290  GHLTFGSAGIVSKSVKFTPVYSFRSSPHYGIKIVGISVGDKELEITPASFSTNGAIIDSG  349

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            TVITRLP   Y+ LR+ F++ MS+Y       I DTCYD +   T+ +PKI+F L GG  
Sbjct  350  TVITRLPTKVYAELRTVFKEKMSRYKATSGRGIFDTCYDFTGLDTMRIPKIAFSLGGGTV  409

Query  361  MDLPLVGILLGN-GASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            ++L  +G++L     SQVCLAFAG+ D     IFGN+QQ+T E+VYDVA
Sbjct  410  VELDKIGMVLYPFTRSQVCLAFAGDDDHIP-AIFGNVQQKTMEIVYDVA  457



>ref|XP_002437273.1| hypothetical protein SORBIDRAFT_10g023970 [Sorghum bicolor]
 gb|EER88640.1| hypothetical protein SORBIDRAFT_10g023970 [Sorghum bicolor]
Length=503

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 102/155 (66%), Gaps = 3/155 (2%)
 Frame = -3

Query  676  KYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSALR  497
            + TP   D G +FY++ +  I VGG  LSI   VF  +G ++DSGTVITRLPP+AY  LR
Sbjct  337  RLTPMLVDNGPTFYYVGMTGIKVGGHLLSIPATVFSDAGALVDSGTVITRLPPSAYEPLR  396

Query  496  SAFRQGMS--KYPQAPALSILDTCYDLSKYT-TVSVPKISFVLNGGVTMDLPLVGILLGN  326
            SAF +GM    Y  APA SILDTCYDL+ Y  ++++P +S V  GG  +D+   GIL   
Sbjct  397  SAFAKGMEGLGYKTAPAFSILDTCYDLTGYQGSIALPAVSLVFQGGACLDVDASGILYVA  456

Query  325  GASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
              SQ CLAFA N D +D+ I GN QQ+T+ V+YD+
Sbjct  457  DVSQACLAFAANDDDTDMTIVGNTQQKTYSVLYDL  491



>ref|XP_010913303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=453

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 111/171 (65%), Gaps = 9/171 (5%)
 Frame = -3

Query  724  GANGHLTFGKGG-AAPVKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            G+ G+LTFG+   +A + YTP  TD    +FY +++ AI+V G+QL+I P VF S+  I+
Sbjct  278  GSTGYLTFGEPTPSANISYTPMHTDTSRPTFYIVNLMAISVSGQQLAIQPSVFSSTVFIL  337

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGTVITRLPP+AY  LRSAF+  M  Y       ILDTCYD  +   V    ++    G
Sbjct  338  DSGTVITRLPPSAYQVLRSAFQSSMMNYRMREPSGILDTCYD--ENANVKPASVALHFEG  395

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             VT++L   GIL  N     CLAFAGN + SD+GI GN+QQ+TFEVVYD+A
Sbjct  396  NVTLNLDDSGILFDN-----CLAFAGNKEDSDLGIIGNVQQRTFEVVYDLA  441



>ref|XP_010050792.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=382

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 108/168 (64%), Gaps = 3/168 (2%)
 Frame = -3

Query  715  GHLTFGKGG--AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            G+LTFGKG   +A + +TP  T  Q   FY I++  I+VGG  LSI   VF ++G IIDS
Sbjct  202  GYLTFGKGTVTSASLNFTPMVTIAQNPLFYGINITGISVGGNPLSIPSTVFSNAGAIIDS  261

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GT  T LPP AY+AL+SAF++ M+ Y  AP    LDTCYD S  + ++VP I+F  +G +
Sbjct  262  GTTFTYLPPTAYTALQSAFKEAMANYTSAPPALPLDTCYDFSMLSDITVPAITFSFDGPI  321

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             +DL + G+      S VCLAF  N   +D  I+GN QQ+TFEV+YDV
Sbjct  322  NVDLDVSGMFYVLDPSLVCLAFVANNADTDTVIYGNTQQRTFEVIYDV  369



>ref|XP_011012148.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Populus euphratica]
Length=365

