BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF040P05

Length=695
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP20126.1|  unnamed protein product                              56.6    6e-06   Coffea canephora [robusta coffee]



>emb|CDP20126.1| unnamed protein product [Coffea canephora]
Length=931

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 66/122 (54%), Gaps = 12/122 (10%)
 Frame = -2

Query  598  WXXGXSMXTEPXKPXXGNXXXNxggxsggGAVNSXNFXGYXKXTQGFFX------KPXXX  437
            W       TEP +P  GN   N    +GG  +N+ N  G+ K  QG         K    
Sbjct  811  WAFNTESLTEPMRPNQGNSSLNTNSLNGG-GLNTQNSLGFMKQNQGVSTYGVSSEKTMDL  869

Query  436  GSXXSSNKTXXXAPRLAPPPSTAxgrgrgrgrGNQGQL-----SRPSXAKPXXEQPPXLX  272
            GS  +S+K+   APRLAPPP+TA GRGRGRGRGNQGQL     SR S  KP  EQPP L 
Sbjct  870  GSIFASSKSEHTAPRLAPPPATAVGRGRGRGRGNQGQLSASSASRSSHMKPQSEQPPLLD  929

Query  271  LL  266
            LL
Sbjct  930  LL  931



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340