BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF040N06

Length=744
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011091473.1|  PREDICTED: actin-11                                198   1e-82   Sesamum indicum [beniseed]
gb|EPS60057.1|  hypothetical protein M569_14747                         200   1e-82   Genlisea aurea
gb|ADL59374.2|  actin 4                                                 200   1e-82   Ipomoea nil [qian niu]
ref|XP_007016434.1|  Actin 3 isoform 3                                  201   2e-82   
gb|AFP43696.1|  actin4                                                  199   2e-82   Eriobotrya japonica [loquat]
dbj|BAL14664.1|  actin                                                  200   2e-82   Chrysanthemum seticuspe f. boreale
ref|XP_008382817.1|  PREDICTED: actin                                   199   2e-82   Malus domestica [apple tree]
ref|XP_010553283.1|  PREDICTED: actin                                   200   2e-82   Tarenaya hassleriana [spider flower]
ref|XP_010534357.1|  PREDICTED: actin-1-like                            200   2e-82   Tarenaya hassleriana [spider flower]
gb|KDO70920.1|  hypothetical protein CISIN_1g017089mg                   199   3e-82   Citrus sinensis [apfelsine]
gb|AFD62266.1|  actin                                                   201   3e-82   Persea americana
ref|XP_007016432.1|  Actin-11 isoform 1                                 200   4e-82   Theobroma cacao [chocolate]
ref|XP_010524532.1|  PREDICTED: actin-1-like                            200   4e-82   Tarenaya hassleriana [spider flower]
gb|ABK96176.1|  unknown                                                 200   5e-82   Populus trichocarpa [western balsam poplar]
ref|XP_009397437.1|  PREDICTED: actin-like                              199   5e-82   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB76650.1|  hypothetical protein B456_012G100700                    199   5e-82   Gossypium raimondii
gb|ADK20401.1|  actin                                                   199   5e-82   Citrus maxima [buntan]
ref|XP_004142758.1|  PREDICTED: actin-1-like                            198   5e-82   
ref|XP_008354115.1|  PREDICTED: actin-1                                 199   5e-82   
ref|XP_010528400.1|  PREDICTED: actin-1                                 200   5e-82   Tarenaya hassleriana [spider flower]
ref|XP_010111359.1|  hypothetical protein L484_028016                   199   5e-82   Morus notabilis
ref|XP_010106464.1|  hypothetical protein L484_025221                   199   5e-82   Morus notabilis
ref|XP_003560589.1|  PREDICTED: actin-1                                 200   5e-82   Brachypodium distachyon [annual false brome]
ref|XP_004156708.1|  PREDICTED: actin-97-like                           198   5e-82   
ref|XP_010520033.1|  PREDICTED: actin-1-like                            200   5e-82   Tarenaya hassleriana [spider flower]
ref|XP_006429882.1|  hypothetical protein CICLE_v10011974mg             199   5e-82   Citrus clementina [clementine]
gb|AFP43694.1|  actin 2                                                 199   5e-82   Eriobotrya japonica [loquat]
ref|XP_007028993.1|  Actin-11                                           199   5e-82   
ref|XP_007027035.1|  Actin 3                                            200   5e-82   Theobroma cacao [chocolate]
dbj|BAK06400.1|  predicted protein                                      200   6e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007204362.1|  hypothetical protein PRUPE_ppa007228mg             199   6e-82   Prunus persica
ref|XP_003575839.1|  PREDICTED: actin-1-like                            200   6e-82   Brachypodium distachyon [annual false brome]
ref|XP_008355144.1|  PREDICTED: actin                                   199   6e-82   Malus domestica [apple tree]
gb|ADY38689.1|  actin                                                   199   6e-82   Camellia sinensis [black tea]
gb|ACJ84552.1|  unknown                                                 200   6e-82   Medicago truncatula
ref|XP_004304361.1|  PREDICTED: actin-like                              199   6e-82   Fragaria vesca subsp. vesca
ref|XP_009341422.1|  PREDICTED: actin-like                              199   6e-82   Pyrus x bretschneideri [bai li]
ref|XP_004136568.1|  PREDICTED: actin-like                              199   6e-82   Cucumis sativus [cucumbers]
ref|XP_006379593.1|  actin family protein                               197   6e-82   Populus trichocarpa [western balsam poplar]
ref|XP_010554872.1|  PREDICTED: actin-1                                 200   6e-82   Tarenaya hassleriana [spider flower]
ref|XP_008385127.1|  PREDICTED: actin                                   199   6e-82   Malus domestica [apple tree]
ref|XP_006350765.1|  PREDICTED: actin-like                              201   7e-82   Solanum tuberosum [potatoes]
ref|XP_004142070.1|  PREDICTED: actin-like                              199   7e-82   
gb|AGZ90152.1|  actin 11                                                199   7e-82   Litsea cubeba [may chang]
gb|AFN53639.1|  putative actin-97 protein                               199   7e-82   Linum usitatissimum
gb|EYU33199.1|  hypothetical protein MIMGU_mgv1a008335mg                198   7e-82   Erythranthe guttata [common monkey flower]
ref|XP_008241048.1|  PREDICTED: actin                                   199   7e-82   Prunus mume [ume]
ref|XP_002530711.1|  actin, putative                                    199   7e-82   Ricinus communis
ref|XP_010557948.1|  PREDICTED: actin-1-like                            200   7e-82   Tarenaya hassleriana [spider flower]
ref|XP_006435988.1|  hypothetical protein CICLE_v10031847mg             197   7e-82   Citrus clementina [clementine]
ref|XP_002530851.1|  actin, putative                                    197   8e-82   
dbj|BAI39620.1|  beta actin                                             197   8e-82   Bruguiera gymnorhiza [Burma mangrove]
gb|KDO67622.1|  hypothetical protein CISIN_1g017081mg                   197   8e-82   Citrus sinensis [apfelsine]
ref|XP_011080749.1|  PREDICTED: actin-1-like                            197   8e-82   Sesamum indicum [beniseed]
emb|CDP00088.1|  unnamed protein product                                198   9e-82   Coffea canephora [robusta coffee]
gb|AFK40690.1|  unknown                                                 199   9e-82   Lotus japonicus
ref|XP_010685773.1|  PREDICTED: actin-66                                200   1e-81   Beta vulgaris subsp. vulgaris [field beet]
gb|AHA91827.1|  actin-4                                                 199   1e-81   Rosa hybrid cultivar
gb|EPS69960.1|  actin-97                                                200   1e-81   Genlisea aurea
ref|XP_004236747.1|  PREDICTED: actin-97                                200   1e-81   
gb|KHG29811.1|  Actin                                                   200   1e-81   Gossypium arboreum [tree cotton]
ref|XP_002283590.1|  PREDICTED: actin-1                                 200   1e-81   Vitis vinifera
gb|KGN50545.1|  hypothetical protein Csa_5G182010                       199   1e-81   Cucumis sativus [cucumbers]
ref|XP_010682856.1|  PREDICTED: actin-11                                200   1e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001275087.1|  actin-like                                         200   1e-81   Solanum tuberosum [potatoes]
sp|P30171.1|ACT11_SOLTU  RecName: Full=Actin-97                         200   1e-81   Solanum tuberosum [potatoes]
gb|EMT21476.1|  Actin-1                                                 199   1e-81   
gb|KEH24717.1|  actin-97                                                199   1e-81   Medicago truncatula
gb|AEF58501.1|  actin                                                   199   1e-81   Platycodon grandiflorus [balloon-flower]
gb|KHG15514.1|  Actin                                                   201   1e-81   Gossypium arboreum [tree cotton]
ref|XP_008345452.1|  PREDICTED: actin                                   199   1e-81   
gb|KHG29096.1|  Actin                                                   200   1e-81   Gossypium arboreum [tree cotton]
dbj|BAJ85474.1|  predicted protein                                      200   1e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009625006.1|  PREDICTED: actin-like                              199   1e-81   Nicotiana tomentosiformis
ref|XP_009353688.1|  PREDICTED: actin                                   198   1e-81   Pyrus x bretschneideri [bai li]
ref|XP_004489182.1|  PREDICTED: actin-like                              199   1e-81   Cicer arietinum [garbanzo]
ref|XP_010036489.1|  PREDICTED: actin                                   199   1e-81   Eucalyptus grandis [rose gum]
ref|XP_002308365.1|  actin family protein                               199   1e-81   Populus trichocarpa [western balsam poplar]
ref|XP_006424815.1|  hypothetical protein CICLE_v10028665mg             199   1e-81   
ref|XP_010265918.1|  PREDICTED: actin                                   199   1e-81   Nelumbo nucifera [Indian lotus]
ref|XP_004302738.1|  PREDICTED: actin                                   199   1e-81   Fragaria vesca subsp. vesca
ref|NP_001051086.1|  Os03g0718100                                       200   1e-81   
ref|XP_006595018.1|  PREDICTED: actin-like isoform X1                   199   1e-81   Glycine max [soybeans]
ref|XP_008363858.1|  PREDICTED: LOW QUALITY PROTEIN: actin-like         199   1e-81   Malus domestica [apple tree]
gb|AEO45960.1|  actin 4                                                 199   1e-81   Mangifera indica
sp|O81221.1|ACT_GOSHI  RecName: Full=Actin                              200   2e-81   Gossypium hirsutum [American cotton]
ref|XP_007205366.1|  hypothetical protein PRUPE_ppa007219mg             199   2e-81   Prunus persica
gb|AEL88913.1|  actin                                                   202   2e-81   Halodule beaudettei
ref|XP_004307518.1|  PREDICTED: actin-97-like                           197   2e-81   Fragaria vesca subsp. vesca
gb|AIO05828.1|  actin                                                   200   2e-81   Lycium chinense [Chinese boxthorn]
gb|AAC49651.1|  actin                                                   200   2e-81   Striga asiatica [witchweed]
sp|P30167.1|ACT3_SOLTU  RecName: Full=Actin-58                          199   2e-81   Solanum tuberosum [potatoes]
ref|XP_010690498.1|  PREDICTED: actin-1                                 200   2e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007205365.1|  hypothetical protein PRUPE_ppa007214mg             199   2e-81   Prunus persica
ref|NP_001276160.1|  actin-11-like                                      199   2e-81   
tpg|DAA51050.1|  TPA: putative actin family protein                     201   2e-81   
ref|XP_006345961.1|  PREDICTED: actin-58-like                           199   2e-81   Solanum tuberosum [potatoes]
dbj|BAF68887.1|  actin 3                                                200   2e-81   Torenia fournieri [bluewings]
ref|NP_190236.1|  actin-12                                              201   2e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454923.1|  PREDICTED: actin-12-like                           201   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_002316289.1|  actin family protein                               197   2e-81   Populus trichocarpa [western balsam poplar]
gb|AEL88911.1|  actin                                                   202   2e-81   Halodule beaudettei
gb|ABY66084.1|  actin                                                   201   2e-81   Dimocarpus longan [longan]
ref|XP_010936865.1|  PREDICTED: actin                                   200   2e-81   Elaeis guineensis
ref|XP_003547359.1|  PREDICTED: actin-like isoform X1                   199   2e-81   
ref|XP_007218136.1|  hypothetical protein PRUPE_ppa007236mg             199   2e-81   Prunus persica
ref|XP_007150869.1|  hypothetical protein PHAVU_004G001000g             199   2e-81   Phaseolus vulgaris [French bean]
ref|XP_007009346.1|  Actin-11 isoform 1                                 196   2e-81   Theobroma cacao [chocolate]
gb|KHF99778.1|  Actin                                                   200   2e-81   Gossypium arboreum [tree cotton]
ref|XP_006351346.1|  PREDICTED: actin-58-like                           200   2e-81   Solanum tuberosum [potatoes]
ref|XP_004294508.1|  PREDICTED: actin-1                                 199   2e-81   Fragaria vesca subsp. vesca
ref|XP_007150318.1|  hypothetical protein PHAVU_005G143500g             199   2e-81   Phaseolus vulgaris [French bean]
ref|XP_004981971.1|  PREDICTED: actin-1-like isoform X2                 200   2e-81   
ref|XP_004250955.1|  PREDICTED: actin-97-like                           200   2e-81   
ref|XP_004239790.1|  PREDICTED: actin-58                                199   2e-81   Solanum lycopersicum
ref|XP_011078821.1|  PREDICTED: actin                                   199   2e-81   Sesamum indicum [beniseed]
gb|KHG27347.1|  Actin                                                   197   2e-81   Gossypium arboreum [tree cotton]
ref|XP_009802880.1|  PREDICTED: actin-like                              199   2e-81   Nicotiana sylvestris
gb|EPS68331.1|  hypothetical protein M569_06438                         201   2e-81   Genlisea aurea
gb|KJB36724.1|  hypothetical protein B456_006G173100                    201   2e-81   Gossypium raimondii
dbj|BAK52268.1|  beta actin                                             196   2e-81   Rhizophora stylosa
ref|NP_001150462.1|  LOC100284092                                       200   2e-81   Zea mays [maize]
ref|XP_003622020.1|  Actin                                              199   3e-81   
gb|KJB16973.1|  hypothetical protein B456_002G257900                    200   3e-81   Gossypium raimondii
gb|AAF40438.1|AF234528_2  actin 1                                       200   3e-81   Avena nuda
ref|XP_009621805.1|  PREDICTED: actin-like                              200   3e-81   Nicotiana tomentosiformis
gb|KDP44962.1|  hypothetical protein JCGZ_01462                         197   3e-81   Jatropha curcas
ref|XP_009591335.1|  PREDICTED: actin-97                                199   3e-81   Nicotiana tomentosiformis
gb|ADX97327.1|  actin 7                                                 198   3e-81   Mangifera indica
ref|XP_006855625.1|  hypothetical protein AMTR_s00044p00088410          199   3e-81   
gb|ADE05541.1|  actin                                                   200   3e-81   Liriodendron tulipifera
gb|KEH39427.1|  actin-97                                                200   3e-81   Medicago truncatula
ref|XP_008798327.1|  PREDICTED: actin                                   199   3e-81   Phoenix dactylifera
emb|CDP10143.1|  unnamed protein product                                198   3e-81   Coffea canephora [robusta coffee]
ref|XP_003622019.1|  Actin                                              199   3e-81   Medicago truncatula
ref|XP_004147692.1|  PREDICTED: actin-97-like                           197   3e-81   Cucumis sativus [cucumbers]
gb|ACK87035.1|  actin                                                   199   4e-81   Caragana korshinskii
gb|KJB20092.1|  hypothetical protein B456_003G132400                    200   4e-81   Gossypium raimondii
gb|AHY94895.1|  actin                                                   199   4e-81   Prunella vulgaris
ref|NP_001241178.1|  uncharacterized protein LOC100807341               199   4e-81   Glycine max [soybeans]
gb|KHN27489.1|  Actin-97                                                199   4e-81   Glycine soja [wild soybean]
gb|KHN24335.1|  Actin-97                                                199   4e-81   Glycine soja [wild soybean]
gb|AFD62269.1|  actin 2                                                 199   4e-81   Annona cherimola [cherimoya]
ref|NP_200745.1|  actin 4                                               201   5e-81   Arabidopsis thaliana [mouse-ear cress]
gb|AFZ78526.1|  actin                                                   197   5e-81   Populus tomentosa [Chinese white poplar]
gb|AAM65657.1|  actin 4                                                 201   5e-81   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54465.1|  actin-3-like protein                                    199   5e-81   Phaseolus vulgaris [French bean]
gb|KJB76085.1|  hypothetical protein B456_012G070300                    196   5e-81   Gossypium raimondii
ref|XP_007162325.1|  hypothetical protein PHAVU_001G142500g             199   5e-81   Phaseolus vulgaris [French bean]
ref|XP_011029076.1|  PREDICTED: actin-97-like                           194   5e-81   Populus euphratica
gb|AAF31643.1|AF143208_1  actin                                         199   5e-81   Vigna radiata [mung bean]
gb|ADK11998.1|  putative actin protein                                  199   5e-81   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006282193.1|  hypothetical protein CARUB_v10028459mg             201   5e-81   Capsella rubella
gb|KHF98940.1|  hypothetical protein F383_05741                         198   5e-81   Gossypium arboreum [tree cotton]
ref|XP_008795328.1|  PREDICTED: actin-1                                 199   6e-81   Phoenix dactylifera
ref|XP_004487013.1|  PREDICTED: actin-like                              199   6e-81   Cicer arietinum [garbanzo]
gb|AIY27746.1|  actin                                                   196   6e-81   Betula luminifera [liang ye hua]
ref|XP_009150245.1|  PREDICTED: actin-12                                201   6e-81   Brassica rapa
gb|KDP24628.1|  hypothetical protein JCGZ_25544                         199   6e-81   Jatropha curcas
ref|XP_003537995.1|  PREDICTED: actin-like isoform X1                   196   6e-81   Glycine max [soybeans]
emb|CDY48688.1|  BnaC02g10000D                                          202   6e-81   Brassica napus [oilseed rape]
emb|CDX82985.1|  BnaA01g19850D                                          201   6e-81   
ref|XP_009131999.1|  PREDICTED: actin-12-like                           201   6e-81   Brassica rapa
gb|KDO72871.1|  hypothetical protein CISIN_1g017125mg                   199   7e-81   Citrus sinensis [apfelsine]
ref|XP_006418890.1|  hypothetical protein EUTSA_v10002572mg             201   7e-81   Eutrema salsugineum [saltwater cress]
ref|XP_004241231.1|  PREDICTED: actin-82                                200   7e-81   Solanum lycopersicum
ref|XP_009618901.1|  PREDICTED: actin                                   199   7e-81   Nicotiana tomentosiformis
ref|XP_006854536.1|  hypothetical protein AMTR_s00030p00045700          199   7e-81   Amborella trichopoda
ref|NP_001239953.1|  uncharacterized protein LOC100798523               199   7e-81   Glycine max [soybeans]
ref|XP_009587904.1|  PREDICTED: actin-97-like                           199   7e-81   Nicotiana tomentosiformis
ref|XP_004492148.1|  PREDICTED: actin-11-like                           198   7e-81   Cicer arietinum [garbanzo]
ref|XP_003553313.1|  PREDICTED: actin-like                              199   8e-81   Glycine max [soybeans]
gb|KHN13906.1|  Actin-11                                                199   8e-81   Glycine soja [wild soybean]
gb|AAC49652.1|  actin                                                   199   8e-81   Striga asiatica [witchweed]
ref|NP_001239660.1|  uncharacterized protein LOC100781831               198   8e-81   Glycine max [soybeans]
gb|AGA63729.1|  actin                                                   199   8e-81   Vicia faba [broad bean]
gb|ADP09679.1|  actin isoform PEAc14-1                                  199   9e-81   Pisum sativum [garden pea]
ref|XP_006429073.1|  hypothetical protein CICLE_v10011973mg             196   9e-81   Citrus clementina [clementine]
ref|XP_011075140.1|  PREDICTED: actin-97                                198   9e-81   Sesamum indicum [beniseed]
ref|XP_002279672.1|  PREDICTED: actin-66                                196   9e-81   Vitis vinifera
dbj|BAI39619.1|  beta actin                                             196   9e-81   Kandelia candel
gb|KHG18648.1|  Actin-58                                                197   1e-80   Gossypium arboreum [tree cotton]
gb|KDO47175.1|  hypothetical protein CISIN_1g017102mg                   196   1e-80   Citrus sinensis [apfelsine]
gb|AFK39354.1|  unknown                                                 199   1e-80   Medicago truncatula
gb|AFK41203.1|  unknown                                                 197   1e-80   Medicago truncatula
gb|EYU39941.1|  hypothetical protein MIMGU_mgv1a008854mg                199   1e-80   Erythranthe guttata [common monkey flower]
ref|XP_010030965.1|  PREDICTED: actin                                   196   1e-80   Eucalyptus grandis [rose gum]
sp|P30172.1|ACT12_SOLTU  RecName: Full=Actin-100                        197   1e-80   Solanum tuberosum [potatoes]
ref|XP_010257475.1|  PREDICTED: actin                                   196   1e-80   Nelumbo nucifera [Indian lotus]
ref|XP_009388742.1|  PREDICTED: actin-like                              199   1e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR17342.1|  unknown                                                 197   1e-80   Picea sitchensis
ref|NP_187818.1|  actin-11                                              200   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011075141.1|  PREDICTED: actin-97-like                           199   1e-80   Sesamum indicum [beniseed]
ref|XP_002283939.1|  PREDICTED: actin                                   199   1e-80   Vitis vinifera
ref|XP_002882767.1|  actin-11                                           200   1e-80   
emb|CAN69147.1|  hypothetical protein VITISV_023982                     199   1e-80   Vitis vinifera
emb|CDP06619.1|  unnamed protein product                                200   1e-80   Coffea canephora [robusta coffee]
ref|XP_010905701.1|  PREDICTED: actin-101-like                          196   1e-80   Elaeis guineensis
ref|XP_004497894.1|  PREDICTED: actin-like                              197   1e-80   Cicer arietinum [garbanzo]
emb|CDY38066.1|  BnaC03g75050D                                          201   1e-80   Brassica napus [oilseed rape]
ref|XP_006846523.1|  hypothetical protein AMTR_s00018p00188200          197   1e-80   Amborella trichopoda
emb|CDY53444.1|  BnaA02g07080D                                          201   1e-80   Brassica napus [oilseed rape]
ref|XP_008776351.1|  PREDICTED: actin-101                               196   1e-80   Phoenix dactylifera
gb|ADN88106.1|  actin 1                                                 199   1e-80   Guzmania wittmackii x Guzmania lingulata
dbj|BAF68888.1|  actin 4                                                200   1e-80   Torenia fournieri [bluewings]
ref|XP_006297921.1|  hypothetical protein CARUB_v10013962mg             199   1e-80   Capsella rubella
ref|XP_006858216.1|  hypothetical protein AMTR_s00062p00184900          199   1e-80   Amborella trichopoda
ref|XP_009773019.1|  PREDICTED: actin-97                                199   1e-80   Nicotiana sylvestris
gb|ACU23316.1|  unknown                                                 197   1e-80   Glycine max [soybeans]
ref|XP_011077464.1|  PREDICTED: actin-like                              197   1e-80   Sesamum indicum [beniseed]
ref|XP_003521216.1|  PREDICTED: actin-3-like isoform X1                 197   2e-80   Glycine max [soybeans]
ref|XP_003539675.1|  PREDICTED: actin-like isoform X1                   196   2e-80   Glycine max [soybeans]
sp|P30173.1|ACT13_SOLTU  RecName: Full=Actin-101                        196   2e-80   Solanum tuberosum [potatoes]
gb|ACP19073.1|  actin 2                                                 197   2e-80   Picea abies
ref|XP_011099798.1|  PREDICTED: actin-1-like                            196   2e-80   Sesamum indicum [beniseed]
gb|AAO42312.1|  putative actin 4                                        199   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010541399.1|  PREDICTED: actin-12-like                           201   2e-80   Tarenaya hassleriana [spider flower]
ref|XP_009410069.1|  PREDICTED: actin                                   199   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009773924.1|  PREDICTED: actin                                   198   2e-80   Nicotiana sylvestris
gb|EYU20691.1|  hypothetical protein MIMGU_mgv1a008334mg                199   2e-80   Erythranthe guttata [common monkey flower]
ref|XP_010427034.1|  PREDICTED: actin-1-like                            200   2e-80   
ref|XP_010111138.1|  hypothetical protein L484_010751                   196   2e-80   Morus notabilis
gb|ACH69153.1|  actin                                                   197   2e-80   Nicotiana tabacum [American tobacco]
gb|EPS69959.1|  actin                                                   198   2e-80   Genlisea aurea
ref|XP_003625265.1|  Actin                                              197   2e-80   Medicago truncatula
gb|ADU52545.1|  actin 2                                                 196   2e-80   Morus alba
