BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF040O14

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU42831.1|  hypothetical protein MIMGU_mgv1a003489mg                283   1e-87   Erythranthe guttata [common monkey flower]
ref|XP_009612399.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    281   2e-87   Nicotiana tomentosiformis
ref|XP_009612398.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    281   5e-87   Nicotiana tomentosiformis
ref|XP_009784852.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    280   6e-87   Nicotiana sylvestris
ref|XP_009784851.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    280   1e-86   Nicotiana sylvestris
ref|XP_009784850.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    280   1e-86   Nicotiana sylvestris
gb|AJD25227.1|  cytochrome P450 CYP97B34                                276   3e-85   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009347871.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     275   1e-84   Pyrus x bretschneideri [bai li]
ref|XP_002308766.1|  hypothetical protein POPTR_0006s00800g             275   1e-84   Populus trichocarpa [western balsam poplar]
ref|XP_008342307.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     274   2e-84   
ref|XP_006354415.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    274   2e-84   Solanum tuberosum [potatoes]
ref|XP_010093134.1|  Cytochrome P450                                    274   2e-84   Morus notabilis
ref|XP_011100398.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     273   8e-84   Sesamum indicum [beniseed]
ref|XP_007158591.1|  hypothetical protein PHAVU_002G165400g             272   9e-84   Phaseolus vulgaris [French bean]
ref|XP_004239253.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    271   2e-83   Solanum lycopersicum
ref|XP_010321037.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    271   2e-83   Solanum lycopersicum
gb|KEH27406.1|  cytochrome P450 family 97 protein                       267   3e-83   Medicago truncatula
ref|XP_007215027.1|  hypothetical protein PRUPE_ppa003405mg             271   3e-83   
ref|XP_004147731.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    271   3e-83   Cucumis sativus [cucumbers]
ref|XP_002520583.1|  cytochrome P450, putative                          270   4e-83   Ricinus communis
ref|XP_004164429.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    270   1e-82   
ref|XP_011002376.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     269   2e-82   Populus euphratica
ref|XP_008451892.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    269   3e-82   
ref|XP_002266883.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     268   3e-82   Vitis vinifera
gb|KDP42786.1|  hypothetical protein JCGZ_00485                         268   3e-82   Jatropha curcas
ref|XP_010680161.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     268   4e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003610974.1|  Cytochrome P450                                    268   6e-82   Medicago truncatula
ref|XP_010313051.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    268   7e-82   
gb|KHG14945.1|  Cytochrome P450, chloroplastic                          266   1e-81   Gossypium arboreum [tree cotton]
dbj|BAJ97821.1|  predicted protein                                      266   2e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN35086.1|  Cytochrome P450 97B2, chloroplastic                     266   2e-81   Glycine soja [wild soybean]
ref|NP_001235534.1|  cytochrome P450 97B2, chloroplastic                266   2e-81   
dbj|BAJ87287.1|  predicted protein                                      266   3e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS51606.1|  Cytochrome P450 97B2, chloroplastic                     265   4e-81   Triticum urartu
ref|XP_010044825.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     265   5e-81   Eucalyptus grandis [rose gum]
ref|XP_007049043.1|  Cytochrome P450 97B2 isoform 1                     266   5e-81   
ref|XP_010233882.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    261   7e-81   Brachypodium distachyon [annual false brome]
dbj|BAG90081.1|  unnamed protein product                                259   1e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002451628.1|  hypothetical protein SORBIDRAFT_04g004850          265   1e-80   Sorghum bicolor [broomcorn]
ref|XP_004951757.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    263   2e-80   Setaria italica
gb|KJB10650.1|  hypothetical protein B456_001G213800                    261   2e-80   Gossypium raimondii
ref|XP_010260624.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    259   8e-80   
gb|KJB10648.1|  hypothetical protein B456_001G213800                    262   8e-80   Gossypium raimondii
emb|CDP16026.1|  unnamed protein product                                263   9e-80   Coffea canephora [robusta coffee]
ref|XP_010914244.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     262   9e-80   Elaeis guineensis
ref|XP_007049044.1|  Cytochrome P450 97B2, chloroplastic isoform 2      262   1e-79   
gb|KDO64373.1|  hypothetical protein CISIN_1g014372mg                   257   2e-79   Citrus sinensis [apfelsine]
ref|XP_006429774.1|  hypothetical protein CICLE_v10011353mg             257   2e-79   
ref|XP_008679919.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     261   2e-79   Zea mays [maize]
ref|XP_006648355.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    260   3e-79   
ref|XP_003570274.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    260   4e-79   Brachypodium distachyon [annual false brome]
ref|XP_010260623.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    260   8e-79   Nelumbo nucifera [Indian lotus]
gb|EAZ21913.1|  hypothetical protein OsJ_05566                          258   2e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010440341.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     258   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_008809593.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     258   3e-78   Phoenix dactylifera
gb|EAY84668.1|  hypothetical protein OsI_06039                          258   3e-78   Oryza sativa Indica Group [Indian rice]
dbj|BAD26183.1|  putative cytochrome P450                               258   4e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006429775.1|  hypothetical protein CICLE_v10011353mg             258   4e-78   
ref|XP_006481375.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    258   7e-78   Citrus sinensis [apfelsine]
ref|XP_010435019.1|  PREDICTED: cytochrome P450 97B3, chloroplast...    257   9e-78   Camelina sativa [gold-of-pleasure]
ref|XP_006854622.1|  hypothetical protein AMTR_s00030p00167800          253   1e-77   
gb|KFK33561.1|  hypothetical protein AALP_AA5G029500                    256   1e-77   Arabis alpina [alpine rockcress]
emb|CDY09057.1|  BnaC08g10110D                                          256   1e-77   Brassica napus [oilseed rape]
emb|CDY22733.1|  BnaA08g05630D                                          256   2e-77   Brassica napus [oilseed rape]
ref|XP_009107829.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     255   3e-77   Brassica rapa
ref|XP_006414564.1|  hypothetical protein EUTSA_v10024764mg             255   5e-77   Eutrema salsugineum [saltwater cress]
ref|XP_010532498.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     254   1e-76   Tarenaya hassleriana [spider flower]
ref|XP_006285060.1|  hypothetical protein CARUB_v10006369mg             254   1e-76   Capsella rubella
ref|XP_010495892.1|  PREDICTED: cytochrome P450 97B3, chloroplast...    254   1e-76   Camelina sativa [gold-of-pleasure]
emb|CAB10290.1|  cytochrome P450 like protein                           254   1e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193247.2|  cytochrome P450 97B3                                  254   1e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009412060.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    249   3e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008229650.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     251   2e-75   Prunus mume [ume]
ref|XP_002868224.1|  hypothetical protein ARALYDRAFT_493377             250   2e-75   
ref|XP_004303949.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     250   4e-75   Fragaria vesca subsp. vesca
ref|XP_009412059.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    249   9e-75   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAT28222.1|  putative 97B2-like cytochrome P450                      248   3e-74   Ginkgo biloba [ginkgo]
ref|XP_006841947.1|  hypothetical protein AMTR_s00042p00221280          245   4e-73   
ref|XP_001769554.1|  predicted protein                                  239   5e-71   
gb|EMT03024.1|  Cytochrome P450 97B2                                    226   6e-66   
ref|XP_002976141.1|  hypothetical protein SELMODRAFT_175360             221   2e-64   
ref|XP_002968239.1|  hypothetical protein SELMODRAFT_145597             221   2e-64   
gb|KHN25634.1|  Cytochrome P450 97B2, chloroplastic                     207   4e-61   Glycine soja [wild soybean]
sp|Q43078.1|C97B1_PEA  RecName: Full=Cytochrome P450 97B1, chloro...    200   2e-56   Pisum sativum [garden pea]
ref|XP_011399626.1|  Cytochrome P450 97B2, chloroplastic                167   2e-47   Auxenochlorella protothecoides
emb|CBJ27249.1|  Cytochrome P450                                        175   5e-47   Ectocarpus siliculosus
gb|AFR36909.1|  chloroplast CYP97B                                      169   5e-45   Haematococcus lacustris
gb|AGK38423.1|  CYP97B1                                                 165   3e-43   Parachlorella kessleri
ref|XP_002955478.1|  hypothetical protein VOLCADRAFT_65884              165   3e-43   Volvox carteri f. nagariensis
gb|AGK38421.1|  CYP97B1                                                 160   8e-42   Parachlorella kessleri
gb|EJK63850.1|  hypothetical protein THAOC_15469                        159   3e-41   Thalassiosira oceanica
ref|XP_002292287.1|  predicted protein                                  159   6e-41   Thalassiosira pseudonana CCMP1335
emb|CBJ27248.1|  Cytochrome P450                                        158   1e-40   Ectocarpus siliculosus
gb|AAL73435.1|AF459441_1  cytochrome P450                               157   2e-40   Skeletonema costatum
gb|EWM30289.1|  cytochrome p450                                         157   2e-40   Nannochloropsis gaditana
ref|XP_005650550.1|  cytochrome P450                                    152   4e-39   Coccomyxa subellipsoidea C-169
emb|CDY09055.1|  BnaC08g10090D                                          146   4e-39   Brassica napus [oilseed rape]
ref|XP_001421212.1|  predicted protein                                  151   1e-38   Ostreococcus lucimarinus CCE9901
emb|CEG01697.1|  Cytochrome P450, conserved site                        150   3e-38   Ostreococcus tauri
ref|XP_003074608.1|  cytochrome P450 (ISS)                              150   5e-38   Ostreococcus tauri
gb|KIY95180.1|  hypothetical protein MNEG_12781                         141   8e-38   Monoraphidium neglectum
ref|XP_003061074.1|  predicted protein                                  148   2e-37   Micromonas pusilla CCMP1545
gb|AHA51695.1|  P450-type beta-carotene hydroxylase CYP97B29            148   2e-37   Porphyra umbilicalis
ref|XP_005827896.1|  cytochrome P450                                    147   2e-37   Guillardia theta CCMP2712
ref|XP_002185035.1|  lut1-1                                             147   3e-37   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005845008.1|  hypothetical protein CHLNCDRAFT_138471             147   4e-37   Chlorella variabilis
ref|XP_002185034.1|  lutein deficient 1-like protein                    147   5e-37   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_001415984.1|  predicted protein                                  147   5e-37   Ostreococcus lucimarinus CCE9901
ref|XP_002506798.1|  predicted protein                                  146   9e-37   Micromonas commoda
ref|XP_002178724.1|  lutein deficient 1-like protein                    147   1e-36   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005830096.1|  cytochrome P450                                    144   3e-36   Guillardia theta CCMP2712
ref|XP_007509002.1|  predicted protein                                  144   3e-36   Bathycoccus prasinos
ref|XP_005715216.1|  cytochrome P450 family 97G-CYP97G1                 144   5e-36   Chondrus crispus [carageen]
gb|ACF83994.1|  unknown                                                 133   6e-36   Zea mays [maize]
ref|XP_007514506.1|  predicted protein                                  142   2e-35   Bathycoccus prasinos
ref|XP_009032928.1|  hypothetical protein AURANDRAFT_19592              141   3e-35   Aureococcus anophagefferens
ref|XP_009034650.1|  hypothetical protein AURANDRAFT_21944              137   8e-35   Aureococcus anophagefferens
emb|CDY61653.1|  BnaCnng38160D                                          133   1e-33   Brassica napus [oilseed rape]
ref|XP_002293604.1|  cytochrome P450                                    137   1e-33   Thalassiosira pseudonana CCMP1335
ref|XP_004516959.1|  PREDICTED: carotene epsilon-monooxygenase, c...    136   2e-33   Cicer arietinum [garbanzo]
dbj|BAD94136.1|  Cytochrom P450 -like protein                           133   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005648231.1|  CYP97C3                                            136   3e-33   Coccomyxa subellipsoidea C-169
ref|XP_003542540.1|  PREDICTED: carotene epsilon-monooxygenase, c...    135   4e-33   Glycine max [soybeans]
gb|KFK34549.1|  hypothetical protein AALP_AA5G160700                    135   5e-33   Arabis alpina [alpine rockcress]
ref|XP_003537025.1|  PREDICTED: carotene epsilon-monooxygenase, c...    135   6e-33   Glycine max [soybeans]
gb|KHN36453.1|  Carotene epsilon-monooxygenase, chloroplastic           136   7e-33   Glycine soja [wild soybean]
ref|XP_007145289.1|  hypothetical protein PHAVU_007G2265000g            127   7e-33   Phaseolus vulgaris [French bean]
ref|XP_005826161.1|  cytochrome P450                                    134   3e-32   Guillardia theta CCMP2712
ref|XP_010504071.1|  PREDICTED: carotene epsilon-monooxygenase, c...    133   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010426945.1|  PREDICTED: carotene epsilon-monooxygenase, c...    133   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_003574294.1|  PREDICTED: carotene epsilon-monooxygenase, c...    133   3e-32   Brachypodium distachyon [annual false brome]
ref|XP_010515801.1|  PREDICTED: carotene epsilon-monooxygenase, c...    132   4e-32   Camelina sativa [gold-of-pleasure]
gb|AAM13903.1|  putative cytochrome P450                                132   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125249.1|  PREDICTED: carotene epsilon-monooxygenase, c...    132   7e-32   Brassica rapa
ref|NP_190881.2|  carotene epsilon-monooxygenase                        132   7e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDY13314.1|  BnaC06g14430D                                          132   9e-32   Brassica napus [oilseed rape]
emb|CDX67558.1|  BnaA07g15980D                                          131   1e-31   
emb|CAB64216.1|  Cytochrom P450-like protein                            132   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002506759.1|  predicted protein                                  131   1e-31   Micromonas commoda
gb|AGN27239.1|  CYP97A1                                                 132   1e-31   Parachlorella kessleri
gb|ACO53105.1|  epsilon carotene hydroxylase                            126   1e-31   Actinidia chinensis
gb|EMS57747.1|  Cytochrome P450 97B2, chloroplastic                     131   1e-31   Triticum urartu
ref|XP_009623194.1|  PREDICTED: carotene epsilon-monooxygenase, c...    130   2e-31   
ref|XP_001420992.1|  predicted protein                                  130   2e-31   Ostreococcus lucimarinus CCE9901
ref|XP_001422903.1|  predicted protein                                  130   2e-31   Ostreococcus lucimarinus CCE9901
ref|XP_011397501.1|  Cytochrome P450 97B2, chloroplastic                131   2e-31   Auxenochlorella protothecoides
gb|AID51468.1|  epsilon-ring carotene hydroxylase                       124   2e-31   Cucumis melo var. makuwa
ref|XP_002876190.1|  hypothetical protein ARALYDRAFT_485688             130   3e-31   
gb|AFP65826.1|  carotene epsilon-ring hydroxylase                       126   3e-31   Eriobotrya japonica [loquat]
dbj|BAJ87296.1|  predicted protein                                      130   3e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP15310.1|  unnamed protein product                                129   4e-31   Coffea canephora [robusta coffee]
ref|XP_006403722.1|  hypothetical protein EUTSA_v10010267mg             130   4e-31   Eutrema salsugineum [saltwater cress]
ref|XP_004983761.1|  PREDICTED: carotene epsilon-monooxygenase, c...    130   4e-31   Setaria italica
ref|XP_004983762.1|  PREDICTED: carotene epsilon-monooxygenase, c...    130   5e-31   Setaria italica
ref|XP_001700492.1|  cytochrome P450, carotenoid hydroxylase            130   5e-31   Chlamydomonas reinhardtii
gb|AGI61105.1|  carotenoid hydroxylase                                  130   5e-31   Parachlorella kessleri
ref|XP_006339098.1|  PREDICTED: carotene epsilon-monooxygenase, c...    128   5e-31   
gb|AIX87504.1|  P450 carotenoid epsilon-ring hydroxylase                129   5e-31   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_003590442.1|  Cytochrome P450 monooxygenase CYP97C10             129   5e-31   
gb|EJK46027.1|  hypothetical protein THAOC_35331                        129   6e-31   Thalassiosira oceanica
gb|AGK38422.1|  CYP97B2                                                 130   6e-31   Parachlorella kessleri
gb|AIX87528.1|  P450 carotenoid epsilon-ring hydroxylase                129   6e-31   Lycium ruthenicum
ref|XP_009623193.1|  PREDICTED: carotene epsilon-monooxygenase, c...    129   1e-30   Nicotiana tomentosiformis
ref|XP_010241652.1|  PREDICTED: carotene epsilon-monooxygenase, c...    129   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_005849069.1|  hypothetical protein CHLNCDRAFT_51247              129   1e-30   Chlorella variabilis
ref|NP_001065217.1|  Os10g0546600                                       129   1e-30   
ref|XP_006662027.1|  PREDICTED: carotene epsilon-monooxygenase, c...    129   1e-30   Oryza brachyantha
emb|CEG00185.1|  Cytochrome P450, conserved site                        128   1e-30   Ostreococcus tauri
ref|XP_009757367.1|  PREDICTED: carotene epsilon-monooxygenase, c...    128   2e-30   Nicotiana sylvestris
ref|XP_003082726.1|  probable cytochrome P450 (ISS)                     129   2e-30   
ref|XP_010241651.1|  PREDICTED: carotene epsilon-monooxygenase, c...    128   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_008462512.1|  PREDICTED: carotene epsilon-monooxygenase, c...    127   3e-30   Cucumis melo [Oriental melon]
ref|NP_001234058.1|  cytochrome P450-type monooxygenase 97C11           127   3e-30   
ref|XP_006339097.1|  PREDICTED: carotene epsilon-monooxygenase, c...    127   3e-30   Solanum tuberosum [potatoes]
ref|XP_002958826.1|  hypothetical protein VOLCADRAFT_100143             128   4e-30   Volvox carteri f. nagariensis
ref|XP_003058421.1|  cytochrome P450 superfamily protein                128   5e-30   Micromonas pusilla CCMP1545
gb|ABQ59243.1|  CYP97C3                                                 127   5e-30   Chlamydomonas reinhardtii
ref|XP_008807069.1|  PREDICTED: LOW QUALITY PROTEIN: carotene eps...    127   5e-30   Phoenix dactylifera
ref|XP_010098846.1|  Carotene epsilon-monooxygenase                     127   5e-30   
gb|AAK20054.1|AC025783_14  putative cytochrome P450 monooxygenase       127   6e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006391881.1|  hypothetical protein EUTSA_v10023482mg             124   6e-30   
ref|XP_008658121.1|  PREDICTED: carotene epsilon-monooxygenase, c...    127   6e-30   Zea mays [maize]
ref|XP_006428525.1|  hypothetical protein CICLE_v10011420mg             126   8e-30   Citrus clementina [clementine]
gb|EEC67393.1|  hypothetical protein OsI_34547                          126   9e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_011094564.1|  PREDICTED: carotene epsilon-monooxygenase, c...    126   1e-29   Sesamum indicum [beniseed]
gb|KDO54337.1|  hypothetical protein CISIN_1g008564mg                   125   2e-29   Citrus sinensis [apfelsine]
gb|KDO54335.1|  hypothetical protein CISIN_1g008564mg                   125   2e-29   Citrus sinensis [apfelsine]
gb|KDO54333.1|  hypothetical protein CISIN_1g008564mg                   125   2e-29   Citrus sinensis [apfelsine]
gb|KDO54334.1|  hypothetical protein CISIN_1g008564mg                   125   2e-29   Citrus sinensis [apfelsine]
ref|XP_009375781.1|  PREDICTED: carotene epsilon-monooxygenase, c...    125   2e-29   
ref|XP_009382395.1|  PREDICTED: carotene epsilon-monooxygenase, c...    125   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382394.1|  PREDICTED: carotene epsilon-monooxygenase, c...    125   3e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382396.1|  PREDICTED: carotene epsilon-monooxygenase, c...    125   3e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006391882.1|  hypothetical protein EUTSA_v10023482mg             124   3e-29   
ref|XP_007027524.1|  Cytochrome P450 superfamily protein isoform 2      123   3e-29   
ref|XP_008392557.1|  PREDICTED: carotene epsilon-monooxygenase, c...    124   3e-29   Malus domestica [apple tree]
ref|XP_002467549.1|  hypothetical protein SORBIDRAFT_01g030050          124   3e-29   
ref|XP_002955547.1|  hypothetical protein VOLCADRAFT_83281              124   4e-29   Volvox carteri f. nagariensis
ref|XP_004156328.1|  PREDICTED: carotene epsilon-monooxygenase, c...    124   5e-29   
gb|KHG23674.1|  Cytochrome P450, chloroplastic                          124   6e-29   Gossypium arboreum [tree cotton]
ref|XP_004143287.1|  PREDICTED: carotene epsilon-monooxygenase, c...    124   6e-29   Cucumis sativus [cucumbers]
ref|XP_002519427.1|  cytochrome P450, putative                          124   6e-29   
ref|XP_004516958.1|  PREDICTED: carotene epsilon-monooxygenase, c...    124   7e-29   
ref|XP_010907646.1|  PREDICTED: carotene epsilon-monooxygenase, c...    123   7e-29   
ref|XP_003062894.1|  predicted protein                                  123   7e-29   Micromonas pusilla CCMP1545
gb|KJB46498.1|  hypothetical protein B456_007G372200                    123   8e-29   Gossypium raimondii
ref|XP_010907645.1|  PREDICTED: carotene epsilon-monooxygenase, c...    123   8e-29   Elaeis guineensis
ref|XP_010907643.1|  PREDICTED: carotene epsilon-monooxygenase, c...    123   8e-29   Elaeis guineensis
ref|XP_011468004.1|  PREDICTED: carotene epsilon-monooxygenase, c...    122   1e-28   Fragaria vesca subsp. vesca
ref|XP_010546517.1|  PREDICTED: carotene epsilon-monooxygenase, c...    123   1e-28   Tarenaya hassleriana [spider flower]
gb|EYU41579.1|  hypothetical protein MIMGU_mgv1a004062mg                123   1e-28   Erythranthe guttata [common monkey flower]
ref|XP_004306170.1|  PREDICTED: carotene epsilon-monooxygenase, c...    122   2e-28   Fragaria vesca subsp. vesca
ref|XP_006381359.1|  hypothetical protein POPTR_0006s12150g             122   2e-28   
ref|XP_011018827.1|  PREDICTED: carotene epsilon-monooxygenase, c...    122   2e-28   Populus euphratica
ref|XP_011018826.1|  PREDICTED: carotene epsilon-monooxygenase, c...    122   2e-28   Populus euphratica
ref|XP_011396817.1|  Cytochrome P450 97B3, chloroplastic                122   2e-28   Auxenochlorella protothecoides
ref|XP_007027523.1|  Cytochrome P450 superfamily protein isoform 1      122   2e-28   
gb|AFQ31612.1|  CYP97C                                                  122   2e-28   Haematococcus lacustris
ref|XP_008241353.1|  PREDICTED: carotene epsilon-monooxygenase, c...    122   3e-28   Prunus mume [ume]
emb|CBI30186.3|  unnamed protein product                                121   3e-28   Vitis vinifera
gb|AGT63110.1|  plastid carotenoid epsilon-ring hydroxylase             122   3e-28   Haematococcus lacustris
ref|XP_007204192.1|  hypothetical protein PRUPE_ppa003701mg             122   3e-28   Prunus persica
gb|KCW89308.1|  hypothetical protein EUGRSUZ_A01599                     121   3e-28   Eucalyptus grandis [rose gum]
ref|XP_006491796.1|  PREDICTED: carotene epsilon-monooxygenase, c...    121   4e-28   Citrus sinensis [apfelsine]
gb|EPS64627.1|  hypothetical protein M569_10150                         122   5e-28   Genlisea aurea
ref|XP_010050328.1|  PREDICTED: carotene epsilon-monooxygenase, c...    121   5e-28   Eucalyptus grandis [rose gum]
ref|XP_002503315.1|  predicted protein                                  122   6e-28   Micromonas commoda
gb|ABC59096.1|  cytochrome P450 monooxygenase CYP97C10                  121   6e-28   Medicago truncatula
gb|KDO54336.1|  hypothetical protein CISIN_1g008564mg                   120   7e-28   Citrus sinensis [apfelsine]
ref|XP_002991812.1|  hypothetical protein SELMODRAFT_186370             120   7e-28   Selaginella moellendorffii
ref|XP_002992972.1|  hypothetical protein SELMODRAFT_187123             120   7e-28   Selaginella moellendorffii
emb|CAN65775.1|  hypothetical protein VITISV_030413                     120   7e-28   Vitis vinifera
ref|XP_002265015.1|  PREDICTED: carotene epsilon-monooxygenase, c...    120   1e-27   
ref|XP_006833028.1|  hypothetical protein AMTR_s00094p00105890          112   1e-27   
ref|XP_010683980.1|  PREDICTED: carotene epsilon-monooxygenase, c...    119   2e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_005761340.1|  hypothetical protein EMIHUDRAFT_471046             115   3e-27   Emiliania huxleyi CCMP1516
gb|AJB84623.1|  carotene epsilon-monooxygenase                          119   3e-27   Camellia sinensis [black tea]
gb|ABB52076.1|  putative epsilon-ring carotene hydroxylase              118   6e-27   Daucus carota subsp. sativus
gb|KDP29211.1|  hypothetical protein JCGZ_16600                         118   1e-26   Jatropha curcas
gb|AJD25228.1|  cytochrome P450 CYP97C28                                117   1e-26   Salvia miltiorrhiza [Chinese salvia]
gb|ADK60778.1|  putative mitochondrial cytochrome P450 monooxygenase    112   2e-26   Arachis diogoi
ref|XP_005779653.1|  hypothetical protein EMIHUDRAFT_463287             117   4e-26   Emiliania huxleyi CCMP1516
ref|XP_002971637.1|  hypothetical protein SELMODRAFT_231778             114   5e-26   
ref|XP_006833025.1|  hypothetical protein AMTR_s00094p00091950          108   6e-26   
gb|ABD97103.1|  cytochrome P450 monooxygenase CYP97C10                  114   6e-26   Glycine max [soybeans]
ref|XP_010674674.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    115   1e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|AJD25226.1|  cytochrome P450 CYP97A41                                115   1e-25   Salvia miltiorrhiza [Chinese salvia]
ref|XP_002965693.1|  hypothetical protein SELMODRAFT_407294             114   1e-25   
gb|ACU20919.1|  unknown                                                 107   2e-25   Glycine max [soybeans]
ref|XP_006829190.1|  hypothetical protein AMTR_s00001p00271310          114   2e-25   Amborella trichopoda
ref|XP_002512609.1|  cytochrome P450, putative                          115   2e-25   
ref|XP_003534527.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    114   3e-25   Glycine max [soybeans]
ref|XP_006428546.1|  hypothetical protein CICLE_v10011312mg             114   3e-25   Citrus clementina [clementine]
ref|XP_008218412.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    114   3e-25   Prunus mume [ume]
ref|XP_006428547.1|  hypothetical protein CICLE_v10011312mg             114   3e-25   Citrus clementina [clementine]
gb|KHN29293.1|  Protein LUTEIN DEFICIENT 5, chloroplastic               114   3e-25   Glycine soja [wild soybean]
ref|XP_004170273.1|  PREDICTED: LOW QUALITY PROTEIN: protein LUTE...    114   4e-25   
ref|XP_004133753.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    114   4e-25   Cucumis sativus [cucumbers]
ref|XP_003552430.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    114   5e-25   Glycine max [soybeans]
ref|XP_004302135.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    113   5e-25   Fragaria vesca subsp. vesca
ref|XP_006649172.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    113   5e-25   Oryza brachyantha
ref|XP_002890950.1|  hypothetical protein ARALYDRAFT_473366             113   6e-25   
ref|XP_008450166.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    113   7e-25   Cucumis melo [Oriental melon]
ref|XP_009108103.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    113   8e-25   Brassica rapa
emb|CDY27131.1|  BnaA08g07690D                                          113   8e-25   Brassica napus [oilseed rape]
emb|CDY12360.1|  BnaC08g08450D                                          113   8e-25   Brassica napus [oilseed rape]
ref|XP_007204988.1|  hypothetical protein PRUPE_ppa003455mg             112   9e-25   
ref|NP_001234049.1|  cytochrome P450-type monooxygenase 97A29           112   9e-25   Solanum lycopersicum
emb|CBI17673.3|  unnamed protein product                                112   1e-24   Vitis vinifera
ref|XP_010245680.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    112   1e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010245679.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    112   1e-24   Nelumbo nucifera [Indian lotus]
gb|KDP23307.1|  hypothetical protein JCGZ_23140                         112   1e-24   Jatropha curcas
ref|XP_002279984.3|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    112   1e-24   Vitis vinifera
ref|XP_001698892.1|  cytochrome P450, carotenoid hydroxylase            112   2e-24   Chlamydomonas reinhardtii
ref|XP_005652354.1|  cytochrome P450                                    109   3e-24   Coccomyxa subellipsoidea C-169
ref|XP_010070132.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    111   4e-24   Eucalyptus grandis [rose gum]
ref|XP_007139751.1|  hypothetical protein PHAVU_008G056400g             111   4e-24   Phaseolus vulgaris [French bean]
ref|XP_009802494.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    111   4e-24   Nicotiana sylvestris
ref|XP_006340502.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    111   4e-24   Solanum tuberosum [potatoes]
ref|XP_001781608.1|  predicted protein                                  110   5e-24   
ref|XP_006415302.1|  hypothetical protein EUTSA_v10007138mg             110   5e-24   
ref|XP_010907644.1|  PREDICTED: carotene epsilon-monooxygenase, c...    110   5e-24   
ref|XP_010111039.1|  Protein LUTEIN DEFICIENT 5                         110   5e-24   
ref|XP_001783943.1|  predicted protein                                  110   5e-24   
ref|XP_010499724.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    110   7e-24   
ref|XP_009627106.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    110   8e-24   
ref|NP_564384.1|  protein LUTEIN DEFICIENT 5                            109   1e-23   
gb|AAG50718.1|AC079041_11  cytochrome P450, putative                    109   1e-23   
gb|EMS64313.1|  Cytochrome P450 97B2, chloroplastic                     108   1e-23   
ref|XP_006830626.1|  hypothetical protein AMTR_s00120p00092320          109   2e-23   
gb|ABC59110.1|  cytochrome P450 monooxygenase CYP97A10                  107   2e-23   
gb|EPS59936.1|  hypothetical protein M569_14868                         108   2e-23   
ref|XP_006304811.1|  hypothetical protein CARUB_v10012441mg             109   2e-23   
ref|XP_007029434.1|  Cytochrome P450, family 97, subfamily A, pol...    109   2e-23   
ref|XP_007029436.1|  Cytochrome P450, family 97, subfamily A, pol...    109   2e-23   
ref|XP_007029435.1|  Cytochrome P450 97B2 isoform 2                     108   2e-23   
ref|XP_008646433.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    109   2e-23   
gb|KFK44941.1|  hypothetical protein AALP_AA1G322700                    108   2e-23   
ref|XP_009346816.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    108   2e-23   
ref|XP_009346815.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    108   2e-23   
ref|XP_009337974.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    108   3e-23   
ref|XP_007513609.1|  predicted protein                                  108   3e-23   
ref|XP_004954387.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    108   3e-23   
gb|EEE58048.1|  hypothetical protein OsJ_08883                          108   3e-23   
ref|XP_009337972.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    108   3e-23   
ref|NP_001048526.1|  Os02g0817900                                       108   3e-23   
gb|EMT31539.1|  Cytochrome P450 97B2                                    108   3e-23   
gb|EEC74248.1|  hypothetical protein OsI_09455                          108   3e-23   
ref|XP_004492816.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    108   4e-23   
ref|XP_010461000.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    108   4e-23   
ref|XP_010478597.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    108   4e-23   
ref|XP_008388781.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    108   4e-23   
ref|XP_008388780.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    108   4e-23   
gb|KJB82186.1|  hypothetical protein B456_013G180200                    108   4e-23   
ref|XP_010540722.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    108   4e-23   
gb|AIX87503.1|  P450 carotenoid beta-ring hydroxylase                   108   5e-23   
gb|KJB82185.1|  hypothetical protein B456_013G180200                    108   5e-23   
gb|EYU39507.1|  hypothetical protein MIMGU_mgv1a003045mg                108   5e-23   
gb|KJB82184.1|  hypothetical protein B456_013G180200                    108   5e-23   
ref|XP_008364063.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    107   5e-23   
gb|EMS57431.1|  Cytochrome P450 97B2, chloroplastic                     107   6e-23   
emb|CDP04239.1|  unnamed protein product                                107   7e-23   
ref|XP_008370918.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    106   7e-23   
ref|XP_003624118.1|  Cytochrome P450                                    107   7e-23   
ref|XP_011077088.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    107   7e-23   
gb|AES80336.2|  cytochrome P450 family monooxygenase                    107   9e-23   
ref|XP_003570402.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    107   1e-22   
gb|AIX87527.1|  P450 carotenoid beta-ring hydroxylase                   106   1e-22   
gb|AFU10536.1|  chloroplast cytochrome P450 monooxygenase 97A3          106   1e-22   
ref|XP_010264030.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    106   2e-22   
ref|XP_009341091.1|  PREDICTED: LOW QUALITY PROTEIN: carotene eps...    104   2e-22   
ref|XP_011013175.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    105   5e-22   
ref|XP_009386597.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    105   5e-22   
ref|XP_008789534.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    103   1e-21   
ref|XP_002454784.1|  hypothetical protein SORBIDRAFT_04g037300          103   1e-21   
ref|XP_010940645.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    102   5e-21   
gb|AEQ20873.1|  epsilon-carotene hydroxylase                          91.7    9e-20   
emb|CEF99083.1|  Cytochrome P450, conserved site                      97.1    3e-19   
ref|XP_001419574.1|  predicted protein                                95.5    7e-19   
ref|XP_007510564.1|  predicted protein                                92.4    1e-17   
gb|EJK60667.1|  hypothetical protein THAOC_18940                      85.5    2e-17   
gb|KIZ06958.1|  hypothetical protein MNEG_0987                        85.9    5e-17   
gb|KJB82188.1|  hypothetical protein B456_013G180200                  89.7    7e-17   
gb|EYU39508.1|  hypothetical protein MIMGU_mgv1a003045mg              89.7    8e-17   
ref|XP_002506185.1|  predicted protein                                89.0    1e-16   
ref|XP_003056711.1|  predicted protein                                88.6    2e-16   
dbj|BAJ91518.1|  predicted protein                                    88.2    3e-16   
gb|ABA27087.1|  TO103-3                                               80.5    1e-15   
ref|WP_015803319.1|  cytochrome P450                                  84.0    4e-15   
ref|XP_003081246.1|  putative cytochrome P450 monooxygenase (ISS)     83.6    9e-15   
ref|WP_043466649.1|  cytochrome P450                                  82.8    1e-14   
ref|WP_037979442.1|  cytochrome P450                                  82.0    2e-14   
ref|XP_010019089.1|  PREDICTED: cytochrome P450 4V2-like              78.6    3e-14   
ref|XP_009582591.1|  PREDICTED: cytochrome P450 4V2-like              78.2    4e-14   
ref|XP_006263919.1|  PREDICTED: cytochrome P450 4B1-like              77.4    4e-14   
gb|EMC80620.1|  Cytochrome P450 4V2                                   79.7    4e-14   
ref|XP_010172881.1|  PREDICTED: cytochrome P450 4V2                   80.9    5e-14   
ref|WP_016546059.1|  cytochrome P450                                  80.9    5e-14   
ref|XP_001959879.1|  GF11817                                          80.9    5e-14   
gb|KFZ48513.1|  Cytochrome P450 4V2                                   80.9    6e-14   
ref|XP_009867596.1|  PREDICTED: cytochrome P450 4V2-like              77.4    8e-14   
ref|XP_005500270.1|  PREDICTED: cytochrome P450 4V2-like isoform X2   79.7    1e-13   
ref|XP_010080484.1|  PREDICTED: thromboxane-A synthase-like           74.7    2e-13   
ref|XP_005500269.1|  PREDICTED: cytochrome P450 4V2-like isoform X1   79.3    2e-13   
gb|KFV14223.1|  Thromboxane-A synthase                                74.7    2e-13   
gb|KFQ43026.1|  Thromboxane-A synthase                                75.5    2e-13   
gb|KFO79690.1|  Cytochrome P450 4V2                                   79.3    2e-13   
ref|XP_009563950.1|  PREDICTED: cytochrome P450 4V2                   79.3    2e-13   
ref|XP_009981146.1|  PREDICTED: cytochrome P450 4V2                   79.0    2e-13   
ref|XP_005243199.1|  PREDICTED: cytochrome P450 4V2-like              79.0    3e-13   
ref|WP_026672938.1|  hypothetical protein                             78.6    3e-13   
gb|KFQ05492.1|  Cytochrome P450 4V2                                   79.0    3e-13   
ref|XP_009960179.1|  PREDICTED: cytochrome P450 4V2                   78.6    3e-13   
ref|NP_001001879.1|  cytochrome P450, family 4, subfamily V, poly...  78.6    3e-13   
ref|XP_010190788.1|  PREDICTED: cytochrome P450 4V2                   78.6    3e-13   
ref|WP_033201907.1|  cytochrome P450                                  78.6    3e-13   
ref|WP_037968823.1|  cytochrome P450                                  78.6    3e-13   
gb|KFQ40732.1|  Cytochrome P450 4V2                                   78.6    3e-13   
ref|XP_003763211.1|  PREDICTED: cytochrome P450 3A5-like              77.4    3e-13   
ref|WP_013020288.1|  cytochrome P450                                  78.2    4e-13   
ref|XP_011412813.1|  PREDICTED: cytochrome P450 4F22-like             78.2    4e-13   
ref|WP_035868092.1|  cytochrome P450                                  78.2    4e-13   
gb|KDO54874.1|  hypothetical protein CISIN_1g0072312mg                73.2    4e-13   
ref|XP_010209107.1|  PREDICTED: cytochrome P450 4V2                   78.2    4e-13   
gb|KFP28925.1|  Cytochrome P450 4V2                                   78.2    4e-13   
ref|XP_002138545.1|  GA24833                                          78.2    5e-13   
gb|KFV96946.1|  Cytochrome P450 4V2                                   77.4    7e-13   
ref|XP_010147968.1|  PREDICTED: cytochrome P450 4V2                   77.4    7e-13   
ref|XP_009473113.1|  PREDICTED: cytochrome P450 4V2                   77.4    8e-13   
gb|KFQ79651.1|  Cytochrome P450 4V2                                   77.4    8e-13   
ref|XP_009478507.1|  PREDICTED: cytochrome P450 4V2-like              75.9    8e-13   
gb|KFR08758.1|  Cytochrome P450 4V2                                   77.4    8e-13   
ref|XP_003205823.1|  PREDICTED: cytochrome P450 4V2                   77.4    8e-13   
ref|XP_006015877.1|  PREDICTED: cytochrome P450 4A12A-like            77.0    8e-13   
gb|KFQ59985.1|  Cytochrome P450 4V2                                   75.9    8e-13   
gb|KFW71810.1|  Cytochrome P450 4V2                                   77.4    9e-13   
ref|XP_009328930.1|  PREDICTED: cytochrome P450 4V2                   77.0    9e-13   
ref|XP_010290117.1|  PREDICTED: cytochrome P450 4V2                   77.0    9e-13   
ref|WP_009154628.1|  cytochrome P450                                  77.0    1e-12   
gb|KGL73289.1|  Cytochrome P450 4V2                                   77.0    1e-12   
ref|XP_010220976.1|  PREDICTED: cytochrome P450 4V2                   77.0    1e-12   
ref|XP_009275655.1|  PREDICTED: cytochrome P450 4V2                   77.0    1e-12   
ref|XP_009900520.1|  PREDICTED: cytochrome P450 4V2                   77.0    1e-12   
gb|KFO04478.1|  Cytochrome P450 4V2                                   77.0    1e-12   
gb|KFV42202.1|  Cytochrome P450 4V2                                   77.0    1e-12   
gb|KFM06228.1|  Cytochrome P450 4V2                                   77.0    1e-12   
ref|XP_010298276.1|  PREDICTED: cytochrome P450 4V2                   77.0    1e-12   
gb|KFV68658.1|  Cytochrome P450 4V2                                   77.0    1e-12   
ref|XP_009938493.1|  PREDICTED: cytochrome P450 4V2 isoform X2        77.0    1e-12   
ref|XP_009962626.1|  PREDICTED: cytochrome P450 4V2                   77.0    1e-12   
ref|XP_008946210.1|  PREDICTED: cytochrome P450 4V2                   77.0    1e-12   
ref|WP_005040564.1|  cytochrome P450                                  75.5    1e-12   
ref|XP_002068796.1|  GK17838                                          76.6    1e-12   
ref|XP_009938492.1|  PREDICTED: cytochrome P450 4V2 isoform X1        76.6    1e-12   
gb|KFP18953.1|  Cytochrome P450 4V2                                   76.6    1e-12   
ref|XP_009640714.1|  PREDICTED: cytochrome P450 4V2                   76.6    1e-12   
ref|XP_009043079.1|  hypothetical protein AURANDRAFT_9878             71.2    2e-12   
ref|XP_002049575.1|  GJ21667                                          76.3    2e-12   
gb|KFW81676.1|  Cytochrome P450 4V2                                   76.3    2e-12   
ref|XP_008923000.1|  PREDICTED: cytochrome P450 4V2                   76.3    2e-12   
ref|XP_002033066.1|  GM21113                                          76.3    2e-12   
ref|WP_019989847.1|  cytochrome P450                                  76.3    2e-12   
ref|WP_035290705.1|  hypothetical protein                             75.9    2e-12   
ref|NP_610473.1|  Cyp4p3                                              76.3    2e-12   
gb|KFQ21330.1|  Cytochrome P450 4V2                                   76.3    2e-12   
ref|WP_040006741.1|  cytochrome P450                                  75.9    2e-12   
emb|CCH55669.1|  cyc2                                                 75.9    2e-12   
gb|KFV58947.1|  Cytochrome P450 4V2                                   75.9    2e-12   
gb|KFQ86713.1|  Cytochrome P450 4V2                                   75.9    2e-12   
ref|XP_005149111.1|  PREDICTED: cytochrome P450 4V2-like              75.9    2e-12   
ref|XP_009924714.1|  PREDICTED: cytochrome P450 4V2                   74.3    2e-12   
gb|EEZ99363.1|  cytochrome P450-like protein                          72.4    3e-12   
gb|EWC58123.1|  cytochrome P450                                       75.9    3e-12   
ref|XP_009816577.1|  PREDICTED: cytochrome P450 4V2                   75.9    3e-12   
ref|XP_009081963.1|  PREDICTED: cytochrome P450 4V2                   75.9    3e-12   
ref|XP_002050323.1|  GJ22097                                          75.9    3e-12   
ref|WP_015152944.1|  cytochrome P450                                  75.5    3e-12   
ref|XP_002018192.1|  GL17580                                          75.5    3e-12   
ref|XP_003801475.1|  PREDICTED: cytochrome P450 4X1-like              75.5    3e-12   
gb|AGJ83726.1|  cytochrome P450                                       73.6    3e-12   
ref|XP_008490073.1|  PREDICTED: cytochrome P450 4V2                   75.5    3e-12   
ref|WP_012234495.1|  hypothetical protein                             75.5    3e-12   
ref|WP_020769637.1|  cytochrome P450                                  75.1    4e-12   
ref|XP_010357874.1|  PREDICTED: cytochrome P450 4B1-like              71.6    4e-12   
ref|XP_010399874.1|  PREDICTED: cytochrome P450 4V2 isoform X4        75.1    4e-12   
ref|XP_010399871.1|  PREDICTED: cytochrome P450 4V2 isoform X2        75.1    4e-12   
ref|XP_010399870.1|  PREDICTED: cytochrome P450 4V2 isoform X1        75.1    5e-12   
ref|XP_008639675.1|  PREDICTED: cytochrome P450 4V2                   75.1    5e-12   
gb|KFO65043.1|  Cytochrome P450 4V2                                   75.1    5e-12   
ref|XP_010399873.1|  PREDICTED: cytochrome P450 4V2 isoform X3        75.1    5e-12   
ref|WP_017949162.1|  cytochrome P450                                  74.7    5e-12   
ref|WP_006975851.1|  cytochrome P450 family protein                   74.7    5e-12   
ref|XP_004452069.1|  PREDICTED: cytochrome P450 3A29-like isoform 1   75.1    5e-12   
ref|XP_005045213.1|  PREDICTED: cytochrome P450 4V2-like              75.1    5e-12   
ref|WP_020161050.1|  MULTISPECIES: cytochrome P450                    74.7    5e-12   
gb|KFW04945.1|  Thromboxane-A synthase                                71.2    5e-12   
ref|WP_042816376.1|  cytochrome P450                                  74.7    5e-12   
sp|Q8SPK0.1|CP4AP_PIG  RecName: Full=Cytochrome P450 4A25; AltNam...  74.7    5e-12   
ref|WP_008591672.1|  cytochrome P450                                  74.7    5e-12   
ref|XP_005517737.1|  PREDICTED: cytochrome P450 4V2-like              74.7    5e-12   
ref|XP_010000770.1|  PREDICTED: cytochrome P450 4V2                   74.7    6e-12   
ref|XP_002089770.1|  GE19268                                          74.7    6e-12   
ref|XP_006274266.1|  PREDICTED: cytochrome P450 4V2-like              74.7    6e-12   
gb|KFV42896.1|  Thromboxane-A synthase                                70.9    6e-12   
ref|XP_009810461.1|  PREDICTED: thromboxane-A synthase-like           70.9    6e-12   
ref|XP_006015961.1|  PREDICTED: cytochrome P450 4V2-like              74.3    6e-12   
emb|CAF96024.1|  unnamed protein product                              74.7    7e-12   
ref|WP_018889154.1|  cytochrome P450                                  74.3    7e-12   
ref|WP_026308546.1|  cytochrome P450                                  74.3    8e-12   
ref|WP_018465663.1|  hypothetical protein                             73.9    8e-12   
ref|XP_007498482.1|  PREDICTED: cytochrome P450 3A24-like isoform X2  73.9    9e-12   
ref|XP_008200988.1|  PREDICTED: cytochrome P450 4C1-like              73.9    9e-12   
ref|XP_003507508.2|  PREDICTED: cytochrome P450 4V2 isoform X1        71.6    9e-12   
ref|NP_001073465.1|  cytochrome P450, family 4, subfamily V, poly...  73.9    1e-11   
gb|EQA35573.1|  unspecific monooxygenase                              73.9    1e-11   
ref|WP_039935528.1|  cytochrome P450                                  73.9    1e-11   
ref|WP_030265702.1|  cytochrome P450                                  73.9    1e-11   
ref|XP_002413003.1|  cytochrome P450, putative                        69.7    1e-11   
ref|XP_002049574.1|  GJ21666                                          73.9    1e-11   
gb|EAU42626.1|  hypothetical protein FP2506_07291                     73.9    1e-11   
ref|WP_037839946.1|  cytochrome P450                                  73.9    1e-11   
ref|WP_027734198.1|  cytochrome P450                                  73.9    1e-11   
ref|WP_006078525.1|  cytochrome P450                                  73.2    1e-11   
ref|XP_004598556.1|  PREDICTED: cytochrome P450 4X1-like              72.0    1e-11   
ref|WP_040489474.1|  cytochrome P450                                  73.6    1e-11   
ref|WP_006893499.1|  cytochrome P450                                  73.6    1e-11   
ref|XP_002005218.1|  GI20372                                          73.9    1e-11   
ref|XP_005483922.1|  PREDICTED: cytochrome P450 4V2-like              73.9    1e-11   
ref|WP_030217492.1|  cytochrome P450                                  73.6    1e-11   
ref|XP_003356523.2|  PREDICTED: cytochrome P450 4X1-like              73.6    1e-11   
ref|WP_030086779.1|  cytochrome P450                                  73.2    1e-11   
gb|AGT57865.1|  cytochrome P450 4aa1                                  70.9    1e-11   
ref|WP_018618424.1|  cytochrome P450                                  73.6    1e-11   
ref|XP_006092709.1|  PREDICTED: cytochrome P450 4V2-like              73.6    1e-11   
gb|EEZ99364.1|  cytochrome P450-like protein                          73.6    1e-11   
ref|XP_010161318.1|  PREDICTED: thromboxane-A synthase                73.6    1e-11   
ref|WP_020734243.1|  hypothetical protein                             73.6    1e-11   
ref|WP_040911305.1|  cytochrome P450                                  73.6    1e-11   
ref|XP_002191071.1|  PREDICTED: cytochrome P450 4V2-like              73.6    1e-11   
gb|EQA46123.1|  unspecific monooxygenase                              73.6    1e-11   