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 111/172 (65%), Gaps = 5/172 (3%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            + GHL+FG G +   K+TP  T +    Y +DV  I+VGG++L I P VF++SGTIIDSG
Sbjct  184  STGHLSFGGGVSQAAKFTPITT-KIPELYGLDVSGISVGGRKLLIDPSVFRTSGTIIDSG  242

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYT--TVSVPKISFVLNGG  368
            T +T LP  A+SAL SAF++ M+ Y      S L  CYD SK     + +P+IS    GG
Sbjct  243  TTLTFLPSTAHSALSSAFQEMMTNYTLTNGTSGLQPCYDFSKNANDNIPLPQISIFFEGG  302

Query  367  VTMDLPLVGILL--GNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            V +D+   GIL+    G  +VCLAF  NG+  D+ IFGN+QQ+T+EVVYDVA
Sbjct  303  VEVDIDDSGILISVNGGLEEVCLAFIDNGNDKDLAIFGNLQQKTYEVVYDVA  354



>ref|NP_001168472.1| hypothetical protein [Zea mays]
 gb|ACN28327.1| unknown [Zea mays]
Length=434

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 109/171 (64%), Gaps = 5/171 (3%)
 Frame = -3

Query  718  NGHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
             G L  G G  AA  + TP   D+G +FY++ +  I VGG  L I   VF ++GT++DSG
Sbjct  252  TGFLDLGPGAPAANARLTPMLVDRGPTFYYVGMTGIKVGGHVLPIPGSVFSTAGTLVDSG  311

Query  541  TVITRLPPAAYSALRSAFRQGMS--KYPQAPALSILDTCYDLSKYT--TVSVPKISFVLN  374
            TVITRLPP+AY+ LRSAF + M    Y  APA SILDTCYDL+ +   ++++P +S V  
Sbjct  312  TVITRLPPSAYAPLRSAFSKAMQGLGYSAAPAFSILDTCYDLTGHKGGSIALPAVSLVFQ  371

Query  373  GGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            GG  +D+   GIL     SQ CLAFA N D +DV I GN QQ+T  V+YD+
Sbjct  372  GGACLDVDASGILYVADVSQACLAFAPNADDTDVAIVGNTQQKTHGVLYDI  422



>ref|XP_010913304.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=407

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 111/170 (65%), Gaps = 9/170 (5%)
 Frame = -3

Query  721  ANGHLTFG-KGGAAPVKYTPFATDQGA-SFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            + G+LTFG    +A + YTP  TD    +FY +++ AI+V G+QL+I P VF S+  ++D
Sbjct  233  STGYLTFGAPTPSATISYTPMHTDTTQPTFYIVNLIAISVSGQQLAIQPSVFSSTLFVLD  292

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP+AY  LRSAF+  M  YP      ILDTCYD  K   V    ++    G 
Sbjct  293  SGTVITRLPPSAYQVLRSAFQSSMMNYPMTGPSGILDTCYD--KNVNVKPAPVALHFEGD  350

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
            VT++L   GIL+ N     CLAFAGN + SD+GI GN+QQ+TFEVVYD+A
Sbjct  351  VTLNLDDSGILIDN-----CLAFAGNKEDSDLGIIGNVQQRTFEVVYDLA  395



>gb|KCW44808.1| hypothetical protein EUGRSUZ_L01627, partial [Eucalyptus grandis]
Length=394

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 106/169 (63%), Gaps = 24/169 (14%)
 Frame = -3

Query  715  GHLTFGKGGAAP--VKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            GHLTFGK G A   V +TP +T  Q + FY I +  I+V G +LSI              
Sbjct  235  GHLTFGKDGGASNSVSFTPLSTVPQSSQFYGISIVGISVEGNRLSI--------------  280

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
                   P  A+  +R+AFR+ M+ Y  APALSILDTCYDLSK +TV+VP I+F   GG 
Sbjct  281  -------PSTAFQCVRTAFRKAMANYTTAPALSILDTCYDLSKESTVTVPTITFSFAGGA  333