gb|AAN08622.1|  actin                                                   196   2e-80   Phalaenopsis hybrid cultivar
emb|CDP09045.1|  unnamed protein product                                197   2e-80   Coffea canephora [robusta coffee]
gb|ABG49392.1|  actin 2                                                 200   2e-80   Torenia fournieri [bluewings]
gb|ABV59397.1|  actin                                                   197   2e-80   Phyllostachys bambusoides
ref|XP_008787899.1|  PREDICTED: actin-like                              199   2e-80   Phoenix dactylifera
gb|EYU41721.1|  hypothetical protein MIMGU_mgv1a008324mg                199   2e-80   Erythranthe guttata [common monkey flower]
ref|XP_009801998.1|  PREDICTED: actin-97-like                           196   2e-80   Nicotiana sylvestris
ref|XP_010922421.1|  PREDICTED: actin-100-like isoform X2               196   2e-80   
gb|AIY25484.1|  actin isoform 3-1                                       197   2e-80   Pisum sativum [garden pea]
dbj|BAN13564.1|  actin                                                  197   2e-80   Chrysanthemum seticuspe f. boreale
ref|XP_006407369.1|  hypothetical protein EUTSA_v10020950mg             200   2e-80   Eutrema salsugineum [saltwater cress]
gb|ABK21898.1|  unknown                                                 200   2e-80   Picea sitchensis
ref|XP_009381444.1|  PREDICTED: actin-like                              199   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEI29166.1|  actin-like protein                                      195   2e-80   Vanilla planifolia [cultivated vanilla]
ref|XP_003533915.1|  PREDICTED: actin-like isoform X1                   198   2e-80   Glycine max [soybeans]
dbj|BAL27711.1|  actin like 1                                           199   3e-80   Prunus avium [gean]
ref|XP_010520110.1|  PREDICTED: actin-like                              199   3e-80   Tarenaya hassleriana [spider flower]
ref|XP_002265476.1|  PREDICTED: actin-101                               195   3e-80   Vitis vinifera
ref|XP_010922415.1|  PREDICTED: actin-101-like isoform X1               196   3e-80   
gb|AFO68183.1|  actin                                                   197   3e-80   Anthurium andraeanum [flamingo-lily]
ref|XP_011089811.1|  PREDICTED: actin-like                              199   3e-80   Sesamum indicum [beniseed]
ref|XP_002879684.1|  hypothetical protein ARALYDRAFT_321462             200   3e-80   Arabidopsis lyrata subsp. lyrata
dbj|BAO04185.1|  actin                                                  197   3e-80   Delphinium grandiflorum
ref|XP_009381010.1|  PREDICTED: actin-like                              199   3e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011094851.1|  PREDICTED: actin-4                                 198   3e-80   Sesamum indicum [beniseed]
gb|EYU26584.1|  hypothetical protein MIMGU_mgv1a024149mg                197   3e-80   Erythranthe guttata [common monkey flower]
ref|XP_004230564.1|  PREDICTED: actin-101                               196   3e-80   
ref|XP_010535499.1|  PREDICTED: actin-11                                198   3e-80   Tarenaya hassleriana [spider flower]
ref|XP_008781400.1|  PREDICTED: actin-101-like                          196   3e-80   Phoenix dactylifera
ref|XP_007132070.1|  hypothetical protein PHAVU_011G064500g             195   4e-80   Phaseolus vulgaris [French bean]
gb|AEL88910.1|  actin                                                   200   4e-80   Halodule beaudettei
gb|AIR74902.1|  beta-actin                                              199   4e-80   Mentha spicata
gb|KJB76651.1|  hypothetical protein B456_012G100700                    192   4e-80   Gossypium raimondii
dbj|BAA89214.1|  actin isoform B                                        196   4e-80   Mimosa pudica [sensitive-plant]
gb|ABS83240.2|  actin 7                                                 199   4e-80   Corchorus olitorius [Nalta jute]
ref|XP_004306592.1|  PREDICTED: actin-7                                 196   4e-80   Fragaria vesca subsp. vesca
ref|XP_009150339.1|  PREDICTED: actin-12-like                           199   4e-80   Brassica rapa
sp|Q05214.1|ACT1_TOBAC  RecName: Full=Actin                             196   4e-80   Nicotiana tabacum [American tobacco]
gb|AEP31940.1|  actin                                                   196   4e-80   Fragaria x ananassa
ref|XP_010027698.1|  PREDICTED: actin-7                                 196   4e-80   Eucalyptus grandis [rose gum]
gb|AEK70331.1|  actin                                                   196   4e-80   Paeonia suffruticosa [moutan peony]
ref|XP_009608442.1|  PREDICTED: actin-71                                199   4e-80   Nicotiana tomentosiformis
gb|EYU43487.1|  hypothetical protein MIMGU_mgv1a008318mg                198   4e-80   Erythranthe guttata [common monkey flower]
ref|XP_007145688.1|  hypothetical protein PHAVU_007G260000g             197   4e-80   Phaseolus vulgaris [French bean]
emb|CDY33033.1|  BnaA10g12390D                                          198   5e-80   Brassica napus [oilseed rape]
ref|XP_010260924.1|  PREDICTED: actin-101-like                          196   5e-80   Nelumbo nucifera [Indian lotus]
ref|XP_009146643.1|  PREDICTED: actin-11                                199   5e-80   Brassica rapa
gb|AAC23632.2|  actin 3                                                 200   5e-80   Arabidopsis thaliana [mouse-ear cress]
gb|KHF98170.1|  Actin                                                   197   5e-80   Gossypium arboreum [tree cotton]
ref|XP_003525105.1|  PREDICTED: actin-7-like                            196   5e-80   
ref|XP_006400969.1|  hypothetical protein EUTSA_v10013840mg             199   5e-80   Eutrema salsugineum [saltwater cress]
ref|XP_009787806.1|  PREDICTED: actin-like                              197   5e-80   Nicotiana sylvestris
emb|CDY08455.1|  BnaA05g26910D                                          199   5e-80   Brassica napus [oilseed rape]
ref|XP_010520278.1|  PREDICTED: actin-like                              198   5e-80   
ref|XP_007041601.1|  Actin 7 isoform 1                                  195   5e-80   
emb|CDY01102.1|  BnaC05g40980D                                          199   5e-80   
gb|AAF03692.1|AF172094_1  actin                                         199   5e-80   
ref|XP_009403146.1|  PREDICTED: actin                                   199   5e-80   
gb|KJB18789.1|  hypothetical protein B456_003G069800                    196   5e-80   
ref|XP_010067406.1|  PREDICTED: actin-1-like                            197   5e-80   
ref|XP_006351818.1|  PREDICTED: actin-101-like                          197   5e-80   
ref|XP_009409104.1|  PREDICTED: actin-like                              199   6e-80   
gb|AAF71264.1|AF246714_1  actin-like protein                            194   6e-80   
ref|XP_009393674.1|  PREDICTED: actin-like                              199   6e-80   
ref|XP_003519037.1|  PREDICTED: actin-like isoform X1                   199   6e-80   
gb|AIX10767.1|  actin                                                   196   6e-80   
emb|CDX80274.1|  BnaC09g34680D                                          197   6e-80   
gb|AEO13836.1|  actin                                                   196   7e-80   
gb|ACJ05350.1|  actin                                                   196   7e-80   
ref|XP_010912406.1|  PREDICTED: actin-101-like                          195   7e-80   
ref|XP_009631892.1|  PREDICTED: actin-101                               197   7e-80   
ref|XP_010909197.1|  PREDICTED: actin-like                              198   7e-80   
gb|ADA70361.1|  actin                                                   196   7e-80   
gb|AFP43693.1|  actin 1                                                 196   7e-80   
ref|XP_009420081.1|  PREDICTED: actin-2                                 193   7e-80   
gb|ACJ05348.1|  actin                                                   196   7e-80   
gb|ACB88021.1|  actin                                                   196   8e-80   
gb|AEO45961.1|  actin 1                                                 196   8e-80   
gb|AAW34192.1|  actin                                                   196   8e-80   
gb|AEL88498.1|  actin                                                   195   8e-80   
dbj|BAD27408.1|  actin                                                  197   8e-80   
ref|XP_009759480.1|  PREDICTED: actin-101                               197   8e-80   
dbj|BAK57343.1|  actin1                                                 196   8e-80   
gb|KHG13435.1|  Actin-7 -like protein                                   196   8e-80   
ref|NP_566988.1|  actin 3                                               200   8e-80   
gb|AAP73455.1|  actin                                                   196   8e-80   
gb|AFM38980.1|  actin                                                   196   8e-80   
gb|AHA84238.1|  actin                                                   195   8e-80   
ref|XP_008788057.1|  PREDICTED: actin-3-like                            196   8e-80   
gb|AIC33035.1|  actin 1                                                 196   8e-80   
ref|XP_002282516.1|  PREDICTED: actin-7                                 196   8e-80   
ref|XP_002298710.1|  actin family protein                               196   9e-80   
emb|CBI37599.3|  unnamed protein product                                196   9e-80   
gb|AAF71266.1|AF246716_1  actin-like protein                            198   9e-80   
gb|ADU52547.1|  actin 1                                                 196   9e-80   
gb|AAF82805.1|  actin                                                   196   9e-80   
gb|AAP73457.1|  actin                                                   196   9e-80   
ref|XP_006371012.1|  hypothetical protein POPTR_0019s02630g             196   9e-80   
gb|AAP73451.1|  actin                                                   196   9e-80   
gb|ADH82414.1|  actin                                                   196   9e-80   
gb|AAB18643.1|  actin                                                   196   9e-80   
gb|ADH44694.1|  actin 7                                                 194   9e-80   
ref|XP_009772796.1|  PREDICTED: actin-71                                199   9e-80   
gb|KHF99045.1|  Actin-7 -like protein                                   196   9e-80   
gb|AAN40685.1|  actin                                                   196   1e-79   
ref|XP_003523242.1|  PREDICTED: actin-7-like isoform X1                 196   1e-79   
gb|ACL97684.1|  actin 1                                                 196   1e-79   
ref|XP_010498525.1|  PREDICTED: actin-11                                197   1e-79   
gb|AAV83798.1|  putative actin 2                                        200   1e-79   
ref|XP_002977012.1|  hypothetical protein SELMODRAFT_175956             197   1e-79   
gb|ADU52548.1|  actin 2                                                 196   1e-79   
gb|AAD41039.1|AF112538_1  actin                                         196   1e-79   
gb|AAL66196.1|AF386514_1  actin                                         193   1e-79   
ref|XP_008788993.1|  PREDICTED: actin-101-like                          196   1e-79   
gb|ABG49457.2|  actin 1                                                 196   1e-79   
gb|KHG17291.1|  hypothetical protein F383_20779                         195   1e-79   
gb|AAT72934.2|  stem cambial region actin protein                       193   1e-79   
gb|AEL88499.1|  actin                                                   194   1e-79   
dbj|BAL14271.1|  actin                                                  195   1e-79   
ref|XP_008455254.1|  PREDICTED: actin-7-like                            197   1e-79   
gb|KJB73912.1|  hypothetical protein B456_011G260600                    195   1e-79   
ref|XP_006427855.1|  hypothetical protein CICLE_v10025866mg             196   1e-79   
ref|XP_004147353.1|  PREDICTED: actin-7-like                            196   1e-79   
ref|XP_010937718.1|  PREDICTED: actin-3                                 196   1e-79   
gb|AHE41423.1|  actin                                                   196   1e-79   
gb|AHF27441.1|  actin                                                   197   1e-79   
gb|ADV17460.1|  actin                                                   195   1e-79   
gb|KHF97889.1|  hypothetical protein F383_16333                         195   1e-79   
dbj|BAN45712.1|  putative actin                                         195   1e-79   
ref|XP_004136855.1|  PREDICTED: actin-like                              197   1e-79   
gb|AAD48335.1|AF090969_1  actin                                         197   1e-79   
ref|XP_002981586.1|  hypothetical protein SELMODRAFT_233752             197   1e-79   
dbj|BAA21108.1|  actin                                                  196   2e-79   
gb|ACP19072.1|  actin 1                                                 199   2e-79   
sp|P46258.1|ACT3_PEA  RecName: Full=Actin-3                             197   2e-79   
gb|AAP73456.1|  actin                                                   196   2e-79   
gb|AEN70747.1|  actin 1                                                 196   2e-79   
gb|AGV75926.1|  actin                                                   196   2e-79   
gb|AAP73450.1|  actin                                                   196   2e-79   
gb|AEI27262.1|  actin                                                   193   2e-79   
gb|AEI27257.1|  actin                                                   193   2e-79   
gb|AAP73452.1|  actin                                                   196   2e-79   
gb|ADY68784.1|  actin                                                   196   2e-79   
gb|AEL88497.1|  actin                                                   194   2e-79   
gb|AEN70759.1|  actin 1                                                 196   2e-79   
gb|AFO65511.1|  actin 2                                                 197   2e-79   
gb|AAP73449.1|  actin                                                   196   2e-79   
gb|AEL88500.1|  actin                                                   194   2e-79   
gb|AFY06656.1|  actin 2                                                 196   2e-79   
ref|XP_010932520.1|  PREDICTED: actin-like                              197   2e-79   
gb|AEN70754.1|  actin 1                                                 196   2e-79   
gb|KHG03218.1|  Actin                                                   195   2e-79   
gb|ADW83713.1|  actin 1                                                 195   2e-79   
ref|NP_001289215.1|  actin-7                                            195   2e-79   
ref|XP_006432485.1|  hypothetical protein CICLE_v10001518mg             194   2e-79   
gb|KHN32122.1|  Actin-97                                                196   2e-79   
ref|XP_009416898.1|  PREDICTED: actin-3                                 195   2e-79   
ref|XP_009594162.1|  PREDICTED: actin-104                               197   2e-79   
ref|XP_004960554.1|  PREDICTED: actin-97-like                           195   2e-79   
sp|P30164.1|ACT1_PEA  RecName: Full=Actin-1                             197   2e-79   
ref|NP_001051822.1|  Os03g0836000                                       197   2e-79   
emb|CDP12785.1|  unnamed protein product                                195   2e-79   
dbj|BAH98157.1|  actin                                                  196   2e-79   
gb|EPS67367.1|  hypothetical protein M569_07407                         198   2e-79   
gb|EMT00396.1|  Actin-3                                                 197   2e-79   
ref|XP_008794560.1|  PREDICTED: actin-101-like                          196   2e-79   
gb|KHG24741.1|  Actin-7 -like protein                                   195   2e-79   
ref|XP_007048253.1|  Actin 7 isoform 1                                  194   2e-79   
ref|XP_009412537.1|  PREDICTED: actin-3-like                            193   2e-79   
gb|AAR15174.1|  actin                                                   196   2e-79   
ref|XP_009599876.1|  PREDICTED: actin-7-like                            196   2e-79   
gb|ACJ05349.1|  actin                                                   194   2e-79   
gb|EEE62039.1|  hypothetical protein OsJ_16821                          196   2e-79   
gb|ACZ04921.1|  actin 7-like protein                                    196   2e-79   
ref|XP_009388633.1|  PREDICTED: actin-101                               192   2e-79   
ref|XP_009139296.1|  PREDICTED: actin-1                                 200   2e-79   
gb|AAP73462.1|  actin                                                   194   3e-79   
gb|ACL97685.1|  actin 2                                                 194   3e-79   
gb|ADV91594.1|  actin                                                   195   3e-79   
emb|CAA33874.1|  actin                                                  192   3e-79   
ref|NP_001054419.1|  Os05g0106600                                       195   3e-79   
gb|AFK42711.1|  unknown                                                 194   3e-79   
ref|XP_010251047.1|  PREDICTED: actin-3                                 195   3e-79   
gb|ABR45727.1|  ACT1                                                    196   3e-79   
gb|AAB18641.1|  actin                                                   194   3e-79   
gb|AAA32727.1|  actin-1                                                 197   3e-79   
dbj|BAN45711.1|  putative actin                                         194   4e-79   
sp|P30165.1|ACT2_PEA  RecName: Full=Actin-2                             196   4e-79   
gb|AEI27264.1|  actin                                                   193   4e-79   
ref|XP_004235068.1|  PREDICTED: actin-7                                 196   4e-79   
ref|XP_009133195.1|  PREDICTED: actin-1-like                            199   4e-79   
ref|XP_004493592.1|  PREDICTED: actin-3-like                            197   4e-79   
gb|AHB86961.1|  actin-2                                                 196   4e-79   
ref|XP_007039275.1|  Actin 7 isoform 1                                  198   4e-79   
gb|AFP44112.1|  actin                                                   196   4e-79   
gb|AAP73459.1|  actin                                                   194   5e-79   
ref|XP_009416124.1|  PREDICTED: actin-7-like                            192   5e-79   
ref|XP_002963206.1|  hypothetical protein SELMODRAFT_230187             198   5e-79   
ref|XP_003602546.1|  Actin                                              196   5e-79   
ref|XP_011004377.1|  PREDICTED: actin-7-like isoform X2                 196   5e-79   
gb|AGI15325.1|  actin 1                                                 196   5e-79   
ref|XP_011074742.1|  PREDICTED: actin-104                               195   5e-79   
gb|ACJ38662.1|  actin                                                   193   5e-79   
gb|ADV72541.1|  actin 7b                                                193   5e-79   
gb|AIZ68150.1|  Actin 7 isoform 1                                       196   5e-79   
ref|XP_009407474.1|  PREDICTED: actin-7-like                            193   5e-79   
ref|XP_003602545.1|  Actin                                              196   5e-79   
gb|ACS68187.1|  actin2.1                                                197   5e-79   
gb|ACV04873.1|  actin 2                                                 196   5e-79   
gb|KJB24091.1|  hypothetical protein B456_004G127500                    197   5e-79   
dbj|BAB63635.1|  putative actin                                         196   5e-79   
gb|AAP73454.1|  actin                                                   193   5e-79   
gb|AAP73460.1|  actin                                                   194   5e-79   
gb|AGK63075.1|  actin 1                                                 196   5e-79   
ref|XP_003562930.1|  PREDICTED: actin-3                                 196   5e-79   
gb|KHF97916.1|  Actin-7 -like protein                                   196   5e-79   
ref|NP_188508.1|  actin 2                                               197   5e-79   
gb|AFB83349.1|  actin 2                                                 196   5e-79   
gb|AEE98359.1|  actin                                                   197   6e-79   
ref|NP_001266023.1|  uncharacterized protein LOC101503086               196   6e-79   
ref|XP_009390755.1|  PREDICTED: actin-7                                 194   6e-79   
gb|ADW83714.1|  actin 2                                                 194   6e-79   
emb|CDY61982.1|  BnaC03g73810D                                          197   6e-79   
ref|NP_175350.1|  actin 8                                               197   6e-79   
ref|XP_002449040.1|  hypothetical protein SORBIDRAFT_05g003880          197   6e-79   
ref|XP_009600120.1|  PREDICTED: actin-like                              196   6e-79   
gb|EAY79170.1|  hypothetical protein OsI_34279                          195   6e-79   
gb|AAK82991.1|AF285176_1  actin                                         195   7e-79   
ref|NP_001291342.1|  uncharacterized protein LOC105159390               195   7e-79   
ref|XP_010546369.1|  PREDICTED: actin-7                                 196   7e-79   
gb|KHG20985.1|  Actin-7 -like protein                                   197   7e-79   
emb|CDY30846.1|  BnaC04g27010D                                          200   7e-79   
ref|XP_008809027.1|  PREDICTED: actin-2                                 196   7e-79   
ref|XP_009116071.1|  PREDICTED: actin-1-like                            200   8e-79   
ref|XP_011004375.1|  PREDICTED: actin-7-like isoform X1                 196   8e-79   
ref|XP_010933731.1|  PREDICTED: actin-101-like                          196   8e-79   
gb|AJB28504.1|  actin V1                                                192   8e-79   
ref|XP_004249866.1|  PREDICTED: actin-7-like                            196   8e-79   
gb|AHF27440.1|  actin                                                   197   9e-79   
ref|XP_009413409.1|  PREDICTED: actin-7                                 194   9e-79   
emb|CDX73527.1|  BnaC08g24760D                                          199   9e-79   
ref|XP_006650864.1|  PREDICTED: actin-3-like                            197   9e-79   
gb|ACT98686.1|  actin                                                   192   9e-79   
ref|XP_006661942.1|  PREDICTED: actin-2-like isoform X1                 194   9e-79   
ref|XP_004978759.1|  PREDICTED: actin-7-like                            197   9e-79   
ref|NP_001130463.1|  putative actin family protein isoform 1            193   9e-79   
dbj|BAJ85914.1|  predicted protein                                      194   1e-78   
gb|AEN70757.1|  actin 1                                                 196   1e-78   
ref|XP_009383456.1|  PREDICTED: actin-7-like                            195   1e-78   
ref|XP_008654246.1|  PREDICTED: putative actin family protein iso...    193   1e-78   
ref|NP_196543.1|  actin 7                                               196   1e-78   
gb|AHE76167.1|  actin                                                   194   1e-78   
ref|XP_009787561.1|  PREDICTED: actin-104                               197   1e-78   
ref|XP_009406076.1|  PREDICTED: actin-3                                 195   1e-78   
emb|CEL26646.1|  Actin1                                                 196   1e-78   
ref|XP_008810321.1|  PREDICTED: actin-2-like                            194   1e-78   
gb|ADX97326.1|  actin 9                                                 196   1e-78   
gb|AAC49523.1|  actin 8                                                 196   1e-78   
ref|XP_010520298.1|  PREDICTED: actin-7                                 196   1e-78   
gb|AEN79435.1|  actin                                                   193   1e-78   
gb|AAQ74875.1|  actin                                                   196   1e-78   
ref|XP_010671378.1|  PREDICTED: actin-7                                 197   1e-78   
gb|AAM64898.1|  actin 8                                                 197   1e-78   
ref|XP_009135599.1|  PREDICTED: actin-2                                 197   1e-78   
ref|XP_006287952.1|  hypothetical protein CARUB_v10001188mg             196   1e-78   
gb|AHE76166.1|  actin                                                   196   1e-78   
gb|AFU06383.1|  actin                                                   194   1e-78   
ref|XP_009409006.1|  PREDICTED: actin-101-like                          192   2e-78   
gb|AFW82899.1|  LOW QUALITY PROTEIN: putative actin family protein      192   2e-78   
ref|XP_010500469.1|  PREDICTED: actin-8-like                            197   2e-78   
sp|P30168.2|ACT6_SOLTU  RecName: Full=Actin-71                          197   2e-78   
ref|XP_003569118.1|  PREDICTED: actin-97                                196   2e-78   
ref|XP_003578869.1|  PREDICTED: actin-3-like                            194   2e-78   
ref|XP_006341033.1|  PREDICTED: actin-71-like                           197   2e-78   