>gb|EYU42831.1| hypothetical protein MIMGU_mgv1a003489mg [Erythranthe guttata]
Length=582

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+PD+LPGGYNGDKDG +IPAG+DI  SVYNLHRSPYFWD PN+FEP  FQV
Sbjct  423  PPLLIRRSLKPDKLPGGYNGDKDGYSIPAGSDIFISVYNLHRSPYFWDNPNDFEPERFQV  482

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             K  E+EGWAGFDPSRSPGALYPNE+ISDFAFLPFGGGPRK VGDQFALMES +ALAMLL
Sbjct  483  QKSSEVEGWAGFDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTVALAMLL  542

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            QKFD++L+G+P+SV+LVTGATIHTKNGLWC+L+KR
Sbjct  543  QKFDVNLRGSPDSVELVTGATIHTKNGLWCQLRKR  577



>ref|XP_009612399.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=546

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+ D+LPGGYNGDKDG  IPAGTD+  SVYNLHRSPYFWDKPNEFEP  F V
Sbjct  389  PPLLIRRSLKSDKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLV  448

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             K   IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES IALAMLL
Sbjct  449  PKESSIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLL  508

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            QKFD++L+G+PESV+LVTGATIHTK GLWCKLKKR
Sbjct  509  QKFDVELRGSPESVELVTGATIHTKTGLWCKLKKR  543



>ref|XP_009612398.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=582

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+ D+LPGGYNGDKDG  IPAGTD+  SVYNLHRSPYFWDKPNEFEP  F V
Sbjct  425  PPLLIRRSLKSDKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLV  484

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             K   IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES IALAMLL
Sbjct  485  PKESSIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLL  544

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            QKFD++L+G+PESV+LVTGATIHTK GLWCKLKKR
Sbjct  545  QKFDVELRGSPESVELVTGATIHTKTGLWCKLKKR  579



>ref|XP_009784852.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X3 [Nicotiana 
sylvestris]
Length=548

 Score =   280 bits (716),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+ D+LPGGYNGDKDG  IPAGTD+  SVYNLHRSPY WDKPNEFEP  F V
Sbjct  391  PPLLIRRSLKSDKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYLWDKPNEFEPERFLV  450

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             K   IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES IALAMLL
Sbjct  451  PKESSIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLL  510

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            QKFD++L+G+PESV+LVTGATIHTK GLWCKLKKR +V
Sbjct  511  QKFDVELRGSPESVELVTGATIHTKTGLWCKLKKRSNV  548



>ref|XP_009784851.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nicotiana 
sylvestris]
Length=574

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+ D+LPGGYNGDKDG  IPAGTD+  SVYNLHRSPY WDKPNEFEP  F V
Sbjct  417  PPLLIRRSLKSDKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYLWDKPNEFEPERFLV  476

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             K   IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES IALAMLL
Sbjct  477  PKESSIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLL  536

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            QKFD++L+G+PESV+LVTGATIHTK GLWCKLKKR +V
Sbjct  537  QKFDVELRGSPESVELVTGATIHTKTGLWCKLKKRSNV  574



>ref|XP_009784850.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nicotiana 
sylvestris]
Length=584

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+ D+LPGGYNGDKDG  IPAGTD+  SVYNLHRSPY WDKPNEFEP  F V
Sbjct  427  PPLLIRRSLKSDKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYLWDKPNEFEPERFLV  486

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             K   IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES IALAMLL
Sbjct  487  PKESSIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLL  546

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            QKFD++L+G+PESV+LVTGATIHTK GLWCKLKKR +V
Sbjct  547  QKFDVELRGSPESVELVTGATIHTKTGLWCKLKKRSNV  584



>gb|AJD25227.1| cytochrome P450 CYP97B34 [Salvia miltiorrhiza]
Length=582

 Score =   276 bits (707),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+PD+LPGGYNGD+DG +IPAGTD+  SVYNLHRSPYFWD PN+FEP  FQV
Sbjct  423  PPLLIRRSLKPDRLPGGYNGDEDGYSIPAGTDLFISVYNLHRSPYFWDNPNDFEPERFQV  482

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             K  +++GWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRK VGDQFALMES +ALA LL
Sbjct  483  QKPSQVDGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCVGDQFALMESTVALAALL  542

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            QKFD++L+G+PESV+LVTGATIHTK+G+WC+LKKRL
Sbjct  543  QKFDVNLRGSPESVELVTGATIHTKSGMWCQLKKRL  578



>ref|XP_009347871.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Pyrus x bretschneideri]
Length=577

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+PD+LPGGYNG KDG A+PAGTD+  SVYNLHRSPYFWD PNEFEP  F V
Sbjct  419  PPLLIRRSLKPDKLPGGYNGAKDGYAVPAGTDLFISVYNLHRSPYFWDNPNEFEPERFLV  478

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             K   +EGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRK VGDQFALMES +ALAMLL
Sbjct  479  EKKSHVEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCVGDQFALMESTVALAMLL  538

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            QKF ++LKG+P+SV+ VTGAT+HTKNGLWCKL+KR D+
Sbjct  539  QKFTVELKGSPDSVEQVTGATLHTKNGLWCKLQKRSDI  576



>ref|XP_002308766.1| hypothetical protein POPTR_0006s00800g [Populus trichocarpa]
 gb|EEE92289.1| hypothetical protein POPTR_0006s00800g [Populus trichocarpa]
Length=579

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+PD LPGGY GDKDG AIPAGTDI  SVYNLHRSPYFWD PNEFEP  F V
Sbjct  420  PPLLIRRSLKPDVLPGGYKGDKDGYAIPAGTDIFVSVYNLHRSPYFWDNPNEFEPERFLV  479

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +  + IEGW+GFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES IAL +L
Sbjct  480  TRNNDGIEGWSGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALTLL  539

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LQKFD++L+G+PE V+LVTGATIHTKNGLWC+LKKR DV
Sbjct  540  LQKFDVELRGSPEEVELVTGATIHTKNGLWCRLKKRSDV  578



>ref|XP_008342307.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Malus domestica]
Length=577

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+PD+LPGGYNG KDG A+PAGTD+  SVYNLHRSPYFWD PNEFEP  F V
Sbjct  419  PPLLIRRSLKPDKLPGGYNGAKDGYAVPAGTDLFISVYNLHRSPYFWDNPNEFEPERFLV  478

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             K   +EGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRK VGDQFALMES +ALAMLL
Sbjct  479  EKKSHVEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCVGDQFALMESTVALAMLL  538

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            QKF ++LKG+P+SV+ VTGAT+HTKNGLWCKL+KR D+
Sbjct  539  QKFTVELKGSPDSVEQVTGATLHTKNGLWCKLQKRSDI  576



>ref|XP_006354415.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Solanum 
tuberosum]
Length=573

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL  D LPGGYNGDK+G  IPAGTD+  SVYNLHRSPYFWDKPNEFEP  F V
Sbjct  415  PPLLIRRSLTSDILPGGYNGDKNGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLV  474

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  + IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES IALAML
Sbjct  475  QKESQGIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAML  534

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LQKFD++LKG+PE V+LVTGATIHTK GLWCKLKKR +V
Sbjct  535  LQKFDVELKGSPEDVELVTGATIHTKTGLWCKLKKRSNV  573



>ref|XP_010093134.1| Cytochrome P450 [Morus notabilis]
 gb|EXB53586.1| Cytochrome P450 [Morus notabilis]
Length=581

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+ D+LPGGYNGDK+G  IP GTDI  SVYNLHRSPYFWD+PNEFEP  F V
Sbjct  422  PPLLIRRSLKSDKLPGGYNGDKNGYEIPVGTDIFISVYNLHRSPYFWDRPNEFEPERFLV  481

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGW GFDPSRSPGALYPNEIISDF+FLPFGGGPRK VGDQFALMES +ALAML
Sbjct  482  EKKGECIEGWDGFDPSRSPGALYPNEIISDFSFLPFGGGPRKCVGDQFALMESTVALAML  541

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LQKFD++LKG+PESV+LVTGATIHTKNGLWCKL+KR  V
Sbjct  542  LQKFDVELKGSPESVELVTGATIHTKNGLWCKLRKRSHV  580



>ref|XP_011100398.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Sesamum indicum]
Length=577

 Score =   273 bits (697),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL  D LPGGYNG+KDG AIP GTD+  SVYNLHRSP+FWD PN+FEP  F +
Sbjct  419  PPLLIRRSLMSDTLPGGYNGNKDGYAIPPGTDLFVSVYNLHRSPHFWDNPNDFEPERFLM  478

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             K  ++EGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES IALAMLL
Sbjct  479  QKLSQLEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLL  538

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            QKFD+ LKG+PESV+LVTGATIHTKNGLWC+LKKR
Sbjct  539  QKFDVSLKGSPESVELVTGATIHTKNGLWCQLKKR  573



>ref|XP_007158591.1| hypothetical protein PHAVU_002G165400g [Phaseolus vulgaris]
 gb|ESW30585.1| hypothetical protein PHAVU_002G165400g [Phaseolus vulgaris]
Length=576

 Score =   272 bits (696),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+ D LPGG+ GDKDG AIPAGTD+  SVYNLHRSPYFWD+P+EFEP  F V
Sbjct  417  PPLLIRRSLKSDVLPGGHKGDKDGYAIPAGTDLFISVYNLHRSPYFWDRPHEFEPERFLV  476

Query  567  X-KXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K  EIEGW+GFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES +AL ML
Sbjct  477  QNKNEEIEGWSGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALTML  536

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LQ FD++LKGTPESV+LVTGATIHTKNGLWCKLKKR D+
Sbjct  537  LQNFDVELKGTPESVELVTGATIHTKNGLWCKLKKRSDL  575



>ref|XP_004239253.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Solanum 
lycopersicum]
Length=578

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL  D LPGGYNGDK+G  IPAGTD+  SVYNLHRSPYFWDKPNEFEP  F V
Sbjct  420  PPLLIRRSLTSDILPGGYNGDKNGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLV  479

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  + IEGW GFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES IALAML
Sbjct  480  QKESQGIEGWGGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAML  539

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LQKFD++LKG+PE V+LVTGATIHTK GLWCKLKKR ++
Sbjct  540  LQKFDVELKGSPEDVELVTGATIHTKTGLWCKLKKRSNI  578



>ref|XP_010321037.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Solanum 
lycopersicum]
Length=573

