BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF040M24

Length=831
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004245560.1|  PREDICTED: reticulon-like protein B4               332   2e-110   Solanum lycopersicum
ref|XP_006343915.1|  PREDICTED: reticulon-like protein B1-like          331   5e-110   Solanum tuberosum [potatoes]
ref|XP_009793558.1|  PREDICTED: reticulon-like protein B4               329   3e-109   Nicotiana sylvestris
gb|KHG24129.1|  Reticulon-like protein B3                               312   7e-103   Gossypium arboreum [tree cotton]
emb|CDP12094.1|  unnamed protein product                                311   2e-102   Coffea canephora [robusta coffee]
ref|XP_010251601.1|  PREDICTED: reticulon-like protein B2               310   4e-102   Nelumbo nucifera [Indian lotus]
ref|XP_010658515.1|  PREDICTED: reticulon-like protein B2               309   1e-101   Vitis vinifera
ref|XP_002509881.1|  conserved hypothetical protein                     308   3e-101   Ricinus communis
ref|XP_009597328.1|  PREDICTED: reticulon-like protein B5               307   8e-101   Nicotiana tomentosiformis
ref|XP_010915765.1|  PREDICTED: reticulon-like protein B2               305   3e-100   Elaeis guineensis
ref|XP_006339640.1|  PREDICTED: reticulon-like protein B1-like          306   4e-100   Solanum tuberosum [potatoes]
ref|XP_008805646.1|  PREDICTED: reticulon-like protein B3               305   5e-100   Phoenix dactylifera
ref|XP_009766982.1|  PREDICTED: reticulon-like protein B5               305   6e-100   Nicotiana sylvestris
ref|XP_004229935.1|  PREDICTED: reticulon-like protein B1               304   2e-99    
ref|XP_003633964.1|  PREDICTED: reticulon-like protein B1               303   2e-99    Vitis vinifera
gb|KDP25363.1|  hypothetical protein JCGZ_20519                         303   2e-99    Jatropha curcas
ref|XP_011026963.1|  PREDICTED: reticulon-like protein B2               302   8e-99    Populus euphratica
ref|XP_009626480.1|  PREDICTED: reticulon-like protein B2 isoform X1    301   1e-98    Nicotiana tomentosiformis
ref|XP_006439447.1|  hypothetical protein CICLE_v10021801mg             301   1e-98    Citrus clementina [clementine]
ref|XP_008796064.1|  PREDICTED: reticulon-like protein B2               301   1e-98    Phoenix dactylifera
gb|AFK41983.1|  unknown                                                 300   2e-98    Medicago truncatula
ref|NP_001239711.1|  uncharacterized protein LOC100811024               301   2e-98    Glycine max [soybeans]
ref|XP_007160119.1|  hypothetical protein PHAVU_002G294100g             301   2e-98    Phaseolus vulgaris [French bean]
ref|XP_009763462.1|  PREDICTED: reticulon-like protein B1 isoform X2    301   3e-98    Nicotiana sylvestris
ref|XP_006476478.1|  PREDICTED: reticulon-like protein B2-like          300   3e-98    Citrus sinensis [apfelsine]
ref|XP_009765582.1|  PREDICTED: reticulon-like protein B2               300   3e-98    Nicotiana sylvestris
ref|XP_010925814.1|  PREDICTED: reticulon-like protein B2               300   3e-98    Elaeis guineensis
ref|XP_010055800.1|  PREDICTED: reticulon-like protein B1               300   8e-98    Eucalyptus grandis [rose gum]
gb|ACJ84486.1|  unknown                                                 299   1e-97    Medicago truncatula
gb|KCW72347.1|  hypothetical protein EUGRSUZ_E00805                     299   1e-97    Eucalyptus grandis [rose gum]
gb|KCW72348.1|  hypothetical protein EUGRSUZ_E00805                     300   2e-97    Eucalyptus grandis [rose gum]
ref|XP_008810936.1|  PREDICTED: reticulon-like protein B5               298   3e-97    Phoenix dactylifera
ref|XP_003525365.1|  PREDICTED: reticulon-like protein B2-like is...    298   4e-97    Glycine max [soybeans]
gb|ACU23452.1|  unknown                                                 298   4e-97    Glycine max [soybeans]
ref|XP_008792381.1|  PREDICTED: reticulon-like protein B2 isoform X2    297   7e-97    
ref|XP_009598008.1|  PREDICTED: reticulon-like protein B2               295   1e-96    
ref|XP_011093062.1|  PREDICTED: reticulon-like protein B1               296   1e-96    Sesamum indicum [beniseed]