>ref|XP_011091473.1| PREDICTED: actin-11 [Sesamum indicum]
 ref|XP_011091474.1| PREDICTED: actin-11 [Sesamum indicum]
Length=377

 Score =   198 bits (504),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            +HETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  VHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFTGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   136 bits (342),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELET+KTSS+VEKSYELPDGQVITIGNERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETAKTSSSVEKSYELPDGQVITIGNERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|EPS60057.1| hypothetical protein M569_14747 [Genlisea aurea]
Length=377

 Score =   200 bits (508),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   134 bits (338),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETSKTSS+VEKS+ELPDGQVITIGNERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETSKTSSSVEKSFELPDGQVITIGNERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEA+
Sbjct  266  PSMIGMEAS  274



>gb|ADL59374.2| actin 4 [Ipomoea nil]
 gb|AFD62801.1| actin 4 [Ipomoea purpurea]
Length=376

 Score =   200 bits (509),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  275  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  334

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  335  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  375


 Score =   134 bits (337),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  205  AEREIVRDMKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  264

Query  564  PSIIGMEAA  538
            PS++GMEAA
Sbjct  265  PSLVGMEAA  273



>ref|XP_007016434.1| Actin 3 isoform 3 [Theobroma cacao]
 gb|EOY34053.1| Actin 3 isoform 3 [Theobroma cacao]
Length=322

 Score =   201 bits (511),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  221  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  280

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  281  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  321


 Score =   133 bits (334),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSA+EKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  151  AEREIVRDMKEKLAYIALDYEQELETAKTSSAIEKSYELPDGQVITIGAERFRCPEVLFQ  210

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  211  PSMIGMEAA  219



>gb|AFP43696.1| actin4, partial [Eriobotrya japonica]
Length=174

 Score =   199 bits (507),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  73   IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  132

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  133  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  173


 Score =   134 bits (337),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQE+ETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  3    AEREIVRDMKEKLSYIALDYEQEMETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  62

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  63   PSMIGMEAA  71



>dbj|BAL14664.1| actin [Chrysanthemum seticuspe f. boreale]
Length=377

 Score =   200 bits (509),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_008382817.1| PREDICTED: actin [Malus domestica]
Length=377

 Score =   199 bits (505),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   134 bits (338),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQE+ETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQEMETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_010553283.1| PREDICTED: actin [Tarenaya hassleriana]
Length=377

 Score =   200 bits (509),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELETSKTSSAVEK+YELPDGQVITIG+ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLSYIALDYEQELETSKTSSAVEKNYELPDGQVITIGSERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_010534357.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
 ref|XP_010534358.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
Length=377