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL  D LPGGYNGDK+G  IPAGTD+  SVYNLHRSPYFWDKPNEFEP  F V
Sbjct  415  PPLLIRRSLTSDILPGGYNGDKNGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLV  474

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  + IEGW GFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES IALAML
Sbjct  475  QKESQGIEGWGGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAML  534

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LQKFD++LKG+PE V+LVTGATIHTK GLWCKLKKR ++
Sbjct  535  LQKFDVELKGSPEDVELVTGATIHTKTGLWCKLKKRSNI  573



>gb|KEH27406.1| cytochrome P450 family 97 protein [Medicago truncatula]
Length=426

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 137/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+ D LPGG+ GDKDG  IPAGTD+  SVYNLHRSPYFWD+P++FEP  F V
Sbjct  267  PPLLIRRSLKSDVLPGGHKGDKDGYTIPAGTDVFISVYNLHRSPYFWDRPDDFEPERFLV  326

Query  567  X-KXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES +AL ML
Sbjct  327  ENKNEEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALTML  386

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQ FD++LKGTPESV+LVTGATIHTKNGLWC L+KR
Sbjct  387  LQNFDVELKGTPESVELVTGATIHTKNGLWCNLRKR  422



>ref|XP_007215027.1| hypothetical protein PRUPE_ppa003405mg [Prunus persica]
 gb|EMJ16226.1| hypothetical protein PRUPE_ppa003405mg [Prunus persica]
Length=577

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLL+RRSL+ D LPGGYNG+KDG  IPAGTDI  SVYNLHRSPYFWD PNEFEP  F V
Sbjct  419  PPLLVRRSLKSDTLPGGYNGEKDGYVIPAGTDIFLSVYNLHRSPYFWDNPNEFEPERFLV  478

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             K  E+EGWAGFDPSR PGALYP+EI +DFAFLPFGGGPRK VGDQFALMES +ALAMLL
Sbjct  479  PKKSEVEGWAGFDPSRIPGALYPSEITADFAFLPFGGGPRKCVGDQFALMESTVALAMLL  538

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            QKF ++LKG+PESV+ VTGATIHTKNGLWCKL+KR DV
Sbjct  539  QKFTVELKGSPESVEQVTGATIHTKNGLWCKLRKRSDV  576



>ref|XP_004147731.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN53488.1| hypothetical protein Csa_4G056760 [Cucumis sativus]
Length=580

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+PD LPGGYNGDK+G AIPAGTDI  SVYNLHRSPYFW+ P EFEP  FQV
Sbjct  421  PPLLIRRALKPDTLPGGYNGDKNGYAIPAGTDIFISVYNLHRSPYFWENPQEFEPERFQV  480

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +  E IEGW GFDPSRSPGALYPNEI+SDF+FLPFGGGPRK VGDQFALMES IALAML
Sbjct  481  KRASEGIEGWDGFDPSRSPGALYPNEIVSDFSFLPFGGGPRKCVGDQFALMESTIALAML  540

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LQKFD++L+G+PESV+LVTGATIHTK+GLWCKL++R  V
Sbjct  541  LQKFDVELRGSPESVELVTGATIHTKSGLWCKLRRRSQV  579



>ref|XP_002520583.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF41816.1| cytochrome P450, putative [Ricinus communis]
Length=555

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+ D LPGGY GD +G AIP GTDI  SVYNLHRSPYFW+ PNEFEP  F V
Sbjct  396  PPLLIRRALKTDVLPGGYKGDNNGYAIPEGTDIFISVYNLHRSPYFWNSPNEFEPERFLV  455

Query  567  X-KXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES +ALAML
Sbjct  456  QRKSDEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALAML  515

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LQKFD++LKG+PESV+LVTGATIHTKNGLWCKLKKR +V
Sbjct  516  LQKFDVELKGSPESVELVTGATIHTKNGLWCKLKKRSNV  554



>ref|XP_004164429.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Cucumis 
sativus]
Length=580

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+PD LPGGYNGDK+G AIPAGTDI  SVYNLHRSPYFW+ P EFEP  FQV
Sbjct  421  PPLLIRRALKPDTLPGGYNGDKNGYAIPAGTDIFISVYNLHRSPYFWENPQEFEPERFQV  480

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +  E IEGW GFDPSRSPGALYPNEI+SDF+FLPFGGGPRK VGDQFALMES IALA+L
Sbjct  481  KRASEGIEGWDGFDPSRSPGALYPNEIVSDFSFLPFGGGPRKCVGDQFALMESTIALALL  540

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LQKFD++L+G+PESV+LVTGATIHTK+GLWCKL++R  V
Sbjct  541  LQKFDVELRGSPESVELVTGATIHTKSGLWCKLRRRSQV  579



>ref|XP_011002376.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Populus euphratica]
Length=585

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+PD LPGGY GDKDG AI AGTDI  SVYNLHRSPYFWD PNEFEP  F V
Sbjct  426  PPLLIRRSLKPDVLPGGYKGDKDGYAIRAGTDIFVSVYNLHRSPYFWDNPNEFEPERFLV  485

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +  + IEGW+GFDPSRSPGALYPNE+ISDFAFLPFGGGPRK VGDQFALMES  AL +L
Sbjct  486  TRNSDGIEGWSGFDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTTALTLL  545

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LQKFD++L+G+PE V+LVTGATIHTKNGLWC+LKKR DV
Sbjct  546  LQKFDVELRGSPEEVELVTGATIHTKNGLWCRLKKRSDV  584



>ref|XP_008451892.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 97B2, chloroplastic 
[Cucumis melo]
Length=580

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+PD LPGGYNGDK+G AIPAGTDI  SVYNLHRSPYFW+ P EFEP  FQV
Sbjct  421  PPLLIRRALKPDTLPGGYNGDKNGYAIPAGTDIFISVYNLHRSPYFWENPQEFEPERFQV  480

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +  E IEGW GFDPSRSPGALYPNEI+SDF+FLPFGGGPRK VGDQFALMES IALA L
Sbjct  481  KRASEGIEGWDGFDPSRSPGALYPNEIVSDFSFLPFGGGPRKCVGDQFALMESTIALAXL  540

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LQKFD++L+G+PESV+LVTGATIHTK+GLWCKL++R  V
Sbjct  541  LQKFDVELRGSPESVELVTGATIHTKSGLWCKLRRRSQV  579



>ref|XP_002266883.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Vitis vinifera]
 emb|CBI34117.3| unnamed protein product [Vitis vinifera]
Length=572

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+ D LPGGY G KDG +IPAGTDI  SVYNLHRSPYFWD+P+EFEP  F V
Sbjct  414  PPLLIRRSLKSDALPGGYKGKKDGHSIPAGTDIFLSVYNLHRSPYFWDRPHEFEPERFLV  473

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             +  +IEGW+GFDPSRSPGALYPNEI++DFAFLPFGGGPRK VGDQFALMES IAL MLL
Sbjct  474  PRNSDIEGWSGFDPSRSPGALYPNEIVADFAFLPFGGGPRKCVGDQFALMESTIALTMLL  533

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            QKFD++LKG PESV+LVTGATIHTKNGLWC++ KR D+
Sbjct  534  QKFDVELKGGPESVELVTGATIHTKNGLWCRMMKRSDL  571



>gb|KDP42786.1| hypothetical protein JCGZ_00485 [Jatropha curcas]
Length=583

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 137/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+ D LPGGY G KDG AIP GTDI  SVYNLHRSPYFWD PNEFEP  F V
Sbjct  428  PPLLIRRALKSDVLPGGYKGSKDGYAIPKGTDIFISVYNLHRSPYFWDLPNEFEPERFLV  487

Query  567  X-KXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K  EIEGW GFDPSRSPGALYPNEII+DFAFLPFGGGPRK VGDQFALMES +ALAML
Sbjct  488  QRKSEEIEGWTGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCVGDQFALMESTVALAML  547

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++LKG+PESV+LVTGATIHTKNGLWCKL+KR
Sbjct  548  LQKFDVELKGSPESVELVTGATIHTKNGLWCKLRKR  583



>ref|XP_010680161.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=574

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+PD LPGGY G KDG  IP GTDI  SVYNLHRSPY WDKP+EFEP  F V
Sbjct  415  PPLLIRRTLKPDLLPGGYKGQKDGYQIPTGTDIFISVYNLHRSPYLWDKPHEFEPERFLV  474

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +  E IEGW GFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES IALAML
Sbjct  475  ERKSEDIEGWNGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAML  534

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LQKFD+ LKG+P+SV+LVTGATIHTKNGLWCKL+KR +V
Sbjct  535  LQKFDVTLKGSPDSVELVTGATIHTKNGLWCKLRKRANV  573



>ref|XP_003610974.1| Cytochrome P450 [Medicago truncatula]
 gb|AES93932.1| cytochrome P450 family 97 protein [Medicago truncatula]
Length=574

 Score =   268 bits (684),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 137/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+ D LPGG+ GDKDG  IPAGTD+  SVYNLHRSPYFWD+P++FEP  F V
Sbjct  415  PPLLIRRSLKSDVLPGGHKGDKDGYTIPAGTDVFISVYNLHRSPYFWDRPDDFEPERFLV  474

Query  567  X-KXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES +AL ML
Sbjct  475  ENKNEEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALTML  534

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQ FD++LKGTPESV+LVTGATIHTKNGLWC L+KR
Sbjct  535  LQNFDVELKGTPESVELVTGATIHTKNGLWCNLRKR  570



>ref|XP_010313051.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 97B2, chloroplastic-like 
[Solanum lycopersicum]
Length=585

 Score =   268 bits (684),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL  D LPGGYNGDK+G  IPAGTD+  SVYNLHRSPYFWDKPNEFEPX F V
Sbjct  427  PPLLIRRSLTSDILPGGYNGDKNGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPXRFLV  486

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K    IEGW GFDPSRS GALYPNEIISDFAFLPFGGGPRK VGDQFALMES IALAML
Sbjct  487  QKESRGIEGWGGFDPSRSRGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAML  546

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LQKFD++LKG+PE V+LVTGATIHTK GLWCKLKKR ++
Sbjct  547  LQKFDVELKGSPEDVELVTGATIHTKTGLWCKLKKRSNI  585



>gb|KHG14945.1| Cytochrome P450, chloroplastic [Gossypium arboreum]
Length=576

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L    LPGGY GDKDG  IPAGTDI  SVYNLHRSPYFWD+P++F P  FQV
Sbjct  417  PPLLIRRALEEVVLPGGYKGDKDGYTIPAGTDIFISVYNLHRSPYFWDQPHDFVPERFQV  476

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES +ALAML
Sbjct  477  QKESEGIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALAML  536

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+PESV+LVTGATIHTKNGLWCKLK+R
Sbjct  537  LQKFDVELRGSPESVELVTGATIHTKNGLWCKLKRR  572



>dbj|BAJ97821.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSLRPD+LPGGYNG K+G  IPAGTDI  S+YNLHRSPYFWD+PNEFEP  F V
Sbjct  416  PPLLIRRSLRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTV  475

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGWAGFDP RSPGA+YPNEII+DFAFLPFGGGPRK VGDQFAL+ES +ALA+L
Sbjct  476  PKKDENIEGWAGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALL  535

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+P+ V++VTGATIHTKNGLWC+L+KR
Sbjct  536  LQKFDVELRGSPDEVEMVTGATIHTKNGLWCRLRKR  571



>gb|KHN35086.1| Cytochrome P450 97B2, chloroplastic [Glycine soja]
Length=576

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+ D LPGG+ G+KDG AIPAGTD+  SVYNLHRSPYFWD+P++FEP  F V
Sbjct  417  PPLLIRRSLKSDVLPGGHKGEKDGYAIPAGTDVFISVYNLHRSPYFWDRPDDFEPERFLV  476

Query  567  X-KXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K  EIEGWAG DPSRSPGALYPNE+ISDFAFLPFGGGPRK VGDQFALMES +AL ML
Sbjct  477  QNKNEEIEGWAGLDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTVALTML  536

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQ FD++LKGTPESV+LVTGATIHTKNG+WC+LKKR
Sbjct  537  LQNFDVELKGTPESVELVTGATIHTKNGMWCRLKKR  572



>ref|NP_001235534.1| cytochrome P450 97B2, chloroplastic [Glycine max]
 sp|O48921.1|C97B2_SOYBN RecName: Full=Cytochrome P450 97B2, chloroplastic; Flags: Precursor 
[Glycine max]
 gb|AAB94586.1| CYP97B2p [Glycine max]
Length=576

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+ D LPGG+ G+KDG AIPAGTD+  SVYNLHRSPYFWD+P++FEP  F V
Sbjct  417  PPLLIRRSLKSDVLPGGHKGEKDGYAIPAGTDVFISVYNLHRSPYFWDRPDDFEPERFLV  476

Query  567  X-KXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K  EIEGWAG DPSRSPGALYPNE+ISDFAFLPFGGGPRK VGDQFALMES +AL ML
Sbjct  477  QNKNEEIEGWAGLDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTVALTML  536

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQ FD++LKGTPESV+LVTGATIHTKNG+WC+LKKR
Sbjct  537  LQNFDVELKGTPESVELVTGATIHTKNGMWCRLKKR  572



>dbj|BAJ87287.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSLRPD+LPGGYNG K+G  IPAGTDI  S+YNLHRSPYFWD+PNEFEP  F V
Sbjct  416  PPLLIRRSLRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTV  475

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGWAGFDP RSPGA+YPNEII+DFAFLPFGGGPRK VGDQFAL+ES +ALA+L
Sbjct  476  PKKDENIEGWAGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALL  535

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+P+ V++VTGATIHTKNGLWC+L+KR
Sbjct  536  LQKFDVELRGSPDEVEMVTGATIHTKNGLWCRLRKR  571



>gb|EMS51606.1| Cytochrome P450 97B2, chloroplastic [Triticum urartu]
Length=571

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSLRPD+LPGGYNG K+G  IPAGTDI  S+YNLHRSPYFWD+PNEFEP  F V
Sbjct  415  PPLLIRRSLRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTV  474

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGWAGFDP RSPGA+YPNEII+DFAFLPFGGGPRK VGDQFAL+ES +ALA+L
Sbjct  475  PKKDENIEGWAGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALL  534

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+P  V++VTGATIHTKNGLWC+L+KR
Sbjct  535  LQKFDVELRGSPNEVEMVTGATIHTKNGLWCRLRKR  570



>ref|XP_010044825.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Eucalyptus grandis]
 gb|KCW88536.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
 gb|KCW88537.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
 gb|KCW88538.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
Length=584

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 1/158 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+ DQLPGGY GDK+G AIPAGTDI  SVYNLHRSPYFWD+P++FEP  F  
Sbjct  423  PPLLIRRALKSDQLPGGYRGDKNGYAIPAGTDIFISVYNLHRSPYFWDRPSDFEPERFLT  482

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +  E +EGWAGFDPSRSPGALYPNEI+SDFAFLPFGGGPRK VGDQFALMES +ALAML
Sbjct  483  QRKSEGVEGWAGFDPSRSPGALYPNEIVSDFAFLPFGGGPRKCVGDQFALMESTVALAML  542

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLD  277
            LQKFD++LKG+ +SV+LVTGATIHTKNGLWC ++KR D
Sbjct  543  LQKFDVELKGSADSVELVTGATIHTKNGLWCNIRKRSD  580



>ref|XP_007049043.1| Cytochrome P450 97B2 isoform 1 [Theobroma cacao]
 gb|EOX93200.1| Cytochrome P450 97B2 isoform 1 [Theobroma cacao]
Length=622

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+ D +PGGY GDKDG  IPAGTDI  SVYNLHRSPYFWD+P++F P  F V
Sbjct  463  PPLLIRRALKADVIPGGYKGDKDGYKIPAGTDIFLSVYNLHRSPYFWDQPHDFVPERFLV  522

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK +GDQFALMES +ALAML
Sbjct  523  EKKSEGIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCIGDQFALMESTVALAML  582

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++LKG+PESV+LVTGATIHTKNG+WCKL+KR
Sbjct  583  LQKFDVELKGSPESVELVTGATIHTKNGMWCKLRKR  618



>ref|XP_010233882.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Brachypodium 
distachyon]
Length=422

 Score =   261 bits (666),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+LRPD+LPGGYNG K+G  IPAGTDI  S+YNLHRSPYFWD+PNEFEP  F V
Sbjct  266  PPLLIRRALRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTV  325

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGW+GFDP RSPGA+YPNEII+DFAFLPFGGGPRK VGDQFAL+ES +ALAML
Sbjct  326  PKMDENIEGWSGFDPGRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALAML  385

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L KFD++L+G+P+ V++VTGATIHTKNGLWC+L KR
Sbjct  386  LGKFDVELRGSPDEVEMVTGATIHTKNGLWCRLMKR  421



>dbj|BAG90081.1| unnamed protein product [Oryza sativa Japonica Group]
Length=391

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+LRPD+LPGGYNG K+G  IPAGTDI  S+YNLHRSPYFWD+P+EFEP  F V
Sbjct  235  PPLLIRRALRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPDEFEPERFSV  294

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGWAGFDP RSPGA+YPNEI++DFAFLPFGGGPRK VGDQFAL+ES +ALA+L
Sbjct  295  PKKDESIEGWAGFDPDRSPGAMYPNEILADFAFLPFGGGPRKCVGDQFALLESTVALALL  354

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+P+ V++VTGATIHTK+GLWC++++R
Sbjct  355  LQKFDVELRGSPDEVEMVTGATIHTKSGLWCRVRRR  390



>ref|XP_002451628.1| hypothetical protein SORBIDRAFT_04g004850 [Sorghum bicolor]
 gb|EES04604.1| hypothetical protein SORBIDRAFT_04g004850 [Sorghum bicolor]
Length=573

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSLRPD+LPGGYNG K+G  IPAGTDI  S+YNLHRSPYFWD+PNEFEP  F V
Sbjct  417  PPLLIRRSLRPDKLPGGYNGAKEGYEIPAGTDIFVSIYNLHRSPYFWDRPNEFEPERFSV  476

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGW+GFDP RSPGA+YPNEII+DFAFLPFGGGPRK VGDQFAL+ES +ALA+L
Sbjct  477  PKKDESIEGWSGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALL  536

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L+KFD++L+G+P+ V++VTGATIHTKNGLWC+L+KR
Sbjct  537  LRKFDVELRGSPDEVEMVTGATIHTKNGLWCRLRKR  572



>ref|XP_004951757.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Setaria 
italica]
Length=568

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSLRPD+LPGGYNG K+G  IPAGTDI  S+YNLHRSPYFWD+PNEFEP  F V
Sbjct  411  PPLLIRRSLRPDKLPGGYNGAKEGYEIPAGTDIFVSIYNLHRSPYFWDRPNEFEPERFSV  470

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGW+GFDP RSPGA+YPNEII+DFAFLPFGGGPRK VGDQFAL+ES +ALA+L
Sbjct  471  PKKDESIEGWSGFDPERSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALL  530

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L+KFD++L+G+P+ V++VTGATIHTKNGLWC+L++R
Sbjct  531  LRKFDVELRGSPDEVEMVTGATIHTKNGLWCRLRRR  566



>gb|KJB10650.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=498

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 137/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L    LPGGY GDKDG  IPAGTDI  SVYNLHRSPYFWD+P++F P  F+V
Sbjct  339  PPLLIRRALEEVVLPGGYKGDKDGYTIPAGTDIFISVYNLHRSPYFWDQPHDFVPERFRV  398

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IE WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES +ALAML
Sbjct  399  QKESEGIEEWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALAML  458

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+PESV+LVTGATIHTKNGLWCKLK+R
Sbjct  459  LQKFDVELRGSPESVELVTGATIHTKNGLWCKLKRR  494



>ref|XP_010260624.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nelumbo 
nucifera]
Length=481

 Score =   259 bits (663),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL PD LPGGY GDK+G  IPAGTD+  SVYNLHRSPYFWD+P+EFEP  F V
Sbjct  315  PPLLIRRSLVPDVLPGGYKGDKEGYPIPAGTDLFVSVYNLHRSPYFWDRPHEFEPERFLV  374

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +  E IEGWAGFDP RS GALYPNEIISDFAFLPFGGGPRK VGDQFALMES +AL +L
Sbjct  375  PRKSEGIEGWAGFDPCRSAGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALVLL  434

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLD-VC  271
            LQKF ++LKG+PESV+LVTGATIHTK+GLWCKL+KR   VC
Sbjct  435  LQKFTVELKGSPESVELVTGATIHTKSGLWCKLRKRASTVC  475



>gb|KJB10648.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=579

 Score =   262 bits (670),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 137/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L    LPGGY GDKDG  IPAGTDI  SVYNLHRSPYFWD+P++F P  F+V
Sbjct  420  PPLLIRRALEEVVLPGGYKGDKDGYTIPAGTDIFISVYNLHRSPYFWDQPHDFVPERFRV  479

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IE WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES +ALAML
Sbjct  480  QKESEGIEEWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALAML  539

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+PESV+LVTGATIHTKNGLWCKLK+R
Sbjct  540  LQKFDVELRGSPESVELVTGATIHTKNGLWCKLKRR  575



>emb|CDP16026.1| unnamed protein product [Coffea canephora]
Length=599

 Score =   263 bits (671),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+ D+LPGG+ GD +G AIPAGTDI  SVYN+HRSPY WD PN+FEP  F V
Sbjct  438  PPLLIRRSLKSDKLPGGHKGDNNGYAIPAGTDIFLSVYNVHRSPYLWDNPNDFEPERFLV  497

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +  + IEGWAGFDPSRSPGALYPNEI+SDFAFLPFGGGPRK VGDQFA MES IALAML
Sbjct  498  KRVSQGIEGWAGFDPSRSPGALYPNEIMSDFAFLPFGGGPRKCVGDQFAFMESTIALAML  557

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LQ+FDI+LKG+PESV++VTGATIHTKNGLWC+L KR D+
Sbjct  558  LQEFDIELKGSPESVEIVTGATIHTKNGLWCRLMKRQDI  596



>ref|XP_010914244.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Elaeis guineensis]
Length=574

 Score =   262 bits (669),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+PD+LPGGY GD++G  IPAGTDI  SVYNLHRSPYFW++PNEFEP  F V
Sbjct  414  PPLLIRRALKPDKLPGGYKGDENGYKIPAGTDIFLSVYNLHRSPYFWERPNEFEPERFLV  473

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E I+GWAGFDP RSPGA+YPNEII+DFAFLPFGGGPRK VGDQFAL+ES IALAML
Sbjct  474  TKKSEGIDGWAGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTIALAML  533

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQK+DI+LKG+P+ V+ VTGATIHTKNGLWCKLK+R
Sbjct  534  LQKYDIELKGSPDEVEPVTGATIHTKNGLWCKLKRR  569



>ref|XP_007049044.1| Cytochrome P450 97B2, chloroplastic isoform 2 [Theobroma cacao]
 gb|EOX93201.1| Cytochrome P450 97B2, chloroplastic isoform 2 [Theobroma cacao]
Length=582

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 139/157 (89%), Gaps = 2/157 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLP-GGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQ  571
            PPLLIRR+L+ D +P GGY GDKDG  IPAGTDI  SVYNLHRSPYFWD+P++F P  F 
Sbjct  422  PPLLIRRALKADVIPAGGYKGDKDGYKIPAGTDIFLSVYNLHRSPYFWDQPHDFVPERFL  481

Query  570  VXKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
            V K  E IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK +GDQFALMES +ALAM
Sbjct  482  VEKKSEGIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCIGDQFALMESTVALAM  541

Query  393  LLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LLQKFD++LKG+PESV+LVTGATIHTKNG+WCKL+KR
Sbjct  542  LLQKFDVELKGSPESVELVTGATIHTKNGMWCKLRKR  578



>gb|KDO64373.1| hypothetical protein CISIN_1g014372mg [Citrus sinensis]
Length=426

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-Q  571
            PPLLIRR+++PD LPGGY GDKDG  +PAGTDI  S+YNLHRSPYFWD+P+EFEP  F +
Sbjct  267  PPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSIYNLHRSPYFWDRPHEFEPERFLK  326

Query  570  VXKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K   IEGW+GFDPSRSPGALYPNEI+SD+AFL FGGGPRK VGDQFA+MES + LAML
Sbjct  327  PRKDVGIEGWSGFDPSRSPGALYPNEIVSDYAFLGFGGGPRKCVGDQFAVMESTVGLAML  386

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFDI+LKG+PESV+LVTGATIHTKNGLWCKL++R
Sbjct  387  LQKFDIELKGSPESVELVTGATIHTKNGLWCKLRER  422



>ref|XP_006429774.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
 gb|ESR43014.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
Length=426

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-Q  571
            PPLLIRR+++PD LPGGY GDKDG  +PAGTDI  S+YNLHRSPYFWD+P+EFEP  F +
Sbjct  267  PPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSIYNLHRSPYFWDRPHEFEPERFLK  326

Query  570  VXKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K   IEGW+GFDPSRSPGALYPNEI+SD+AFL FGGGPRK VGDQFA+MES + LAML
Sbjct  327  PRKDVGIEGWSGFDPSRSPGALYPNEIVSDYAFLGFGGGPRKCVGDQFAVMESTVGLAML  386

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFDI+LKG+PESV+LVTGATIHTKNGLWCKL++R
Sbjct  387  LQKFDIELKGSPESVELVTGATIHTKNGLWCKLRER  422



>ref|XP_008679919.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Zea mays]
 gb|ADL28271.1| carotene beta-ring hydroxylase [Zea mays]
 gb|AFP28222.1| beta-carotene hydroxylase [synthetic construct]
 gb|AFW66346.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=572

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSLRPD+LPGG NG K+G  IPAGTDI  SVYNLHRSPYFWD+PNEFEP  F V
Sbjct  416  PPLLIRRSLRPDKLPGGCNGAKEGYEIPAGTDIFVSVYNLHRSPYFWDRPNEFEPERFSV  475

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGW+GFDP RSPGA+YPNEII+DFAFLPFGGGPRK VGDQFAL+ES +ALA+L
Sbjct  476  PKKDESIEGWSGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALL  535

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L+KFD++L+G+P+ V++VTGATIHTKNGLWC+L++R
Sbjct  536  LRKFDVELRGSPDEVEMVTGATIHTKNGLWCRLRRR  571



>ref|XP_006648355.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Oryza brachyantha]
Length=543

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+LRPD+LPGGYNG K+G  IPAGTDI  S+YNLHRSPYFWD+PNEFEP  F V
Sbjct  387  PPLLIRRALRPDKLPGGYNGAKEGYDIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFSV  446

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGWAGFDP RSPGA+YPNEII+DFAFLPFGGGPRK VGDQFAL+ES +ALA+L
Sbjct  447  PKMDESIEGWAGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALL  506

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+P  V++VTGATIHTK+GLWC++++R
Sbjct  507  LQKFDVELRGSPNEVEMVTGATIHTKSGLWCRVRRR  542



>ref|XP_003570274.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Brachypodium 
distachyon]
Length=569

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+LRPD+LPGGYNG K+G  IPAGTDI  S+YNLHRSPYFWD+PNEFEP  F V
Sbjct  413  PPLLIRRALRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTV  472

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGW+GFDP RSPGA+YPNEII+DFAFLPFGGGPRK VGDQFAL+ES +ALAML
Sbjct  473  PKMDENIEGWSGFDPGRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALAML  532

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L KFD++L+G+P+ V++VTGATIHTKNGLWC+L KR
Sbjct  533  LGKFDVELRGSPDEVEMVTGATIHTKNGLWCRLMKR  568



>ref|XP_010260623.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=587

 Score =   260 bits (664),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL PD LPGGY GDK+G  IPAGTD+  SVYNLHRSPYFWD+P+EFEP  F V
Sbjct  421  PPLLIRRSLVPDVLPGGYKGDKEGYPIPAGTDLFVSVYNLHRSPYFWDRPHEFEPERFLV  480

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +  E IEGWAGFDP RS GALYPNEIISDFAFLPFGGGPRK VGDQFALMES +AL +L
Sbjct  481  PRKSEGIEGWAGFDPCRSAGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALVLL  540

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLD-VC  271
            LQKF ++LKG+PESV+LVTGATIHTK+GLWCKL+KR   VC
Sbjct  541  LQKFTVELKGSPESVELVTGATIHTKSGLWCKLRKRASTVC  581



>gb|EAZ21913.1| hypothetical protein OsJ_05566 [Oryza sativa Japonica Group]
Length=557

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+LRPD+LPGGYNG K+G  IPAGTDI  S+YNLHRSPYFWD+P+EFEP  F V
Sbjct  401  PPLLIRRALRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPDEFEPERFSV  460

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGWAGFDP RSPGA+YPNEI++DFAFLPFGGGPRK VGDQFAL+ES +ALA+L
Sbjct  461  PKKDESIEGWAGFDPDRSPGAMYPNEILADFAFLPFGGGPRKCVGDQFALLESTVALALL  520

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+P+ V++VTGATIHTK+GLWC++++R
Sbjct  521  LQKFDVELRGSPDEVEMVTGATIHTKSGLWCRVRRR  556



>ref|XP_010440341.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Camelina sativa]
Length=578

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+P+ LPGGY G+K G  +P GTDI  SVYNLHRSPYFWD P+EFEP  F  
Sbjct  421  PPLLIRRTLKPETLPGGYKGEKSGYQVPKGTDIFISVYNLHRSPYFWDNPHEFEPERFLR  480

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K    IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRK +GDQFALMES +ALAML
Sbjct  481  TKESNGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAML  540