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDVA  218
             ++L   GI     ASQVCLAFAGNG  SD+GI+GN+QQ+TFEVVYDVA
Sbjct  334  DINLDHNGIFYVAKASQVCLAFAGNGADSDLGIYGNVQQKTFEVVYDVA  382



>gb|ACN85264.1| aspartic proteinase nepenthesin-1 precursor [Oryza alta]
Length=517

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 101/152 (66%), Gaps = 2/152 (1%)
 Frame = -3

Query  670  TPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSALR--  497
            TP  TD G +FY+I +  I VGG+ LSI   VF ++GTI+DSGTVITRLPP AYS+LR  
Sbjct  354  TPMLTDNGPTFYYIGMTGIRVGGQLLSIPQSVFATAGTIVDSGTVITRLPPPAYSSLRYA  413

Query  496  SAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNGAS  317
             A       Y +APA+S+LDTCYD +  + V++P +S +  GG  +D+   GI+    AS
Sbjct  414  FAAAMAARGYKKAPAVSLLDTCYDFTGMSQVAIPTVSLLFQGGARLDVDASGIMYAASAS  473

Query  316  QVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            QVCLAFA N D  DVGI GN Q +TF V YD+
Sbjct  474  QVCLAFAANEDGGDVGIVGNTQLKTFGVAYDI  505



>ref|XP_004965901.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=499

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 107/172 (62%), Gaps = 4/172 (2%)
 Frame = -3

Query  724  GANGHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            G  G L FG G  AA  + TP  T    +FY++ +  I VGG  L I   VF + G ++D
Sbjct  316  GTTGFLDFGPGAPAANARLTPMLTGSVPTFYYVGMTGIKVGGHLLPIPGSVFSAGGALVD  375

Query  547  SGTVITRLPPAAYSALRSAFRQGMSK--YPQAPALSILDTCYDLSKYT-TVSVPKISFVL  377
            SGTVITRLPP+AY  +RSAF +GM    Y + PA SILDTCYDL+ Y  ++ +P +S V 
Sbjct  376  SGTVITRLPPSAYEPMRSAFAKGMDALGYKKVPAFSILDTCYDLTGYKGSIPLPAVSLVF  435

Query  376  NGGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             GG  +D+   GIL     SQ CLAFA N D +DV I GN QQ+T+ V+YD+
Sbjct  436  KGGACLDVDASGILYDVDVSQACLAFAANDDDTDVAIIGNTQQKTYSVLYDL  487



>ref|XP_002454359.1| hypothetical protein SORBIDRAFT_04g029390 [Sorghum bicolor]
 gb|EES07335.1| hypothetical protein SORBIDRAFT_04g029390 [Sorghum bicolor]
Length=460

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 111/167 (66%), Gaps = 6/167 (4%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            ++G LT G G +  VK     +    +FY + ++AI VGG QLSI   VF S+G ++DSG
Sbjct  288  SSGFLTLGAGTSGFVKTPMLRSSPVPTFYGVRLEAIRVGGTQLSIPTSVF-SAGMVMDSG  346

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            T+ITRLP  AYSAL SAF+ GM +Y  AP  SI+DTC+D S  ++V +P ++ V +GG  
Sbjct  347  TIITRLPRTAYSALSSAFKAGMKQYRPAPPRSIMDTCFDFSGQSSVRLPSVALVFSGGAV  406

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            ++L   GI+LGN     CLAFA N D S  GI GN+QQ+TFEV+YDV
Sbjct  407  VNLDANGIILGN-----CLAFAANSDDSSPGIVGNVQQRTFEVLYDV  448



>ref|XP_010050794.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=466

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 107/170 (63%), Gaps = 5/170 (3%)
 Frame = -3

Query  721  ANGHLTFGKGG--AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            A G+LTFG+    +  + +TP  T  Q   FY I +  I+V GK LSI   VF S+ TII
Sbjct  286  APGYLTFGRDKVTSPSLSFTPMVTVAQNPLFYGIKIIGISVDGKPLSIPSTVFSSASTII  345