 Score =   200 bits (509),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQE+ETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQEMETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>gb|KDO70920.1| hypothetical protein CISIN_1g017089mg [Citrus sinensis]
Length=332

 Score =   199 bits (506),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  231  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  290

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  291  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  331


 Score =   133 bits (335),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  161  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  220

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  221  PSMIGMEAA  229



>gb|AFD62266.1| actin, partial [Persea americana]
Length=186

 Score =   201 bits (510),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  85   IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFSGIADRMSKEITALAPSSMKIKVVAPP  144

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  145  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  185


 Score =   132 bits (331),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETS+TSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  15   AEREIVRDMKEKLAYIALDYEQELETSRTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  74

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  75   PSMIGMEAA  83



>ref|XP_007016432.1| Actin-11 isoform 1 [Theobroma cacao]
 ref|XP_007016433.1| Actin-11 isoform 1 [Theobroma cacao]
 gb|EOY34051.1| Actin-11 isoform 1 [Theobroma cacao]
 gb|EOY34052.1| Actin-11 isoform 1 [Theobroma cacao]
Length=377

 Score =   200 bits (509),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (333),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSA+EKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAIEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_010524532.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
 ref|XP_010524540.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
Length=377

 Score =   200 bits (509),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (332),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQE+ETSKTSS VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQEIETSKTSSTVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>gb|ABK96176.1| unknown [Populus trichocarpa]
Length=294

 Score =   200 bits (508),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  193  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  252

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  253  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  293


 Score =   132 bits (332),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  123  AEREIVRDMKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  182

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  183  PSMIGMEAA  191



>ref|XP_009397437.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
 ref|XP_009397438.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   199 bits (506),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFTGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|KJB76650.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
 gb|KJB76653.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
 gb|KJB76654.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
 gb|KJB76655.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
 gb|KJB76656.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
Length=377

 Score =   199 bits (506),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+KAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|ADK20401.1| actin [Citrus maxima]
Length=377

 Score =   199 bits (506),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (335),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_004142758.1| PREDICTED: actin-1-like [Cucumis sativus]
 ref|XP_008458878.1| PREDICTED: actin-1-like isoform X2 [Cucumis melo]
 gb|KGN51311.1| hypothetical protein Csa_5G517100 [Cucumis sativus]
Length=377

 Score =   198 bits (503),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFSGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   134 bits (337),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_008354115.1| PREDICTED: actin-1 [Malus domestica]
 ref|XP_008354116.1| PREDICTED: actin-1 [Malus domestica]
 ref|XP_009343424.1| PREDICTED: actin-1 [Pyrus x bretschneideri]
Length=377

 Score =   199 bits (506),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (335),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_010528400.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010528408.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010529829.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010529830.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010529831.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010529832.1| PREDICTED: actin-1 [Tarenaya hassleriana]
Length=377

 Score =   200 bits (509),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (332),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELET+KTSSAVEK+YELPDGQVITIG+ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLSYIALDYEQELETAKTSSAVEKNYELPDGQVITIGSERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_010111359.1| hypothetical protein L484_028016 [Morus notabilis]
 gb|EXC30837.1| hypothetical protein L484_028016 [Morus notabilis]
 gb|AID16085.1| actin [Morus alba]
Length=377

 Score =   199 bits (506),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (335),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_010106464.1| hypothetical protein L484_025221 [Morus notabilis]
 gb|EXC10640.1| hypothetical protein L484_025221 [Morus notabilis]
Length=377

 Score =   199 bits (506),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (335),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_003560589.1| PREDICTED: actin-1 [Brachypodium distachyon]
Length=377

 Score =   200 bits (509),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDY+QE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYDQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>ref|XP_004156708.1| PREDICTED: actin-97-like [Cucumis sativus]
Length=382

 Score =   198 bits (503),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  281  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFSGIADRMSKEISALAPSSMKIKVVAPP  340

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  341  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  381


 Score =   134 bits (337),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  211  AEREIVRDMKEKLSYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  270

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  271  PSMIGMEAA  279



>ref|XP_010520033.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
Length=377

 Score =   200 bits (509),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQE+ETSKTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQEMETSKTSSAVEKTYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>ref|XP_006429882.1| hypothetical protein CICLE_v10011974mg [Citrus clementina]
 ref|XP_006492856.1| PREDICTED: actin-like [Citrus sinensis]
 gb|ESR43122.1| hypothetical protein CICLE_v10011974mg [Citrus clementina]
 gb|KDO70918.1| hypothetical protein CISIN_1g017089mg [Citrus sinensis]
 gb|KDO70919.1| hypothetical protein CISIN_1g017089mg [Citrus sinensis]
Length=377

 Score =   199 bits (506),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|AFP43694.1| actin 2, partial [Eriobotrya japonica]
Length=174

 Score =   199 bits (507),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  73   IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  132

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  133  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  173


 Score =   132 bits (333),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  3    AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  62

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  63   PSMIGMEAA  71



>ref|XP_007028993.1| Actin-11 [Theobroma cacao]
 gb|EOY09495.1| Actin-11 [Theobroma cacao]
Length=377

 Score =   199 bits (506),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_007027035.1| Actin 3 [Theobroma cacao]
 gb|EOY07537.1| Actin 3 [Theobroma cacao]
Length=377

 Score =   200 bits (509),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>dbj|BAK06400.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   200 bits (509),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDY+QE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYDQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>ref|XP_007204362.1| hypothetical protein PRUPE_ppa007228mg [Prunus persica]
 ref|XP_008240928.1| PREDICTED: actin-like [Prunus mume]
 ref|XP_008240929.1| PREDICTED: actin-like [Prunus mume]
 ref|XP_008392069.1| PREDICTED: actin-like [Malus domestica]
 ref|XP_008360627.1| PREDICTED: actin [Malus domestica]
 gb|EMJ05561.1| hypothetical protein PRUPE_ppa007228mg [Prunus persica]
Length=377

 Score =   199 bits (506),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_003575839.1| PREDICTED: actin-1-like [Brachypodium distachyon]
 gb|ACO87663.1| actin [Brachypodium sylvaticum]
Length=377

 Score =   200 bits (509),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDY+QE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYDQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>ref|XP_008355144.1| PREDICTED: actin [Malus domestica]
Length=377

 Score =   199 bits (505),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|ADY38689.1| actin [Camellia sinensis]
Length=377

 Score =   199 bits (505),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|ACJ84552.1| unknown [Medicago truncatula]
 gb|AFK42090.1| unknown [Medicago truncatula]
 gb|KEH17435.1| actin-97 [Medicago truncatula]
Length=377

 Score =   200 bits (509),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (330),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 64/68 (94%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGMEA
Sbjct  266  PSMIGMEA  273



>ref|XP_004304361.1| PREDICTED: actin-like [Fragaria vesca subsp. vesca]
 ref|XP_011468046.1| PREDICTED: actin-like [Fragaria vesca subsp. vesca]
Length=377

 Score =   199 bits (506),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_009341422.1| PREDICTED: actin-like [Pyrus x bretschneideri]
Length=377

 Score =   199 bits (505),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_004136568.1| PREDICTED: actin-like [Cucumis sativus]
 ref|XP_004163927.1| PREDICTED: actin-like [Cucumis sativus]
 ref|XP_008380137.1| PREDICTED: actin-like [Malus domestica]
 ref|XP_008443052.1| PREDICTED: actin-like [Cucumis melo]
 ref|XP_009369519.1| PREDICTED: actin-like [Pyrus x bretschneideri]
 gb|KGN59299.1| Actin 3 [Cucumis sativus]
Length=377

 Score =   199 bits (505),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_006379593.1| actin family protein [Populus trichocarpa]
 ref|XP_002311167.2| hypothetical protein POPTR_0008s05560g [Populus trichocarpa]
 gb|ABK92589.1| unknown [Populus trichocarpa]
 gb|ERP57390.1| actin family protein [Populus trichocarpa]
 gb|EEE88534.2| hypothetical protein POPTR_0008s05560g [Populus trichocarpa]
Length=377

 Score =   197 bits (502),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   134 bits (337),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_010554872.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010554874.1| PREDICTED: actin-1 [Tarenaya hassleriana]
Length=377

 Score =   200 bits (509),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (330),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIA+DYEQE+ET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIAVDYEQEMETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>ref|XP_008385127.1| PREDICTED: actin [Malus domestica]
Length=377

 Score =   199 bits (505),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_006350765.1| PREDICTED: actin-like [Solanum tuberosum]
Length=377

 Score =   201 bits (510),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFNGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQEL+TSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQELDTSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_004142070.1| PREDICTED: actin-like [Cucumis sativus]
 ref|XP_004165254.1| PREDICTED: actin-like [Cucumis sativus]
 ref|XP_008447829.1| PREDICTED: actin [Cucumis melo]
 ref|XP_008447838.1| PREDICTED: actin [Cucumis melo]
 ref|XP_008447847.1| PREDICTED: actin [Cucumis melo]
 ref|XP_008447857.1| PREDICTED: actin [Cucumis melo]
 ref|XP_008447866.1| PREDICTED: actin [Cucumis melo]
Length=377

 Score =   199 bits (505),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|AGZ90152.1| actin 11, partial [Litsea cubeba]
Length=377

 Score =   199 bits (505),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|AFN53639.1| putative actin-97 protein [Linum usitatissimum]
Length=377

 Score =   199 bits (505),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|EYU33199.1| hypothetical protein MIMGU_mgv1a008335mg [Erythranthe guttata]
Length=377

 Score =   198 bits (503),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            +HETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  VHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (335),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQE+ETSKTSS+VEKSYELPDGQVITIGNERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQEIETSKTSSSVEKSYELPDGQVITIGNERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS++GMEAA
Sbjct  266  PSMVGMEAA  274



>ref|XP_008241048.1| PREDICTED: actin [Prunus mume]
Length=377

 Score =   199 bits (505),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_002530711.1| actin, putative [Ricinus communis]
 gb|EEF31665.1| actin, putative [Ricinus communis]
Length=377

 Score =   199 bits (505),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_010557948.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
Length=377

 Score =   200 bits (509),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (330),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQE+ETSKT SAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQEMETSKTGSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>ref|XP_006435988.1| hypothetical protein CICLE_v10031847mg [Citrus clementina]
 ref|XP_006435989.1| hypothetical protein CICLE_v10031847mg [Citrus clementina]
 ref|XP_006486101.1| PREDICTED: actin-like isoform X1 [Citrus sinensis]
 ref|XP_006486102.1| PREDICTED: actin-like isoform X2 [Citrus sinensis]
 gb|ESR49228.1| hypothetical protein CICLE_v10031847mg [Citrus clementina]
 gb|ESR49229.1| hypothetical protein CICLE_v10031847mg [Citrus clementina]
Length=377

 Score =   197 bits (501),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   134 bits (337),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_002530851.1| actin, putative [Ricinus communis]
 gb|EEF31525.1| actin, putative [Ricinus communis]
Length=240

 Score =   197 bits (502),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  139  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  198

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  199  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  239


 Score =   134 bits (337),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  69   AEREIVRDMKEKLSYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  128

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  129  PSMIGMEAA  137



>dbj|BAI39620.1| beta actin [Bruguiera gymnorhiza]
Length=297

 Score =   197 bits (502),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  196  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  255

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  256  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  296


 Score =   134 bits (336),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQE+ETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  126  AEREIVRDMKEKLAYIALDYEQEMETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  185

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  186  PSLIGMEAA  194



>gb|KDO67622.1| hypothetical protein CISIN_1g017081mg [Citrus sinensis]
 gb|KDO67623.1| hypothetical protein CISIN_1g017081mg [Citrus sinensis]
 gb|KDO67624.1| hypothetical protein CISIN_1g017081mg [Citrus sinensis]
Length=377

 Score =   197 bits (501),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   134 bits (337),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_011080749.1| PREDICTED: actin-1-like [Sesamum indicum]
 ref|XP_011101608.1| PREDICTED: actin-1-like [Sesamum indicum]
Length=377

 Score =   197 bits (500),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLY N VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYSNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDE+GPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDEAGPSIVHRKC  376


 Score =   134 bits (338),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELET+KTSS+VEKS+ELPDGQVITIGNERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETAKTSSSVEKSFELPDGQVITIGNERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>emb|CDP00088.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   198 bits (504),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFAGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAK+EYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKC  376


 Score =   133 bits (335),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQE+ETSKTSS+VEKSYELPDGQVITIGNERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQEIETSKTSSSVEKSYELPDGQVITIGNERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|AFK40690.1| unknown [Lotus japonicus]
Length=377

 Score =   199 bits (505),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (333),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQE+ETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQEIETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS++GMEAA
Sbjct  266  PSLVGMEAA  274



>ref|XP_010685773.1| PREDICTED: actin-66 [Beta vulgaris subsp. vulgaris]
Length=377

 Score =   200 bits (509),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQE+ET+KTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLSYIALDYEQEMETAKTSSAVEKNYELPDGQVITIGGERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|AHA91827.1| actin-4, partial [Rosa hybrid cultivar]
Length=302

 Score =   199 bits (506),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  201  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  260

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  261  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  301


 Score =   132 bits (331),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  131  AEREIVRDMKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  190

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  191  PSMIGMEAA  199



>gb|EPS69960.1| actin-97 [Genlisea aurea]
Length=377

 Score =   200 bits (508),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLAYIALDYEQELETSKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_004236747.1| PREDICTED: actin-97 [Solanum lycopersicum]
Length=377

 Score =   200 bits (509),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|KHG29811.1| Actin [Gossypium arboreum]
 gb|KJB07135.1| hypothetical protein B456_001G110400 [Gossypium raimondii]
Length=377

 Score =   200 bits (509),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALD+EQELET+KTSS++EKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDFEQELETAKTSSSIEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_002283590.1| PREDICTED: actin-1 [Vitis vinifera]
 ref|XP_010658578.1| PREDICTED: actin-1 [Vitis vinifera]
 ref|XP_010658579.1| PREDICTED: actin-1 [Vitis vinifera]
 ref|XP_010658580.1| PREDICTED: actin-1 [Vitis vinifera]
 emb|CAN83697.1| hypothetical protein VITISV_027542 [Vitis vinifera]
 emb|CBI31677.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   200 bits (508),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEA+
Sbjct  266  PSFIGMEAS  274



>gb|KGN50545.1| hypothetical protein Csa_5G182010 [Cucumis sativus]
Length=257

 Score =   199 bits (505),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  156  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  215

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  216  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  256


 Score =   132 bits (332),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  86   AEREIVRDMKEKLAYIALDYEQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  145

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  146  PSMIGMEAA  154



>ref|XP_010682856.1| PREDICTED: actin-11 [Beta vulgaris subsp. vulgaris]
 ref|XP_010682857.1| PREDICTED: actin-11 [Beta vulgaris subsp. vulgaris]
Length=377

 Score =   200 bits (508),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQE+ET+KTSSAVEKS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQEMETAKTSSAVEKSFELPDGQVITIGGERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>ref|NP_001275087.1| actin-like [Solanum tuberosum]
 gb|ABB55389.1| actin-like [Solanum tuberosum]
Length=377

 Score =   200 bits (509),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>sp|P30171.1|ACT11_SOLTU RecName: Full=Actin-97 [Solanum tuberosum]
 emb|CAA39280.1| actin [Solanum tuberosum]
Length=377

 Score =   200 bits (508),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|EMT21476.1| Actin-1 [Aegilops tauschii]
Length=343

 Score =   199 bits (507),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  242  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMKIKVVAPP  301

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  302  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  342


 Score =   131 bits (330),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDY+QE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  172  AEREIVRDMKEKLSYIALDYDQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  231

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  232  PSFIGMEAA  240



>gb|KEH24717.1| actin-97 [Medicago truncatula]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (332),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV +Q
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLYQ  265

Query  564  PSIIGMEAA  538
            PS++GMEAA
Sbjct  266  PSMVGMEAA  274



>gb|AEF58501.1| actin [Platycodon grandiflorus]
Length=377

 Score =   199 bits (506),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|KHG15514.1| Actin [Gossypium arboreum]
Length=377

 Score =   201 bits (511),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFAGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALD+EQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLAYIALDFEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_008345452.1| PREDICTED: actin [Malus domestica]
Length=360

 Score =   199 bits (506),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  259  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  318

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  319  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  359