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+PESV+LV+GATIH KNG+WCKLKKR
Sbjct  541  LQKFDVELRGSPESVELVSGATIHAKNGMWCKLKKR  576



>ref|XP_008809593.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Phoenix dactylifera]
Length=572

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+PD+LPGGY GD++G  IPAGTDI  SVYNLHRSP+FWD+PNEFEP  F V
Sbjct  412  PPLLIRRALKPDKLPGGYKGDENGYKIPAGTDIFLSVYNLHRSPHFWDRPNEFEPERFLV  471

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGWAGFDP RS GA+YPNEII+DFAFLPFGGGPRK VGDQFAL+ES +ALAML
Sbjct  472  PKKSEDIEGWAGFDPDRSAGAIYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALAML  531

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQK+DI+LKG+P+ V+ VTGATIHTKNGLWCKLK+R
Sbjct  532  LQKYDIELKGSPDDVEPVTGATIHTKNGLWCKLKRR  567



>gb|EAY84668.1| hypothetical protein OsI_06039 [Oryza sativa Indica Group]
Length=571

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+LRPD+LPGGYNG K+G  IPAGTDI  S+YNLHRSPYFWD+P+EFEP  F V
Sbjct  415  PPLLIRRALRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPDEFEPERFSV  474

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGWAGFDP RSPGA+YPNEI++DFAFLPFGGGPRK VGDQFAL+ES +ALA+L
Sbjct  475  PKKDESIEGWAGFDPDRSPGAMYPNEILADFAFLPFGGGPRKCVGDQFALLESTVALALL  534

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+P+ V++VTGATIHTK+GLWC++++R
Sbjct  535  LQKFDVELRGSPDEVEMVTGATIHTKSGLWCRVRRR  570



>dbj|BAD26183.1| putative cytochrome P450 [Oryza sativa Japonica Group]
Length=571

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+LRPD+LPGGYNG K+G  IPAGTDI  S+YNLHRSPYFWD+P+EFEP  F V
Sbjct  415  PPLLIRRALRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPDEFEPERFSV  474

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGWAGFDP RSPGA+YPNEI++DFAFLPFGGGPRK VGDQFAL+ES +ALA+L
Sbjct  475  PKKDESIEGWAGFDPDRSPGAMYPNEILADFAFLPFGGGPRKCVGDQFALLESTVALALL  534

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+P+ V++VTGATIHTK+GLWC++++R
Sbjct  535  LQKFDVELRGSPDEVEMVTGATIHTKSGLWCRVRRR  570



>ref|XP_006429775.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
 gb|ESR43015.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
Length=582

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-Q  571
            PPLLIRR+++PD LPGGY GDKDG  +PAGTDI  S+YNLHRSPYFWD+P+EFEP  F +
Sbjct  423  PPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSIYNLHRSPYFWDRPHEFEPERFLK  482

Query  570  VXKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K   IEGW+GFDPSRSPGALYPNEI+SD+AFL FGGGPRK VGDQFA+MES + LAML
Sbjct  483  PRKDVGIEGWSGFDPSRSPGALYPNEIVSDYAFLGFGGGPRKCVGDQFAVMESTVGLAML  542

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFDI+LKG+PESV+LVTGATIHTKNGLWCKL++R
Sbjct  543  LQKFDIELKGSPESVELVTGATIHTKNGLWCKLRER  578



>ref|XP_006481375.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Citrus sinensis]
Length=619

 Score =   258 bits (659),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-Q  571
            PPLLIRR+++PD LPGGY GDKDG  +PAGTDI  S+YNLHRSPYFWD+P+EFEP  F +
Sbjct  460  PPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSIYNLHRSPYFWDRPHEFEPERFLK  519

Query  570  VXKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K   IEGW+GFDPSRSPGALYPNEI+SD+AFL FGGGPRK VGDQFA+MES + LAML
Sbjct  520  PRKDVGIEGWSGFDPSRSPGALYPNEIVSDYAFLGFGGGPRKCVGDQFAVMESTVGLAML  579

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFDI+LKG+PESV+LVTGATIHTKNGLWCKL++R
Sbjct  580  LQKFDIELKGSPESVELVTGATIHTKNGLWCKLRER  615



>ref|XP_010435019.1| PREDICTED: cytochrome P450 97B3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score =   257 bits (656),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+P+ LPGGY G+K G  +P GTDI  SVYNLHRSPYFWD P++FEP  F  
Sbjct  422  PPLLIRRTLKPETLPGGYKGEKSGHQVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLR  481

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K    IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRK +GDQFALMES +ALAML
Sbjct  482  TKESNGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAML  541

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+PESV+LV+GATIH KNG+WCKLKKR
Sbjct  542  LQKFDVELRGSPESVELVSGATIHAKNGMWCKLKKR  577



>ref|XP_006854622.1| hypothetical protein AMTR_s00030p00167800 [Amborella trichopoda]
 gb|ERN16089.1| hypothetical protein AMTR_s00030p00167800 [Amborella trichopoda]
Length=440

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSLRPD LPGG  GDK+G +IPAGT+I  SVYNLHR  YFWD+P+EFEP  F  
Sbjct  279  PPLLIRRSLRPDILPGGLTGDKNGYSIPAGTEICLSVYNLHRCHYFWDRPHEFEPERFLR  338

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             K  E+EGWAGFDP RSPGALYPNEIISDFAFLPFGGGPRK +GDQFALMES IALA+LL
Sbjct  339  PKKSEVEGWAGFDPQRSPGALYPNEIISDFAFLPFGGGPRKCLGDQFALMESTIALALLL  398

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
             +FD++L+  PES++ VTGATIHTK+GLWCKL+KR
Sbjct  399  HRFDVELRDPPESMEAVTGATIHTKDGLWCKLRKR  433



>gb|KFK33561.1| hypothetical protein AALP_AA5G029500 [Arabis alpina]
Length=577

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+P+ LPGGY G+K+G  +P GTDI  SVYNLHRSPYFWD P+EFEP  F  
Sbjct  420  PPLLIRRTLKPETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHEFEPERFLR  479

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K    IEGWAGFDPSRSPGALYPNEI+SDFAFLPFGGGPRK +GDQFALMES +ALAML
Sbjct  480  TKESNGIEGWAGFDPSRSPGALYPNEIVSDFAFLPFGGGPRKCIGDQFALMESTVALAML  539

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
             QKFD++L+G+PESV+LV+GATIH KNG+WCKLK+R
Sbjct  540  FQKFDVELRGSPESVELVSGATIHAKNGMWCKLKRR  575



>emb|CDY09057.1| BnaC08g10110D [Brassica napus]
Length=565

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+P+ LPGGY G+K+G  +P GTDI  SVYNLHRSPYFWD P EFEP  F  
Sbjct  408  PPLLIRRTLKPETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPQEFEPERFLR  467

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K    IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRK +GDQFALMES +ALAML
Sbjct  468  TKESNGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAML  527

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G PESV+LV+GATIH KNG+WCKLK+R
Sbjct  528  LQKFDVELRGPPESVELVSGATIHAKNGMWCKLKRR  563



>emb|CDY22733.1| BnaA08g05630D [Brassica napus]
Length=566

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+P+ LPGGY G+K+G  +P GTDI  SVYNLHRSPYFWD P EFEP  F  
Sbjct  409  PPLLIRRTLKPETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPQEFEPERFLR  468

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K    IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRK +GDQFALMES +ALAML
Sbjct  469  KKESNGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAML  528

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G PESV+LV+GATIH KNG+WCKLK+R
Sbjct  529  LQKFDVELRGPPESVELVSGATIHAKNGMWCKLKRR  564



>ref|XP_009107829.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Brassica rapa]
Length=578

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+P+ LPGGY G+K+G  +P GTDI  SVYNLHRSPYFWD P EFEP  F  
Sbjct  421  PPLLIRRTLKPETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPQEFEPERFLR  480

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K    IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRK +GDQFALMES +ALAML
Sbjct  481  KKESNGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAML  540

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G PESV+LV+GATIH KNG+WCKLK+R
Sbjct  541  LQKFDVELRGPPESVELVSGATIHAKNGMWCKLKRR  576



>ref|XP_006414564.1| hypothetical protein EUTSA_v10024764mg [Eutrema salsugineum]
 gb|ESQ56017.1| hypothetical protein EUTSA_v10024764mg [Eutrema salsugineum]
Length=581

 Score =   255 bits (651),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+ + LPGGY G+K+G  +P GTDI  SVYNLHRSPYFWD P+EFEP  F  
Sbjct  424  PPLLIRRTLKAETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPDEFEPERFLR  483

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K    IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRK +GDQFALMES +ALAML
Sbjct  484  TKESNGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAML  543

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+PESV+LV+GATIH KNG+WCKLK+R
Sbjct  544  LQKFDVELRGSPESVELVSGATIHAKNGMWCKLKRR  579



>ref|XP_010532498.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Tarenaya hassleriana]
Length=585

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+PD LPGGYNG+K+G  IP GTDI  SVYNLHRSPYFWD P++FEP  F  
Sbjct  427  PPLLIRRSLKPDILPGGYNGEKEGHRIPRGTDIFISVYNLHRSPYFWDSPDDFEPERFLR  486

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +  + IEGWAGFDPSRSPGALYPNE+ISDFA LPFGGGPRK +GDQFALMES  ALA+L
Sbjct  487  KRESDGIEGWAGFDPSRSPGALYPNEVISDFALLPFGGGPRKCIGDQFALMESTAALALL  546

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G PESV+LV+GATIH KNGLWCKLK+R
Sbjct  547  LQKFDVELRGPPESVELVSGATIHAKNGLWCKLKRR  582



>ref|XP_006285060.1| hypothetical protein CARUB_v10006369mg [Capsella rubella]
 gb|EOA17958.1| hypothetical protein CARUB_v10006369mg [Capsella rubella]
Length=576

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+ + LPGGY G+K+G  +P GTDI  SVYNLHRSPYFWD P++FEP  F  
Sbjct  419  PPLLIRRTLKAETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLR  478

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K    IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK +GDQFALMES +ALAML
Sbjct  479  TKESNGIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCIGDQFALMESTVALAML  538

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+GTPESV+LV+GATIH K+G+WCKLK+R
Sbjct  539  LQKFDVELRGTPESVELVSGATIHAKDGMWCKLKRR  574



>ref|XP_010495892.1| PREDICTED: cytochrome P450 97B3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+ + LPGGY G+K G  +P GTDI  SVYNLHRSPYFWD P+EFEP  F  
Sbjct  422  PPLLIRRTLKSETLPGGYKGEKSGHQVPKGTDIFISVYNLHRSPYFWDNPHEFEPERFLR  481

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K    IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRK +GDQFALMES +ALAML
Sbjct  482  TKESNGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAML  541

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G PESV+LV+GATIH KNG+WCKLKKR
Sbjct  542  LQKFDVELRGPPESVELVSGATIHAKNGMWCKLKKR  577



>emb|CAB10290.1| cytochrome P450 like protein [Arabidopsis thaliana]
 emb|CAB78553.1| cytochrome P450 like protein [Arabidopsis thaliana]
Length=576

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+P+ LPGG+ G+K+G  +P GTDI  SVYNLHRSPYFWD P++FEP  F  
Sbjct  419  PPLLIRRTLKPETLPGGHKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLR  478

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K    IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRK +GDQFALMES +ALAML
Sbjct  479  TKESNGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAML  538

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
             QKFD++L+GTPESV+LV+GATIH KNG+WCKLK+R
Sbjct  539  FQKFDVELRGTPESVELVSGATIHAKNGMWCKLKRR  574



>ref|NP_193247.2| cytochrome P450 97B3 [Arabidopsis thaliana]
 sp|O23365.2|C97B3_ARATH RecName: Full=Cytochrome P450 97B3, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL32753.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAO00942.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AEE83557.1| cytochrome P450 97B3 [Arabidopsis thaliana]
Length=580

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+P+ LPGG+ G+K+G  +P GTDI  SVYNLHRSPYFWD P++FEP  F  
Sbjct  423  PPLLIRRTLKPETLPGGHKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLR  482

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K    IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRK +GDQFALMES +ALAML
Sbjct  483  TKESNGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAML  542

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
             QKFD++L+GTPESV+LV+GATIH KNG+WCKLK+R
Sbjct  543  FQKFDVELRGTPESVELVSGATIHAKNGMWCKLKRR  578



>ref|XP_009412060.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=422

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+ D+LPGGY G  DG AIPAG DI  SV+NLHRSPYFWD+PNEFEP  F  
Sbjct  266  PPLLIRRALKADKLPGGYMGCDDGYAIPAGADIFISVFNLHRSPYFWDRPNEFEPERFLA  325

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E I GWAG+DP RSPGA+YPNEI SDFAF+PFGGGPRK VGDQFAL+ES IALA+L
Sbjct  326  PKPSEGIAGWAGYDPGRSPGAMYPNEITSDFAFIPFGGGPRKCVGDQFALLESTIALALL  385

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD+ L+G+P+ V+LVTGATIHTKNGLWCKLKKR
Sbjct  386  LQKFDVLLRGSPDEVELVTGATIHTKNGLWCKLKKR  421



>ref|XP_008229650.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Prunus mume]
Length=577

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 130/158 (82%), Gaps = 2/158 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLL+RRSL+ D LPGGYN        PAGTDI  SVYNLHRSPYFWD PNEFEP  F V
Sbjct  421  PPLLVRRSLKSDTLPGGYNXXXXXS--PAGTDIFLSVYNLHRSPYFWDNPNEFEPERFLV  478

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             K  E+EGWAGFDPSR PGALYP EI +DFAFLPFGGGPRK VGDQFALMES + LAMLL
Sbjct  479  PKKSEVEGWAGFDPSRIPGALYPGEITADFAFLPFGGGPRKCVGDQFALMESTVTLAMLL  538

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            QKF ++LKG+PESV+ VTGATIHTKNGLWCKL+KR DV
Sbjct  539  QKFTVELKGSPESVEQVTGATIHTKNGLWCKLRKRSDV  576



>ref|XP_002868224.1| hypothetical protein ARALYDRAFT_493377 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44483.1| hypothetical protein ARALYDRAFT_493377 [Arabidopsis lyrata subsp. 
lyrata]
Length=571

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+P+ LPGGY G+K+G  +P GTDI  SVYNLHRSPYFWD P++FEP  F  
Sbjct  414  PPLLIRRTLKPETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLR  473

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K    IEGWAGFDPS S GALYPNEIISDFAFLPFGGGPRK +GDQFALMES +ALAML
Sbjct  474  TKESNGIEGWAGFDPSCSLGALYPNEIISDFAFLPFGGGPRKCIGDQFALMESTVALAML  533

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD++L+G+PESV+LV+GATIH KNG+WCKLK+R
Sbjct  534  LQKFDVELRGSPESVELVSGATIHAKNGMWCKLKRR  569



>ref|XP_004303949.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Fragaria vesca 
subsp. vesca]
 ref|XP_011467680.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=572

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+PD LPGGY G+K G  IPAGTDI  SVYNLHRSPY+WD+PN FEP  F V
Sbjct  414  PPLLIRRSLKPDTLPGGYKGEKGGYKIPAGTDIFISVYNLHRSPYYWDRPNVFEPERFSV  473

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             K  EIEGWAGFDPSRSPGA YPNEI++DF+FLPFGGGPRK VGDQFAL+ES ++LAMLL
Sbjct  474  QKNSEIEGWAGFDPSRSPGAYYPNEIMADFSFLPFGGGPRKCVGDQFALLESTVSLAMLL  533

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            QKF+++L+G+PESV LVTGATIHTKNG+WCKL KR DV
Sbjct  534  QKFNVELRGSPESVGLVTGATIHTKNGMWCKLSKRSDV  571



>ref|XP_009412059.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=574

 Score =   249 bits (635),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L+ D+LPGGY G  DG AIPAG DI  SV+NLHRSPYFWD+PNEFEP  F  
Sbjct  418  PPLLIRRALKADKLPGGYMGCDDGYAIPAGADIFISVFNLHRSPYFWDRPNEFEPERFLA  477

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E I GWAG+DP RSPGA+YPNEI SDFAF+PFGGGPRK VGDQFAL+ES IALA+L
Sbjct  478  PKPSEGIAGWAGYDPGRSPGAMYPNEITSDFAFIPFGGGPRKCVGDQFALLESTIALALL  537

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKFD+ L+G+P+ V+LVTGATIHTKNGLWCKLKKR
Sbjct  538  LQKFDVLLRGSPDEVELVTGATIHTKNGLWCKLKKR  573



>gb|AAT28222.1| putative 97B2-like cytochrome P450 [Ginkgo biloba]
Length=586

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+LR D +PGGY GDKDG  IP GTDI  SVYNLHRSPYFWD+P+EF P  F +
Sbjct  423  PPLLIRRALRQDTIPGGYRGDKDGYLIPKGTDIFISVYNLHRSPYFWDQPHEFRPERFLI  482

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  + IEGWAGFDP RS GALYPNE+++DFAFLPFGGGPRK VGDQFALMES + LAML
Sbjct  483  PKDNKGIEGWAGFDPYRSQGALYPNEVLADFAFLPFGGGPRKCVGDQFALMESTVGLAML  542

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LQKF+++LK  PES+++VTGATIHT+NGLWCK+K+R
Sbjct  543  LQKFEVELKDPPESLRIVTGATIHTQNGLWCKIKRR  578



>ref|XP_006841947.1| hypothetical protein AMTR_s00042p00221280 [Amborella trichopoda]
 gb|ERN03622.1| hypothetical protein AMTR_s00042p00221280 [Amborella trichopoda]
Length=589

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+LR D LPGG+ GDKDG AIPAGTDI  SVYNLHRSPYFW++P+EFEP  F  
Sbjct  423  PPLLIRRTLRLDTLPGGFKGDKDGYAIPAGTDIFISVYNLHRSPYFWEQPHEFEPERFLG  482

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +  E IEGWAGFDPSRSPGALY NEI++DFAFLPFGGGPRK VGDQFALMES +ALAML
Sbjct  483  PRKGEGIEGWAGFDPSRSPGALYSNEIVADFAFLPFGGGPRKCVGDQFALMESTVALAML  542

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L+KF+++L+  P+ V+LVTGATIHTK GLWC LK R
Sbjct  543  LRKFNVELRDPPDQVELVTGATIHTKAGLWCNLKFR  578



>ref|XP_001769554.1| predicted protein [Physcomitrella patens]
 gb|EDQ65715.1| predicted protein [Physcomitrella patens]
Length=586

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+PD LPGG+ GD +G +IP G D+  SVYNLHRSPYFWD+P +F P  F  
Sbjct  424  PPLLIRRSLQPDTLPGGHKGDPNGYSIPKGVDLFISVYNLHRSPYFWDEPEKFNPERFLK  483

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  + IEGWAGFDP R  GALYPNE+++DFAFLPFGGG RK VGDQFALMES +ALAML
Sbjct  484  AKLSDGIEGWAGFDPKRGQGALYPNEVMADFAFLPFGGGARKCVGDQFALMESTVALAML  543

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDVC  271
            LQKF+++L+G+PE V+LVTGATIHTK+GLWCKL +R  + 
Sbjct  544  LQKFEVELRGSPEDVELVTGATIHTKDGLWCKLSRRKSIT  583



>gb|EMT03024.1| Cytochrome P450 97B2 [Aegilops tauschii]
Length=605

 Score =   226 bits (577),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSLRPD+LPGGYNG K+G  IPAGTDI  S+YNLHRSPYFWD PNEFEP  F V
Sbjct  396  PPLLIRRSLRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDSPNEFEPERFTV  455

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K  E IEGWAGFDP RSPGA+YPNEII+DFAFLPFGGGPRK VGDQFAL+ES +ALA+L
Sbjct  456  PKKDENIEGWAGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALL  515

Query  390  LQKFDIDLKGTPESVKLV  337
            LQKFD++L+G+P+ V+++
Sbjct  516  LQKFDVELRGSPDEVEMI  533



>ref|XP_002976141.1| hypothetical protein SELMODRAFT_175360 [Selaginella moellendorffii]
 gb|EFJ23046.1| hypothetical protein SELMODRAFT_175360 [Selaginella moellendorffii]
Length=541

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+PD+LPGG+ GD DG +IP GTDI  SV+NLHRSPYFW+ P  F+P  F  
Sbjct  385  PPLLIRRSLQPDKLPGGHKGDPDGYSIPKGTDIFISVFNLHRSPYFWENPESFDPERFLR  444

Query  567  XKX-XEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +    I GWAG DP++  G LYPNEI++DFAFLPFGGGPRK VGDQFA ME+ I LA+L
Sbjct  445  RRVDSSIPGWAGIDPTKLQG-LYPNEIMADFAFLPFGGGPRKCVGDQFAFMEATIGLAVL  503

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L+KF ++L+G+P+ V+LVTGAT+HTKNGLWCKL KR
Sbjct  504  LRKFSVELRGSPQEVELVTGATLHTKNGLWCKLSKR  539



>ref|XP_002968239.1| hypothetical protein SELMODRAFT_145597, partial [Selaginella 
moellendorffii]
 gb|EFJ30493.1| hypothetical protein SELMODRAFT_145597, partial [Selaginella 
moellendorffii]
Length=563

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+PD+LPGG+ GD DG +IP GTDI  SV+NLHRSPYFW+ P  F+P  F  
Sbjct  409  PPLLIRRSLQPDKLPGGHKGDPDGYSIPKGTDIFISVFNLHRSPYFWENPESFDPERFLR  468

Query  567  XKX-XEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +    I GWAG DP++  G LYPNEI++DFAFLPFGGGPRK VGDQFA ME+ I LA+L
Sbjct  469  RRVDSSIPGWAGIDPTKLQG-LYPNEIMADFAFLPFGGGPRKCVGDQFAFMEATIGLAVL  527

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L+KF ++L+G+P+ V+LVTGAT+HTKNGLWCKL KR
Sbjct  528  LRKFSVELRGSPQEVELVTGATLHTKNGLWCKLSKR  563



>gb|KHN25634.1| Cytochrome P450 97B2, chloroplastic [Glycine soja]
Length=353

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+ D LPGG+ GDKDG AIPAGTD+  SVYNLHRSPYFWD+P++FEP  F V
Sbjct  222  PPLLIRRSLKSDVLPGGHKGDKDGYAIPAGTDVFISVYNLHRSPYFWDRPHDFEPERFLV  281

Query  567  X-KXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K  EIEGW G DPSRSPGALYPNE+ISDFAFLPFGGGPRK VGDQFALMES +AL +L
Sbjct  282  QNKNEEIEGWGGLDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTVALTLL  341

Query  390  LQKFDIDL  367
            LQ FD++L
Sbjct  342  LQNFDVEL  349



>sp|Q43078.1|C97B1_PEA RecName: Full=Cytochrome P450 97B1, chloroplastic; AltName: Full=Cytochrome 
P450 97A2; Flags: Precursor [Pisum sativum]
 emb|CAA89260.1| cytochrome P450 [Pisum sativum]
Length=552

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRRSL+PD LPGG+ GDKDG  IPAGTD+  SVYNLHRSPYFWD+PN+FEP  F V
Sbjct  426  PPLLIRRSLKPDVLPGGHKGDKDGYTIPAGTDVFISVYNLHRSPYFWDRPNDFEPERFLV  485

Query  567  XKXX-EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
                 E+EGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRK VGDQFALMES +AL   
Sbjct  486  QNNNEEVEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALVCC  545

Query  390  LQ  385
             +
Sbjct  546  YR  547



>ref|XP_011399626.1| Cytochrome P450 97B2, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM26688.1| Cytochrome P450 97B2, chloroplastic [Auxenochlorella protothecoides]
Length=205

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 106/156 (68%), Gaps = 4/156 (3%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L PD LPGG  GD  G  I  G D+  S +NLHRSP+ WD P +F+P  +  
Sbjct  33   PPILIRRALAPDVLPGGLYGDAAGYPIGKGADLFISTWNLHRSPHLWDDPEDFKPERWSA  92

Query  567  XKXXEI-EGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             +   I E WAG+ P ++  ALYPNE+ SDFAF+PFGGG RK VGDQFA++E+ +ALAM 
Sbjct  93   KRASPIPEKWAGYAPLQAASALYPNEVASDFAFIPFGGGARKCVGDQFAMLEATVALAMT  152

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L+++   L   P    L +GATIHT +GL C +++R
Sbjct  153  LRRYSFSLAADP---GLASGATIHTAHGLRCSVQRR  185



>emb|CBJ27249.1| Cytochrome P450 [Ectocarpus siliculosus]
Length=574

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L  D+LP G +GD     I  G D+  ++YNLHRS  FW+ PN+F+P  F+ 
Sbjct  390  PPLLIRRALESDELPPG-SGDGHRPKITRGVDLFLAIYNLHRSEDFWENPNKFDPERFER  448

Query  567  -XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              +   +EGWAGF+P    G LYPNEI SDFA+LPFGGG RK VGDQFA+MES ++LAML
Sbjct  449  PFQNKGVEGWAGFNPDLLEGKLYPNEIASDFAYLPFGGGQRKCVGDQFAMMESVVSLAML  508

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
             ++F+ +L   PE V   TGATIHT+NGL  ++KKR+
Sbjct  509  TRRFEFELMIKPEEVGFYTGATIHTRNGLPMRVKKRV  545



>gb|AFR36909.1| chloroplast CYP97B, partial [Haematococcus pluvialis]
Length=539

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 103/160 (64%), Gaps = 2/160 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L PD LP G  GD  G  I  G D   SV+NLHRSP+ W  P+ F P  F  
Sbjct  362  PPILIRRALAPDTLPPGLKGDPAGYPIGKGADPFISVWNLHRSPHLWKDPDTFRPERFSE  421

Query  567  XKXXEIEG--WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
                   G  WAG+ P  SPGALYPNE+ SDFAF+PFGGG RK +GDQFAL E+ +ALA+
Sbjct  422  PHSNPAFGSAWAGYRPDASPGALYPNEVTSDFAFIPFGGGARKCIGDQFALFEATVALAL  481

Query  393  LLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            LL+ F   L  +PE V + TGATIHT NGL  K+  R  V
Sbjct  482  LLRDFTFKLAVSPEQVGMATGATIHTANGLPMKITIRRAV  521



>gb|AGK38423.1| CYP97B1 [Parachlorella kessleri]
Length=607

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 105/157 (67%), Gaps = 2/157 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-Q  571
            PP+LIRR+L  D LP G NGD +G  I  G D+  S +NLHRSP+ W  P+ F P  F +
Sbjct  434  PPILIRRALGDDVLPAGLNGDPNGYPIGKGADLFISSWNLHRSPHLWKDPDTFRPERFAE  493

Query  570  VXKXXEIEG-WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
              +    EG WAG+DP     +LYPNE+ SDFA LPFGGG RK VGDQFA+ME+ +AL M
Sbjct  494  RFENPAFEGRWAGYDPELQGNSLYPNEVASDFALLPFGGGIRKCVGDQFAIMEATVALTM  553

Query  393  LLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LL++F   L G+ + V + TGATIHT NGL   +++R
Sbjct  554  LLRRFRFRLAGSAKDVGMATGATIHTANGLKVTVQRR  590



>ref|XP_002955478.1| hypothetical protein VOLCADRAFT_65884 [Volvox carteri f. nagariensis]
 gb|EFJ43549.1| hypothetical protein VOLCADRAFT_65884 [Volvox carteri f. nagariensis]
Length=641

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 104/157 (66%), Gaps = 2/157 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-Q  571
            PP+LIRR+L  D LPGG  GD  G  I  G D+  SV+NLHRSPY W  P+ F P  F +
Sbjct  459  PPILIRRALGEDVLPGGLRGDPAGYPIGTGADLFISVWNLHRSPYLWKDPDTFRPDRFFE  518

Query  570  VXKXXEIEG-WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
                 + EG WAG        ALYPNE+ SDFAF+PFGGG RK VGDQFA+ E+ +ALA+
Sbjct  519  SYSNPDFEGKWAGAYAVSGGAALYPNEVGSDFAFIPFGGGARKCVGDQFAMFEATVALAV  578

Query  393  LLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LL++F   L+G PE V + TGATIHT NGL  ++ +R
Sbjct  579  LLRRFSFALEGPPEKVGMATGATIHTANGLMVRVSRR  615



>gb|AGK38421.1| CYP97B1 [Parachlorella kessleri]
Length=607

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 104/157 (66%), Gaps = 2/157 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-Q  571
            PP+LIRR+L  D LP G NGD +G  I  G D+  S +NLHRSP+ W  P+ F P  F +
Sbjct  434  PPILIRRALGDDVLPAGLNGDPNGYPIGKGADLFISSWNLHRSPHLWKDPDTFRPERFAE  493

Query  570  VXKXXEIEGW-AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
              +    EG  AG+DP     +LYPNE+ SDFA LPFGGG RK VGDQFA+ME+ +AL M
Sbjct  494  RFENPAFEGRRAGYDPELQGNSLYPNEVASDFALLPFGGGIRKCVGDQFAIMEATVALTM  553

Query  393  LLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LL++F   L G+ + V + TGATIHT NGL   +++R
Sbjct  554  LLRRFRFRLAGSAKDVGMATGATIHTANGLKVTVRRR  590



>gb|EJK63850.1| hypothetical protein THAOC_15469 [Thalassiosira oceanica]
Length=714

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LP G +G K G  +  GTDI  S +NLHR+P +WD+P +++P  ++ 
Sbjct  523  PPVLIRRAREEDTLPAGGSGLKGGIKVLRGTDIFISTWNLHRAPEYWDEPEKYDPTRWER  582