ref|XP_010924771.1|  PREDICTED: reticulon-like protein B2               295   3e-96    Elaeis guineensis
ref|XP_002299504.1|  reticulon family protein                           295   4e-96    Populus trichocarpa [western balsam poplar]
ref|XP_009603968.1|  PREDICTED: reticulon-like protein B1               295   6e-96    Nicotiana tomentosiformis
ref|XP_009763461.1|  PREDICTED: reticulon-like protein B6 isoform X1    295   8e-96    Nicotiana sylvestris
gb|AEZ00899.1|  putative 24 kDa seed maturation protein                 293   2e-95    Elaeis guineensis
ref|XP_010676393.1|  PREDICTED: reticulon-like protein B2               293   2e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004503660.1|  PREDICTED: reticulon-like protein B2-like          293   2e-95    Cicer arietinum [garbanzo]
ref|XP_004234204.1|  PREDICTED: reticulon-like protein B2               293   2e-95    Solanum lycopersicum
ref|XP_007038874.1|  VIRB2-interacting protein 2                        293   3e-95    Theobroma cacao [chocolate]
gb|ABC01908.1|  putative 24 kDa seed maturation protein-like protein    292   6e-95    Solanum tuberosum [potatoes]
gb|KHG04885.1|  Reticulon-like protein B5                               292   7e-95    Gossypium arboreum [tree cotton]
gb|EYU19605.1|  hypothetical protein MIMGU_mgv1a012182mg                291   1e-94    Erythranthe guttata [common monkey flower]
ref|XP_006358652.1|  PREDICTED: reticulon-like protein B1-like          291   2e-94    Solanum tuberosum [potatoes]
gb|KJB24634.1|  hypothetical protein B456_004G154600                    290   3e-94    Gossypium raimondii
gb|KJB52210.1|  hypothetical protein B456_008G250900                    290   3e-94    Gossypium raimondii
ref|NP_001149653.1|  LOC100283279                                       290   5e-94    Zea mays [maize]
ref|XP_010545343.1|  PREDICTED: reticulon-like protein B3               290   5e-94    Tarenaya hassleriana [spider flower]
ref|XP_006645662.1|  PREDICTED: reticulon-like protein B1-like          289   8e-94    Oryza brachyantha
gb|KJB06451.1|  hypothetical protein B456_001G157900                    289   9e-94    Gossypium raimondii
ref|XP_009388111.1|  PREDICTED: reticulon-like protein B1               289   1e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004248066.1|  PREDICTED: reticulon-like protein B1               289   1e-93    Solanum lycopersicum
ref|XP_010916969.1|  PREDICTED: reticulon-like protein B3               291   1e-93    Elaeis guineensis
ref|XP_010053196.1|  PREDICTED: reticulon-like protein B1               289   1e-93    Eucalyptus grandis [rose gum]
ref|XP_010541290.1|  PREDICTED: reticulon-like protein B1               289   2e-93    Tarenaya hassleriana [spider flower]
ref|XP_007051689.1|  Reticulon family protein                           288   2e-93    
ref|XP_010529625.1|  PREDICTED: reticulon-like protein B1               288   3e-93    Tarenaya hassleriana [spider flower]
ref|XP_011022600.1|  PREDICTED: reticulon-like protein B1               288   3e-93    Populus euphratica
ref|XP_003528823.2|  PREDICTED: reticulon-like protein B1-like          290   3e-93    Glycine max [soybeans]
ref|XP_010533622.1|  PREDICTED: reticulon-like protein B4               287   6e-93    Tarenaya hassleriana [spider flower]
ref|XP_006366650.1|  PREDICTED: putative 24 kDa seed maturation p...    292   8e-93    
gb|KHG29253.1|  Reticulon-like protein B5                               286   1e-92    Gossypium arboreum [tree cotton]
ref|XP_002303615.1|  reticulon family protein                           286   1e-92    Populus trichocarpa [western balsam poplar]
ref|XP_003565836.1|  PREDICTED: reticulon-like protein B1               286   2e-92    Brachypodium distachyon [annual false brome]
ref|XP_002511930.1|  conserved hypothetical protein                     285   2e-92    Ricinus communis
gb|KJB19087.1|  hypothetical protein B456_003G084400                    285   3e-92    Gossypium raimondii
ref|XP_008437352.1|  PREDICTED: reticulon-like protein B2               285   3e-92    Cucumis melo [Oriental melon]