 Score =   132 bits (331),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  189  AEREIVRDMKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  248

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  249  PSMIGMEAA  257



>gb|KHG29096.1| Actin [Gossypium arboreum]
Length=377

 Score =   200 bits (509),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (328),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALD+EQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDFEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>dbj|BAJ85474.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   200 bits (509),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (328),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDY+QE+ETSKTSS+VEKSYELPDGQVITIG+ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYDQEMETSKTSSSVEKSYELPDGQVITIGSERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>ref|XP_009625006.1| PREDICTED: actin-like [Nicotiana tomentosiformis]
 ref|XP_009625007.1| PREDICTED: actin-like [Nicotiana tomentosiformis]
Length=377

 Score =   199 bits (507),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFNGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (330),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALD+EQELETSKTSS+VEKSYELPDGQVITIG+ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDFEQELETSKTSSSVEKSYELPDGQVITIGSERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_009353688.1| PREDICTED: actin [Pyrus x bretschneideri]
Length=377

 Score =   198 bits (503),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMS+EITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSREITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_004489182.1| PREDICTED: actin-like [Cicer arietinum]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (332),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV +Q
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLYQ  265

Query  564  PSIIGMEAA  538
            PS++GMEAA
Sbjct  266  PSMVGMEAA  274



>ref|XP_010036489.1| PREDICTED: actin [Eucalyptus grandis]
 gb|KCW48106.1| hypothetical protein EUGRSUZ_K01841 [Eucalyptus grandis]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGME+A
Sbjct  266  PSMIGMESA  274



>ref|XP_002308365.1| actin family protein [Populus trichocarpa]
 ref|XP_002322664.1| actin family protein [Populus trichocarpa]
 ref|XP_011033209.1| PREDICTED: actin [Populus euphratica]
 ref|XP_011004840.1| PREDICTED: actin [Populus euphratica]
 ref|XP_011013244.1| PREDICTED: actin [Populus euphratica]
 gb|ABK92789.1| unknown [Populus trichocarpa]
 gb|ABK93722.1| unknown [Populus trichocarpa]
 gb|ABK95521.1| unknown [Populus trichocarpa]
 gb|EEE91888.1| actin family protein [Populus trichocarpa]
 gb|EEF04425.1| actin family protein [Populus trichocarpa]
 gb|ADK70741.1| actin [Populus tomentosa]
 gb|ADK70742.1| actin [Populus tomentosa]
 gb|ADK70743.1| actin [Populus tomentosa]
 gb|ADK70744.1| actin [Populus tomentosa]
 gb|ADK70745.1| actin [Populus tomentosa]
 gb|ADK70746.1| actin [Populus tomentosa]
 gb|ADK70747.1| actin [Populus tomentosa]
 gb|ADK70748.1| actin [Populus tomentosa]
 gb|ADK70749.1| actin [Populus tomentosa]
 gb|ADK70750.1| actin [Populus tomentosa]
 gb|ADK70751.1| actin [Populus tomentosa]
 gb|ADK70752.1| actin [Populus tomentosa]
 gb|ADK70753.1| actin [Populus tomentosa]
 gb|ADK70754.1| actin [Populus tomentosa]
 gb|ADK70755.1| actin [Populus tomentosa]
 gb|ADK70756.1| actin [Populus tomentosa]
 gb|ADK70757.1| actin [Populus tomentosa]
 gb|ADK70758.1| actin [Populus tomentosa]
 gb|ADK70759.1| actin [Populus tomentosa]
 gb|ADK70760.1| actin [Populus tomentosa]
 gb|ADK70761.1| actin [Populus tomentosa]
 gb|ADK70762.1| actin [Populus tomentosa]
 gb|ADK70763.1| actin [Populus tomentosa]
 gb|ADK70764.1| actin [Populus tomentosa]
 gb|ADK70765.1| actin [Populus tomentosa]
 gb|ADK70766.1| actin [Populus tomentosa]
 gb|ADK70767.1| actin [Populus tomentosa]
 gb|ADK70768.1| actin [Populus tomentosa]
 gb|ADK70769.1| actin [Populus tomentosa]
 gb|ADK70770.1| actin [Populus tomentosa]
 gb|ADK70771.1| actin [Populus tomentosa]
 gb|ADK70772.1| actin [Populus tomentosa]
 gb|ADK70773.1| actin [Populus tomentosa]
 gb|ADK70774.1| actin [Populus tomentosa]
 gb|ADK70775.1| actin [Populus tomentosa]
 gb|ADK70776.1| actin [Populus tomentosa]
 gb|ADK70777.1| actin [Populus tomentosa]
 gb|ADK70778.1| actin [Populus tomentosa]
 gb|ADK70779.1| actin [Populus tomentosa]
 gb|ADK70780.1| actin [Populus tomentosa]
 gb|ADK70781.1| actin [Populus tomentosa]
 gb|AFZ78524.1| actin [Populus tomentosa]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_006424815.1| hypothetical protein CICLE_v10028665mg [Citrus clementina]
 ref|XP_006424816.1| hypothetical protein CICLE_v10028665mg [Citrus clementina]
 ref|XP_006488313.1| PREDICTED: actin-like [Citrus sinensis]
 gb|ESR38055.1| hypothetical protein CICLE_v10028665mg [Citrus clementina]
 gb|ESR38056.1| hypothetical protein CICLE_v10028665mg [Citrus clementina]
Length=377

 Score =   199 bits (506),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGME+A
Sbjct  266  PSMIGMESA  274



>ref|XP_010265918.1| PREDICTED: actin [Nelumbo nucifera]
 ref|XP_010265919.1| PREDICTED: actin [Nelumbo nucifera]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_004302738.1| PREDICTED: actin [Fragaria vesca subsp. vesca]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|NP_001051086.1| Os03g0718100 [Oryza sativa Japonica Group]
 sp|Q10DV7.1|ACT1_ORYSJ RecName: Full=Actin-1; AltName: Full=OsRAC1 [Oryza sativa Japonica 
Group]
 sp|A2XLF2.1|ACT1_ORYSI RecName: Full=Actin-1 [Oryza sativa Indica Group]
 dbj|BAC76319.1| actin [Oryza sativa Japonica Group]
 gb|ABF98567.1| Actin-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13000.1| Os03g0718100 [Oryza sativa Japonica Group]
 gb|EAY91662.1| hypothetical protein OsI_13301 [Oryza sativa Indica Group]
 gb|EAZ28382.1| hypothetical protein OsJ_12362 [Oryza sativa Japonica Group]
 gb|AGT42318.1| actin-1 [Oryza sativa Japonica Group]
Length=377

 Score =   200 bits (509),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (328),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDY+QE+ET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYDQEMETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>ref|XP_006595018.1| PREDICTED: actin-like isoform X1 [Glycine max]
 ref|XP_006595019.1| PREDICTED: actin-like isoform X2 [Glycine max]
 ref|XP_006595020.1| PREDICTED: actin-like isoform X3 [Glycine max]
 gb|KHN30176.1| Actin-97 [Glycine soja]
Length=377

 Score =   199 bits (506),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYLALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGMEA
Sbjct  266  PSMIGMEA  273



>ref|XP_008363858.1| PREDICTED: LOW QUALITY PROTEIN: actin-like [Malus domestica]
 ref|XP_009338750.1| PREDICTED: actin-like [Pyrus x bretschneideri]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|AEO45960.1| actin 4 [Mangifera indica]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>sp|O81221.1|ACT_GOSHI RecName: Full=Actin [Gossypium hirsutum]
 gb|AAC31886.1| actin [Gossypium hirsutum]
 gb|KHG26781.1| Actin [Gossypium arboreum]
 gb|KJB21624.1| hypothetical protein B456_004G004900 [Gossypium raimondii]
Length=377

 Score =   200 bits (509),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (327),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSS++EKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETSKTSSSIEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_007205366.1| hypothetical protein PRUPE_ppa007219mg [Prunus persica]
 ref|XP_008223466.1| PREDICTED: actin [Prunus mume]
 gb|EMJ06565.1| hypothetical protein PRUPE_ppa007219mg [Prunus persica]
Length=377

 Score =   199 bits (505),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGME+A
Sbjct  266  PSMIGMESA  274



>gb|AEL88913.1| actin [Halodule beaudettei]
Length=289

 Score =   202 bits (513),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  188  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  247

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  248  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  288


 Score =   129 bits (323),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYE+ELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  118  AEREIVRDMKEKLAYIALDYERELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  177

Query  564  PSIIGMEAA  538
            PS+IGME A
Sbjct  178  PSMIGMEVA  186



>ref|XP_004307518.1| PREDICTED: actin-97-like [Fragaria vesca subsp. vesca]
 ref|XP_011469775.1| PREDICTED: actin-97-like [Fragaria vesca subsp. vesca]
 ref|XP_011469776.1| PREDICTED: actin-97-like [Fragaria vesca subsp. vesca]
Length=377

 Score =   197 bits (502),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|AIO05828.1| actin [Lycium chinense]
Length=186

 Score =   200 bits (508),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  85   IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  144

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  145  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  185


 Score =   130 bits (328),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  15   AEREIVRDVKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  74

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  75   PSMIGMEAA  83



>gb|AAC49651.1| actin [Striga asiatica]
Length=377

 Score =   200 bits (509),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (327),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLAYIALDYEQELETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>sp|P30167.1|ACT3_SOLTU RecName: Full=Actin-58 [Solanum tuberosum]
 emb|CAA39278.1| actin [Solanum tuberosum]
Length=377

 Score =   199 bits (507),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKE+TALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKELTALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALD+EQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDFEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>ref|XP_010690498.1| PREDICTED: actin-1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690505.1| PREDICTED: actin-1 [Beta vulgaris subsp. vulgaris]
Length=377

 Score =   200 bits (508),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (327),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQE+ET+KTSS+VEKS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQEMETAKTSSSVEKSFELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>ref|XP_007205365.1| hypothetical protein PRUPE_ppa007214mg [Prunus persica]
 gb|EMJ06564.1| hypothetical protein PRUPE_ppa007214mg [Prunus persica]
Length=377

 Score =   199 bits (505),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (330),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELET+KT S+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETAKTGSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|NP_001276160.1| actin-11-like [Glycine max]
 gb|ACU21101.1| unknown [Glycine max]
Length=377

 Score =   199 bits (505),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (330),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELET++TSS+VEKSYELPDGQVITIG+ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEA+
Sbjct  266  PSMIGMEAS  274



>tpg|DAA51050.1| TPA: putative actin family protein [Zea mays]
Length=186

 Score =   201 bits (511),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  85   IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  144

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  145  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  185


 Score =   129 bits (324),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDY+QE+ET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  15   AEREIVRDMKEKLAYIALDYDQEMETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  74

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  75   PSFIGMEAA  83



>ref|XP_006345961.1| PREDICTED: actin-58-like [Solanum tuberosum]
Length=377

 Score =   199 bits (506),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKE+TALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKELTALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALD+EQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDFEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>dbj|BAF68887.1| actin 3, partial [Torenia fournieri]
Length=290

 Score =   200 bits (508),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  189  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  248

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  249  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  289


 Score =   130 bits (327),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  119  AEREIVRDIKEKLAYIALDYEQELETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQ  178

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  179  PSMIGMEAA  187



>ref|NP_190236.1| actin-12 [Arabidopsis thaliana]
 ref|XP_002864629.1| actin-12 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002875788.1| actin-12 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006291307.1| hypothetical protein CARUB_v10017441mg [Capsella rubella]
 ref|XP_010503262.1| PREDICTED: actin-12 [Camelina sativa]
 ref|XP_010514974.1| PREDICTED: actin-12 [Camelina sativa]
 ref|XP_010426084.1| PREDICTED: actin-12 [Camelina sativa]
 ref|XP_010483556.1| PREDICTED: actin-12 [Camelina sativa]
 ref|XP_010483559.1| PREDICTED: actin-12 [Camelina sativa]
 ref|XP_010483560.1| PREDICTED: actin-12 [Camelina sativa]
 sp|P53497.1|ACT12_ARATH RecName: Full=Actin-12 [Arabidopsis thaliana]
 gb|AAB39405.1| actin-12 [Arabidopsis thaliana]
 emb|CAB62322.1| actin 12 [Arabidopsis thaliana]
 gb|AAO41897.1| putative actin 12 [Arabidopsis thaliana]
 gb|AAO50606.1| putative actin 12 [Arabidopsis thaliana]
 gb|EFH40888.1| actin-12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52047.1| actin-12 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE78168.1| actin-12 [Arabidopsis thaliana]
 gb|EOA24205.1| hypothetical protein CARUB_v10017441mg [Capsella rubella]
Length=377

 Score =   201 bits (512),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MFGG  DRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (323),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 62/67 (93%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETSKTSS+VEKS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETSKTSSSVEKSFELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGME  544
            PS+IGME
Sbjct  266  PSMIGME  272



>ref|XP_010454923.1| PREDICTED: actin-12-like [Camelina sativa]
Length=377

 Score =   201 bits (512),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MFGG  DRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (323),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 62/67 (93%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETSKTSS+VEKS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETSKTSSSVEKSFELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGME  544
            PS+IGME
Sbjct  266  PSMIGME  272



>ref|XP_002316289.1| actin family protein [Populus trichocarpa]
 ref|XP_011027194.1| PREDICTED: actin-97-like [Populus euphratica]
 ref|XP_011027195.1| PREDICTED: actin-97-like [Populus euphratica]
 gb|ABK92513.1| unknown [Populus trichocarpa]
 gb|EEF02460.1| actin family protein [Populus trichocarpa]
Length=377

 Score =   197 bits (502),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (333),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSTVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|AEL88911.1| actin [Halodule beaudettei]
 gb|AEL88912.1| actin, partial [Halodule beaudettei]
Length=289

 Score =   202 bits (513),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  188  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  247

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  248  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  288


 Score =   128 bits (322),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYE+ELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  118  AEREIVRDMKEKLAYIALDYERELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  177

Query  564  PSIIGMEAA  538
            PS+IGME A
Sbjct  178  PSMIGMEVA  186



>gb|ABY66084.1| actin [Dimocarpus longan]
Length=242

 Score =   201 bits (511),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  141  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFNGIADRMSKEITALAPSSMKIKVVAPP  200

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  201  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  241


 Score =   129 bits (324),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELE +K+SSA+EKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  71   AEREIVRDMKEKLAYVALDYEQELEAAKSSSAIEKSYELPDGQVITIGAERFRCPEVLFQ  130

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  131  PSMIGMEAA  139



>ref|XP_010936865.1| PREDICTED: actin [Elaeis guineensis]
Length=377

 Score =   200 bits (509),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_003547359.1| PREDICTED: actin-like isoform X1 [Glycine max]
 ref|XP_006597274.1| PREDICTED: actin-like isoform X2 [Glycine max]
 ref|XP_006597275.1| PREDICTED: actin-like isoform X3 [Glycine max]
 ref|XP_006597276.1| PREDICTED: actin-like isoform X4 [Glycine max]
 gb|KHN33389.1| Actin [Glycine soja]
Length=377

 Score =   199 bits (505),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGMEA
Sbjct  266  PSMIGMEA  273



>ref|XP_007218136.1| hypothetical protein PRUPE_ppa007236mg [Prunus persica]
 ref|XP_008233620.1| PREDICTED: actin-1 [Prunus mume]
 gb|EMJ19335.1| hypothetical protein PRUPE_ppa007236mg [Prunus persica]
Length=377

 Score =   199 bits (506),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQE+ET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQEMETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_007150869.1| hypothetical protein PHAVU_004G001000g [Phaseolus vulgaris]
 gb|ESW22863.1| hypothetical protein PHAVU_004G001000g [Phaseolus vulgaris]
Length=377

 Score =   199 bits (505),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV +Q
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLYQ  265

Query  564  PSIIGMEAA  538
            PS++GMEAA
Sbjct  266  PSMVGMEAA  274



>ref|XP_007009346.1| Actin-11 isoform 1 [Theobroma cacao]
 gb|EOY18156.1| Actin-11 isoform 1 [Theobroma cacao]
Length=377

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAK EYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKTEYDESGPSIVHRKC  376


 Score =   134 bits (337),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|KHF99778.1| Actin [Gossypium arboreum]
 gb|KJB83781.1| hypothetical protein B456_013G264100 [Gossypium raimondii]
 gb|KJB83782.1| hypothetical protein B456_013G264100 [Gossypium raimondii]
 gb|KJB83783.1| hypothetical protein B456_013G264100 [Gossypium raimondii]
 gb|KJB83784.1| hypothetical protein B456_013G264100 [Gossypium raimondii]
Length=377