Query  567  -XKXXEIEGWAGFDPSR-SPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
                 +I+ W G++P + S   LYPNEI +DFAFLPFG G RK +GDQFA++E+++ LAM
Sbjct  583  PFSNPDIKDWLGYNPEKISSQFLYPNEIAADFAFLPFGAGKRKCIGDQFAMLEASVTLAM  642

Query  393  LLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKL  292
            L+ KFD+ L G PE V + TGATIHT NGL  K+
Sbjct  643  LMNKFDLTLVGKPEDVGMKTGATIHTMNGLNMKV  676



>ref|XP_002292287.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90262.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=736

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 108/157 (69%), Gaps = 2/157 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LP G +G   G  +  GTDI  S +NLHR+P +W+ P +++P  ++ 
Sbjct  526  PPVLIRRARSEDNLPAGGSGLSGGVKVLRGTDIFISTWNLHRAPEYWENPEKYDPTRWER  585

Query  567  X-KXXEIEGWAGFDPSR-SPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
              K   ++GW G+DP + S  +LYPNEI +D+AFLPFG G RK +GDQFA++E+++ LAM
Sbjct  586  RFKNPGVKGWNGYDPEKQSESSLYPNEITADYAFLPFGAGKRKCIGDQFAMLEASVTLAM  645

Query  393  LLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            ++ KFD  L G+P+ V + TGATIHT NGL   + +R
Sbjct  646  IINKFDFTLVGSPKDVGMKTGATIHTMNGLNLVVSRR  682



>emb|CBJ27248.1| Cytochrome P450 [Ectocarpus siliculosus]
Length=774

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 102/150 (68%), Gaps = 6/150 (4%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDG-XAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQ  571
            PP++IRR+L+  +LP    G  DG   +  GTD+  S +NLHRS   WD+P E+ P  F 
Sbjct  535  PPVIIRRALKETELP---QGGADGPVKLVKGTDVFISTWNLHRSKELWDRPAEYMPERFL  591

Query  570  VXKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
                 E + GW GF P    G LYP+EI +DFAFLPFGGG RK VGDQFA+ME+ ++LAM
Sbjct  592  SEFRNEGVVGWKGFTPKMGAG-LYPSEIDADFAFLPFGGGTRKCVGDQFAMMEATVSLAM  650

Query  393  LLQKFDIDLKGTPESVKLVTGATIHTKNGL  304
            +L+K D  L GTPE V +VTGATIHTKNGL
Sbjct  651  MLKKLDFTLVGTPEDVGMVTGATIHTKNGL  680



>gb|AAL73435.1|AF459441_1 cytochrome P450 [Skeletonema costatum]
Length=659

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 105/150 (70%), Gaps = 2/150 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+ + D LP G  G   G  +  GTDI  S +NLHR+P +W+  ++++P  ++ 
Sbjct  457  PPVLIRRARQEDTLPPGGTGLSGGVKVLRGTDIFISTWNLHRAPEYWENADKYDPTRWER  516

Query  567  -XKXXEIEGWAGFDPSR-SPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
              K   ++GW G+DP + S  +LYPNEI SD+AFLPFG G RK +GDQFA++E+++ L+M
Sbjct  517  PFKNPGVKGWNGYDPEKQSSQSLYPNEITSDYAFLPFGAGKRKCIGDQFAMLEASVTLSM  576

Query  393  LLQKFDIDLKGTPESVKLVTGATIHTKNGL  304
            ++ KFD  L GTPE V + TGATIHT NGL
Sbjct  577  IMNKFDFTLVGTPEDVGMKTGATIHTMNGL  606



>gb|EWM30289.1| cytochrome p450 [Nannochloropsis gaditana]
Length=623

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 100/157 (64%), Gaps = 5/157 (3%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQ-  571
            PPLLIRR+L    LP G  G +    I  G DI  S+YNLHR P  W  PN F+P  +  
Sbjct  450  PPLLIRRALEDHSLPKGTAGFE--ARIIRGCDIFISIYNLHRDPDLWPNPNSFDPERYLR  507

Query  570  -VXKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
                  +   WAGFDP++  G LYPNEI SDFA LPFGGG RK VGDQFA +E+ + LAM
Sbjct  508  PFINKEKYPEWAGFDPAQVTG-LYPNEIASDFAMLPFGGGARKCVGDQFATLEATVTLAM  566

Query  393  LLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LL++FD D  G PE V + TGATIHT+NGL    ++R
Sbjct  567  LLRRFDFDFVGKPEDVGMFTGATIHTRNGLRMTPRRR  603



>ref|XP_005650550.1| cytochrome P450 [Coccomyxa subellipsoidea C-169]
 gb|EIE26006.1| cytochrome P450 [Coccomyxa subellipsoidea C-169]
Length=533

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 99/164 (60%), Gaps = 9/164 (5%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXS-------VYNLHRSPYFWDKPNEF  589
            PP+LIRR+L  D LP    GD  G  I  G DI  S         +LHRSP+ W  P+ F
Sbjct  352  PPILIRRALSDDVLPAPLGGDSSGYPIGKGADIFISSSSGTIMFQSLHRSPHLWKDPDTF  411

Query  588  EPXXF-QVXKXXEIEG-WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALME  415
             P  F +        G WAG+ P     + YPNE+ SDFAF+PFGGG RK VGDQFAL+E
Sbjct  412  RPERFSETNSNPAFNGAWAGYRPEAQGSSFYPNEVASDFAFIPFGGGARKCVGDQFALLE  471

Query  414  SAIALAMLLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            + +AL MLL++F  D    PESV + TGATIHT NGL  ++++R
Sbjct  472  ATVALTMLLRRFTFDFVEGPESVGMATGATIHTANGLQVRVQRR  515



>emb|CDY09055.1| BnaC08g10090D [Brassica napus]
Length=214

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 85/115 (74%), Gaps = 12/115 (10%)
 Frame = -2

Query  591  FEPXXF-QVXKXXEIEGWAGFDPSRSPGALYPNEI-----------ISDFAFLPFGGGPR  448
            FEP  F +  K   IEGWAGFDPSRSPGALYPNE+            S     PFGGGPR
Sbjct  98   FEPERFLRTKKSNTIEGWAGFDPSRSPGALYPNEVKMKTCKYNISYHSRLCIFPFGGGPR  157

Query  447  KXVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
              +GDQFALMES +ALA+LLQKFD++++ +PESV+LV+GATI+ KNG+WCKLK+R
Sbjct  158  NCIGDQFALMESTVALAILLQKFDVEVRESPESVELVSGATINAKNGMWCKLKRR  212



>ref|XP_001421212.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99505.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=560

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 106/156 (68%), Gaps = 4/156 (3%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-Q  571
            PP+LIRR+++   LP G NG +    + AGTD   +V+NLHRSP  W+ P +F+P  F +
Sbjct  408  PPILIRRAIKDVTLPRGGNGKE--ITLKAGTDCFIAVWNLHRSPDLWEDPEKFDPSRFSR  465

Query  570  VXKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              +   IEGW G +P    G LYPNE  +DF+++PFGGG R+  GDQFA++E+  AL++L
Sbjct  466  RFENPAIEGWGGLNPELMTG-LYPNEQCTDFSYVPFGGGQRRCAGDQFAMLEAVTALSVL  524

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L+KF  +L   P  V+++TGATIHTK GL  KLK+R
Sbjct  525  LKKFKFELACEPGEVEMITGATIHTKKGLPMKLKRR  560



>emb|CEG01697.1| Cytochrome P450, conserved site [Ostreococcus tauri]
Length=568

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 105/156 (67%), Gaps = 4/156 (3%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+++   LP G NG +    + AGTD   +V+NLHRSP  W+ P +F+P  F  
Sbjct  415  PPILIRRAIKDVTLPRGGNGKE--ITLKAGTDCFIAVWNLHRSPDLWENPEKFDPSRFSR  472

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
                E IEGW G +P    G LYPNE  +DF+++PFGGG R+  GDQFA++E+  +L++L
Sbjct  473  RFTNEAIEGWGGLNPDLMTG-LYPNEQSTDFSYVPFGGGQRRCAGDQFAMLEAVTSLSVL  531

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L+KF  +L   P  V+++TGATIHTK GL  K+K+R
Sbjct  532  LKKFKFELDCPPNDVEMITGATIHTKKGLPMKIKRR  567



>ref|XP_003074608.1| cytochrome P450 (ISS) [Ostreococcus tauri]
 emb|CAL50459.1| Cytochrome P450, conserved site [Ostreococcus tauri]
Length=576

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 105/156 (67%), Gaps = 4/156 (3%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR L    LP G  GD +   I  G DI  SV+NLHRSP  W+ P EF+P  F+ 
Sbjct  413  PPILIRRCLEDVTLPKG-AGDAEVTLI-KGMDIFISVWNLHRSPECWENPEEFDPFRFKR  470

Query  567  -XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
                  ++ WAG++P    G LYPNE+ SDFAF+PFG G RK +GDQFA++E+ IA+AM+
Sbjct  471  PFANPGVKDWAGYNPELFTG-LYPNEVASDFAFIPFGAGARKCIGDQFAMLEATIAMAMV  529

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L+++D +L   P+ + +  GATIHT+ GL C++++R
Sbjct  530  LRRYDFELTTDPKDIGMTMGATIHTEKGLPCRVRRR  565



>gb|KIY95180.1| hypothetical protein MNEG_12781 [Monoraphidium neglectum]
Length=168

 Score =   141 bits (356),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 86/134 (64%), Gaps = 2/134 (1%)
 Frame = -2

Query  678  GXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQVXKXXEIEG--WAGFDPSRSPGAL  505
            G  I  G D+  SV+NLHRSP+ W  P+ F P  ++        G  WAG+ P    GAL
Sbjct  16   GYPIGKGADLFISVWNLHRSPHLWKDPDTFRPERYEEVHTNPQYGGKWAGYQPEAGRGAL  75

Query  504  YPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGAT  325
            YPNE+ SDFAF+PFGGG RK +GDQFAL E+ +A AMLL+++   L  TP+ + + TGAT
Sbjct  76   YPNEVASDFAFIPFGGGARKCIGDQFALFEATVAFAMLLRRYTFRLAATPQEIGMATGAT  135

Query  324  IHTKNGLWCKLKKR  283
            IHT NG+   + +R
Sbjct  136  IHTANGMMVSVSRR  149



>ref|XP_003061074.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54724.1| predicted protein [Micromonas pusilla CCMP1545]
Length=557

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 103/156 (66%), Gaps = 4/156 (3%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+LR   LP G  G      +  GTD   +V+NLHRSP  W+ P +F+P  F+ 
Sbjct  404  PPILIRRALRDVTLPRGGMGK--AITLKKGTDCFVAVWNLHRSPDLWENPEKFDPSRFKR  461

Query  567  -XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              +   +EGW G  P  + G LYPNE  +DFA++PFGGG R+  GD FA+ME+ +AL++L
Sbjct  462  PFQNPAVEGWRGLQPELATG-LYPNETSTDFAYVPFGGGQRRCAGDMFAMMEATVALSVL  520

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            +++FD++L    E V+++TGATIHTK G+  KL  R
Sbjct  521  MKRFDVELACEKEDVEMITGATIHTKAGMPVKLTPR  556



>gb|AHA51695.1| P450-type beta-carotene hydroxylase CYP97B29 [Porphyra umbilicalis]
Length=658

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 105/159 (66%), Gaps = 8/159 (5%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXX-FQ  571
            PPLLIRR L  D LPGG  G      +  GTD+   VY++HRSP  W++P+ F P    +
Sbjct  488  PPLLIRRLLADDTLPGGEIGKPTN--LKRGTDVFICVYSMHRSPALWEEPDVFNPDRWLK  545

Query  570  VXKXXEIEGWAGF---DPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIAL  400
                  +EGW+G+   DP+R+  +LYPNE+ +DFAFLPFGGG RK VGDQFA++ES +A 
Sbjct  546  PFSNPGVEGWSGYNPPDPNRA--SLYPNEVNADFAFLPFGGGSRKCVGDQFAMLESTVAF  603

Query  399  AMLLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            A L+++FD  L   P  V + TGATIHTK G+  +++KR
Sbjct  604  ATLVRRFDFSLGCAPSEVGVDTGATIHTKGGMPIRVRKR  642



>ref|XP_005827896.1| cytochrome P450 [Guillardia theta CCMP2712]
 gb|EKX40916.1| cytochrome P450 [Guillardia theta CCMP2712]
Length=491

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 107/167 (64%), Gaps = 13/167 (8%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKD----------GXAIPAGTDIXXSVYNLHRSPYFWDKP  598
            PP+L+RR+L+  +LP  ++G  +          G +I  G +I  SV+NLHR+P  WD P
Sbjct  324  PPILLRRALKETKLPVAHSGSHEDQASSDMQPSGVSISPGANIFISVWNLHRNPKLWDNP  383

Query  597  NEFEPXXFQVXKXXE--IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFA  424
            + F+P  +   +        WAG+ P +  G LYPNE  +++ ++PFGGG RK VGDQFA
Sbjct  384  DSFDPSRWLRPQPATNGHSSWAGYTPRKDMG-LYPNENDANYGYIPFGGGQRKCVGDQFA  442

Query  423  LMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            + E+ + L+ L Q+FDI+L G+PE V + TGATIH+KNGL  +LKKR
Sbjct  443  MQEAVVILSKLFQRFDIELAGSPEEVGMSTGATIHSKNGLMIRLKKR  489



>ref|XP_002185035.1| lut1-1 [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43482.1| lut1-1 [Phaeodactylum tricornutum CCAP 1055/1]
Length=538

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 103/171 (60%), Gaps = 19/171 (11%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-Q  571
            PPLLIRR   PD+LP G   +     +  G DI  +VYN+HR   FW  P+ F+P  F +
Sbjct  367  PPLLIRRCRTPDELPQGAGRE---AKVIRGMDIFMAVYNIHRDERFWPSPDTFDPLRFTR  423

Query  570  VXKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
                 ++ GWAGFDP +  G LYPNE+ SDFAFLPFGGG RK VGD+FA++E+ + LAM+
Sbjct  424  SHSNPDVPGWAGFDPKKWEGKLYPNEVASDFAFLPFGGGARKCVGDEFAILEATVTLAMV  483

Query  390  LQKFDIDL---------------KGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L++F+                  +G    V + TGATIHT+NGL   ++KR
Sbjct  484  LRRFEFSFDESKFEGKDDILSSAQGLNHPVGMRTGATIHTRNGLHLVVEKR  534



>ref|XP_005845008.1| hypothetical protein CHLNCDRAFT_138471 [Chlorella variabilis]
 gb|EFN52906.1| hypothetical protein CHLNCDRAFT_138471 [Chlorella variabilis]
Length=614

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 102/172 (59%), Gaps = 17/172 (10%)
 Frame = -2

Query  747  PPLLIRR----------SLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKP  598
            PP+LIRR          +L  D LP G  GD +G  I  G D+  S++NLHRSP+ W  P
Sbjct  431  PPILIRRQAGAGGWVRVALGEDVLPAGLGGDPNGYPIGKGADLFISLWNLHRSPHLWKDP  490

Query  597  NEFEPXXFQVXKXXEIEG------WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVG  436
            + F P  F                WAG+ P     +LYPNE+ SDFAFLPFGGG RK +G
Sbjct  491  DTFRPERFTGQLGERFVNAAFGGKWAGYTPGGEGSSLYPNEVSSDFAFLPFGGGARKCIG  550

Query  435  DQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            DQFA+ E+A+ L MLL++F   L+  P+ V + TGATIHT NGL C +++R+
Sbjct  551  DQFAVTEAALILVMLLRRFRFRLQ-DPQGVGMATGATIHTANGLKCTVERRV  601



>ref|XP_002185034.1| lutein deficient 1-like protein [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC43481.1| lutein deficient 1-like protein [Phaeodactylum tricornutum CCAP 
1055/1]
Length=644

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 103/171 (60%), Gaps = 19/171 (11%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-Q  571
            PPLLIRR   PD+LP G   +     +  G DI  +VYN+HR   FW  P+ F+P  F +
Sbjct  473  PPLLIRRCRTPDELPQGAGRE---AKVIRGMDIFMAVYNIHRDERFWPSPDTFDPLRFTR  529

Query  570  VXKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
                 ++ GWAGFDP +  G LYPNE+ SDFAFLPFGGG RK VGD+FA++E+ + LAM+
Sbjct  530  SHSNPDVPGWAGFDPKKWEGKLYPNEVASDFAFLPFGGGARKCVGDEFAILEATVTLAMV  589

Query  390  LQKFDIDL---------------KGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L++F+                  +G    V + TGATIHT+NGL   ++KR
Sbjct  590  LRRFEFSFDESKFEGKDDILSSAQGLNHPVGMRTGATIHTRNGLHLVVEKR  640



>ref|XP_001415984.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94276.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=563

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 105/156 (67%), Gaps = 4/156 (3%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR L    LP G  GD +   I  G DI  SV+NLHRSP  W+ P+EF+P  F+ 
Sbjct  407  PPILIRRCLEDVTLPKG-AGDVEVTLI-KGMDIFISVWNLHRSPECWENPDEFDPFRFKR  464

Query  567  -XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K   ++ WAG++P    G LYPNE+ SDFAF+PFG G RK +GDQFA++E+ IA+AM 
Sbjct  465  PFKNPGVKDWAGYNPDLLTG-LYPNEVASDFAFIPFGAGARKCIGDQFAMLEATIAMAMT  523

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L+++D +L+  P+ + +  GATIHT  GL  K+K+R
Sbjct  524  LRRYDFELQKDPKDIGMEMGATIHTAGGLPMKIKRR  559



>ref|XP_002506798.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68056.1| predicted protein [Micromonas sp. RCC299]
Length=573

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 103/156 (66%), Gaps = 4/156 (3%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L    LP G  G +    +  GTD   +V+NLHRSP  WD+P+ F+P  F+ 
Sbjct  418  PPILIRRALEDVTLPAGGMGRE--ITLKKGTDCFVAVWNLHRSPDLWDRPDVFDPARFKR  475

Query  567  X-KXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K  +IEGW G  P    G LYPNE  +DFA++PFGGG R+  GD FA+ME+ +AL++L
Sbjct  476  EFKNPKIEGWNGLSPELVTG-LYPNEQSTDFAYVPFGGGQRRCAGDMFAMMEATVALSVL  534

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L++F+ +L      V+++TGATIHTK G+  KL+ R
Sbjct  535  LKRFEFELGCDESEVEMITGATIHTKAGMPVKLRSR  570



>ref|XP_002178724.1| lutein deficient 1-like protein [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC49422.1| lutein deficient 1-like protein [Phaeodactylum tricornutum CCAP 
1055/1]
Length=769

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-Q  571
            PPLLIRR+   D LP G +  K G  +  GTD+  S +NLHRSP  W+ P  F+P  + +
Sbjct  552  PPLLIRRARTEDNLPAGSSDLKSGVKVLRGTDMFISTWNLHRSPDLWENPEVFDPTRWDR  611

Query  570  VXKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
                  I GW+G++P +  G LYP+E  +DFAFLPFGGG RK VGDQFA+ME+ + +A++
Sbjct  612  PFNNAGIPGWSGYNPDKVSG-LYPSENAADFAFLPFGGGQRKCVGDQFAMMEATVTMALM  670

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKK  286
            ++K+D D     E V + TGATIHT NGL  + ++
Sbjct  671  IKKYDFDFAIPAEDVGMKTGATIHTMNGLMMRARQ  705



>ref|XP_005830096.1| cytochrome P450 [Guillardia theta CCMP2712]
 gb|EKX43116.1| cytochrome P450 [Guillardia theta CCMP2712]
Length=498

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 102/160 (64%), Gaps = 5/160 (3%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFW-DKPNEFEPXXFQ  571
            PP+LIRR+L  D LP  + G++    +  GTDI   V+NLHRSP  W D  + F P  + 
Sbjct  339  PPILIRRALDDDVLPLAW-GNEKQVKVFRGTDIFMLVWNLHRSPVLWGDDADAFRPDRWL  397

Query  570  VXKXX-EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
              +   ++ GW G+ P+     LYPNE+ SDFAF PFG GPRK +GDQFA +ES + L+ 
Sbjct  398  SSRSNPDVPGWEGYKPNMK--NLYPNEVSSDFAFCPFGAGPRKCIGDQFAFLESVVILSR  455

Query  393  LLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            +LQ+FDI L  +PE V + TGATIHT+ GL   L+ R +V
Sbjct  456  VLQEFDIQLATSPEEVGMTTGATIHTEKGLKVSLRARKNV  495



>ref|XP_007509002.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20088.1| predicted protein [Bathycoccus prasinos]
Length=584

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 101/156 (65%), Gaps = 4/156 (3%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR L    LP G  GD+D   I  G D+  SV+NLHRSP  W+ P+E++P  F+ 
Sbjct  430  PPILIRRCLEDVPLPRG-AGDRDITLI-KGMDVFISVWNLHRSPECWENPDEYDPERFKK  487

Query  567  -XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              K   ++ WAG++P    G LYPNEI SD+AF+PFG G RK +GDQFA +E+ I+L M 
Sbjct  488  PFKNPGVKDWAGYNPDLLTG-LYPNEIASDYAFIPFGAGARKCIGDQFATLEATISLVMT  546

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L+KF  +L+  P  + +  GATIHT  GL C LK R
Sbjct  547  LRKFTFNLQKDPNEIGMEMGATIHTAGGLPCTLKLR  582



>ref|XP_005715216.1| cytochrome P450 family 97G-CYP97G1 [Chondrus crispus]
 emb|CDF35397.1| cytochrome P450 family 97G-CYP97G1 [Chondrus crispus]
Length=591

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 100/152 (66%), Gaps = 6/152 (4%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR L    LP G  G  +   +P G+DI  +VY+LHRSP  WD P  ++P  +  
Sbjct  411  PPVLIRRLLEDTTLPKG--GSPEVTNLPRGSDIFINVYSLHRSPALWDDPEIYDPDRWLK  468

Query  567  XKXXE-IEGWAGFDPS---RSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIAL  400
             K    +EGWAG+ P+        LYPNE+ +DFAFLPFGGG RK VGD FA++ES +AL
Sbjct  469  PKSNPGVEGWAGYKPASGLEEGTPLYPNEVNADFAFLPFGGGSRKCVGDHFAVLESVVAL  528

Query  399  AMLLQKFDIDLKGTPESVKLVTGATIHTKNGL  304
            AM++++FD  +    + V++ TGATIHTKNGL
Sbjct  529  AMVIRQFDFVMVDPSKDVEMTTGATIHTKNGL  560



>gb|ACF83994.1| unknown [Zea mays]
Length=76

 Score =   133 bits (335),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = -2

Query  507  LYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGA  328
            +YPNEII+DFAFLPFGGGPRK VGDQFAL+ES +ALA+LL+KFD++L+G+P+ V++VTGA
Sbjct  1    MYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLRKFDVELRGSPDEVEMVTGA  60

Query  327  TIHTKNGLWCKLKKR  283
            TIHTKNGLWC+L++R
Sbjct  61   TIHTKNGLWCRLRRR  75



>ref|XP_007514506.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14746.1| predicted protein [Bathycoccus prasinos]
Length=591

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 103/156 (66%), Gaps = 4/156 (3%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-Q  571
            PP+LIRR++    LP G  G      +  GTD   +V+NLHRSP  W+ P+ F+P  + +
Sbjct  436  PPILIRRAIETVDLPKG--GMGKSIQLKKGTDCFIAVWNLHRSPDHWENPDLFDPSRWDR  493

Query  570  VXKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
                 +IEGW G+DP    G LYPNE+ +D+A++PFGGG R+  GD FA+ME+ +AL++L
Sbjct  494  KFTNPKIEGWNGYDPELVTG-LYPNEVATDYAYVPFGGGQRRCAGDVFAMMEATVALSVL  552

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L+KF  +L    + V+++TGATIHTK GL  + K+R
Sbjct  553  LKKFSFELACDEKDVQMITGATIHTKKGLPVRAKRR  588



>ref|XP_009032928.1| hypothetical protein AURANDRAFT_19592 [Aureococcus anophagefferens]
 gb|EGB11800.1| hypothetical protein AURANDRAFT_19592 [Aureococcus anophagefferens]
Length=527

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 104/176 (59%), Gaps = 21/176 (12%)
 Frame = -2

Query  747  PPLLIRRSLRPD-----QLPGGYNGDKDG-------XAIPAGTDIXXSVYNLHRSPYFWD  604
            PPLLIRR++  D     QLP     D  G         +P   D+  ++Y+LHR+P +W 
Sbjct  350  PPLLIRRAVDDDAVPTVQLPDTDELDASGLRARAVDVKVPRACDMFIAIYSLHRNPRYWK  409

Query  603  KPNEFEPXXFQVXKXXEIE-GWAGFDPSR-----SPGALYPNEIISDFAFLPFGGGPRKX  442
             P+ F+P  +        E  WAG+DP++       G+LYP E  +DFA+LPFGGG RK 
Sbjct  410  NPDSFDPKRWLEKYANPDEPTWAGYDPAKWKAGDGMGSLYPTETSADFAYLPFGGGARKC  469

Query  441  VGDQFALMESAIALAMLLQKFDIDLKG---TPESVKLVTGATIHTKNGLWCKLKKR  283
            VGDQFA+ME+ +ALA  LQ+FD D  G   TP+ V   TGATIHT+NGLW  + +R
Sbjct  470  VGDQFAMMEATVALAGFLQRFDFDFAGPTDTPDKVGTNTGATIHTRNGLWMTVTER  525



>ref|XP_009034650.1| hypothetical protein AURANDRAFT_21944, partial [Aureococcus anophagefferens]
 gb|EGB11100.1| hypothetical protein AURANDRAFT_21944, partial [Aureococcus anophagefferens]
Length=279

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 105/174 (60%), Gaps = 20/174 (11%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR+L  D+LP  Y  D+D   I  GTD+  S ++LH++P  WD+P  F+P  ++ 
Sbjct  103  PPLLIRRALDSDELPQPY-ADEDRVKIARGTDVFMSTWSLHKNPALWDEPESFDPTRWER  161

Query  567  XKX---XEIEGWAGFDPSRSPG-ALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIAL  400
             K        GW G+DP++ P  ALYP E  +D+AFLPFG G R+ VGDQFA++E+ + L
Sbjct  162  KKEPGPDAPAGWRGYDPAKIPAQALYPTEQSADYAFLPFGAGNRRCVGDQFAILEATVML  221

Query  399  AMLLQKFDID--------------LKGTPES-VKLVTGATIHTKNGLWCKLKKR  283
              L+++FD +              L G P + V + TGATIHT++GLW   K R
Sbjct  222  TTLIREFDFEFALDDPSTLAPKTGLGGLPVADVGMRTGATIHTEHGLWMTAKPR  275



>emb|CDY61653.1| BnaCnng38160D [Brassica napus]
Length=260

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 84/128 (66%), Gaps = 16/128 (13%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIR +L+P+ L GGY G+++G  +P  TDI  SV               FEP  F  
Sbjct  148  PPLLIRHTLKPETLNGGYKGEEEGHKVPKRTDIFISV---------------FEPDRFLR  192

Query  567  XKXXE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
             K    IEGWAGFDPSRSPGALYPNEII+DF  LPFGGGPRK +G+QFALMES +ALA +
Sbjct  193  TKESNGIEGWAGFDPSRSPGALYPNEIIADFQSLPFGGGPRKCIGEQFALMESTVALANV  252

Query  390  LQKFDIDL  367
              +  + +
Sbjct  253  WNRLSLRI  260



>ref|XP_002293604.1| cytochrome P450 [Thalassiosira pseudonana CCMP1335]
 gb|EED89340.1| cytochrome P450 [Thalassiosira pseudonana CCMP1335]
Length=546

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 106/173 (61%), Gaps = 21/173 (12%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR    ++LP G  G ++   I  G DI  S+YNLH    FW +PNEF+P  ++ 
Sbjct  375  PPLLIRRCRTENKLPKG--GGREATVI-RGMDIFLSLYNLHHDERFWPEPNEFKPERWES  431

Query  567  XKXX-EIEGWAGFDPSRSPGA-LYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
                 E+  WAG+DP++     LYPNE+ SDFA+LPFGGG RK VGD+FA +E+ + LAM
Sbjct  432  KYINPEVPEWAGYDPAKWINTNLYPNEVASDFAYLPFGGGARKCVGDEFATLEATVTLAM  491

Query  393  LLQKFD------------IDLKGTPE----SVKLVTGATIHTKNGLWCKLKKR  283
            LL++F+            ID+   PE    +V + TGATIHT+ GL   ++KR
Sbjct  492  LLRRFEFEFDSAKLAASKIDIMDHPEDLEHAVGMRTGATIHTRKGLHMVIRKR  544



>ref|XP_004516959.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=537

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 95/156 (61%), Gaps = 26/156 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L PD+LPG Y        + AG DI  SVYN+HRS   WD+  EF P  F  
Sbjct  407  PPVLIRRALVPDELPGAYK-------VNAGQDIMISVYNIHRSSEVWDRAEEFLPERF--  457

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                E++G              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  458  ----ELDGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAVFL  501

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            Q  + +L    +++ + TGATIHT NGL+ KL +RL
Sbjct  502  QNMNFELVPN-QNISMTTGATIHTTNGLYMKLNRRL  536