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGT +T+LPP AY+ALRSAFR+ M+ Y  AP    LDTCYD S  +T + P I+F  +G
Sbjct  346  DSGTTVTQLPPTAYTALRSAFREAMANYTSAPPFEPLDTCYDFSGVSTFTGPVITFTFDG  405

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             + +DL L G+      SQVCLAF    D  D  I+GN QQ+TFEVVYDV
Sbjct  406  PINIDLDLSGMFYVVDVSQVCLAFVAGAD--DFAIYGNTQQRTFEVVYDV  453



>gb|EMS66296.1| Aspartic proteinase nepenthesin-1 [Triticum urartu]
Length=424

 Score =   153 bits (386),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 103/145 (71%), Gaps = 6/145 (4%)
 Frame = -3

Query  658  TDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSGTVITRLPPAAYSALRSAFRQG  479
            ++Q  +FY + +Q I VGG Q+S++P VF S+G+++DSGT+ITRLPP AY+AL++AF+ G
Sbjct  273  SEQAPTFYGVLLQGIKVGGDQISVAPSVF-SAGSVMDSGTIITRLPPTAYTALKTAFKDG  331

Query  478  MSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVTMDLPLVGILLGNGASQVCLAF  299
            M +YP AP+ SILDTC+D S    V++P ++ + +GG  +DL   GI+ G+     CLAF
Sbjct  332  MKQYPTAPSRSILDTCFDFSGQDNVTIPTVALMFDGGAVVDLDANGIIFGS-----CLAF  386

Query  298  AGNGDASDVGIFGNIQQQTFEVVYD  224
             G  D    GI GN+QQ+T EV+YD
Sbjct  387  TGTDDDESTGIIGNVQQRTLEVLYD  411



>gb|KCW80528.1| hypothetical protein EUGRSUZ_C01882, partial [Eucalyptus grandis]
Length=463

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 107/170 (63%), Gaps = 5/170 (3%)
 Frame = -3

Query  721  ANGHLTFGKGG--AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTII  551
            A G+LTFG+    +  + +TP  T  Q   FY I +  I+V GK LSI   VF S+ TII
Sbjct  286  APGYLTFGRDKVTSPSLSFTPMVTVAQNPLFYGIKIIGISVDGKPLSIPSTVFSSASTII  345

Query  550  DSGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNG  371
            DSGT +T+LPP AY+ALRSAFR+ M+ Y  AP    LDTCYD S  +T + P I+F  +G
Sbjct  346  DSGTTVTQLPPTAYTALRSAFREAMANYTSAPPFEPLDTCYDFSGVSTFTGPVITFTFDG  405

Query  370  GVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             + +DL L G+      SQVCLAF    D  D  I+GN QQ+TFEVVYDV
Sbjct  406  PINIDLDLSGMFYVVDVSQVCLAFVAGAD--DFAIYGNTQQRTFEVVYDV  453



>gb|EMS67344.1| Aspartic proteinase nepenthesin-2 [Triticum urartu]
Length=424

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 112/167 (67%), Gaps = 6/167 (4%)
 Frame = -3

Query  721  ANGHLTFGKGGAAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
            ++G LT G   +  VK     + Q  ++Y + +QAI VGG+QLSI   VF S+G+I+DSG
Sbjct  252  SSGFLTLGAATSGFVKTQMLRSSQVPAYYGVLLQAIRVGGRQLSIPTSVF-SAGSIMDSG  310

Query  541  TVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGVT  362
            T+ITRLP  AYSAL SAF+ GM +YP A  + I DTC+D S  ++VS+P +  V +GG  
Sbjct  311  TIITRLPATAYSALSSAFKAGMKQYPLAQPMGIFDTCFDFSGQSSVSIPTVVLVFSGGAA  370

Query  361  MDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            ++L   GI+LG+     CLAFA N D   +GI GN+QQ+TFEV+YDV
Sbjct  371  VNLASDGIILGS-----CLAFAANNDDRPLGIIGNVQQRTFEVLYDV  412



>ref|XP_008648080.1| PREDICTED: uncharacterized protein LOC100382248 isoform X1 [Zea 
mays]
 gb|AFW76337.1| hypothetical protein ZEAMMB73_223549 [Zea mays]
 gb|AFW76338.1| hypothetical protein ZEAMMB73_223549 [Zea mays]
Length=499