gb|EAY73097.1|  hypothetical protein OsI_00974                          286   4e-92    Oryza sativa Indica Group [Indian rice]
gb|KDP28552.1|  hypothetical protein JCGZ_14323                         285   4e-92    Jatropha curcas
ref|NP_001056102.1|  Os05g0526400                                       285   5e-92    
gb|KDO56851.1|  hypothetical protein CISIN_1g023137mg                   285   6e-92    Citrus sinensis [apfelsine]
ref|XP_006422079.1|  hypothetical protein CICLE_v10005564mg             285   6e-92    Citrus clementina [clementine]
ref|XP_009415169.1|  PREDICTED: reticulon-like protein B2               284   6e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001150474.1|  seed maturation protein                            285   6e-92    
gb|EYU23406.1|  hypothetical protein MIMGU_mgv1a012325mg                284   6e-92    Erythranthe guttata [common monkey flower]
ref|XP_010261408.1|  PREDICTED: reticulon-like protein B2               284   6e-92    Nelumbo nucifera [Indian lotus]
ref|XP_006288443.1|  hypothetical protein CARUB_v10001704mg             285   7e-92    Capsella rubella
tpg|DAA52789.1|  TPA: seed maturation protein                           285   7e-92    
gb|KHG20258.1|  Reticulon-like protein B3                               284   8e-92    Gossypium arboreum [tree cotton]
ref|XP_008234814.1|  PREDICTED: reticulon-like protein B1               284   8e-92    Prunus mume [ume]
ref|XP_006847055.1|  hypothetical protein AMTR_s00017p00194840          285   1e-91    
ref|XP_011073407.1|  PREDICTED: reticulon-like protein B2 isoform X1    283   1e-91    Sesamum indicum [beniseed]
ref|XP_009772131.1|  PREDICTED: reticulon-like protein B2               283   1e-91    Nicotiana sylvestris
ref|XP_004143883.1|  PREDICTED: reticulon-like protein B2-like          283   2e-91    Cucumis sativus [cucumbers]
gb|KHG15548.1|  Reticulon-like protein B3                               283   2e-91    Gossypium arboreum [tree cotton]
gb|KHG09260.1|  Reticulon-like protein B3                               283   2e-91    Gossypium arboreum [tree cotton]
emb|CDP05124.1|  unnamed protein product                                283   3e-91    Coffea canephora [robusta coffee]
dbj|BAB32723.1|  unknown protein                                        283   3e-91    Oryza sativa Japonica Group [Japonica rice]
emb|CDP08746.1|  unnamed protein product                                283   3e-91    Coffea canephora [robusta coffee]
ref|XP_004967455.1|  PREDICTED: reticulon-like protein B1-like          283   4e-91    Setaria italica
gb|EMS62606.1|  Reticulon-like protein B1                               281   6e-91    Triticum urartu
ref|XP_006360189.1|  PREDICTED: reticulon-like protein B2-like          282   6e-91    Solanum tuberosum [potatoes]
ref|XP_002874678.1|  VIRB2-interacting protein 2                        282   7e-91    Arabidopsis lyrata subsp. lyrata
gb|EAY75742.1|  hypothetical protein OsI_03655                          281   7e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_008655792.1|  PREDICTED: reticulon-like protein B1               282   8e-91    
ref|XP_010669728.1|  PREDICTED: reticulon-like protein B4               283   9e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004240710.1|  PREDICTED: reticulon-like protein B6               281   9e-91    Solanum lycopersicum
ref|XP_006374289.1|  hypothetical protein POPTR_0015s05710g             281   1e-90    
gb|EMT19773.1|  Reticulon-like protein B1                               282   1e-90    
ref|XP_010092876.1|  Reticulon-like protein                             281   1e-90    Morus notabilis
ref|XP_006374290.1|  hypothetical protein POPTR_0015s05710g             281   1e-90    
ref|XP_009416410.1|  PREDICTED: reticulon-like protein B2               281   1e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008376662.1|  PREDICTED: reticulon-like protein B1               281   1e-90    Malus domestica [apple tree]
ref|XP_007218819.1|  hypothetical protein PRUPE_ppa010065mg             281   2e-90    Prunus persica