>dbj|BAD94136.1| Cytochrom P450 -like protein [Arabidopsis thaliana]
Length=301

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD LPG Y        +  G DI  SVYN+HRS   W+K  EF P  F +
Sbjct  173  PPVLIRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDI  225

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                              GA+ PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  226  -----------------DGAI-PNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFL  267

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ +++L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  268  QRLNVEL--VPDQTISMTTGATIHTTNGLYMKVSQR  301



>ref|XP_005648231.1| CYP97C3 [Coccomyxa subellipsoidea C-169]
 gb|EIE23687.1| CYP97C3 [Coccomyxa subellipsoidea C-169]
Length=540

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 96/155 (62%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+   D LPGGY+       +P G D+  SVYN+HRSP  WD PN+F P  F  
Sbjct  386  PPVLLRRAQVADTLPGGYS-------VPVGQDVMISVYNIHRSPAVWDDPNDFRPERF--  436

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P   P    P+E  +D+ F+PF GGPRK VGDQFALME+ +ALA+LL
Sbjct  437  -------------PLDEP---VPSEQTTDYRFIPFSGGPRKCVGDQFALMEAVVALAVLL  480

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            ++FD +L    + + + TGATIHT+NGL+  +++R
Sbjct  481  KRFDFELV-PDQDIGMTTGATIHTQNGLFMTVRER  514



>ref|XP_003542540.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Glycine max]
Length=534

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 95/156 (61%), Gaps = 26/156 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD+LPGGY  D       AG DI  SVYN+HRS   WD+  EF P  F  
Sbjct  404  PPVLIRRAQVPDELPGGYKLD-------AGQDIMISVYNIHRSSEVWDRAEEFVPERF--  454

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                +++G              PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  455  ----DLDGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFL  498

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            Q  + +L    +++ + TGATIHT NGL+ KL +RL
Sbjct  499  QHMNFELVPD-QNISMTTGATIHTTNGLYMKLSRRL  533



>gb|KFK34549.1| hypothetical protein AALP_AA5G160700 [Arabis alpina]
Length=542

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 95/156 (61%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD LPG Y        +  G DI  SVYN+HRS   W+K  EF P  F  
Sbjct  414  PPVLIRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSVVWEKAEEFLPERF--  464

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                E+EG              PNEI +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  465  ----ELEG------------AIPNEINTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFL  508

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ +++L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  509  QRLNVEL--VPDQTISMTTGATIHTTNGLYMKVSQR  542



>ref|XP_003537025.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Glycine 
max]
Length=537

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 95/156 (61%), Gaps = 26/156 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD+LPGGY        + AG DI  SVYN+HRS   WD+  EF P  F  
Sbjct  407  PPVLIRRAQVPDELPGGYK-------LNAGQDIMISVYNIHRSSEVWDRAEEFAPERF--  457

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                +++G              PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  458  ----DLDGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFL  501

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            Q  + +L    ++V + TGATIHT NGL+ KL +RL
Sbjct  502  QHMNFELVPD-QNVSMTTGATIHTTNGLYMKLSRRL  536



>gb|KHN36453.1| Carotene epsilon-monooxygenase, chloroplastic [Glycine soja]
Length=674

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 95/156 (61%), Gaps = 26/156 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD+LPGGY        + AG DI  SVYN+HRS   WD+  EF P  F  
Sbjct  544  PPVLIRRAQVPDELPGGYK-------LNAGQDIMISVYNIHRSSEVWDRAEEFAPERF--  594

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                +++G              PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  595  ----DLDGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFL  638

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            Q  + +L    ++V + TGATIHT NGL+ KL +RL
Sbjct  639  QHMNFELVPD-QNVSMTTGATIHTTNGLYMKLSRRL  673



>ref|XP_007145289.1| hypothetical protein PHAVU_007G2265000g, partial [Phaseolus vulgaris]
 gb|ESW17283.1| hypothetical protein PHAVU_007G2265000g, partial [Phaseolus vulgaris]
Length=129

 Score =   127 bits (319),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 92/154 (60%), Gaps = 26/154 (17%)
 Frame = -2

Query  741  LLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQVXK  562
            +LIRR+  PD+LPG Y        + AG DI  SVYN+HRS   WD+  EF P  F    
Sbjct  1    VLIRRAQVPDELPGSYK-------VNAGQDIMISVYNIHRSSEVWDRAEEFMPERF----  49

Query  561  XXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLLQK  382
              +++G              PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ +Q 
Sbjct  50   --DLDGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFIQH  95

Query  381  FDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
             + +L    +++ + TGATIHT NGL+ KL +RL
Sbjct  96   MNFELV-PDQNISMTTGATIHTTNGLYMKLSQRL  128



>ref|XP_005826161.1| cytochrome P450 [Guillardia theta CCMP2712]
 gb|EKX39181.1| cytochrome P450 [Guillardia theta CCMP2712]
Length=637

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 103/179 (58%), Gaps = 26/179 (15%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDK----DGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPX  580
            PP+LIRR+L  D LP   N D     +   I  G+D   SV+NLHRSP  WDKP+EF+P 
Sbjct  459  PPILIRRALDADVLPKASNLDGSVQGNAVKIIKGSDFFLSVWNLHRSPLLWDKPDEFDPD  518

Query  579  XFQVXKXXEI----------EG---WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXV  439
             ++     E+          EG   W G+ P      LYPNE+ +D+AFLPFG GPRK +
Sbjct  519  RWRRPTPPELVEKYNAQRRAEGLPEWQGYVPDLK--TLYPNEVHADYAFLPFGAGPRKCL  576

Query  438  GDQFALMESAIALAMLLQKFDIDLKGTPE-------SVKLVTGATIHTKNGLWCKLKKR  283
            GDQFALMES + L  + Q++  +L G  +        V ++ GATIHT NGL  ++K+R
Sbjct  577  GDQFALMESVVMLTKIFQRYSFELVGNHDPKVPNESDVGMMFGATIHTANGLNVRVKRR  635



>ref|XP_010504071.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Camelina sativa]
Length=545

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 94/156 (60%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD LPG Y        +  G DI  SVYN+HRS   W+K  EF P  F  
Sbjct  417  PPVLIRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERF--  467

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                E+EG              PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  468  ----ELEG------------AIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFL  511

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ +++L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  512  QRLNVEL--VPDQTISMTTGATIHTTNGLYMKVSRR  545



>ref|XP_010426945.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Camelina 
sativa]
Length=544

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 93/155 (60%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD LPG Y        +  G DI  SVYN+HRS   W+K  EF P  F  
Sbjct  416  PPVLIRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERF--  466

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                E+EG              PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  467  ----ELEG------------AIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFL  510

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ +++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  511  QRLNVELVPD-QTISMTTGATIHTTNGLYMKVSRR  544



>ref|XP_003574294.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Brachypodium 
distachyon]
Length=550

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 93/155 (60%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR++  D LPG Y        + AG DI  SVYN+HRSP  WD+ +EF P  F  
Sbjct  408  PPVLIRRAIVDDVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFVPERF--  458

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA++L
Sbjct  459  ----DLEGPV------------PNESNTDFRFVPFSGGPRKCVGDQFALLEAIVALAVVL  502

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            QK DI L    E + + TGATIHT NGL+  +  R
Sbjct  503  QKIDIQLVADQE-INMTTGATIHTTNGLYMNVSLR  536



>ref|XP_010515801.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Camelina sativa]
Length=545

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 93/155 (60%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD LPG Y        +  G DI  SVYN+HRS   W+K  EF P  F  
Sbjct  417  PPVLIRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERF--  467

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                E+EG              PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  468  ----ELEG------------AIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFL  511

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ +++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  512  QRLNVELVPD-QTISMTTGATIHTTNGLYMKVSRR  545



>gb|AAM13903.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=552

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD LPG Y        +  G DI  SVYN+HRS   W+K  EF P  F +
Sbjct  424  PPVLIRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDI  476

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                              GA+ PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  477  D-----------------GAI-PNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFL  518

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ +++L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  519  QRLNVEL--VPDQTISMTTGATIHTTNGLYMKVSQR  552



>ref|XP_009125249.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Brassica 
rapa]
Length=533

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 95/156 (61%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD LPG Y        +  G DI  SVYN+HRS   W+K  EF P  F  
Sbjct  405  PPVLIRRAQVPDVLPGNYK-------VNTGQDIMISVYNVHRSSAVWEKAEEFLPERF--  455

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                E+EG         P    PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  456  ----ELEG---------P---IPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFL  499

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ +++L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  500  QRLNVEL--VPDQTISMTTGATIHTTNGLYMKVSQR  533



>ref|NP_190881.2| carotene epsilon-monooxygenase [Arabidopsis thaliana]
 sp|Q6TBX7.1|LUT1_ARATH RecName: Full=Carotene epsilon-monooxygenase, chloroplastic; 
AltName: Full=Cytochrome P450 97C1; AltName: Full=Protein LUTEIN 
DEFICIENT 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAR83120.1| chloroplast carotenoid epsilon-ring hydroxylase [Arabidopsis 
thaliana]
 gb|AEE79040.1| carotene epsilon-monooxygenase [Arabidopsis thaliana]
Length=539

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD LPG Y        +  G DI  SVYN+HRS   W+K  EF P  F +
Sbjct  411  PPVLIRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDI  463

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                              GA+ PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  464  D-----------------GAI-PNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFL  505

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ +++L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  506  QRLNVEL--VPDQTISMTTGATIHTTNGLYMKVSQR  539



>emb|CDY13314.1| BnaC06g14430D [Brassica napus]
Length=533

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 94/155 (61%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD LPG Y        +  G DI  SVYN+HRS   W+K  EF P  F  
Sbjct  405  PPVLIRRAQVPDILPGNYK-------VNTGQDIMISVYNVHRSSAVWEKAEEFLPERF--  455

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                E+EG         P    PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  456  ----ELEG---------P---IPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFL  499

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ +++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  500  QRLNVELVPD-QTISMTTGATIHTTNGLYMKVSQR  533



>emb|CDX67558.1| BnaA07g15980D [Brassica napus]
Length=546

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 95/156 (61%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD LPG Y        +  G DI  SVYN+HRS   W+K  EF P  F  
Sbjct  418  PPVLIRRAQVPDILPGNYK-------VNTGQDIMISVYNVHRSSAVWEKAEEFLPERF--  468

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                E+EG         P    PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  469  ----ELEG---------P---IPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFL  512

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ +++L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  513  QRLNVEL--VPDQTISMTTGATIHTTNGLYMKVSQR  546



>emb|CAB64216.1| Cytochrom P450-like protein [Arabidopsis thaliana]
Length=566

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD LPG Y        +  G DI  SVYN+HRS   W+K  EF P  F +
Sbjct  438  PPVLIRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDI  490

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                              GA+ PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  491  D-----------------GAI-PNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFL  532

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ +++L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  533  QRLNVEL--VPDQTISMTTGATIHTTNGLYMKVSQR  566



>ref|XP_002506759.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68017.1| predicted protein [Micromonas sp. RCC299]
Length=538

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR L    LP G  GD +   I  G D+  SV+NLHR P  W++P +F+P  F+ 
Sbjct  386  PPILIRRCLEDVPLPKG-AGDANVTLI-KGMDVFISVWNLHRHPDCWEEPLKFDPTRFKR  443

Query  567  -XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAML  391
              +   ++ WAG++P    G LYPNE+ SDFAF+PFG G RK +GDQFA++E+   LAM 
Sbjct  444  PFQNPGVKDWAGYNPDLISG-LYPNEVTSDFAFIPFGAGARKCIGDQFAMLEATSCLAMT  502

Query  390  LQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            L+++D ++      V +  GATIHT  GL  K+ +R
Sbjct  503  LRRYDFEMTKDASEVGMEMGATIHTAGGLPMKVTRR  538



>gb|AGN27239.1| CYP97A1 [Parachlorella kessleri]
Length=647

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 88/158 (56%), Gaps = 25/158 (16%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRRSL PD L G          I  G DI  + +NLHRSP  WD+P+EF+P  F  
Sbjct  450  PPVLIRRSLEPDTLAG--------FEIQEGQDIFIATWNLHRSPQLWDRPDEFDPDRF--  499

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P   P    PNE+  DF +LPFGGG RK +GDQFA+ ES  ALAML+
Sbjct  500  ------------GPLEGPA---PNEVTEDFKYLPFGGGKRKCIGDQFAIFESVTALAMLV  544

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            ++FD         V + TGATIHT NGLW   K R D+
Sbjct  545  RRFDFAFAPDAPPVSMTTGATIHTTNGLWLCPKPRADL  582



>gb|ACO53105.1| epsilon carotene hydroxylase [Actinidia chinensis]
Length=208

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 90/155 (58%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+  PD LPG Y        + AG DI  SVYN+H S   W++  EF P  F +
Sbjct  68   PPVLLRRAQVPDVLPGNYK-------VNAGQDIMISVYNIHHSAQVWERAEEFVPERFDL  120

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                        DP        PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  121  D-----------DP-------VPNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFL  162

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L    +++ + TGATIHT NGL+ K+ +R
Sbjct  163  QHMNFELVPD-QNISMTTGATIHTTNGLYMKVSQR  196



>gb|EMS57747.1| Cytochrome P450 97B2, chloroplastic [Triticum urartu]
Length=528

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 93/155 (60%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L  D LPG Y        +  G DI  SVYN+HRSP  WD+ +EF P  F  
Sbjct  363  PPVLIRRALVDDVLPGNYK-------VKTGQDIMISVYNIHRSPEVWDRADEFIPERF--  413

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG         P    PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+++
Sbjct  414  ----DLEG---------P---IPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIVI  457

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            QK DI L    + + + TGATIHT NGL+  +  R
Sbjct  458  QKVDIQLVA-DQKISMTTGATIHTTNGLYMNVSLR  491



>ref|XP_009623194.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=386

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 91/155 (59%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L  D LPG Y        + AG DI  SVYN+H S   W++  EF+P  F  
Sbjct  250  PPVLIRRALVADVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERFD-  301

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                          S  P    PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  302  --------------SEGP---VPNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFL  344

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q F  +L    +++ + TGATIHT NGL+ K+K+R
Sbjct  345  QNFSFELIP-DQNISMTTGATIHTTNGLYMKVKQR  378



>ref|XP_001420992.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99285.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=495

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 95/158 (60%), Gaps = 29/158 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L P  L GGYN       I AGTD   SV+NLHR+P  WD+P+ F+P  F  
Sbjct  329  PPVLIRRALEPVTL-GGYN-------IDAGTDFFISVWNLHRNPRIWDEPDAFKPERF--  378

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P  +P    PNE   ++A+LPFGGG RK VGDQFA+ ES ++LAML+
Sbjct  379  -------------PIDAP---MPNEYTEEYAYLPFGGGQRKCVGDQFAIFESIVSLAMLM  422

Query  387  QKFDIDLKGTPE---SVKLVTGATIHTKNGLWCKLKKR  283
            ++FD +L  +        + TGATIHT NGL  KLK+R
Sbjct  423  RRFDFELDESKHPDGECGMTTGATIHTTNGLHVKLKRR  460



>ref|XP_001422903.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP01262.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=461

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 95/158 (60%), Gaps = 29/158 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L P  L GGYN D       AGTD   SV+NLHR+P  WD+P+ F+P  F  
Sbjct  330  PPVLIRRALEPVTL-GGYNID-------AGTDFFISVWNLHRNPRIWDEPDAFKPERF--  379

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P  +P    PNE   ++A+LPFGGG RK VGDQFA+ ES ++LAML+
Sbjct  380  -------------PIDAP---MPNEYTEEYAYLPFGGGQRKCVGDQFAIFESIVSLAMLM  423

Query  387  QKFDIDLKGTPE---SVKLVTGATIHTKNGLWCKLKKR  283
            ++FD +L  +        + TGATIHT NGL  KLK+R
Sbjct  424  RRFDFELDESKHPDGECGMTTGATIHTTNGLHVKLKRR  461



>ref|XP_011397501.1| Cytochrome P450 97B2, chloroplastic [Auxenochlorella protothecoides]
 gb|AHA86562.1| cytochrome P450 like protein [Auxenochlorella protothecoides]
 gb|KFM24613.1| Cytochrome P450 97B2, chloroplastic [Auxenochlorella protothecoides]
Length=567

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 94/155 (61%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L  D L         G  +P G+DI  SV+NLHRSP  WD+P  F+P  F +
Sbjct  414  PPVLIRRALGEDTL--------QGFRLPKGSDIFISVWNLHRSPAHWDRPEAFDPDRFDL  465

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                     AG  P+       PNEI + FA+LPFGGG RK +GDQFALMES +ALA+L 
Sbjct  466  ---------AG--PT-------PNEITTGFAYLPFGGGRRKCIGDQFALMESVVALAVLA  507

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            ++FD+ +      V + TGATIHT NGLW  ++ R
Sbjct  508  RRFDVAVPPDAPEVGMTTGATIHTANGLWLNVRPR  542



>gb|AID51468.1| epsilon-ring carotene hydroxylase [Cucumis melo var. makuwa]
Length=148

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 91/155 (59%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+HRS   W++  EF P  F  
Sbjct  7    PPVLIRRAQVADTLPGNYK-------VNAGQDIMISVYNIHRSLQVWEQAEEFIPERF--  57

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  58   ----DLEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  101

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L    +++ + TGATIHT NGL+ KL +R
Sbjct  102  QHLNFELVPN-QTIGMTTGATIHTTNGLYMKLSQR  135



>ref|XP_002876190.1| hypothetical protein ARALYDRAFT_485688 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52449.1| hypothetical protein ARALYDRAFT_485688 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 95/158 (60%), Gaps = 30/158 (19%)
 Frame = -2

Query  747  PPL--LIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF  574
            PP+  LIRR+  PD LPG YN       +  G DI  SVYN+HRS   W+K  EF P  F
Sbjct  402  PPVRNLIRRAQVPDILPGNYN-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERF  454

Query  573  QVXKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
                  +IEG              PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+
Sbjct  455  ------DIEG------------AIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAV  496

Query  393  LLQKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
             LQ+ +++L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  497  FLQRLNVEL--VPDQTISMTTGATIHTTNGLYMKVSQR  532



>gb|AFP65826.1| carotene epsilon-ring hydroxylase, partial [Eriobotrya japonica]
Length=246

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 90/155 (58%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+HRS   W++  EF P  F  
Sbjct  102  PPVLIRRAQVADVLPGNYK-------VNAGPDIMISVYNIHRSSKVWERAEEFVPERF--  152

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ +
Sbjct  153  ----DLEGSV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFI  196

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L    + + + TGATIHT NGL+ KL +R
Sbjct  197  QNLNFELV-LDQKISMTTGATIHTTNGLYMKLSQR  230



>dbj|BAJ87296.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 93/155 (60%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L  D LPG Y        +  G DI  SVYN+HRSP  WD+ +EF P  F  
Sbjct  403  PPVLIRRALVDDVLPGNYK-------VKTGQDIMISVYNIHRSPEVWDRADEFIPERF--  453

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG         P    PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+++
Sbjct  454  ----DLEG---------P---IPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIVI  497

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            QK D+ L    + + + TGATIHT NGL+  +  R
Sbjct  498  QKMDVQLVAD-QKISMTTGATIHTTNGLYMNVSLR  531



>emb|CDP15310.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 94/156 (60%), Gaps = 26/156 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+  PD LPGGY        +  G D+  SVYN+H SP  W++  +F P  F  
Sbjct  345  PPVLLRRAQVPDVLPGGYK-------VNTGQDVMISVYNIHHSPQVWERAEDFVPERF--  395

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                E+EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA++L
Sbjct  396  ----ELEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAVIL  439

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            Q  + +L    +++ + TGATIHT NGL+ K+ +RL
Sbjct  440  QHLNFELI-PDQNISMTTGATIHTTNGLYMKVSQRL  474



>ref|XP_006403722.1| hypothetical protein EUTSA_v10010267mg [Eutrema salsugineum]
 gb|ESQ45175.1| hypothetical protein EUTSA_v10010267mg [Eutrema salsugineum]
Length=546

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD LPG Y        +  G DI  SVYN+HRS   W+K  EF P  F  
Sbjct  417  PPVLIRRAQVPDILPGNYK-------VNPGQDIMISVYNVHRSSAVWEKAEEFLPERF--  467

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                E+EG              PNE  +DF F+PF GGPRK VGDQFA+ME+ +ALA+ L
Sbjct  468  ----ELEG------------PIPNETNTDFKFIPFSGGPRKCVGDQFAMMEAIVALAVFL  511

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ +++L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  512  QRLNVEL--VPDQTISMTTGATIHTTNGLYMKVSQR  545



>ref|XP_004983761.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X1 [Setaria italica]
Length=553

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 93/155 (60%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR++  D LPG Y        + AG DI  SVYN+HRSP  WD+ +EF P  F  
Sbjct  410  PPVLLRRAIVDDVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFIPERF--  460

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA++L
Sbjct  461  ----DLEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIVL  504

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            QK DI L    + + + TGATIHT NGL+  +  R
Sbjct  505  QKMDIQLV-PDQKINMTTGATIHTTNGLYMNVSLR  538



>ref|XP_004983762.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X2 [Setaria italica]
Length=550

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 93/155 (60%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR++  D LPG Y        + AG DI  SVYN+HRSP  WD+ +EF P  F  
Sbjct  410  PPVLLRRAIVDDVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFIPERF--  460

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA++L
Sbjct  461  ----DLEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIVL  504

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            QK DI L    + + + TGATIHT NGL+  +  R
Sbjct  505  QKMDIQLV-PDQKINMTTGATIHTTNGLYMNVSLR  538



>ref|XP_001700492.1| cytochrome P450, carotenoid hydroxylase [Chlamydomonas reinhardtii]
 gb|ABQ59244.1| CYP97A5 [Chlamydomonas reinhardtii]
 gb|EDO98047.1| cytochrome P450, carotenoid hydroxylase [Chlamydomonas reinhardtii]
Length=652

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 97/155 (63%), Gaps = 25/155 (16%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L+ D          D   +PAG+D+  SV+NLHRSP  WD+P++F+P  F  
Sbjct  450  PPVLIRRALQDDHF--------DQFTVPAGSDLFISVWNLHRSPKLWDEPDKFKPERF--  499

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P  SP    PNE+  +FA+LPFGGG RK +GDQFAL E+ +ALAML+
Sbjct  500  ------------GPLDSP---IPNEVTENFAYLPFGGGRRKCIGDQFALFEAVVALAMLM  544

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            ++++ +L  +  +V + TGATIHT NGL   +++R
Sbjct  545  RRYEFNLDESKGTVGMTTGATIHTTNGLNMFVRRR  579



>gb|AGI61105.1| carotenoid hydroxylase [Parachlorella kessleri]
Length=647

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 87/158 (55%), Gaps = 25/158 (16%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRRSL PD L G          I  G DI  + +NLHRSP  WD+P+EF+P  F  
Sbjct  450  PPVLIRRSLEPDTLAG--------FEIQEGQDIFIATWNLHRSPQLWDRPDEFDPDRF--  499

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P   P    PNE+  DF  LPFGGG RK +GDQFA+ ES  ALAML+
Sbjct  500  ------------GPLEGPA---PNEVTEDFKCLPFGGGKRKCIGDQFAIFESVTALAMLV  544

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            ++FD         V + TGATIHT NGLW   K R D+
Sbjct  545  RRFDFAFAPDAPPVSMTTGATIHTTNGLWLCPKPRADL  582



>ref|XP_006339098.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=388

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 91/155 (59%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   WD+  EF+P  F  
Sbjct  250  PPVLIRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSEVWDRAEEFDPERF--  300

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ I LA+ +
Sbjct  301  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATITLAIFV  344

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q F  +L    +++ + TGATIHT NGL+ K+K+R
Sbjct  345  QNFSFELIP-DQTISMTTGATIHTTNGLYMKVKQR  378



>gb|AIX87504.1| P450 carotenoid epsilon-ring hydroxylase [Lycium barbarum]
Length=547

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 93/155 (60%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L  D LPG Y        + AG DI  SVYN+H S   W++  EF+P  F  
Sbjct  409  PPVLIRRALVADVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERF--  459

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  460  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFL  503

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q F  +L    +++ + TGATIHT NGL+ K+K+R
Sbjct  504  QNFSFELI-PDQNISMTTGATIHTTNGLYMKVKQR  537



>ref|XP_003590442.1| Cytochrome P450 monooxygenase CYP97C10 [Medicago truncatula]
 gb|AES60693.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=541

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 93/156 (60%), Gaps = 26/156 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRRS  PD+LPG Y        I AG DI  SVYN+H S   WD+  EF P  F  
Sbjct  411  PPVLIRRSQIPDELPGDYK-------IDAGQDIMISVYNIHHSSKVWDRAEEFLPERF--  461

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                +++G              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  462  ----DLDGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAVFL  505

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            Q  + +L    +++ + TGATIHT NGL+ KL +RL
Sbjct  506  QHMNFELV-PDQNIGMTTGATIHTTNGLYMKLSQRL  540



>gb|EJK46027.1| hypothetical protein THAOC_35331 [Thalassiosira oceanica]
Length=472

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 97/176 (55%), Gaps = 24/176 (14%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PPLLIRR    + LP G   +     +  G D+  S+YNLHR   FW +P+EF P  ++ 
Sbjct  298  PPLLIRRCRTQNDLPKGCGKE---ATVIRGMDMFISLYNLHRDERFWPQPDEFIPERWET  354

Query  567  XKXX---EIEGWAGFDPSR--SPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIA  403
                   ++  W G+DP R  +   LYPNE+ SDFA+LPFGGG RK VGD+FA +E+ + 
Sbjct  355  KYRYVNPDVPEWGGYDPDRWMNTNFLYPNEVASDFAYLPFGGGARKCVGDEFATLEATVT  414

Query  402  LAMLLQKFDIDL----------------KGTPESVKLVTGATIHTKNGLWCKLKKR  283
            LAM+L++F  D                 K     V + TGATIHT+ GL   +KKR
Sbjct  415  LAMVLRRFSFDFDQAKLAETSMSVHEHPKNLEHPVGMKTGATIHTRKGLHMIVKKR  470



>gb|AGK38422.1| CYP97B2 [Parachlorella kessleri]
Length=576

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 88/134 (66%), Gaps = 2/134 (1%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-Q  571
            PP+LIRR+L  D LP G NGD +G  I  G D+  S +NLHRSP+ W  P+ F P  F +
Sbjct  434  PPILIRRALGDDVLPAGLNGDPNGYPIGKGADLFISSWNLHRSPHLWKDPDTFRPERFAE  493

Query  570  VXKXXEIEG-WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
              +    EG WAG+DP     +LYPNE+ SDFA LPFGGG RK VGDQFA+ME+ +AL M
Sbjct  494  RFENPAFEGRWAGYDPELQGNSLYPNEVASDFALLPFGGGIRKCVGDQFAIMEATVALTM  553

Query  393  LLQKFDIDLKGTPE  352
            LL++  +   G P+
Sbjct  554  LLRRRRLRADGRPQ  567



>gb|AIX87528.1| P450 carotenoid epsilon-ring hydroxylase [Lycium ruthenicum]
Length=546

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 93/155 (60%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L  D LPG Y        + AG DI  SVYN+H S   W++  EF+P  F  
Sbjct  408  PPVLIRRALVADVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERF--  458

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  459  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFL  502

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q F  +L    +++ + TGATIHT NGL+ K+K+R
Sbjct  503  QNFSFELIPD-QNISMTTGATIHTTNGLYMKVKQR  536



>ref|XP_009623193.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=544

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 91/155 (59%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L  D LPG Y        + AG DI  SVYN+H S   W++  EF+P  F  
Sbjct  408  PPVLIRRALVADVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERFD-  459

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                          S  P    PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  460  --------------SEGP---VPNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFL  502

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q F  +L    +++ + TGATIHT NGL+ K+K+R
Sbjct  503  QNFSFELI-PDQNISMTTGATIHTTNGLYMKVKQR  536



>ref|XP_010241652.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=555

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 90/155 (58%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F  
Sbjct  416  PPVLIRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFVPERF--  466

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  467  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  510

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q FD DL    + + + TGATIHT NGL+ KL +R
Sbjct  511  QHFDFDLVPD-QKISMTTGATIHTTNGLYMKLSQR  544



>ref|XP_005849069.1| hypothetical protein CHLNCDRAFT_51247 [Chlorella variabilis]
 gb|EFN56967.1| hypothetical protein CHLNCDRAFT_51247 [Chlorella variabilis]
Length=577

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 95/155 (61%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR++ PD+LPGG         +P G D+  SVYN+HRSP  WD+P++F P  F  
Sbjct  425  PPVLLRRAMVPDELPGGLT-------VPQGQDVMISVYNIHRSPAVWDRPDDFLPERF--  475

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P   P    PNE  +D+ ++PF GGPRK VGDQFALME+ +ALA+++
Sbjct  476  -------------PLDGP---VPNEQNTDYKYIPFSGGPRKCVGDQFALMEAVVALAVMI  519

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            ++FD   +   +   + TGATIHTKNGL+  + KR
Sbjct  520  REFDFAPQPGHDP-GMTTGATIHTKNGLYMTVAKR  553



>ref|NP_001065217.1| Os10g0546600 [Oryza sativa Japonica Group]
 gb|ABB47954.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27131.1| Os10g0546600 [Oryza sativa Japonica Group]
 dbj|BAG89623.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51348.1| hypothetical protein OsJ_32354 [Oryza sativa Japonica Group]
Length=561