 Score =   200 bits (509),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALD+EQELET+KTSS++EKSYELPDGQVITIG+ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDFEQELETAKTSSSIEKSYELPDGQVITIGSERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_006351346.1| PREDICTED: actin-58-like [Solanum tuberosum]
 ref|XP_010312150.1| PREDICTED: actin-66 [Solanum lycopersicum]
 ref|XP_010312151.1| PREDICTED: actin-66 [Solanum lycopersicum]
Length=377

 Score =   200 bits (509),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQE+ET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQEIETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_004294508.1| PREDICTED: actin-1 [Fragaria vesca subsp. vesca]
Length=377

 Score =   199 bits (506),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYLALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_007150318.1| hypothetical protein PHAVU_005G143500g [Phaseolus vulgaris]
 gb|ESW22312.1| hypothetical protein PHAVU_005G143500g [Phaseolus vulgaris]
Length=377

 Score =   199 bits (505),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (330),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGMEA
Sbjct  266  PSMIGMEA  273



>ref|XP_004981971.1| PREDICTED: actin-1-like isoform X2 [Setaria italica]
Length=382

 Score =   200 bits (509),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  281  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  340

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  341  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  381


 Score =   129 bits (325),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDY+QE+ET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  211  AEREIVRDMKEKLAYIALDYDQEMETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  270

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  271  PSFIGMEAA  279



>ref|XP_004250955.1| PREDICTED: actin-97-like [Solanum lycopersicum]
Length=377

 Score =   200 bits (508),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQE+ETSKTSS VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQEIETSKTSSNVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_004239790.1| PREDICTED: actin-58 [Solanum lycopersicum]
Length=377

 Score =   199 bits (506),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKE+TALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKELTALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (328),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALD+EQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDFEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_011078821.1| PREDICTED: actin [Sesamum indicum]
 ref|XP_011078822.1| PREDICTED: actin [Sesamum indicum]
Length=377

 Score =   199 bits (505),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELET+KTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLSYIALDYEQELETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|KHG27347.1| Actin [Gossypium arboreum]
Length=377

 Score =   197 bits (500),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEIKALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+KAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKC  376


 Score =   133 bits (334),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_009802880.1| PREDICTED: actin-like [Nicotiana sylvestris]
 ref|XP_009802881.1| PREDICTED: actin-like [Nicotiana sylvestris]
Length=377

 Score =   199 bits (507),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFNGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (328),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALD+EQEL+TSKTSS+VEKSYELPDGQVITIG+ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDFEQELDTSKTSSSVEKSYELPDGQVITIGSERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|EPS68331.1| hypothetical protein M569_06438, partial [Genlisea aurea]
Length=379

 Score =   201 bits (510),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  278  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  337

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  338  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  378


 Score =   129 bits (324),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETSKT+S+VEKS+ELPDGQVITIGNERFR PEV FQ
Sbjct  208  AEREIVRDMKEKLSYIALDYEQELETSKTTSSVEKSFELPDGQVITIGNERFRAPEVLFQ  267

Query  564  PSIIGMEAA  538
            PS++GMEA+
Sbjct  268  PSMVGMEAS  276



>gb|KJB36724.1| hypothetical protein B456_006G173100 [Gossypium raimondii]
Length=377

 Score =   201 bits (511),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFAGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (323),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALD+EQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLAYIALDFEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>dbj|BAK52268.1| beta actin [Rhizophora stylosa]
Length=297

 Score =   196 bits (498),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ LAPSSMKIKVVAPP
Sbjct  196  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISGLAPSSMKIKVVAPP  255

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  256  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  296


 Score =   134 bits (336),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQE+ETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  126  AEREIVRDMKEKLAYIALDYEQEMETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  185

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  186  PSLIGMEAA  194



>ref|NP_001150462.1| LOC100284092 [Zea mays]
 ref|XP_004981970.1| PREDICTED: actin-1-like isoform X1 [Setaria italica]
 ref|XP_006650501.1| PREDICTED: actin-1-like [Oryza brachyantha]
 ref|XP_008678181.1| PREDICTED: LOC100284092 isoform X1 [Zea mays]
 ref|XP_008644563.1| PREDICTED: actin-1 [Zea mays]
 gb|ACG39191.1| actin-1 [Zea mays]
 gb|AFW67797.1| putative actin family protein isoform 1 [Zea mays]
 gb|AFW67798.1| putative actin family protein isoform 2 [Zea mays]
 tpg|DAA51047.1| TPA: putative actin family protein isoform 1 [Zea mays]
 tpg|DAA51048.1| TPA: putative actin family protein isoform 2 [Zea mays]
 gb|AGY80447.1| actin [Dendrocalamus latiflorus]
Length=377

 Score =   200 bits (509),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDY+QE+ET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYDQEMETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>ref|XP_003622020.1| Actin [Medicago truncatula]
Length=360

 Score =   199 bits (505),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  259  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  318

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  319  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  359


 Score =   131 bits (329),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELET++TSS+VEKSYELPDGQVITIG+ERFRCPEV FQ
Sbjct  189  AEREIVRDVKEKLSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQ  248

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  249  PSMIGMEAA  257



>gb|KJB16973.1| hypothetical protein B456_002G257900 [Gossypium raimondii]
Length=377

 Score =   200 bits (509),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALD+EQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDFEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|AAF40438.1|AF234528_2 actin 1 [Avena nuda]
Length=377

 Score =   200 bits (509),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDY+QE+ETS TSS VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYDQEMETSNTSSTVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>ref|XP_009621805.1| PREDICTED: actin-like [Nicotiana tomentosiformis]
 ref|XP_009780859.1| PREDICTED: actin [Nicotiana sylvestris]
 ref|XP_009780860.1| PREDICTED: actin [Nicotiana sylvestris]
Length=377

 Score =   200 bits (508),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|KDP44962.1| hypothetical protein JCGZ_01462 [Jatropha curcas]
Length=377

 Score =   197 bits (501),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (333),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV +Q
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLYQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_009591335.1| PREDICTED: actin-97 [Nicotiana tomentosiformis]
Length=377

 Score =   199 bits (505),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|ADX97327.1| actin 7 [Mangifera indica]
Length=377

 Score =   198 bits (503),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G  +RMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFAGIGERMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_006855625.1| hypothetical protein AMTR_s00044p00088410 [Amborella trichopoda]
 gb|ERN17092.1| hypothetical protein AMTR_s00044p00088410 [Amborella trichopoda]
Length=398

 Score =   199 bits (506),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  297  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  356

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  357  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  397


 Score =   130 bits (328),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET++TSS VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  227  AEREIVRDMKEKLAYIALDYEQELETARTSSTVEKSYELPDGQVITIGAERFRCPEVLFQ  286

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  287  PSMIGMEAA  295



>gb|ADE05541.1| actin [Liriodendron tulipifera]
Length=184

 Score =   200 bits (508),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  83   IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  142

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  143  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  183


 Score =   130 bits (326),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+K+SS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  13   AEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  72

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  73   PSLIGMEAA  81



>gb|KEH39427.1| actin-97 [Medicago truncatula]
Length=377

 Score =   200 bits (509),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (324),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALD+EQELETSKTSSAVEKSYELPDGQ+ITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDFEQELETSKTSSAVEKSYELPDGQIITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS++GMEA
Sbjct  266  PSMVGMEA  273



>ref|XP_008798327.1| PREDICTED: actin [Phoenix dactylifera]
Length=377

 Score =   199 bits (505),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (328),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELE SKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELEMSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>emb|CDP10143.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   198 bits (504),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGME+A
Sbjct  266  PSMIGMESA  274



>ref|XP_003622019.1| Actin [Medicago truncatula]
 gb|AES78237.1| actin-97 [Medicago truncatula]
Length=377

 Score =   199 bits (505),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELET++TSS+VEKSYELPDGQVITIG+ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_004147692.1| PREDICTED: actin-97-like [Cucumis sativus]
 ref|XP_004169160.1| PREDICTED: actin-97-like [Cucumis sativus]
 ref|XP_008461663.1| PREDICTED: actin-97-like [Cucumis melo]
 ref|XP_008461664.1| PREDICTED: actin-97-like [Cucumis melo]
Length=377

 Score =   197 bits (502),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   132 bits (332),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|ACK87035.1| actin [Caragana korshinskii]
Length=377

 Score =   199 bits (505),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (327),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGMEA
Sbjct  266  PSMIGMEA  273



>gb|KJB20092.1| hypothetical protein B456_003G132400 [Gossypium raimondii]
Length=377

 Score =   200 bits (509),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (324),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALD+EQELETSKTSS++EKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDFEQELETSKTSSSIEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|AHY94895.1| actin [Prunella vulgaris]
Length=377

 Score =   199 bits (506),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (327),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLAYIALDYEQELETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|NP_001241178.1| uncharacterized protein LOC100807341 [Glycine max]
 gb|ACU17933.1| unknown [Glycine max]
 gb|KHN45436.1| Actin-3 [Glycine soja]
Length=377

 Score =   199 bits (506),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (327),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGME+
Sbjct  266  PSMIGMES  273



>gb|KHN27489.1| Actin-97 [Glycine soja]
Length=332

 Score =   199 bits (506),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  231  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  290

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  291  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  331


 Score =   130 bits (326),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV +Q
Sbjct  161  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLYQ  220

Query  564  PSIIGMEAA  538
            PS++GMEA+
Sbjct  221  PSMVGMEAS  229



>gb|KHN24335.1| Actin-97 [Glycine soja]
Length=332

 Score =   199 bits (506),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  231  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  290

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  291  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  331


 Score =   130 bits (326),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELET++TSS+VEKSYELPDGQVITIG+ERFRCPEV FQ
Sbjct  161  AEREIVRDVKEKLSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQ  220

Query  564  PSIIGMEAA  538
            PS+IGMEA+
Sbjct  221  PSMIGMEAS  229



>gb|AFD62269.1| actin 2 [Annona cherimola]
Length=377

 Score =   199 bits (505),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (327),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+K+SS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>ref|NP_200745.1| actin 4 [Arabidopsis thaliana]
 ref|NP_001078769.1| actin 4 [Arabidopsis thaliana]
 sp|P53494.1|ACT4_ARATH RecName: Full=Actin-4 [Arabidopsis thaliana]
 gb|AAB39403.1| actin-4 [Arabidopsis thaliana]
 dbj|BAA97473.1| actin 4 [Arabidopsis thaliana]
 gb|AED97176.1| actin 4 [Arabidopsis thaliana]
 gb|AED97177.1| actin 4 [Arabidopsis thaliana]
Length=377

 Score =   201 bits (512),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MFGG  DRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (320),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALD+EQELETSKTSS+VEKS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDFEQELETSKTSSSVEKSFELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGME  544
            PS+IGME
Sbjct  266  PSMIGME  272



>gb|AFZ78526.1| actin [Populus tomentosa]
Length=377

 Score =   197 bits (502),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (330),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDY+QELETSKTSS VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYDQELETSKTSSTVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|AAM65657.1| actin 4 [Arabidopsis thaliana]
Length=377

 Score =   201 bits (512),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MFGG  DRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (320),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALD+EQELETSKTSS+VEKS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDFEQELETSKTSSSVEKSFELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGME  544
            PS+IGME
Sbjct  266  PSMIGME  272



>gb|AGV54465.1| actin-3-like protein [Phaseolus vulgaris]
Length=377

 Score =   199 bits (505),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (327),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGME+
Sbjct  266  PSMIGMES  273



>gb|KJB76085.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
 gb|KJB76086.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
 gb|KJB76089.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
 gb|KJB76090.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
Length=377

 Score =   196 bits (499),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKE++ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKELSALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGP+IVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPAIVHRKC  376


 Score =   132 bits (332),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>ref|XP_007162325.1| hypothetical protein PHAVU_001G142500g [Phaseolus vulgaris]
 gb|ESW34319.1| hypothetical protein PHAVU_001G142500g [Phaseolus vulgaris]
Length=377

 Score =   199 bits (505),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGME+
Sbjct  266  PSMIGMES  273



>ref|XP_011029076.1| PREDICTED: actin-97-like [Populus euphratica]
 ref|XP_011029142.1| PREDICTED: actin-97-like [Populus euphratica]
Length=377

 Score =   194 bits (494),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKV APP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVGAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   134 bits (337),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|AAF31643.1|AF143208_1 actin [Vigna radiata]
Length=377

 Score =   199 bits (505),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGME+
Sbjct  266  PSMIGMES  273



>gb|ADK11998.1| putative actin protein [Salvia miltiorrhiza]
Length=377

 Score =   199 bits (505),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (327),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLAYIALDYEQELETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_006282193.1| hypothetical protein CARUB_v10028459mg [Capsella rubella]
 gb|EOA15091.1| hypothetical protein CARUB_v10028459mg [Capsella rubella]
Length=377

 Score =   201 bits (512),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MFGG  DRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (320),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETS+TSS+VEKS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETSQTSSSVEKSFELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGME  544
            PS+IGME
Sbjct  266  PSMIGME  272



>gb|KHF98940.1| hypothetical protein F383_05741 [Gossypium arboreum]
 gb|KJB12121.1| hypothetical protein B456_002G001500 [Gossypium raimondii]
 gb|KJB12122.1| hypothetical protein B456_002G001500 [Gossypium raimondii]
 gb|KJB12123.1| hypothetical protein B456_002G001500 [Gossypium raimondii]
Length=376

 Score =   198 bits (503),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  275  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  334

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+KAEYDESGP+IVHRKC
Sbjct  335  ERKYSVWIGGSILASLSTFQQMWISKAEYDESGPAIVHRKC  375


 Score =   130 bits (328),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+K+SSA+EKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  205  AEREIVRDMKEKLAYVALDYEQELETAKSSSAIEKSYELPDGQVITIGAERFRCPEVLFQ  264

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  265  PSLIGMEAA  273



>ref|XP_008795328.1| PREDICTED: actin-1 [Phoenix dactylifera]
Length=377

 Score =   199 bits (506),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELE +KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELEMAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_004487013.1| PREDICTED: actin-like [Cicer arietinum]
Length=377

 Score =   199 bits (506),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETSKTSSAVEKTYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGMEA
Sbjct  266  PSMIGMEA  273



>gb|AIY27746.1| actin, partial [Betula luminifera]
Length=240

 Score =   196 bits (499),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  139  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  198

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAK+EYDESGP IVHRKC
Sbjct  199  ERKYSVWIGGSILASLSTFQQMWIAKSEYDESGPPIVHRKC  239


 Score =   132 bits (331),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  69   AEREIVRDMKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  128

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  129  PSMIGMEAA  137



>ref|XP_009150245.1| PREDICTED: actin-12 [Brassica rapa]
 emb|CDY21777.1| BnaA06g20460D [Brassica napus]
Length=377

 Score =   201 bits (512),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MFGG  DRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (319),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETS TSS+VEKS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETSNTSSSVEKSFELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGME  544
            PS+IGME
Sbjct  266  PSMIGME  272



>gb|KDP24628.1| hypothetical protein JCGZ_25544 [Jatropha curcas]
Length=377

 Score =   199 bits (505),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALD+EQELE +KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDFEQELEMAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_003537995.1| PREDICTED: actin-like isoform X1 [Glycine max]
 ref|XP_006590987.1| PREDICTED: actin-like isoform X2 [Glycine max]
 gb|KHN21957.1| Actin-97 [Glycine soja]
Length=377

 Score =   196 bits (499),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDE+GPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDEAGPSIVHRKC  376


 Score =   132 bits (332),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>emb|CDY48688.1| BnaC02g10000D [Brassica napus]
Length=340

 Score =   202 bits (515),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MFGG  DRMSKEITALAPSSMKIKVVAPP
Sbjct  239  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPP  298

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  299  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  339


 Score =   126 bits (316),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETS TSS+V+KS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  169  AEREIVRDMKEKLSYIALDYEQELETSNTSSSVDKSFELPDGQVITIGAERFRCPEVLFQ  228