emb|CDJ26559.1|  unnamed protein product                                282   2e-90    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009406786.1|  PREDICTED: reticulon-like protein B1 isoform X2    280   2e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008792378.1|  PREDICTED: reticulon-like protein B3 isoform X1    281   2e-90    
ref|XP_009368711.1|  PREDICTED: reticulon-like protein B1               280   3e-90    Pyrus x bretschneideri [bai li]
ref|XP_009134231.1|  PREDICTED: reticulon-like protein B2               280   6e-90    Brassica rapa
ref|XP_009380544.1|  PREDICTED: reticulon-like protein B2               279   9e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010422067.1|  PREDICTED: reticulon-like protein B2               279   9e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010544774.1|  PREDICTED: reticulon-like protein B6               279   1e-89    Tarenaya hassleriana [spider flower]
gb|ACF87936.1|  unknown                                                 276   1e-89    Zea mays [maize]
ref|XP_008354289.1|  PREDICTED: reticulon-like protein B1               278   2e-89    
ref|XP_010455527.1|  PREDICTED: reticulon-like protein B2               278   2e-89    Camelina sativa [gold-of-pleasure]
ref|XP_003568063.1|  PREDICTED: reticulon-like protein B1               278   2e-89    Brachypodium distachyon [annual false brome]
ref|XP_008232963.1|  PREDICTED: reticulon-like protein B6               278   2e-89    Prunus mume [ume]
gb|EYU25170.1|  hypothetical protein MIMGU_mgv1a012274mg                278   2e-89    Erythranthe guttata [common monkey flower]
ref|XP_011080892.1|  PREDICTED: reticulon-like protein B2               278   2e-89    Sesamum indicum [beniseed]
gb|EAY98759.1|  hypothetical protein OsI_20691                          277   3e-89    Oryza sativa Indica Group [Indian rice]
ref|NP_001130478.1|  Seed maturation protein                            277   3e-89    Zea mays [maize]
ref|XP_011084470.1|  PREDICTED: reticulon-like protein B2               277   4e-89    Sesamum indicum [beniseed]
gb|KHN15986.1|  Reticulon-like protein B5                               277   4e-89    Glycine soja [wild soybean]
ref|NP_001241367.1|  uncharacterized protein LOC100796111               277   4e-89    Glycine max [soybeans]
ref|XP_004969875.1|  PREDICTED: reticulon-like protein B1-like          277   5e-89    Setaria italica
ref|XP_009375555.1|  PREDICTED: reticulon-like protein B1               277   5e-89    Pyrus x bretschneideri [bai li]
ref|XP_008343772.1|  PREDICTED: reticulon-like protein B1               276   6e-89    Malus domestica [apple tree]
ref|XP_011047748.1|  PREDICTED: reticulon-like protein B1               276   7e-89    Populus euphratica
ref|XP_010435260.1|  PREDICTED: reticulon-like protein B2               277   7e-89    Camelina sativa [gold-of-pleasure]
dbj|BAJ89699.1|  predicted protein                                      276   2e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010035177.1|  PREDICTED: reticulon-like protein B1               275   2e-88    Eucalyptus grandis [rose gum]
ref|XP_006654676.1|  PREDICTED: reticulon-like protein B1-like          275   2e-88    Oryza brachyantha
ref|XP_009406784.1|  PREDICTED: reticulon-like protein B1 isoform X1    275   3e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002320163.1|  reticulon family protein                           275   3e-88    Populus trichocarpa [western balsam poplar]
ref|NP_001044177.1|  Os01g0736900                                       275   3e-88    
gb|ABK94480.1|  unknown                                                 275   4e-88    Populus trichocarpa [western balsam poplar]
gb|KJB24285.1|  hypothetical protein B456_004G137000                    275   4e-88    Gossypium raimondii
ref|NP_192861.1|  reticulon-like protein B2                             275   5e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433883.1|  PREDICTED: reticulon-like protein B1               275   7e-88    Camelina sativa [gold-of-pleasure]
ref|XP_006644671.1|  PREDICTED: reticulon-like protein B1-like          273   9e-88    Oryza brachyantha