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 94/155 (61%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR++  D LPG Y        I AG DI  SVYN+HRSP  WD+ ++F P  F  
Sbjct  419  PPVLIRRAIVDDVLPGNYK-------IKAGQDIMISVYNIHRSPEVWDRADDFIPERF--  469

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +++ F+PF GGPRK VGDQFAL+E+ +ALA++L
Sbjct  470  ----DLEGPV------------PNETNTEYRFIPFSGGPRKCVGDQFALLEAIVALAVVL  513

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            QK DI+L    + + + TGATIHT NGL+  +  R
Sbjct  514  QKMDIELV-PDQKINMTTGATIHTTNGLYMNVSLR  547



>ref|XP_006662027.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Oryza brachyantha]
Length=565

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 94/155 (61%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR++  D LPG Y        I AG DI  SVYN+HRSP  WD+ +EF P  F  
Sbjct  423  PPVLLRRAIVDDVLPGNYK-------IKAGQDIMISVYNIHRSPEVWDRADEFIPERF--  473

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +++ F+PF GGPRK VGDQFAL+E+ +ALA++L
Sbjct  474  ----DLEGPV------------PNETNTEYRFIPFSGGPRKCVGDQFALLEAIVALAIVL  517

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            QK DI+L    + + + TGATIHT NGL+  +  R
Sbjct  518  QKIDIELV-PDQKINMTTGATIHTTNGLYMNVGLR  551



>emb|CEG00185.1| Cytochrome P450, conserved site [Ostreococcus tauri]
Length=534

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 93/158 (59%), Gaps = 29/158 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L P  L GGYN       I AGTD   SV+NLHR+P  W +P+ F+P  F  
Sbjct  332  PPVLIRRALEPVTL-GGYN-------IDAGTDFFISVWNLHRNPRIWPEPDAFKPERF--  381

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P   P    PNE   D+A+LPFGGG RK VGDQFA+ ES ++LAML+
Sbjct  382  -------------PIEGP---MPNEYTEDYAYLPFGGGQRKCVGDQFAIFESIVSLAMLM  425

Query  387  QKFDIDLKGTPE---SVKLVTGATIHTKNGLWCKLKKR  283
            ++FD +L  +        + TGATIHT NGL  +LK+R
Sbjct  426  RRFDFELDESKHPDGECGMTTGATIHTTNGLHVRLKRR  463



>ref|XP_009757367.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Nicotiana 
sylvestris]
Length=544

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 92/155 (59%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L  D LPG Y        + AG DI  SVYN+H S   W++  EF+P  F  
Sbjct  408  PPVLIRRALEADVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERF--  458

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  459  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFL  502

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q    +L    +++ + TGATIHT NGL+ K+K+R
Sbjct  503  QNLSFELIPD-QNISMTTGATIHTTNGLYMKVKQR  536



>ref|XP_003082726.1| probable cytochrome P450 (ISS) [Ostreococcus tauri]
Length=643

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 93/158 (59%), Gaps = 29/158 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L P  L GGYN       I AGTD   SV+NLHR+P  W +P+ F+P  F  
Sbjct  441  PPVLIRRALEPVTL-GGYN-------IDAGTDFFISVWNLHRNPRIWPEPDAFKPERF--  490

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P   P    PNE   D+A+LPFGGG RK VGDQFA+ ES ++LAML+
Sbjct  491  -------------PIEGP---MPNEYTEDYAYLPFGGGQRKCVGDQFAIFESIVSLAMLM  534

Query  387  QKFDIDLKGTPE---SVKLVTGATIHTKNGLWCKLKKR  283
            ++FD +L  +        + TGATIHT NGL  +LK+R
Sbjct  535  RRFDFELDESKHPDGECGMTTGATIHTTNGLHVRLKRR  572



>ref|XP_010241651.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Nelumbo nucifera]
Length=580

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 90/155 (58%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F  
Sbjct  416  PPVLIRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFVPERF--  466

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  467  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  510

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q FD DL    + + + TGATIHT NGL+ KL +R
Sbjct  511  QHFDFDLV-PDQKISMTTGATIHTTNGLYMKLSQR  544



>ref|XP_008462512.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Cucumis 
melo]
Length=558

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 92/155 (59%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+HRSP  W++  EF P  F  
Sbjct  417  PPVLIRRAQVADTLPGNYK-------VNAGQDIMISVYNIHRSPQVWEQAEEFIPERF--  467

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  468  ----DLEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  511

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L    +++ + TGATIHT NGL+ KL +R
Sbjct  512  QHLNFELVPN-QTIGMTTGATIHTTNGLYMKLSQR  545



>ref|NP_001234058.1| cytochrome P450-type monooxygenase 97C11 [Solanum lycopersicum]
 gb|ACJ25967.1| cytochrome P450-type monooxygenase 97C11 [Solanum lycopersicum]
 gb|ACJ25968.1| cytochrome P450-type monooxygenase 97C11 [Solanum lycopersicum]
Length=547

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 92/158 (58%), Gaps = 26/158 (16%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        +  G DI  SVYN+H S   WD+  EF+P  F  
Sbjct  409  PPVLIRRAQVADVLPGNYK-------VNVGQDIMISVYNIHHSSEVWDRAEEFDPERF--  459

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ IALA+ +
Sbjct  460  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATIALAIFV  503

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            Q F  +L    +++ + TGATIHT NGL+ K+K+R  V
Sbjct  504  QNFSFELIPD-QTISMTTGATIHTTNGLYMKVKQREKV  540



>ref|XP_006339097.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=551

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 92/158 (58%), Gaps = 26/158 (16%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   WD+  EF+P  F  
Sbjct  413  PPVLIRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSEVWDRAEEFDPERF--  463

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ I LA+ +
Sbjct  464  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATITLAIFV  507

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  274
            Q F  +L    +++ + TGATIHT NGL+ K+K+R  V
Sbjct  508  QNFSFELIPD-QTISMTTGATIHTTNGLYMKVKQREKV  544



>ref|XP_002958826.1| hypothetical protein VOLCADRAFT_100143 [Volvox carteri f. nagariensis]
 gb|EFJ40130.1| hypothetical protein VOLCADRAFT_100143 [Volvox carteri f. nagariensis]
Length=671

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 94/155 (61%), Gaps = 25/155 (16%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L+ D+         D   +PAG+D+  SV+NLHRSP  WD+P++F+P  F  
Sbjct  450  PPVLIRRALQEDKF--------DQYVVPAGSDLFISVWNLHRSPELWDEPDKFKPERF--  499

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P   P    PNE+  +F +LPFGGG RK +GDQFAL E+ +ALAML+
Sbjct  500  ------------GPLDGP---IPNEVTENFGYLPFGGGRRKCIGDQFALFEALVALAMLV  544

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            +++D  L  +   V + TGATIHT  GL+  +KKR
Sbjct  545  RRYDFVLDTSKPPVGMTTGATIHTTGGLYMHVKKR  579



>ref|XP_003058421.1| cytochrome P450 superfamily protein [Micromonas pusilla CCMP1545]
 gb|EEH56876.1| cytochrome P450 superfamily protein [Micromonas pusilla CCMP1545]
Length=702

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 92/158 (58%), Gaps = 29/158 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L P  L        DG  I AGTD   SV+NLHR+P  W+ P++F+P  F +
Sbjct  452  PPVLIRRALEPVTL--------DGYKIDAGTDFFISVWNLHRNPRLWENPDKFDPDRFPI  503

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             +                    PNEI  +FA+LPFGGG RK VGDQFAL ES I LAM+ 
Sbjct  504  DQK------------------MPNEITENFAYLPFGGGQRKCVGDQFALFESIITLAMVC  545

Query  387  QKFD--IDLKGTPE-SVKLVTGATIHTKNGLWCKLKKR  283
            ++FD  +D K  P+    + TGATIHT  GL  KLK+R
Sbjct  546  RRFDFELDAKFHPDGECGMTTGATIHTTGGLHVKLKRR  583



>gb|ABQ59243.1| CYP97C3 [Chlamydomonas reinhardtii]
Length=576

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 91/155 (59%), Gaps = 25/155 (16%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+L  D+LPGG+        +P G D+  SVYN+H SP  WD P  F P  F  
Sbjct  428  PPVLLRRALVEDELPGGFK-------VPVGQDVMISVYNIHHSPAVWDDPEAFIPERF--  478

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P   P    PNE  +DF ++PF GGPRK VGDQFALME+ +AL +LL
Sbjct  479  ------------GPLDGP---VPNEQNTDFRYIPFSGGPRKCVGDQFALMEAVVALTVLL  523

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            +++D  +    + + + TGATIHT NGL+  +K+R
Sbjct  524  RQYDFQMVPN-QQIGMTTGATIHTTNGLYMYVKER  557



>ref|XP_008807069.1| PREDICTED: LOW QUALITY PROTEIN: carotene epsilon-monooxygenase, 
chloroplastic [Phoenix dactylifera]
Length=552

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 92/156 (59%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+HRSP  WD+  EF P  F  
Sbjct  415  PPVLIRRAQVADILPGDYK-------VNAGQDIMISVYNIHRSPQVWDRAEEFLPERF--  465

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  466  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  509

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q  D+D +  P +++ + TGATIHT NGL+  L  R
Sbjct  510  Q--DMDFRLVPDQNITMTTGATIHTVNGLYMTLSPR  543



>ref|XP_010098846.1| Carotene epsilon-monooxygenase [Morus notabilis]
 gb|EXB75934.1| Carotene epsilon-monooxygenase [Morus notabilis]
Length=634

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 92/156 (59%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D+LPG Y        + AG DI  SVYN+HRS   W++  EF P  F  
Sbjct  415  PPVLIRRAQVADKLPGNYK-------VNAGQDIMISVYNIHRSSKVWERAEEFVPERF--  465

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+ES +ALA+ L
Sbjct  466  ----DMEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLESIVALAIFL  509

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q F  +L   P +++ + TGATIHT NGL+ KL  R
Sbjct  510  QHFTFEL--VPDQNIGMTTGATIHTTNGLYMKLSSR  543



>gb|AAK20054.1|AC025783_14 putative cytochrome P450 monooxygenase [Oryza sativa Japonica 
Group]
Length=584

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 93/152 (61%), Gaps = 26/152 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR++  D LPG Y        I AG DI  SVYN+HRSP  WD+ ++F P  F  
Sbjct  419  PPVLIRRAIVDDVLPGNYK-------IKAGQDIMISVYNIHRSPEVWDRADDFIPERF--  469

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +++ F+PF GGPRK VGDQFAL+E+ +ALA++L
Sbjct  470  ----DLEGPV------------PNETNTEYRFIPFSGGPRKCVGDQFALLEAIVALAVVL  513

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKL  292
            QK DI+L    + + + TGATIHT NGL+  +
Sbjct  514  QKMDIELV-PDQKINMTTGATIHTTNGLYMNV  544



>ref|XP_006391881.1| hypothetical protein EUTSA_v10023482mg [Eutrema salsugineum]
 gb|ESQ29167.1| hypothetical protein EUTSA_v10023482mg [Eutrema salsugineum]
Length=315

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 91/153 (59%), Gaps = 28/153 (18%)
 Frame = -2

Query  738  LIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQVXKX  559
            ++ R+  PD LPG Y        + +G DI  SVYN+HRS   W+K  EF P  F     
Sbjct  190  ILLRAQVPDILPGNYK-------VNSGQDIMISVYNVHRSSAVWEKAEEFLPERF-----  237

Query  558  XEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLLQKF  379
             E+EG              PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ LQ+ 
Sbjct  238  -ELEGA------------IPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRL  284

Query  378  DIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            +++L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  285  NVEL--VPDQTISMTTGATIHTTNGLYMKVSRR  315



>ref|XP_008658121.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Zea 
mays]
 gb|ADD14593.1| carotene epsilon-ring hydroxylase [Zea mays subsp. mays]
 gb|AFP28223.1| carotene epsilon-ring hydroxylase [synthetic construct]
Length=556

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 93/155 (60%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR++  D LPG Y        + AG DI  SVYN+HRSP  WD+ +EF P  F  
Sbjct  414  PPVLLRRAIVDDVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFIPERF--  464

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA++L
Sbjct  465  ----DLEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAVVL  508

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            QK D+ L    + + + TGATIHT +GL+  +  R
Sbjct  509  QKMDMQLV-PDQKINMTTGATIHTTSGLYMNVSLR  542



>ref|XP_006428525.1| hypothetical protein CICLE_v10011420mg [Citrus clementina]
 ref|XP_006491795.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR41765.1| hypothetical protein CICLE_v10011420mg [Citrus clementina]
Length=545

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F  
Sbjct  406  PPVLIRRAQVDDVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF--  456

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG         P    PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+LL
Sbjct  457  ----DLEG---------P---MPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILL  500

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L   P +++ + TGATIHT NGL+ KL++R
Sbjct  501  QNMNFEL--VPDQNINMTTGATIHTTNGLYMKLRQR  534



>gb|EEC67393.1| hypothetical protein OsI_34547 [Oryza sativa Indica Group]
Length=557

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 93/155 (60%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR++  D LPG Y        I AG DI  SVYN+HRS   WD+ ++F P  F  
Sbjct  415  PPVLIRRAIVDDVLPGNYK-------IKAGQDIMISVYNIHRSSEVWDRADDFIPERF--  465

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +++ F+PF GGPRK VGDQFAL+E+ +ALA++L
Sbjct  466  ----DLEGPV------------PNETNTEYRFIPFSGGPRKCVGDQFALLEAIVALAVVL  509

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            QK DI+L    + + + TGATIHT NGL+  +  R
Sbjct  510  QKMDIELV-PDQKINMTTGATIHTTNGLYMNVSLR  543



>ref|XP_011094564.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Sesamum 
indicum]
 ref|XP_011094565.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Sesamum 
indicum]
Length=542

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 91/155 (59%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+   D LPG Y        + AG DI  SVYN+H S   W++ +EF P  F  
Sbjct  403  PPVLLRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSAQVWERADEFVPERF--  453

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  SD+ F+PF GGPRK VGDQFAL+E+ +ALA+LL
Sbjct  454  ----DLEGPV------------PNETNSDYRFIPFSGGPRKCVGDQFALLEAIVALAVLL  497

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q    DL    +++ + TGATIHT NGL+ KL +R
Sbjct  498  QHLSFDLVPN-QNISMTTGATIHTTNGLYMKLTER  531



>gb|KDO54337.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=511

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F  
Sbjct  372  PPVLIRRAQVDDVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF--  422

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG         P    PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+LL
Sbjct  423  ----DLEG---------P---MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILL  466

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L   P +++ + TGATIHT NGL+ KL++R
Sbjct  467  QNMNFEL--VPDQNINMTTGATIHTTNGLYMKLRQR  500



>gb|KDO54335.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=545

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F  
Sbjct  406  PPVLIRRAQVDDVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF--  456

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG         P    PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+LL
Sbjct  457  ----DLEG---------P---MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILL  500

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L   P +++ + TGATIHT NGL+ KL++R
Sbjct  501  QNMNFEL--VPDQNINMTTGATIHTTNGLYMKLRQR  534



>gb|KDO54333.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=544

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F  
Sbjct  405  PPVLIRRAQVDDVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF--  455

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG         P    PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+LL
Sbjct  456  ----DLEG---------P---MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILL  499

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L   P +++ + TGATIHT NGL+ KL++R
Sbjct  500  QNMNFEL--VPDQNINMTTGATIHTTNGLYMKLRQR  533



>gb|KDO54334.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=561

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F  
Sbjct  422  PPVLIRRAQVDDVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF--  472

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG         P    PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+LL
Sbjct  473  ----DLEG---------P---MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILL  516

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L   P +++ + TGATIHT NGL+ KL++R
Sbjct  517  QNMNFEL--VPDQNINMTTGATIHTTNGLYMKLRQR  550



>ref|XP_009375781.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009375782.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Pyrus x bretschneideri]
Length=545

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 90/156 (58%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+HRS   W++  EF P  F  
Sbjct  405  PPVLIRRAQVADVLPGNYK-------VNAGQDIMISVYNIHRSSKVWERAEEFVPERF--  455

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +AL + +
Sbjct  456  ----DLEGSV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALTIFI  499

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L   P + + + TGATIHT NGL+ KL +R
Sbjct  500  QNLNFEL--VPDQKISMTTGATIHTTNGLYMKLSQR  533



>ref|XP_009382395.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=561

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 88/155 (57%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+HRSP  W+K  EF P  F  
Sbjct  419  PPVLIRRAQVDDVLPGDYK-------VNAGQDIMISVYNIHRSPQVWEKAEEFCPERFN-  470

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                 +EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  471  -----LEGP------------IPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  513

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L    + + + TGATIHT NGL+  L  R
Sbjct  514  QHMEFELVAD-QKISMTTGATIHTTNGLYMTLSPR  547



>ref|XP_009382394.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=563

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 88/155 (57%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+HRSP  W+K  EF P  F  
Sbjct  419  PPVLIRRAQVDDVLPGDYK-------VNAGQDIMISVYNIHRSPQVWEKAEEFCPERFN-  470

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                 +EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  471  -----LEGP------------IPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  513

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L    + + + TGATIHT NGL+  L  R
Sbjct  514  QHMEFELVAD-QKISMTTGATIHTTNGLYMTLSPR  547



>ref|XP_009382396.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=561

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 88/155 (57%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+HRSP  W+K  EF P  F  
Sbjct  419  PPVLIRRAQVDDVLPGDYK-------VNAGQDIMISVYNIHRSPQVWEKAEEFCPERFN-  470

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                 +EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  471  -----LEGP------------IPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  513

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L    + + + TGATIHT NGL+  L  R
Sbjct  514  QHMEFELVAD-QKISMTTGATIHTTNGLYMTLSPR  547



>ref|XP_006391882.1| hypothetical protein EUTSA_v10023482mg [Eutrema salsugineum]
 gb|ESQ29168.1| hypothetical protein EUTSA_v10023482mg [Eutrema salsugineum]
Length=422

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 91/153 (59%), Gaps = 28/153 (18%)
 Frame = -2

Query  738  LIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQVXKX  559
            ++ R+  PD LPG Y        + +G DI  SVYN+HRS   W+K  EF P  F     
Sbjct  297  ILLRAQVPDILPGNYK-------VNSGQDIMISVYNVHRSSAVWEKAEEFLPERF-----  344

Query  558  XEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLLQKF  379
             E+EG              PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ LQ+ 
Sbjct  345  -ELEGA------------IPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRL  391

Query  378  DIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            +++L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  392  NVEL--VPDQTISMTTGATIHTTNGLYMKVSRR  422



>ref|XP_007027524.1| Cytochrome P450 superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY08026.1| Cytochrome P450 superfamily protein isoform 2 [Theobroma cacao]
Length=369

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 89/155 (57%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F +
Sbjct  228  PPVLIRRAQVDDILPGNYK-------VKAGQDIMISVYNIHHSSQVWERAEEFVPERFDL  280

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                            SP    PNE  +D+ F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  281  ---------------ESP---VPNETNTDYRFIPFSGGPRKCVGDQFALLEAIVALAIFL  322

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ + +L    + + + TGATIHT NG++ KL +R
Sbjct  323  QRLNFEL-VPDQDISMTTGATIHTTNGMYMKLSER  356



>ref|XP_008392557.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Malus 
domestica]
Length=549

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 90/156 (58%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+HRS   W++  EF P  F  
Sbjct  405  PPVLIRRAQVADVLPGNYK-------VNAGQDIMISVYNIHRSSKVWERAEEFVPERF--  455

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +AL + +
Sbjct  456  ----DLEGSV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALTIFI  499

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L   P + + + TGATIHT NGL+ KL +R
Sbjct  500  QNLNFEL--VPDQKISMTTGATIHTTNGLYMKLSQR  533



>ref|XP_002467549.1| hypothetical protein SORBIDRAFT_01g030050 [Sorghum bicolor]
 gb|EER94547.1| hypothetical protein SORBIDRAFT_01g030050 [Sorghum bicolor]
Length=538

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 90/148 (61%), Gaps = 26/148 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR++  D LPG Y        + AG DI  SVYN+HRSP  WD+ +EF P  F  
Sbjct  413  PPVLLRRAIVDDVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFIPERF--  463

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +D+ F+PF GGPRK VGDQFAL+E+ +ALA++L
Sbjct  464  ----DLEGPV------------PNESNTDYRFIPFSGGPRKCVGDQFALLEAIVALAVVL  507

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGL  304
            QK DI L    + + + TGATIHT NG+
Sbjct  508  QKIDIQLVPD-QKINMTTGATIHTTNGI  534



>ref|XP_002955547.1| hypothetical protein VOLCADRAFT_83281 [Volvox carteri f. nagariensis]
 gb|EFJ43400.1| hypothetical protein VOLCADRAFT_83281 [Volvox carteri f. nagariensis]
Length=575

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 25/155 (16%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+L  D+LPGGY        +P G D+  SVYN+H S   WD P  F P  F  
Sbjct  429  PPVLLRRALVEDELPGGYK-------VPVGQDVMISVYNIHHSEAVWDNPEAFIPERF--  479

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P   P    P+E  +DF ++PF GGPRK VGDQFALME+ +ALA+LL
Sbjct  480  ------------GPLDGP---VPSEQNTDFRYIPFSGGPRKCVGDQFALMEAVVALAVLL  524

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            ++FD  L    + + + TGATIHT +GL+  +K+R
Sbjct  525  RQFDFSLVPN-QKIGMTTGATIHTTDGLYMYVKER  558



>ref|XP_004156328.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Cucumis sativus]
Length=512

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 91/155 (59%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+HRS   W++  EF P  F  
Sbjct  371  PPVLIRRAQVADILPGDYK-------VNAGQDIMISVYNIHRSSQVWEQAEEFIPERF--  421

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  422  ----DLEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  465

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L    +++ + TGATIHT NGL+ KL +R
Sbjct  466  QHMNFELVPN-QTIGMTTGATIHTTNGLYMKLSQR  499



>gb|KHG23674.1| Cytochrome P450, chloroplastic [Gossypium arboreum]
Length=510

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 90/157 (57%), Gaps = 28/157 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F +
Sbjct  372  PPVLIRRAQVDDVLPGDYK-------VKAGQDIMISVYNIHHSSQVWERAEEFVPERFDL  424

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                                  PNE  +D+ F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  425  ESS------------------VPNESNTDYRFIPFSGGPRKCVGDQFALLEAIVALAIFL  466

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKRL  280
            Q+ + +L   P +++ + TGATIHT NGL+ KL +R+
Sbjct  467  QRLNFEL--VPDQNISMTTGATIHTTNGLYMKLSQRM  501



>ref|XP_004143287.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48212.1| hypothetical protein Csa_6G448700 [Cucumis sativus]
Length=559

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 91/155 (59%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+HRS   W++  EF P  F  
Sbjct  418  PPVLIRRAQVADILPGDYK-------VNAGQDIMISVYNIHRSSQVWEQAEEFIPERF--  468

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  469  ----DLEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  512

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L    +++ + TGATIHT NGL+ KL +R
Sbjct  513  QHMNFELVPN-QTIGMTTGATIHTTNGLYMKLSQR  546



>ref|XP_002519427.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF42841.1| cytochrome P450, putative [Ricinus communis]
Length=552

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 90/156 (58%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+   D LPG Y        + AG DI  SVYN+H S   WD+  EF P  F  
Sbjct  412  PPVLLRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSKVWDRAEEFVPERF--  462

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  463  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  506

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L   P + + + TGATIHT NGL+ KL KR
Sbjct  507  QNMNFEL--VPDQKISMTTGATIHTTNGLYMKLGKR  540



>ref|XP_004516958.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=545

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 87/146 (60%), Gaps = 26/146 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L PD+LPG Y        + AG DI  SVYN+HRS   WD+  EF P  F  
Sbjct  407  PPVLIRRALVPDELPGAYK-------VNAGQDIMISVYNIHRSSEVWDRAEEFLPERF--  457

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                E++G              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  458  ----ELDGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAVFL  501

Query  387  QKFDIDLKGTPESVKLVTGATIHTKN  310
            Q  + +L    +++ + TGATIHT N
Sbjct  502  QNMNFELVPN-QNISMTTGATIHTTN  526



>ref|XP_010907646.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X4 [Elaeis guineensis]
Length=483

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 88/155 (57%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + A  DI  SVYN+HRSP  WD+  EF P  F  
Sbjct  346  PPVLIRRAQVADILPGDYK-------VNAAQDIMISVYNIHRSPQVWDRAEEFLPERF--  396

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  397  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  440

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  D  L    +++ + TGATIHT NGL+  L  R
Sbjct  441  QHMDFRLVPD-QNIAMTTGATIHTMNGLYMTLSPR  474



>ref|XP_003062894.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52833.1| predicted protein [Micromonas pusilla CCMP1545]
Length=529

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 97/168 (58%), Gaps = 16/168 (10%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR L    LP G  GD D   I  G D+  SV+NLHR P  W++P +F+P  F+ 
Sbjct  364  PPILIRRCLEDVPLPKG-AGDADVTLI-KGMDVFISVWNLHRHPDCWEEPLKFDPFRFKK  421

Query  567  -XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQ------------F  427
                  ++ WAG++P    G +YPNE+ SDFAF+PFG G RK +GDQ            F
Sbjct  422  PYSNPGVKDWAGYNPDLISG-MYPNEVTSDFAFVPFGAGARKCIGDQARSCLHWSPYDRF  480

Query  426  ALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            A++E+   LAM LQ++D +L      V +  GATIHT  GL  ++ +R
Sbjct  481  AMLEATSCLAMTLQRYDFELDKDAAEVGMEMGATIHTAGGLPMRVTRR  528



>gb|KJB46498.1| hypothetical protein B456_007G372200 [Gossypium raimondii]
Length=548

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 90/157 (57%), Gaps = 28/157 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F +
Sbjct  410  PPVLIRRAQVDDVLPGDYK-------VKAGQDIMISVYNIHHSSQVWERAEEFVPERFDL  462

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                                  PNE  +D+ F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  463  ESSV------------------PNESNTDYRFIPFSGGPRKCVGDQFALLEAIVALAIFL  504

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKRL  280
            Q+ + +L   P +++ + TGATIHT NGL+ KL +R+
Sbjct  505  QRLNFEL--VPDQNISMTTGATIHTTNGLYMKLSQRM  539



>ref|XP_010907645.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X3 [Elaeis guineensis]
Length=542

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 88/155 (57%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + A  DI  SVYN+HRSP  WD+  EF P  F  
Sbjct  405  PPVLIRRAQVADILPGDYK-------VNAAQDIMISVYNIHRSPQVWDRAEEFLPERF--  455

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  456  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  499

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  D  L    +++ + TGATIHT NGL+  L  R
Sbjct  500  QHMDFRLVPD-QNIAMTTGATIHTMNGLYMTLSPR  533



>ref|XP_010907643.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=549

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 88/155 (57%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + A  DI  SVYN+HRSP  WD+  EF P  F  
Sbjct  412  PPVLIRRAQVADILPGDYK-------VNAAQDIMISVYNIHRSPQVWDRAEEFLPERF--  462

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  463  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  506

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  D  L    +++ + TGATIHT NGL+  L  R
Sbjct  507  QHMDFRLVPD-QNIAMTTGATIHTMNGLYMTLSPR  540



>ref|XP_011468004.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Fragaria vesca subsp. vesca]
Length=445

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 90/155 (58%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        +  G DI  SVYN+HRS   W++  EF P  F  
Sbjct  306  PPVLIRRAQVADVLPGNYR-------VNPGQDIMISVYNIHRSSEVWERAEEFSPERF--  356

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ +
Sbjct  357  ----DMEG------------PIPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFI  400

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L    +++ + TGATIHT NGL+ KL +R
Sbjct  401  QHLNFELVPD-QNISMTTGATIHTTNGLYMKLSQR  434



>ref|XP_010546517.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=543

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 90/156 (58%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+  PD LPG Y        +  G DI  SVYN+HRS   W+  NEF P  F +
Sbjct  413  PPVLIRRAQFPDVLPGNYK-------VNTGQDIMISVYNIHRSSEVWESANEFVPERFDL  465

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                           + P    PNE  +DF F+PF GGPRK VGDQFALME+ +ALA+ L
Sbjct  466  ---------------QGP---IPNESNTDFKFIPFSGGPRKCVGDQFALMEAIVALAIFL  507

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ + +L   P +++ + TGATIHT NGL+  +  R
Sbjct  508  QRLNFEL--VPDQNIGMTTGATIHTTNGLYMTVSPR  541



>gb|EYU41579.1| hypothetical protein MIMGU_mgv1a004062mg [Erythranthe guttata]
Length=546

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 90/155 (58%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+   D LPG Y        +  G D+  SVYN+H S   WD+ +EF P  F  
Sbjct  407  PPVLLRRAQVADVLPGDYK-------VNPGQDVMISVYNVHHSAQVWDRADEFVPERF--  457

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  458  ----DLEGAV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAVFL  501

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + DL    +++ + TGATIHT NGL+ KL +R
Sbjct  502  QHLNFDLV-PDQNIGMTTGATIHTANGLYMKLSQR  535



>ref|XP_004306170.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Fragaria vesca subsp. vesca]
Length=544

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        +  G DI  SVYN+HRS   W++  EF P  F  
Sbjct  405  PPVLIRRAQVADVLPGNYR-------VNPGQDIMISVYNIHRSSEVWERAEEFSPERF--  455

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG         P    PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ +
Sbjct  456  ----DMEG---------P---IPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFI  499