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 109/171 (64%), Gaps = 5/171 (3%)
 Frame = -3

Query  718  NGHLTFGKGG-AAPVKYTPFATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDSG  542
             G L  G G  AA  + TP   D+G +FY++ +  I VGG  L I   VF ++GT++DSG
Sbjct  317  TGFLDLGPGAPAANARLTPMLVDRGPTFYYVGMTGIKVGGHVLPIPGSVFSTAGTLVDSG  376

Query  541  TVITRLPPAAYSALRSAFRQGMS--KYPQAPALSILDTCYDLSKYT--TVSVPKISFVLN  374
            TVITRLPP+AY+ LRSAF + M    Y  APA SILDTCYDL+ +   ++++P +S V  
Sbjct  377  TVITRLPPSAYAPLRSAFSKAMQGLGYSAAPAFSILDTCYDLTGHKGGSIALPAVSLVFQ  436

Query  373  GGVTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
            GG  +D+   GIL     SQ CLAFA N D +DV I GN QQ+T  V+YD+
Sbjct  437  GGACLDVDASGILYVADVSQACLAFAPNADDTDVAIVGNTQQKTHGVLYDI  487



>gb|KCW80526.1| hypothetical protein EUGRSUZ_C01880, partial [Eucalyptus grandis]
Length=463

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 108/168 (64%), Gaps = 3/168 (2%)
 Frame = -3

Query  715  GHLTFGKGG--AAPVKYTPFAT-DQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIIDS  545
            G+LTFGKG   +A + +TP  T  Q   FY I++  I+VGG  LSI   VF ++G IIDS
Sbjct  289  GYLTFGKGTVTSASLNFTPMVTIAQNPLFYGINITGISVGGNPLSIPSTVFSNAGAIIDS  348

Query  544  GTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGGV  365
            GT  T LPP AY+AL+SAF++ M+ Y  AP    LDTCYD S  + ++VP I+F  +G +
Sbjct  349  GTTFTYLPPTAYTALQSAFKEAMANYTSAPPALPLDTCYDFSMLSDITVPAITFSFDGPI  408

Query  364  TMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
             +DL + G+      S VCLAF  N   +D  I+GN QQ+TFEV+YDV
Sbjct  409  NVDLDVSGMFYVLDPSLVCLAFVANNADTDTVIYGNTQQRTFEVIYDV  456



>ref|XP_002452641.1| hypothetical protein SORBIDRAFT_04g029670 [Sorghum bicolor]
 gb|EES05617.1| hypothetical protein SORBIDRAFT_04g029670 [Sorghum bicolor]
Length=466

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 113/169 (67%), Gaps = 4/169 (2%)
 Frame = -3

Query  724  GANGHLTFGKGGAAPVKYTP-FATDQGASFYFIDVQAIAVGGKQLSISPVVFKSSGTIID  548
            G++G LT G    +    TP   + Q  ++Y + ++AI VGG+QL+I   VF S+G+++D
Sbjct  289  GSSGFLTLGAASRSGFVKTPMLRSTQIPTYYGVLLEAIRVGGQQLNIPTSVF-SAGSVMD  347

Query  547  SGTVITRLPPAAYSALRSAFRQGMSKYPQAPALSILDTCYDLSKYTTVSVPKISFVLNGG  368
            SGTVITRLPP AYSAL SAF+ GM KYP A    ILDTC+D S  ++VS+P ++ V +GG
Sbjct  348  SGTVITRLPPTAYSALSSAFKAGMKKYPPAQPSGILDTCFDFSGQSSVSIPSVALVFSGG  407

Query  367  VTMDLPLVGILLGNGASQVCLAFAGNGDASDVGIFGNIQQQTFEVVYDV  221
              ++L   GI+L       CLAFA N D S +G  GN+QQ+TFEV+YDV
Sbjct  408  AVVNLDFNGIML--ELDNWCLAFAANSDDSSLGFIGNVQQRTFEVLYDV  454



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485