ref|XP_010509305.1|  PREDICTED: reticulon-like protein B1               274   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010439152.1|  PREDICTED: reticulon-like protein B1 isoform X1    274   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_007218268.1|  hypothetical protein PRUPE_ppa008259mg             276   2e-87    
ref|NP_194094.1|  VIRB2-interacting protein 1                           273   3e-87    Arabidopsis thaliana [mouse-ear cress]
gb|KDO86331.1|  hypothetical protein CISIN_1g025719mg                   272   3e-87    Citrus sinensis [apfelsine]
gb|KFK31901.1|  hypothetical protein AALP_AA6G173800                    273   3e-87    Arabis alpina [alpine rockcress]
ref|XP_006284300.1|  hypothetical protein CARUB_v10005469mg             273   3e-87    
gb|EAZ13460.1|  hypothetical protein OsJ_03377                          272   4e-87    Oryza sativa Japonica Group [Japonica rice]
gb|KJB06453.1|  hypothetical protein B456_001G157900                    273   5e-87    Gossypium raimondii
emb|CDY57657.1|  BnaC01g15350D                                          272   9e-87    Brassica napus [oilseed rape]
ref|XP_002869770.1|  VIRB2-interacting protein 1                        272   1e-86    Arabidopsis lyrata subsp. lyrata
ref|XP_006444935.1|  hypothetical protein CICLE_v10021860mg             271   1e-86    Citrus clementina [clementine]
ref|XP_010112604.1|  Reticulon-like protein                             270   4e-86    Morus notabilis
emb|CDY44123.1|  BnaA01g13310D                                          270   4e-86    Brassica napus [oilseed rape]
ref|XP_004149448.1|  PREDICTED: reticulon-like protein B1-like          269   4e-86    Cucumis sativus [cucumbers]
ref|XP_009137263.1|  PREDICTED: reticulon-like protein B1               270   4e-86    Brassica rapa
ref|XP_006413535.1|  hypothetical protein EUTSA_v10025959mg             269   9e-86    Eutrema salsugineum [saltwater cress]
ref|XP_006396933.1|  hypothetical protein EUTSA_v10028886mg             269   9e-86    Eutrema salsugineum [saltwater cress]
gb|ABR17571.1|  unknown                                                 269   1e-85    Picea sitchensis
ref|XP_010538815.1|  PREDICTED: reticulon-like protein B1               269   1e-85    Tarenaya hassleriana [spider flower]
gb|KDP22201.1|  hypothetical protein JCGZ_26032                         268   1e-85    Jatropha curcas
dbj|BAJ98297.1|  predicted protein                                      268   2e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU32181.1|  hypothetical protein MIMGU_mgv1a012219mg                268   2e-85    Erythranthe guttata [common monkey flower]
gb|ACN40158.1|  unknown                                                 267   3e-85    Picea sitchensis
dbj|BAJ33905.1|  unnamed protein product                                268   3e-85    Eutrema halophilum
ref|XP_002870630.1|  VIRB2-interacting protein 3                        267   4e-85    
gb|EMS62854.1|  Reticulon-like protein B1                               266   5e-85    Triticum urartu
ref|XP_006422078.1|  hypothetical protein CICLE_v10005564mg             268   6e-85    
ref|XP_003569752.1|  PREDICTED: reticulon-like protein B1               266   6e-85    Brachypodium distachyon [annual false brome]
gb|KDO56850.1|  hypothetical protein CISIN_1g023137mg                   268   7e-85    Citrus sinensis [apfelsine]
gb|KFK37395.1|  hypothetical protein AALP_AA4G251600                    266   7e-85    Arabis alpina [alpine rockcress]
ref|XP_009338786.1|  PREDICTED: reticulon-like protein B1               266   8e-85    Pyrus x bretschneideri [bai li]
ref|XP_009341126.1|  PREDICTED: reticulon-like protein B1               266   8e-85    Pyrus x bretschneideri [bai li]
ref|XP_010518282.1|  PREDICTED: reticulon-like protein B5               266   8e-85    Camelina sativa [gold-of-pleasure]
emb|CDY10954.1|  BnaA03g46130D                                          266   9e-85    Brassica napus [oilseed rape]
ref|XP_008375931.1|  PREDICTED: reticulon-like protein B1               266   9e-85    Malus domestica [apple tree]
ref|XP_008344578.1|  PREDICTED: reticulon-like protein B1               266   1e-84    