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L    +++ + TGATIHT NGL+ KL +R
Sbjct  500  QHLNFELVPD-QNISMTTGATIHTTNGLYMKLSQR  533



>ref|XP_006381359.1| hypothetical protein POPTR_0006s12150g [Populus trichocarpa]
 gb|ERP59156.1| hypothetical protein POPTR_0006s12150g [Populus trichocarpa]
Length=545

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 91/156 (58%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F  
Sbjct  415  PPVLIRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSKVWERAEEFVPERF--  465

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                      G D         PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  466  ----------GLDGP------VPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  509

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            QK + +L   P +++++ TGATIHT +GL+ KL +R
Sbjct  510  QKINFEL--VPDQNIRMTTGATIHTTDGLYMKLSQR  543



>ref|XP_011018827.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Populus euphratica]
Length=544

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 91/156 (58%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F  
Sbjct  403  PPVLIRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSKVWERAEEFVPERF--  453

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                      G D         PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  454  ----------GLDGP------VPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  497

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            QK + +L   P +++++ TGATIHT +GL+ KL +R
Sbjct  498  QKINFEL--VPDQNIRMTTGATIHTTDGLYMKLSQR  531



>ref|XP_011018826.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Populus euphratica]
Length=548

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 90/155 (58%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F  
Sbjct  403  PPVLIRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSKVWERAEEFVPERF--  453

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                      G D         PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  454  ----------GLDGP------VPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFL  497

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            QK + +L    +++++ TGATIHT +GL+ KL +R
Sbjct  498  QKINFELV-PDQNIRMTTGATIHTTDGLYMKLSQR  531



>ref|XP_011396817.1| Cytochrome P450 97B3, chloroplastic [Auxenochlorella protothecoides]
 gb|AHA86563.1| cytochrome P450 like protein [Auxenochlorella protothecoides]
 gb|KFM23939.1| Cytochrome P450 97B3, chloroplastic [Auxenochlorella protothecoides]
Length=547

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 92/155 (59%), Gaps = 19/155 (12%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+L PD+LPG +   + G  +P G D+  SVYN+H SP  WD+P  F P  F  
Sbjct  410  PPVLLRRALVPDELPGTWLAGECGYKVPKGQDVMISVYNIHHSPAVWDEPEAFRPDRF--  467

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P  +P    P E  +D+ ++PF GGPRK VGDQFA+ME+  ALA++L
Sbjct  468  -------------PLDAPP---PTEQNTDYRYIPFSGGPRKCVGDQFAMMEAVSALAVVL  511

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            ++F    K   E V + TGATIHT+NGL+  +  R
Sbjct  512  RRFTFYPKPGHE-VGMTTGATIHTQNGLYMGVGLR  545



>ref|XP_007027523.1| Cytochrome P450 superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY08025.1| Cytochrome P450 superfamily protein isoform 1 [Theobroma cacao]
Length=550

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 90/156 (58%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F +
Sbjct  409  PPVLIRRAQVDDILPGNYK-------VKAGQDIMISVYNIHHSSQVWERAEEFVPERFDL  461

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                            SP    PNE  +D+ F+PF GGPRK VGDQFAL+E+ +ALA+ L
Sbjct  462  ---------------ESP---VPNETNTDYRFIPFSGGPRKCVGDQFALLEAIVALAIFL  503

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q+ + +L   P + + + TGATIHT NG++ KL +R
Sbjct  504  QRLNFEL--VPDQDISMTTGATIHTTNGMYMKLSER  537



>gb|AFQ31612.1| CYP97C [Haematococcus pluvialis]
Length=571

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 90/156 (58%), Gaps = 25/156 (16%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+   D LPGGY        +  G D+  SVYN+HRS   WD P  F P  F  
Sbjct  430  PPVLLRRAFAADTLPGGYK-------VVKGQDVMISVYNIHRSKAVWDSPEAFLPERF--  480

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P   P    P+E  +DF ++PF GGPRK VGDQFALME+ ++LA+LL
Sbjct  481  ------------GPLDGP---VPSEQNTDFRYIPFSGGPRKCVGDQFALMEAVVSLAVLL  525

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            ++FD+ L    +++ + TGATIHT NGL+   + R+
Sbjct  526  REFDLSLVPN-QTIGMTTGATIHTTNGLYMYARARI  560



>ref|XP_008241353.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Prunus 
mume]
Length=556

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 88/156 (56%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F +
Sbjct  414  PPVLIRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSEVWERAEEFLPERFDL  466

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                                  PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ +
Sbjct  467  ESS------------------VPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFI  508

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L   P +++ + TGATIHT NGL+ KL +R
Sbjct  509  QHLNFEL--VPDQNISMTTGATIHTTNGLFMKLSQR  542



>emb|CBI30186.3| unnamed protein product [Vitis vinifera]
 gb|AIO11761.1| cytochrome p450 [Croton stellatopilosus]
 emb|CDM63951.1| cytochrom p450 reductase [Croton stellatopilosus]
Length=471

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 91/156 (58%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  +F P  F  
Sbjct  331  PPVLIRRAKVADVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEDFLPERF--  381

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ +
Sbjct  382  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFV  425

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L   P +++ + TGATIHT NGL+ KL +R
Sbjct  426  QHMNFEL--VPDQNISMTTGATIHTTNGLYMKLTQR  459



>gb|AGT63110.1| plastid carotenoid epsilon-ring hydroxylase [Haematococcus pluvialis]
Length=571

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 90/156 (58%), Gaps = 25/156 (16%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+   D LPGGY        +  G D+  SVYN+HRS   WD P  F P  F  
Sbjct  430  PPVLLRRAFAADTLPGGYK-------VVKGQDVMISVYNIHRSKAVWDSPEAFLPERF--  480

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                         P   P    P+E  +DF ++PF GGPRK VGDQFALME+ ++LA+LL
Sbjct  481  ------------GPLDGP---VPSEQNTDFRYIPFSGGPRKCVGDQFALMEAVVSLAVLL  525

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            ++FD+ L    +++ + TGATIHT NGL+   + R+
Sbjct  526  REFDLSLVPN-QTIGMTTGATIHTTNGLYMYARARI  560



>ref|XP_007204192.1| hypothetical protein PRUPE_ppa003701mg [Prunus persica]
 gb|EMJ05391.1| hypothetical protein PRUPE_ppa003701mg [Prunus persica]
Length=555

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 90/156 (58%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F  
Sbjct  413  PPVLIRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSEVWERAEEFLPERF--  463

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +AL + +
Sbjct  464  ----DLEGSV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALVIFI  507

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L   P +++ + TGATIHT NGL+ KL +R
Sbjct  508  QHLNFEL--VPDQNISMTTGATIHTTNGLFMKLSQR  541



>gb|KCW89308.1| hypothetical protein EUGRSUZ_A01599 [Eucalyptus grandis]
Length=529

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 89/155 (57%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR++  D LPG Y  D        G DI  SVYN+H SP  W++  EF P  F  
Sbjct  389  PPVLIRRAMVSDVLPGNYKVDP-------GQDIMISVYNIHHSPQVWERAEEFVPERFY-  440

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                            + G L PNE  +DF F+PF GGPRK VGDQFA++ES +ALA+ L
Sbjct  441  ----------------TEGPL-PNETNTDFRFIPFSGGPRKCVGDQFAMLESIVALAVFL  483

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            ++ +  L    + + + TGATIHT NGL+ ++ +R
Sbjct  484  ERMNFVLVPD-QKISMTTGATIHTTNGLYMRVSRR  517



>ref|XP_006491796.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=498

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 92/154 (60%), Gaps = 28/154 (18%)
 Frame = -2

Query  741  LLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQVXK  562
            +LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F    
Sbjct  361  VLIRRAQVDDVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF----  409

Query  561  XXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLLQK  382
              ++EG         P    PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+LLQ 
Sbjct  410  --DLEG---------P---MPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQN  455

Query  381  FDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
             + +L   P +++ + TGATIHT NGL+ KL++R
Sbjct  456  MNFEL--VPDQNINMTTGATIHTTNGLYMKLRQR  487



>gb|EPS64627.1| hypothetical protein M569_10150 [Genlisea aurea]
Length=624

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 87/156 (56%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+   D LPG Y        +  G DI  SVYN+HRS   WD+  EF P  F V
Sbjct  394  PPVLLRRARVADTLPGNYK-------VEPGQDIMISVYNIHRSSQVWDRAEEFVPDRFDV  446

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                                  PNE  +DF F+PF GGPRK VGDQFAL+E+ + LA++L
Sbjct  447  ------------------AGPVPNETNTDFKFIPFSGGPRKCVGDQFALLEATVGLAVVL  488

Query  387  QKFDIDLKGTPES-VKLVTGATIHTKNGLWCKLKKR  283
            Q+ D +L   P+  + + TGATIHT NGL+ K+  R
Sbjct  489  QRLDFEL--VPDQIIGMTTGATIHTTNGLFMKVSPR  522



>ref|XP_010050328.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Eucalyptus 
grandis]
Length=559

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 89/155 (57%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR++  D LPG Y  D        G DI  SVYN+H SP  W++  EF P  F  
Sbjct  419  PPVLIRRAMVSDVLPGNYKVDP-------GQDIMISVYNIHHSPQVWERAEEFVPERFY-  470

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                            + G L PNE  +DF F+PF GGPRK VGDQFA++ES +ALA+ L
Sbjct  471  ----------------TEGPL-PNETNTDFRFIPFSGGPRKCVGDQFAMLESIVALAVFL  513

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            ++ +  L    + + + TGATIHT NGL+ ++ +R
Sbjct  514  ERMNFVLVPD-QKISMTTGATIHTTNGLYMRVSRR  547



>ref|XP_002503315.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64573.1| predicted protein [Micromonas sp. RCC299]
Length=693

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 89/158 (56%), Gaps = 29/158 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+L P  L        DG  I  GTD   SV+NLHR+P  W +P++F P  F +
Sbjct  453  PPVLIRRALEPVTL--------DGYKIETGTDFFISVWNLHRNPRLWPEPDKFIPERFPL  504

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
             +                    PNE+  +FA+LPFGGG RK VGDQFAL ES I LAM+ 
Sbjct  505  DQK------------------MPNEVTENFAYLPFGGGQRKCVGDQFALFESIITLAMVC  546

Query  387  QKFDIDLKGT--PE-SVKLVTGATIHTKNGLWCKLKKR  283
            ++FDIDL     P+    + TGATIHT  GL  KL +R
Sbjct  547  RRFDIDLDPAFHPDGECGMTTGATIHTTGGLHVKLTRR  584



>gb|ABC59096.1| cytochrome P450 monooxygenase CYP97C10 [Medicago truncatula]
Length=563

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 87/156 (56%), Gaps = 26/156 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRRS  PD+LPG Y        I AG DI  SVYN+H S   WD+  EF       
Sbjct  411  PPVLIRRSQIPDELPGDYK-------IDAGQDIMISVYNIHHSSKVWDRAEEF-------  456

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                       F          PNE  +DF F+PF GGPRK VGDQFAL+E+ +A A+ L
Sbjct  457  -----------FARKICLDGPVPNETNTDFRFIPFRGGPRKGVGDQFALLEATVAFAVFL  505

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            Q  + +L    +++ + TGATIHT NGL+ K+ +RL
Sbjct  506  QHMNFEL-VPDQNIGMTTGATIHTTNGLYMKMSQRL  540



>gb|KDO54336.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=498

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 92/154 (60%), Gaps = 28/154 (18%)
 Frame = -2

Query  741  LLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQVXK  562
            +LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  EF P  F    
Sbjct  361  VLIRRAQVDDVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF----  409

Query  561  XXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLLQK  382
              ++EG         P    PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+LLQ 
Sbjct  410  --DLEG---------P---MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQN  455

Query  381  FDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
             + +L   P +++ + TGATIHT NGL+ KL++R
Sbjct  456  MNFEL--VPDQNINMTTGATIHTTNGLYMKLRQR  487



>ref|XP_002991812.1| hypothetical protein SELMODRAFT_186370 [Selaginella moellendorffii]
 gb|EFJ07074.1| hypothetical protein SELMODRAFT_186370 [Selaginella moellendorffii]
Length=525

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 90/156 (58%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPGGY  ++       G ++  SVYN+H SP  W++  +F P  F  
Sbjct  397  PPVLIRRAQEQDTLPGGYKLER-------GQNVMISVYNIHHSPALWERAEDFVPERF--  447

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                             P    PNE  +DF ++PF GG RK VGDQFA++E+ + LAMLL
Sbjct  448  ----------------DPDGPIPNESNTDFRYIPFSGGARKCVGDQFAMLEALVTLAMLL  491

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q+F+++L   P + + + TGATIHT  GL+  +K+R
Sbjct  492  QRFELEL--VPGQDIGMTTGATIHTTKGLFMTVKRR  525



>ref|XP_002992972.1| hypothetical protein SELMODRAFT_187123 [Selaginella moellendorffii]
 gb|EFJ05918.1| hypothetical protein SELMODRAFT_187123 [Selaginella moellendorffii]
Length=525

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 90/156 (58%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPGGY  ++       G ++  SVYN+H SP  W++  +F P  F  
Sbjct  397  PPVLIRRAQEQDTLPGGYKLER-------GQNVMISVYNIHHSPALWERAEDFVPERF--  447

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                             P    PNE  +DF ++PF GG RK VGDQFA++E+ + LAMLL
Sbjct  448  ----------------DPDGPIPNESNTDFRYIPFSGGARKCVGDQFAMLEALVTLAMLL  491

Query  387  QKFDIDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  283
            Q+F+++L   P + + + TGATIHT  GL+  +K+R
Sbjct  492  QRFELEL--VPGQDIGMTTGATIHTTKGLFMTVKRR  525



>emb|CAN65775.1| hypothetical protein VITISV_030413 [Vitis vinifera]
Length=521

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 90/155 (58%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  +F P  F  
Sbjct  381  PPVLIRRAKVADVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEDFLPERF--  431

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ +
Sbjct  432  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFV  475

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L    +++ + TGATIHT NGL+ KL +R
Sbjct  476  QHMNFELV-PDQNISMTTGATIHTTNGLYMKLTQR  509



>ref|XP_002265015.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Vitis 
vinifera]
Length=546

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 90/155 (58%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        + AG DI  SVYN+H S   W++  +F P  F  
Sbjct  406  PPVLIRRAKVADVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEDFLPERF--  456

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ +ALA+ +
Sbjct  457  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFV  500

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L    +++ + TGATIHT NGL+ KL +R
Sbjct  501  QHMNFELVPD-QNISMTTGATIHTTNGLYMKLTQR  534



>ref|XP_006833028.1| hypothetical protein AMTR_s00094p00105890 [Amborella trichopoda]
 gb|ERM98306.1| hypothetical protein AMTR_s00094p00105890 [Amborella trichopoda]
Length=80

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  495  EIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHT  316
            +IISDFAFLPFGGGPRK +GDQFALMES IALA+LL +FD +L+  PE ++ VT ATIHT
Sbjct  3    QIISDFAFLPFGGGPRKCLGDQFALMESTIALALLLHRFDAELRYPPEYMEAVTEATIHT  62

Query  315  KNGLWCKLKKR  283
            K+GLWCKL+KR
Sbjct  63   KDGLWCKLRKR  73



>ref|XP_010683980.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010683981.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010683982.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=543

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 88/155 (57%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+   D LPG Y        +  G DI  SVYN+H S   W++  EF P  F +
Sbjct  407  PPVLLRRAQIADTLPGDYK-------VNPGQDIMISVYNIHHSSQVWERAEEFIPERFDL  459

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                            SP    PNE  +D+ ++PF GGPRK VGDQFAL+E+ +ALA+LL
Sbjct  460  ---------------ESP---VPNESNTDYRYIPFSGGPRKCVGDQFALLEAIVALAILL  501

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  D +L    + + + TGATIHT NGL+ KL +R
Sbjct  502  QNMDFELVPD-QDITMTTGATIHTTNGLYMKLSER  535



>ref|XP_005761340.1| hypothetical protein EMIHUDRAFT_471046 [Emiliania huxleyi CCMP1516]
 gb|EOD08911.1| hypothetical protein EMIHUDRAFT_471046 [Emiliania huxleyi CCMP1516]
Length=211

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 100/175 (57%), Gaps = 28/175 (16%)
 Frame = -2

Query  720  RPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-QVXKXXEIEG  544
            + DQ P G  G + G A+    D+  S YN+ RSP  W++P+ F+P  + +      ++G
Sbjct  6    KADQWPEGGTGVEGGFALARANDLFISTYNMGRSPQLWEEPDVFDPQRWDRPFDNPNVKG  65

Query  543  WAGFDPSRSPGA--LYPN--------EIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
            WAG+DP++  G   + P         EI SD A +PFG G RK VGDQFAL+E+A+++ M
Sbjct  66   WAGYDPAKRTGTGKMKPEGGLWVANLEIASDHAMIPFGAGERKCVGDQFALLEAAVSVVM  125

Query  393  LLQKFDIDLK-------------GTPE----SVKLVTGATIHTKNGLWCKLKKRL  280
            LL++F+ DL+               P+    +V +V+ ATIHT  GL+C++K+R 
Sbjct  126  LLRRFEFDLEMPDGPVNPAKLDPDNPDKSIGTVGMVSAATIHTATGLFCRVKERF  180



>gb|AJB84623.1| carotene epsilon-monooxygenase [Camellia sinensis]
Length=557

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 89/155 (57%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+   D LPG Y        +  G DI  SVYN+H SP  WD+   F P  F +
Sbjct  415  PPVLLRRAQVADVLPGNYK-------VNPGQDIMISVYNIHHSPQVWDRAEVFVPERFDL  467

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                              G + PNE  +DF F+PF GGPRK +GDQFAL+E+ +ALA+ +
Sbjct  468  D-----------------GPM-PNETNTDFRFIPFSGGPRKCIGDQFALLEAIVALAIFV  509

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  D +L    +++ + TGATIHT+NGL+ K+ +R
Sbjct  510  QHMDFELVPD-QNISMTTGATIHTENGLYMKVSQR  543



>gb|ABB52076.1| putative epsilon-ring carotene hydroxylase [Daucus carota subsp. 
sativus]
Length=548

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 89/156 (57%), Gaps = 28/156 (18%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D+LPG Y        +  G DI  SVYN+H S   WD+  EF P  F  
Sbjct  408  PPVLIRRAEVADELPGSYK-------VNPGQDIMISVYNIHHSSKVWDRAEEFIPERF--  458

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                +++G              PNE  +D+ F+PF GGPRK VGDQFAL+E+ ++LA+ L
Sbjct  459  ----DLDGPV------------PNESNTDYRFIPFSGGPRKCVGDQFALLEAIVSLAIFL  502

Query  387  QKFDIDLKGTPESV-KLVTGATIHTKNGLWCKLKKR  283
            Q    +L   P+ V  + TGATIHT NGL+ K+ KR
Sbjct  503  QHLSFEL--IPDQVINMTTGATIHTTNGLYMKVSKR  536



>gb|KDP29211.1| hypothetical protein JCGZ_16600 [Jatropha curcas]
Length=573

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 88/155 (57%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+   D LPG Y        +  G DI  SVYN+H S   W++  EF P  F  
Sbjct  409  PPVLLRRAQVADVLPGNYK-------VNPGQDIMISVYNIHHSSKVWERAEEFVPERF--  459

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                ++EG              PNE  +DF F+PF GGPRK VGDQFAL+E+ ++LA+ L
Sbjct  460  ----DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVSLAIFL  503

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q  + +L    + + + TGATIHT NGL+ KL +R
Sbjct  504  QNMNFELVPD-QKINMTTGATIHTTNGLYMKLSQR  537



>gb|AJD25228.1| cytochrome P450 CYP97C28 [Salvia miltiorrhiza]
Length=542

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 90/155 (58%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+L+RR+   D LPG Y        +  G DI  SVYN+HRS   W++ ++F P  F +
Sbjct  403  PPVLLRRAQVDDLLPGNYK-------VSPGQDIMISVYNIHRSAEVWERADDFVPERFDL  455

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                            SP    PNE  +D+ ++PF GGPRK VGDQFAL+E+ +ALA+LL
Sbjct  456  D---------------SP---VPNEANTDYRYIPFSGGPRKCVGDQFALLEAIVALAVLL  497

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q    +L    +++ + TGATIHT NGL+ KL +R
Sbjct  498  QHASFELIPD-QTIGMTTGATIHTTNGLYMKLSQR  531



>gb|ADK60778.1| putative mitochondrial cytochrome P450 monooxygenase [Arachis 
diogoi]
Length=197

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 87/156 (56%), Gaps = 26/156 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRRSL  D L G Y        I  G DI  SV+NLHRSP  WD  ++F+P     
Sbjct  33   PPVLIRRSLENDML-GEY-------TIKRGEDIFISVWNLHRSPNLWDDADKFQP-----  79

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                  E W    P+       PNE   +F +LPFGGGPRK VGD FA  E+ +ALAML+
Sbjct  80   ------ERWPVDGPN-------PNETNQNFKYLPFGGGPRKCVGDLFASYETIVALAMLV  126

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            ++F+  +      V++ TGATIHT  GL   + +R+
Sbjct  127  RRFNFQVAVGAPPVEMTTGATIHTTQGLKMTVTRRI  162



>ref|XP_005779653.1| hypothetical protein EMIHUDRAFT_463287 [Emiliania huxleyi CCMP1516]
 gb|EOD27224.1| hypothetical protein EMIHUDRAFT_463287 [Emiliania huxleyi CCMP1516]
Length=617

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 101/175 (58%), Gaps = 28/175 (16%)
 Frame = -2

Query  720  RPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXF-QVXKXXEIEG  544
            + DQ P G  G + G A+    D+  S YN+ RSP  W++P+ F+P  + +     +++G
Sbjct  412  KADQWPEGGTGVEGGFALARANDLFISTYNMGRSPQLWEEPDVFDPQRWDRPFDNPDVKG  471

Query  543  WAGFDPSRSPGA--LYPN--------EIISDFAFLPFGGGPRKXVGDQFALMESAIALAM  394
            WAG+DP++  G   + P         EI SD A +PFG G RK VGDQFAL+E+A+++ M
Sbjct  472  WAGYDPAKRTGTGKMKPEGGLWVANLEIASDHAMIPFGAGERKCVGDQFALLEAAVSVVM  531

Query  393  LLQKFDIDL----------KGTPE-------SVKLVTGATIHTKNGLWCKLKKRL  280
            LL++F+ DL          K  P+       +V +V+ ATIHT  GL+C++K+R 
Sbjct  532  LLRRFEFDLEMPDGPVNPAKLDPDNPDKSIGTVGMVSAATIHTATGLFCRVKERF  586



>ref|XP_002971637.1| hypothetical protein SELMODRAFT_231778 [Selaginella moellendorffii]
 gb|EFJ27386.1| hypothetical protein SELMODRAFT_231778 [Selaginella moellendorffii]
Length=399

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 85/156 (54%), Gaps = 26/156 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRRSL+ D L G          +  G DI  S++NLHRSP  W+  +EF P     
Sbjct  257  PPVLIRRSLQDDVLAG--------YPLKRGEDIFISLWNLHRSPSLWEHSHEFRP-----  303

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                  E W    P   P    PNE+  +F +LPFGGGPRK VGD FA  E+  A+AML+
Sbjct  304  ------ERW----PLDGPD---PNEVTENFKYLPFGGGPRKCVGDMFATFETVTAVAMLV  350

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            ++FD  L      V + TGATIHT  GL   + KR+
Sbjct  351  RRFDFKLAQGAPPVGMTTGATIHTTAGLHVAVTKRI  386



>ref|XP_006833025.1| hypothetical protein AMTR_s00094p00091950 [Amborella trichopoda]
 gb|ERM98303.1| hypothetical protein AMTR_s00094p00091950 [Amborella trichopoda]
Length=89

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  507  LYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGA  328
            L+ ++I+ DFAFLPFGG PRK VGDQFALMES +ALAMLL+KF+++L+  P  V+LV GA
Sbjct  3    LHGHQIVVDFAFLPFGGEPRKCVGDQFALMESTVALAMLLRKFNVELRDPPGQVELVMGA  62

Query  327  TIHTKNGLWCKLK  289
            TIHTK GLWC LK
Sbjct  63   TIHTKAGLWCNLK  75



>gb|ABD97103.1| cytochrome P450 monooxygenase CYP97C10 [Glycine max]
Length=425

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 87/156 (56%), Gaps = 26/156 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRRSL  D L G Y        I  G DI  SV+NLHRSP  WD  ++F+P     
Sbjct  256  PPVLIRRSLEDDVL-GEY-------PIKRGEDIFISVWNLHRSPKLWDDADKFKP-----  302

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                  E WA   PS       PNE   +F +LPFGGGPRK VGD FA  E+ +ALAML+
Sbjct  303  ------ERWALDGPS-------PNETNQNFKYLPFGGGPRKCVGDLFASYETVVALAMLM  349

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            ++F+  +      V++ TGATIHT  GL   +  R+
Sbjct  350  RRFNFQIAVGAPPVEMTTGATIHTTQGLKMTVTHRI  385



>ref|XP_010674674.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=628

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 87/155 (56%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRRS+  D L G Y        I  G DI  S++NLHRSP  W+  ++F P     
Sbjct  461  PPVLIRRSIEEDTL-GPY-------PIRKGEDIFISIWNLHRSPSLWEDADKFNP-----  507

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                  E W    P   P    PNE    F +LPFGGG RK +GD FA  E+ +ALAML+
Sbjct  508  ------ERW----PLDGPA---PNETNQSFRYLPFGGGQRKCIGDMFASYENVVALAMLV  554

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q+FD +L      VK+ TGATIHT NGL  K+++R
Sbjct  555  QRFDFELDPEAPPVKMTTGATIHTTNGLMMKVRQR  589



>gb|AJD25226.1| cytochrome P450 CYP97A41 [Salvia miltiorrhiza]
Length=612

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 89/155 (57%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRRSL  D L G Y        I  G DI  SV+NLHRSP+ W++ ++F P     
Sbjct  448  PPVLIRRSLGDDIL-GKY-------PIKKGEDIFISVWNLHRSPHHWEEADKFNP-----  494

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                  E W    P   P    PNE   +F++LPFGGGPRK +GD FA  E+ +A+AML+
Sbjct  495  ------ERW----PLDGPN---PNETNQNFSYLPFGGGPRKCIGDMFATFETVVAVAMLV  541

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            ++FD  L  +   VK+ TGATIHT  GL   + +R
Sbjct  542  RRFDFQLAISAPPVKMTTGATIHTTEGLKMTVTRR  576



>ref|XP_002965693.1| hypothetical protein SELMODRAFT_407294 [Selaginella moellendorffii]
 gb|EFJ33113.1| hypothetical protein SELMODRAFT_407294 [Selaginella moellendorffii]
Length=553

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 85/156 (54%), Gaps = 26/156 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRRSL+ D L G          +  G DI  S++NLHRSP  W+  +EF P     
Sbjct  411  PPVLIRRSLQDDVLAG--------YPLKRGEDIFISLWNLHRSPSLWEHSHEFRP-----  457

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                  E W    P   P    PNE+  +F +LPFGGGPRK VGD FA  E+  A+AML+
Sbjct  458  ------ERW----PLDGPD---PNEVTENFKYLPFGGGPRKCVGDMFATFETVTAVAMLV  504

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  280
            ++FD  L      V + TGATIHT  GL   + KR+
Sbjct  505  RRFDFKLAQGAPPVGMTTGATIHTTAGLHVAVTKRI  540



>gb|ACU20919.1| unknown [Glycine max]
Length=105

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 74/121 (61%), Gaps = 19/121 (16%)
 Frame = -2

Query  642  SVYNLHRSPYFWDKPNEFEPXXFQVXKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPF  463
            SVYN+HRS   WD+  EF P  F      +++G              PNE  +DF F+PF
Sbjct  3    SVYNIHRSSEVWDRAEEFAPERF------DLDGPV------------PNETNTDFRFIPF  44

Query  462  GGGPRKXVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
             GGPRK VGDQFALME+ +ALA+ LQ  + +L    ++V + TGATIHT NGL+ KL +R
Sbjct  45   SGGPRKCVGDQFALMEAIVALAIFLQHMNFELV-PDQNVSMTTGATIHTTNGLYMKLSRR  103

Query  282  L  280
            L
Sbjct  104  L  104



>ref|XP_006829190.1| hypothetical protein AMTR_s00001p00271310 [Amborella trichopoda]
 gb|ERM96606.1| hypothetical protein AMTR_s00001p00271310 [Amborella trichopoda]
Length=541

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 82/155 (53%), Gaps = 26/155 (17%)
 Frame = -2

Query  747  PPLLIRRSLRPDQLPGGYNGDKDGXAIPAGTDIXXSVYNLHRSPYFWDKPNEFEPXXFQV  568
            PP+LIRR+   D LPG Y        I AG DI  SVYN+H S   WD   EF P  F +
Sbjct  413  PPVLIRRAQEDDVLPGNYK-------INAGQDIMISVYNIHHSAKVWDIAEEFFPERFNL  465

Query  567  XKXXEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKXVGDQFALMESAIALAMLL  388
                               A  PNE  +DF F+PF GGPRK VGDQFA++E+ + L +LL
Sbjct  466  ------------------DAPLPNESNTDFRFIPFSGGPRKCVGDQFAMLEAIVTLTVLL  507

Query  387  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  283
            Q    +L    + + + TGATIHT  GL+  L +R
Sbjct  508  QNLTFELVPN-QDIGMTTGATIHTTKGLYMILSQR  541



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630