Query  564  PSIIGME  544
            PS+IGME
Sbjct  229  PSMIGME  235



>emb|CDX82985.1| BnaA01g19850D [Brassica napus]
Length=377

 Score =   201 bits (512),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MFGG  DRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (319),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETS TSS+VEKS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETSNTSSSVEKSFELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGME  544
            PS+IGME
Sbjct  266  PSMIGME  272



>ref|XP_009131999.1| PREDICTED: actin-12-like [Brassica rapa]
 ref|XP_009149973.1| PREDICTED: actin-12-like [Brassica rapa]
 ref|XP_009120445.1| PREDICTED: actin-12 [Brassica rapa]
 emb|CDX99111.1| BnaA06g18020D [Brassica napus]
 emb|CDX88698.1| BnaA03g09510D [Brassica napus]
 emb|CDX86081.1| BnaC03g55960D [Brassica napus]
 emb|CDX71119.1| BnaC03g12030D [Brassica napus]
Length=377

 Score =   201 bits (512),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MFGG  DRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (319),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETS TSS+VEKS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETSNTSSSVEKSFELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGME  544
            PS+IGME
Sbjct  266  PSMIGME  272



>gb|KDO72871.1| hypothetical protein CISIN_1g017125mg [Citrus sinensis]
Length=377

 Score =   199 bits (505),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+K SSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKISSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGME+A
Sbjct  266  PSMIGMESA  274



>ref|XP_006418890.1| hypothetical protein EUTSA_v10002572mg [Eutrema salsugineum]
 gb|ESQ37326.1| hypothetical protein EUTSA_v10002572mg [Eutrema salsugineum]
Length=377

 Score =   201 bits (512),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MFGG  DRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (319),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELE SKTSS+VEKS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELEASKTSSSVEKSFELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGME  544
            PS+IGME
Sbjct  266  PSMIGME  272



>ref|XP_004241231.1| PREDICTED: actin-82 [Solanum lycopersicum]
Length=377

 Score =   200 bits (509),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   128 bits (322),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQEL+TS T+S+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQELDTSNTNSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_009618901.1| PREDICTED: actin [Nicotiana tomentosiformis]
 ref|XP_009618902.1| PREDICTED: actin [Nicotiana tomentosiformis]
Length=377

 Score =   199 bits (505),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALD+EQE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDFEQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_006854536.1| hypothetical protein AMTR_s00030p00045700 [Amborella trichopoda]
 gb|ERN16003.1| hypothetical protein AMTR_s00030p00045700 [Amborella trichopoda]
Length=377

 Score =   199 bits (505),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+K+SS++EKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYVALDYEQELETAKSSSSIEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>ref|NP_001239953.1| uncharacterized protein LOC100798523 [Glycine max]
 ref|XP_006579420.1| PREDICTED: uncharacterized protein LOC100798523 isoform X1 [Glycine 
max]
 ref|XP_006579421.1| PREDICTED: uncharacterized protein LOC100798523 isoform X2 [Glycine 
max]
 gb|ACU18758.1| unknown [Glycine max]
 gb|KHN19706.1| Actin [Glycine soja]
Length=377

 Score =   199 bits (505),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV +Q
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLYQ  265

Query  564  PSIIGMEAA  538
            PS++GMEA+
Sbjct  266  PSMVGMEAS  274



>ref|XP_009587904.1| PREDICTED: actin-97-like [Nicotiana tomentosiformis]
Length=377

 Score =   199 bits (505),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSS+VEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETSKTSSSVEKNYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_004492148.1| PREDICTED: actin-11-like [Cicer arietinum]
 ref|XP_007139215.1| hypothetical protein PHAVU_008G011000g [Phaseolus vulgaris]
 gb|ESW11209.1| hypothetical protein PHAVU_008G011000g [Phaseolus vulgaris]
Length=377

 Score =   198 bits (504),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET++TSS+VEKSYELPDGQVITIG+ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_003553313.1| PREDICTED: actin-like [Glycine max]
Length=377

 Score =   199 bits (505),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV +Q
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLYQ  265

Query  564  PSIIGMEAA  538
            PS++GMEA+
Sbjct  266  PSMVGMEAS  274



>gb|KHN13906.1| Actin-11 [Glycine soja]
Length=377

 Score =   199 bits (505),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELET++TSS+VEKSYELPDGQVITIG+ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEA+
Sbjct  266  PSMIGMEAS  274



>gb|AAC49652.1| actin [Striga asiatica]
Length=377

 Score =   199 bits (505),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQE+ET+KTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLAYIALDYEQEMETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|NP_001239660.1| uncharacterized protein LOC100781831 [Glycine max]
 gb|ACU22968.1| unknown [Glycine max]
Length=377

 Score =   198 bits (504),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELET++TSS+VEKSYELPDGQVITIG+ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEA+
Sbjct  266  PSMIGMEAS  274



>gb|AGA63729.1| actin [Vicia faba]
Length=377

 Score =   199 bits (505),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELET++TSS+VEKSYELPDGQVITIG+ERFRCPEV +Q
Sbjct  206  AEREIVRDVKEKLSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLYQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|ADP09679.1| actin isoform PEAc14-1 [Pisum sativum]
Length=377

 Score =   199 bits (505),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELET++TSS+VEKSYELPDGQVITIG+ERFRCPEV +Q
Sbjct  206  AEREIVRDVKEKLSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLYQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_006429073.1| hypothetical protein CICLE_v10011973mg [Citrus clementina]
 ref|XP_006480804.1| PREDICTED: actin-like isoform X1 [Citrus sinensis]
 ref|XP_006480805.1| PREDICTED: actin-like isoform X2 [Citrus sinensis]
 gb|ESR42313.1| hypothetical protein CICLE_v10011973mg [Citrus clementina]
 gb|KDO47176.1| hypothetical protein CISIN_1g017102mg [Citrus sinensis]
 gb|KDO47177.1| hypothetical protein CISIN_1g017102mg [Citrus sinensis]
Length=377

 Score =   196 bits (498),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAK+EYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGME+A
Sbjct  266  PSMIGMESA  274



>ref|XP_011075140.1| PREDICTED: actin-97 [Sesamum indicum]
Length=377

 Score =   198 bits (503),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDE+GPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDEAGPSIVHRKC  376


 Score =   130 bits (327),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLAYIALDYEQELETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_002279672.1| PREDICTED: actin-66 [Vitis vinifera]
 emb|CAN71887.1| hypothetical protein VITISV_040859 [Vitis vinifera]
Length=377

 Score =   196 bits (498),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>dbj|BAI39619.1| beta actin [Kandelia candel]
Length=297

 Score =   196 bits (497),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRM++EI+ALAPSSMKIKVVAPP
Sbjct  196  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMNREISALAPSSMKIKVVAPP  255

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  256  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  296


 Score =   132 bits (332),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQE+ETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  126  AEREIVRDMKEKLAYIALDYEQEMETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  185

Query  564  PSIIGMEAA  538
            PS+IGMEA+
Sbjct  186  PSMIGMEAS  194



>gb|KHG18648.1| Actin-58 [Gossypium arboreum]
Length=377

 Score =   197 bits (500),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKE++ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKELSALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGP+IVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPAIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELETS+TSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQELETSRTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>gb|KDO47175.1| hypothetical protein CISIN_1g017102mg [Citrus sinensis]
Length=365

 Score =   196 bits (498),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  264  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  323

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAK+EYDESGPSIVHRKC
Sbjct  324  ERKYSVWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKC  364


 Score =   132 bits (331),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  194  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  253

Query  564  PSIIGMEAA  538
            PS+IGME+A
Sbjct  254  PSMIGMESA  262



>gb|AFK39354.1| unknown [Medicago truncatula]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (324),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELET++TSS+VEKSYELPDGQVITIG+ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGMEA
Sbjct  266  PSMIGMEA  273



>gb|AFK41203.1| unknown [Medicago truncatula]
Length=377

 Score =   197 bits (500),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEY+ESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYEESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQELET++TSS+VEKSYELPDGQVITIG+ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|EYU39941.1| hypothetical protein MIMGU_mgv1a008854mg [Erythranthe guttata]
Length=360

 Score =   199 bits (506),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  259  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  318

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  319  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  359


 Score =   129 bits (323),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KTSS+VEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  189  AEREIVRDIKEKLAYIALDYEQELETAKTSSSVEKNYELPDGQVITIGAERFRCPEVLFQ  248

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  249  PSMIGMEAA  257



>ref|XP_010030965.1| PREDICTED: actin [Eucalyptus grandis]
 gb|KCW50207.1| hypothetical protein EUGRSUZ_J00015 [Eucalyptus grandis]
 gb|KCW50208.1| hypothetical protein EUGRSUZ_J00015 [Eucalyptus grandis]
Length=377

 Score =   196 bits (498),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRM+KEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMNKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (330),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV +Q
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLYQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>sp|P30172.1|ACT12_SOLTU RecName: Full=Actin-100, partial [Solanum tuberosum]
 emb|CAA39276.1| actin [Solanum tuberosum]
Length=357

 Score =   197 bits (500),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  256  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  315

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI K EYDESGPSIVHRKC
Sbjct  316  ERKYSVWIGGSILASLSTFQQMWITKGEYDESGPSIVHRKC  356


 Score =   130 bits (328),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+K+SSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  186  AEREIVRDMKEKLAYVALDYEQELETAKSSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  245

Query  564  PSIIGMEAA  538
            PS++GMEAA
Sbjct  246  PSLVGMEAA  254



>ref|XP_010257475.1| PREDICTED: actin [Nelumbo nucifera]
 ref|XP_010257476.1| PREDICTED: actin [Nelumbo nucifera]
Length=377

 Score =   196 bits (498),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC  376


 Score =   132 bits (331),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_009388742.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
 ref|XP_009388743.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFTGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (323),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYE+ELET+KT S+VEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEKELETAKTGSSVEKTYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|ABR17342.1| unknown [Picea sitchensis]
 gb|ACN40744.1| unknown [Picea sitchensis]
 gb|ACN41089.1| unknown [Picea sitchensis]
Length=377

 Score =   197 bits (501),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAK EYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKTEYDESGPSIVHRKC  376


 Score =   130 bits (327),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+KTSS++EKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYVALDYEQELETAKTSSSLEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>ref|NP_187818.1| actin-11 [Arabidopsis thaliana]
 sp|P53496.1|ACT11_ARATH RecName: Full=Actin-11 [Arabidopsis thaliana]
 gb|AAG51045.1|AC069473_7 actin 11 (ACT11); 24016-22523 [Arabidopsis thaliana]
 gb|AAB39404.1| actin-11 [Arabidopsis thaliana]
 dbj|BAB01959.1| actin 11 [Arabidopsis thaliana]
 gb|AAM65277.1| actin 11 (ACT11) [Arabidopsis thaliana]
 dbj|BAC42968.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64013.1| putative actin 11 (ACT11) [Arabidopsis thaliana]
 gb|AEE75151.1| actin-11 [Arabidopsis thaliana]
Length=377

 Score =   200 bits (508),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (320),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQE+ET+ TSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQEMETANTSSSVEKSYELPDGQVITIGGERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS++GMEAA
Sbjct  266  PSLVGMEAA  274



>ref|XP_011075141.1| PREDICTED: actin-97-like [Sesamum indicum]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (323),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KTSS+VEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLAYIALDYEQELETAKTSSSVEKNYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_002283939.1| PREDICTED: actin [Vitis vinifera]
 ref|XP_010651027.1| PREDICTED: actin [Vitis vinifera]
 ref|XP_010651028.1| PREDICTED: actin [Vitis vinifera]
 emb|CBI16148.3| unnamed protein product [Vitis vinifera]
Length=376

 Score =   199 bits (506),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  275  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  334

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  335  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  375


 Score =   129 bits (323),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KTSS+VEKSYELPDGQ+ITIG ERFRCPEV FQ
Sbjct  205  AEREIVRDVKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQMITIGAERFRCPEVLFQ  264

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  265  PSMIGMEAA  273



>ref|XP_002882767.1| actin-11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59026.1| actin-11 [Arabidopsis lyrata subsp. lyrata]
Length=377

 Score =   200 bits (508),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (320),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQE++T+ TSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQEMDTANTSSSVEKSYELPDGQVITIGGERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS++GMEAA
Sbjct  266  PSLVGMEAA  274



>emb|CAN69147.1| hypothetical protein VITISV_023982 [Vitis vinifera]
Length=376

 Score =   199 bits (505),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  275  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  334

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  335  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  375


 Score =   129 bits (323),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KTSS+VEKSYELPDGQ+ITIG ERFRCPEV FQ
Sbjct  205  AEREIVRDVKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQMITIGAERFRCPEVLFQ  264

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  265  PSMIGMEAA  273



>emb|CDP06619.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   200 bits (509),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (319),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELE +KTSSA+EKSYELPDGQVITIG ERFRCPEV +Q
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELEIAKTSSAIEKSYELPDGQVITIGAERFRCPEVLYQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>ref|XP_010905701.1| PREDICTED: actin-101-like [Elaeis guineensis]
Length=377

 Score =   196 bits (498),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC  376


 Score =   131 bits (330),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+K+SSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYVALDYEQELETAKSSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>ref|XP_004497894.1| PREDICTED: actin-like [Cicer arietinum]
Length=377

 Score =   197 bits (501),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ +F G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTIFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (327),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGMEA
Sbjct  266  PSMIGMEA  273



>emb|CDY38066.1| BnaC03g75050D [Brassica napus]
Length=377

 Score =   201 bits (512),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MFGG  DRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   126 bits (316),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETS TSS+VEKS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETSITSSSVEKSFELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGME  544
            PS+IGME
Sbjct  266  PSMIGME  272



>ref|XP_006846523.1| hypothetical protein AMTR_s00018p00188200 [Amborella trichopoda]
 gb|ERN08198.1| hypothetical protein AMTR_s00018p00188200 [Amborella trichopoda]
Length=377

 Score =   197 bits (501),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEY+ESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYEESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+K+SS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>emb|CDY53444.1| BnaA02g07080D [Brassica napus]
Length=377

 Score =   201 bits (512),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MFGG  DRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   126 bits (316),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELETS TSS+V+KS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETSNTSSSVDKSFELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGME  544
            PS+IGME
Sbjct  266  PSMIGME  272



>ref|XP_008776351.1| PREDICTED: actin-101 [Phoenix dactylifera]
Length=377

 Score =   196 bits (498),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC  376


 Score =   131 bits (330),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+K+SSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYVALDYEQELETAKSSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>gb|ADN88106.1| actin 1 [Guzmania wittmackii x Guzmania lingulata]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (323),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELE SKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELEMSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>dbj|BAF68888.1| actin 4 [Torenia fournieri]
Length=290

 Score =   200 bits (508),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  189  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  248

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  249  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  289


 Score =   127 bits (320),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+K+SS+VEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  119  AEREIVRDIKEKLAYIALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQ  178

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  179  PSMIGMEAA  187



>ref|XP_006297921.1| hypothetical protein CARUB_v10013962mg [Capsella rubella]
 gb|EOA30819.1| hypothetical protein CARUB_v10013962mg [Capsella rubella]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+KAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKC  376


 Score =   129 bits (323),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALDYEQE+ET+ TSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDYEQEMETANTSSSVEKSYELPDGQVITIGGERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS++GMEAA
Sbjct  266  PSLVGMEAA  274



>ref|XP_006858216.1| hypothetical protein AMTR_s00062p00184900 [Amborella trichopoda]
 gb|ERN19683.1| hypothetical protein AMTR_s00062p00184900 [Amborella trichopoda]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   128 bits (322),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALD+EQELET+K+SS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYVALDFEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_009773019.1| PREDICTED: actin-97 [Nicotiana sylvestris]
Length=377

 Score =   199 bits (505),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (323),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KTSS+VEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETAKTSSSVEKNYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|ACU23316.1| unknown [Glycine max]
Length=377

 Score =   197 bits (501),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAP SMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPGSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (327),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGME+
Sbjct  266  PSMIGMES  273



>ref|XP_011077464.1| PREDICTED: actin-like [Sesamum indicum]
 ref|XP_011077465.1| PREDICTED: actin-like [Sesamum indicum]
 ref|XP_011077466.1| PREDICTED: actin-like [Sesamum indicum]
 ref|XP_011077467.1| PREDICTED: actin-like [Sesamum indicum]
Length=377