ref|XP_010506615.1|  PREDICTED: reticulon-like protein B5               265   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010508058.1|  PREDICTED: reticulon-like protein B5               265   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010473658.1|  PREDICTED: reticulon-like protein B3 isoform X3    266   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010418453.1|  PREDICTED: reticulon-like protein B3               265   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010430525.1|  PREDICTED: reticulon-like protein B3               265   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_011003673.1|  PREDICTED: reticulon-like protein B1               265   2e-84    Populus euphratica
ref|XP_009137373.1|  PREDICTED: reticulon-like protein B1               265   2e-84    Brassica rapa
ref|XP_006397801.1|  hypothetical protein EUTSA_v10001599mg             265   2e-84    Eutrema salsugineum [saltwater cress]
ref|XP_009345612.1|  PREDICTED: reticulon-like protein B1               265   2e-84    Pyrus x bretschneideri [bai li]
ref|XP_006294850.1|  hypothetical protein CARUB_v10023902mg             265   3e-84    Capsella rubella
ref|XP_006391670.1|  hypothetical protein EUTSA_v10023649mg             265   3e-84    Eutrema salsugineum [saltwater cress]
ref|XP_004298843.1|  PREDICTED: reticulon-like protein B2               264   4e-84    Fragaria vesca subsp. vesca
ref|NP_198975.1|  reticulon-like protein B4                             264   6e-84    Arabidopsis thaliana [mouse-ear cress]
emb|CDY05135.1|  BnaC03g29330D                                          266   6e-84    
emb|CDY25557.1|  BnaC09g11820D                                          263   8e-84    Brassica napus [oilseed rape]
ref|XP_009142682.1|  PREDICTED: reticulon-like protein B5               263   9e-84    Brassica rapa
ref|XP_004306726.1|  PREDICTED: reticulon-like protein B5               263   9e-84    Fragaria vesca subsp. vesca
gb|KHN29299.1|  Reticulon-like protein B5                               263   2e-83    Glycine soja [wild soybean]
gb|KHN40449.1|  Reticulon-like protein B5                               263   2e-83    Glycine soja [wild soybean]
ref|NP_001240231.1|  uncharacterized protein LOC100778096               263   2e-83    Glycine max [soybeans]
dbj|BAH57206.1|  AT1G64090                                              262   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008377768.1|  PREDICTED: reticulon-like protein B2               263   2e-83    Malus domestica [apple tree]
emb|CDX90792.1|  BnaA03g24720D                                          263   2e-83    
ref|NP_176592.1|  reticulon-like protein B3                             263   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887921.1|  reticulon family protein                           262   3e-83    Arabidopsis lyrata subsp. lyrata
emb|CDY24806.1|  BnaA08g15040D                                          263   4e-83    Brassica napus [oilseed rape]
ref|XP_009395750.1|  PREDICTED: reticulon-like protein B2               262   4e-83    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY42012.1|  BnaC04g00900D                                          261   5e-83    Brassica napus [oilseed rape]
ref|XP_007139767.1|  hypothetical protein PHAVU_008G057300g             262   5e-83    Phaseolus vulgaris [French bean]
emb|CDM81762.1|  unnamed protein product                                261   5e-83    Triticum aestivum [Canadian hard winter wheat]
emb|CDY41666.1|  BnaC03g62180D                                          262   6e-83    Brassica napus [oilseed rape]
ref|XP_002880222.1|  reticulon family protein                           261   6e-83    Arabidopsis lyrata subsp. lyrata
emb|CDY52012.1|  BnaC06g42920D                                          261   8e-83    Brassica napus [oilseed rape]
ref|XP_008367699.1|  PREDICTED: reticulon-like protein B2               261   8e-83    Malus domestica [apple tree]
ref|XP_009334492.1|  PREDICTED: reticulon-like protein B2               261   1e-82    Pyrus x bretschneideri [bai li]