 Score =   197 bits (501),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AE+EIVRDMKEKLSYIALD+EQE+ET+KTSSAVEK++ELPDGQVITIGNERFRCPEV FQ
Sbjct  206  AEKEIVRDMKEKLSYIALDFEQEMETAKTSSAVEKNFELPDGQVITIGNERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            P++IGMEAA
Sbjct  266  PAMIGMEAA  274



>ref|XP_003521216.1| PREDICTED: actin-3-like isoform X1 [Glycine max]
 ref|XP_006576854.1| PREDICTED: actin-3-like isoform X2 [Glycine max]
 gb|KHN07431.1| Actin-3 [Glycine soja]
Length=377

 Score =   197 bits (501),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAP SMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPGSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGME+
Sbjct  266  PSMIGMES  273



>ref|XP_003539675.1| PREDICTED: actin-like isoform X1 [Glycine max]
 ref|XP_006592200.1| PREDICTED: actin-like isoform X2 [Glycine max]
Length=377

 Score =   196 bits (499),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDE+GPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDEAGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEA+
Sbjct  266  PSMIGMEAS  274



>sp|P30173.1|ACT13_SOLTU RecName: Full=Actin-101 [Solanum tuberosum]
 emb|CAA39281.1| actin [Solanum tuberosum]
Length=377

 Score =   196 bits (499),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI K EYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWITKGEYDESGPSIVHRKC  376


 Score =   130 bits (328),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+K+SSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYVALDYEQELETAKSSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS++GMEAA
Sbjct  266  PSLVGMEAA  274



>gb|ACP19073.1| actin 2 [Picea abies]
Length=377

 Score =   197 bits (501),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAK EYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKTEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+KTSS++EKSYELPDGQVIT+G ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYVALDYEQELETAKTSSSLEKSYELPDGQVITVGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>ref|XP_011099798.1| PREDICTED: actin-1-like [Sesamum indicum]
Length=377

 Score =   196 bits (498),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFTGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC  376


 Score =   131 bits (330),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELET+KTSS+VEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELETAKTSSSVEKNYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>gb|AAO42312.1| putative actin 4 [Arabidopsis thaliana]
Length=377

 Score =   199 bits (507),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MFGG  DRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVW GGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWTGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (320),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALD+EQELETSKTSS+VEKS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDFEQELETSKTSSSVEKSFELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGME  544
            PS+IGME
Sbjct  266  PSMIGME  272



>ref|XP_010541399.1| PREDICTED: actin-12-like [Tarenaya hassleriana]
 ref|XP_010541400.1| PREDICTED: actin-12-like [Tarenaya hassleriana]
Length=377

 Score =   201 bits (512),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MFGG  DRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   125 bits (315),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+ + S+VEKS+ELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETANSGSSVEKSFELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_009410069.1| PREDICTED: actin [Musa acuminata subsp. malaccensis]
Length=377

 Score =   199 bits (507),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFSGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (320),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KT+S+VEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLAYIALDYEQELETAKTNSSVEKNYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_009773924.1| PREDICTED: actin [Nicotiana sylvestris]
 ref|XP_009773925.1| PREDICTED: actin [Nicotiana sylvestris]
Length=377

 Score =   198 bits (504),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (323),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALD+EQE++TSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDFEQEMDTSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|EYU20691.1| hypothetical protein MIMGU_mgv1a008334mg [Erythranthe guttata]
 gb|EYU20692.1| hypothetical protein MIMGU_mgv1a008334mg [Erythranthe guttata]
Length=377

 Score =   199 bits (505),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   128 bits (322),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQE+ET+KTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLAYIALDYEQEVETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS++GMEAA
Sbjct  266  PSMVGMEAA  274



>ref|XP_010427034.1| PREDICTED: actin-1-like, partial [Camelina sativa]
Length=305

 Score =   200 bits (509),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  204  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  263

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  264  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  304


 Score =   127 bits (318),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL YIALDYEQELET+KTSSAVEK+YELPDGQVITIG+ERFRCPEV +Q
Sbjct  134  AEREIVRDIKEKLCYIALDYEQELETAKTSSAVEKNYELPDGQVITIGSERFRCPEVLYQ  193

Query  564  PSIIGMEAA  538
            PS+IGME A
Sbjct  194  PSMIGMENA  202



>ref|XP_010111138.1| hypothetical protein L484_010751 [Morus notabilis]
 gb|AGT97389.1| actin [Morus alba]
 gb|EXC30503.1| hypothetical protein L484_010751 [Morus notabilis]
Length=377

 Score =   196 bits (498),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAK+EYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALD+EQE+ET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDFEQEMETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|ACH69153.1| actin [Nicotiana tabacum]
Length=377

 Score =   197 bits (501),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI +CDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMECDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   130 bits (326),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALD+EQE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDFEQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|EPS69959.1| actin [Genlisea aurea]
Length=377

 Score =   198 bits (503),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+KAEYDE+GPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWISKAEYDETGPSIVHRKC  376


 Score =   129 bits (323),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITI  ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIAAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_003625265.1| Actin [Medicago truncatula]
 gb|AES81483.1| actin-97 [Medicago truncatula]
Length=377

 Score =   197 bits (502),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETT+NSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTFNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (324),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKTYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGME+
Sbjct  266  PSMIGMES  273



>gb|ADU52545.1| actin 2 [Morus alba]
Length=377

 Score =   196 bits (498),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAK+EYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALD+EQE+ET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDFEQEMETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|AAN08622.1| actin [Phalaenopsis hybrid cultivar]
Length=377

 Score =   196 bits (498),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G A+RM+KEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIAERMNKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KT+S+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTTSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>emb|CDP09045.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   197 bits (502),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAK+EYDE+GPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKSEYDEAGPSIVHRKC  376


 Score =   129 bits (324),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKLSYIALD+EQELE +KTSS++EK+YELPDGQVITIGNERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLSYIALDFEQELEAAKTSSSIEKNYELPDGQVITIGNERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>gb|ABG49392.1| actin 2 [Torenia fournieri]
Length=377

 Score =   200 bits (508),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (318),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQE+ET+KTSSAVEK+Y LPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLAYIALDYEQEMETTKTSSAVEKNYGLPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS++GMEAA
Sbjct  266  PSLVGMEAA  274



>gb|ABV59397.1| actin [Phyllostachys bambusoides]
Length=377

 Score =   197 bits (501),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYD SGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDGSGPSIVHRKC  376


 Score =   129 bits (325),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDY+QE+ET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYDQEMETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS IGMEAA
Sbjct  266  PSFIGMEAA  274



>ref|XP_008787899.1| PREDICTED: actin-like [Phoenix dactylifera]
Length=377

 Score =   199 bits (506),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   128 bits (321),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELE +K SS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELEMAKNSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|EYU41721.1| hypothetical protein MIMGU_mgv1a008324mg [Erythranthe guttata]
Length=377

 Score =   199 bits (505),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNVVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   128 bits (321),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AE+EIVRDMKEKLSYIALD+EQE+E SKTSS VEK++ELPDGQVITIGNERFRCPEV FQ
Sbjct  206  AEKEIVRDMKEKLSYIALDFEQEMEISKTSSNVEKNFELPDGQVITIGNERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_009801998.1| PREDICTED: actin-97-like [Nicotiana sylvestris]
Length=377

 Score =   196 bits (497),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ M+ G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+KAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKC  376


 Score =   131 bits (329),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_010922421.1| PREDICTED: actin-100-like isoform X2 [Elaeis guineensis]
Length=332

 Score =   196 bits (499),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  231  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  290

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKC
Sbjct  291  ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC  331


 Score =   130 bits (327),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+++SSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  161  AEREIVRDMKEKLAYVALDYEQELETARSSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  220

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  221  PSLIGMEAA  229



>gb|AIY25484.1| actin isoform 3-1 [Pisum sativum]
Length=377

 Score =   197 bits (502),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETT+NSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTFNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   129 bits (324),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELET+KTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKTYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGME+
Sbjct  266  PSMIGMES  273



>dbj|BAN13564.1| actin, partial [Chrysanthemum seticuspe f. boreale]
Length=280

 Score =   197 bits (502),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  179  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  238

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKC
Sbjct  239  ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC  279


 Score =   129 bits (324),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+K+SS+VEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  109  AEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQ  168

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  169  PSLIGMEAA  177



>ref|XP_006407369.1| hypothetical protein EUTSA_v10020950mg [Eutrema salsugineum]
 ref|XP_006407370.1| hypothetical protein EUTSA_v10020950mg [Eutrema salsugineum]
 gb|ESQ48822.1| hypothetical protein EUTSA_v10020950mg [Eutrema salsugineum]
 gb|ESQ48823.1| hypothetical protein EUTSA_v10020950mg [Eutrema salsugineum]
Length=377

 Score =   200 bits (508),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (318),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQE+ET+ TSS+V+KSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQEMETANTSSSVDKSYELPDGQVITIGGERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS++GMEAA
Sbjct  266  PSLVGMEAA  274



>gb|ABK21898.1| unknown [Picea sitchensis]
Length=244

 Score =   200 bits (508),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  143  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  202

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  203  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  243


 Score =   127 bits (318),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+Y+ALDYEQELET+K+SS+++KSYELPDGQVITIG ERFRCPEV FQ
Sbjct  73   AEREIVRDVKEKLAYVALDYEQELETAKSSSSIDKSYELPDGQVITIGAERFRCPEVLFQ  132

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  133  PSLIGMEAA  141



>ref|XP_009381444.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   199 bits (505),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFTGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (320),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KT+S+VEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDIKEKLAYIALDYEQELETAKTNSSVEKNYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>gb|AEI29166.1| actin-like protein [Vanilla planifolia]
Length=196

 Score =   195 bits (495),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI +CDVDIRKDLY N VLSGGT MF G A+RM+KEITALAPSSMKIKVVAPP
Sbjct  95   IHETTYNSIMRCDVDIRKDLYSNIVLSGGTAMFPGIAERMNKEITALAPSSMKIKVVAPP  154

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  155  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  195


 Score =   131 bits (330),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEV +Q
Sbjct  25   AEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLYQ  84

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  85   PSLIGMEAA  93



>ref|XP_003533915.1| PREDICTED: actin-like isoform X1 [Glycine max]
 ref|XP_006587210.1| PREDICTED: actin-like isoform X2 [Glycine max]
 ref|XP_006587211.1| PREDICTED: actin-like isoform X3 [Glycine max]
 gb|KHN31754.1| Actin [Glycine soja]
Length=377

 Score =   198 bits (504),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   128 bits (321),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALDYEQELET+KTSSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEA  541
            PS+IGME+
Sbjct  266  PSMIGMES  273



>dbj|BAL27711.1| actin like 1 [Prunus avium]
Length=377

 Score =   199 bits (505),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (320),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIALD+EQE+ET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIALDFEQEMETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



>ref|XP_010520110.1| PREDICTED: actin-like [Tarenaya hassleriana]
 ref|XP_010520111.1| PREDICTED: actin-like [Tarenaya hassleriana]
Length=377

 Score =   199 bits (505),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEI+ALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (320),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+YIA+DYEQELETSKTSSAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDVKEKLAYIAVDYEQELETSKTSSAVEKTYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGME++
Sbjct  266  PSLIGMESS  274



>ref|XP_002265476.1| PREDICTED: actin-101 [Vitis vinifera]
 ref|XP_010657405.1| PREDICTED: actin-101 [Vitis vinifera]
Length=377

 Score =   195 bits (495),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+K EYDESGP+IVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPAIVHRKC  376


 Score =   131 bits (330),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+K+SSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYVALDYEQELETAKSSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>ref|XP_010922415.1| PREDICTED: actin-101-like isoform X1 [Elaeis guineensis]
 ref|XP_010922416.1| PREDICTED: actin-101-like isoform X1 [Elaeis guineensis]
 ref|XP_010922417.1| PREDICTED: actin-101-like isoform X1 [Elaeis guineensis]
 ref|XP_010922418.1| PREDICTED: actin-101-like isoform X1 [Elaeis guineensis]
 ref|XP_010922420.1| PREDICTED: actin-101-like isoform X1 [Elaeis guineensis]
Length=377

 Score =   196 bits (498),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC  376


 Score =   130 bits (327),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+Y+ALDYEQELET+++SSAVEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYVALDYEQELETARSSSAVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSLIGMEAA  274



>gb|AFO68183.1| actin, partial [Anthurium andraeanum]
Length=276

 Score =   197 bits (501),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKD YGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  175  IHETTYNSIMKCDVDIRKDXYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  234

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+KAEYDESGPSIVHRKC
Sbjct  235  ERKYSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKC  275


 Score =   129 bits (325),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD KEKL+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  105  AEREIVRDXKEKLAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQ  164

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  165  PSMIGMEAA  173



>ref|XP_011089811.1| PREDICTED: actin-like [Sesamum indicum]
Length=377

 Score =   199 bits (505),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (320),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKLSYIALDYEQELE +KT+S VEKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLSYIALDYEQELENAKTNSEVEKSYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            P++IGMEAA
Sbjct  266  PAMIGMEAA  274



>ref|XP_002879684.1| hypothetical protein ARALYDRAFT_321462 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006291303.1| hypothetical protein CARUB_v10017439mg [Capsella rubella]
 ref|XP_006294425.1| hypothetical protein CARUB_v10023442mg [Capsella rubella]
 ref|XP_006294426.1| hypothetical protein CARUB_v10023442mg [Capsella rubella]
 ref|XP_006403657.1| hypothetical protein EUTSA_v10010455mg [Eutrema salsugineum]
 ref|XP_006410952.1| hypothetical protein EUTSA_v10016809mg [Eutrema salsugineum]
 ref|XP_010504145.1| PREDICTED: actin-1 [Camelina sativa]
 ref|XP_010505356.1| PREDICTED: actin-1 [Camelina sativa]
 ref|XP_010509299.1| PREDICTED: actin-1 [Camelina sativa]
 ref|XP_010515877.1| PREDICTED: actin-1 [Camelina sativa]
 ref|XP_010517034.1| PREDICTED: actin-1 [Camelina sativa]
 gb|EFH55943.1| hypothetical protein ARALYDRAFT_321462 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA24201.1| hypothetical protein CARUB_v10017439mg [Capsella rubella]
 gb|EOA27323.1| hypothetical protein CARUB_v10023442mg [Capsella rubella]
 gb|EOA27324.1| hypothetical protein CARUB_v10023442mg [Capsella rubella]
 gb|ESQ45110.1| hypothetical protein EUTSA_v10010455mg [Eutrema salsugineum]
 gb|ESQ52405.1| hypothetical protein EUTSA_v10016809mg [Eutrema salsugineum]
Length=377

 Score =   200 bits (508),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGGT MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   126 bits (317),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL YIALDYEQELET+KTSSAVEK+YELPDGQVITIG+ERFRCPEV +Q
Sbjct  206  AEREIVRDIKEKLCYIALDYEQELETAKTSSAVEKNYELPDGQVITIGSERFRCPEVLYQ  265

Query  564  PSIIGMEAA  538
            PS+IGME A
Sbjct  266  PSMIGMENA  274



>dbj|BAO04185.1| actin, partial [Delphinium grandiflorum]
Length=294

 Score =   197 bits (500),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  193  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  252

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKC
Sbjct  253  ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC  293


 Score =   129 bits (324),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRD+KEKL+Y+ALDYEQELET+KTSS++EKSYELPDGQVITIG ERFRCPEV FQ
Sbjct  123  AEREIVRDVKEKLAYVALDYEQELETAKTSSSIEKSYELPDGQVITIGAERFRCPEVLFQ  182

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  183  PSLIGMEAA  191



>ref|XP_009381010.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   199 bits (505),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  536  IHETTYNSIXKCDVDIRKDLYGNXVLSGGTXMFGGXADRMSKEITALAPSSMKIKVVAPP  357
            IHETTYNSI KCDVDIRKDLYGN VLSGG+ MF G ADRMSKEITALAPSSMKIKVVAPP
Sbjct  276  IHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP  335

Query  356  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  234
            ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC
Sbjct  336  ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKC  376


 Score =   127 bits (319),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  AEREIVRDMKEKLSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGNERFRCPEVXFQ  565
            AEREIVRDMKEKL+YIALDY+QE+E +KT+SAVEK+YELPDGQVITIG ERFRCPEV FQ
Sbjct  206  AEREIVRDMKEKLAYIALDYQQEMEAAKTASAVEKTYELPDGQVITIGAERFRCPEVLFQ  265

Query  564  PSIIGMEAA  538
            PS+IGMEAA
Sbjct  266  PSMIGMEAA  274



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420