ref|XP_010671578.1|  PREDICTED: reticulon-like protein B4               262   1e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007040378.1|  Reticulan like protein B3, putative isoform 3      261   1e-82    
ref|XP_002301382.1|  hypothetical protein POPTR_0002s16690g             260   1e-82    Populus trichocarpa [western balsam poplar]
ref|XP_009104316.1|  PREDICTED: reticulon-like protein B6               260   2e-82    Brassica rapa
ref|NP_001239653.1|  uncharacterized protein LOC100793862               260   2e-82    Glycine max [soybeans]
ref|XP_006302727.1|  hypothetical protein CARUB_v10020840mg             259   3e-82    Capsella rubella
ref|XP_007040377.1|  Reticulan like protein B3, putative isoform 2      261   3e-82    
emb|CDY34396.1|  BnaA09g11380D                                          259   4e-82    Brassica napus [oilseed rape]
ref|XP_009349323.1|  PREDICTED: reticulon-like protein B1               259   5e-82    Pyrus x bretschneideri [bai li]
ref|XP_010447719.1|  PREDICTED: reticulon-like protein B4               259   6e-82    Camelina sativa [gold-of-pleasure]
gb|KFK40472.1|  hypothetical protein AALP_AA2G000200                    259   6e-82    Arabis alpina [alpine rockcress]
emb|CDY38194.1|  BnaA09g11950D                                          258   9e-82    Brassica napus [oilseed rape]
gb|AFK42059.1|  unknown                                                 258   9e-82    Lotus japonicus
ref|NP_566065.1|  reticulon-like protein B5                             258   9e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284372.1|  hypothetical protein CARUB_v10005543mg             258   1e-81    Capsella rubella
ref|XP_007209494.1|  hypothetical protein PRUPE_ppa010244mg             258   2e-81    Prunus persica
ref|XP_009112901.1|  PREDICTED: reticulon-like protein B3               257   2e-81    Brassica rapa
gb|ACG32549.1|  seed maturation protein                                 257   2e-81    Zea mays [maize]
ref|XP_002441411.1|  hypothetical protein SORBIDRAFT_09g026210          257   3e-81    Sorghum bicolor [broomcorn]
ref|XP_006402470.1|  hypothetical protein EUTSA_v10006190mg             257   3e-81    Eutrema salsugineum [saltwater cress]
ref|XP_010436110.1|  PREDICTED: reticulon-like protein B4               256   9e-81    Camelina sativa [gold-of-pleasure]
ref|XP_010441324.1|  PREDICTED: reticulon-like protein B4               256   9e-81    Camelina sativa [gold-of-pleasure]
ref|XP_011037168.1|  PREDICTED: reticulon-like protein B5               255   1e-80    Populus euphratica
ref|XP_004308034.1|  PREDICTED: reticulon-like protein B2               256   2e-80    Fragaria vesca subsp. vesca
ref|XP_007135152.1|  hypothetical protein PHAVU_010G105400g             255   2e-80    Phaseolus vulgaris [French bean]
gb|KFK33000.1|  hypothetical protein AALP_AA6G316900                    255   2e-80    Arabis alpina [alpine rockcress]
emb|CDY08353.1|  BnaC09g12430D                                          254   3e-80    Brassica napus [oilseed rape]
ref|XP_009112802.1|  PREDICTED: reticulon-like protein B3               254   3e-80    Brassica rapa
gb|AFK34557.1|  unknown                                                 254   5e-80    Medicago truncatula
ref|NP_001130268.1|  uncharacterized protein LOC100191362               254   6e-80    Zea mays [maize]
ref|XP_006291739.1|  hypothetical protein CARUB_v10017909mg             253   9e-80    Capsella rubella
ref|XP_011023265.1|  PREDICTED: reticulon-like protein B5               253   1e-79    Populus euphratica
ref|XP_004133840.1|  PREDICTED: reticulon-like protein B5-like          253   1e-79    Cucumis sativus [cucumbers]
gb|EPS71452.1|  hypothetical protein M569_03311                         252   2e-79    Genlisea aurea
ref|XP_010105716.1|  Reticulon-like protein                             253   2e-79    
ref|XP_010469092.1|  PREDICTED: reticulon-like protein B6               252   3e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010413382.1|  PREDICTED: reticulon-like protein B6               251   3e-79    Camelina sativa [gold-of-pleasure]
ref|XP_008437980.1|  PREDICTED: reticulon-like protein B5               252   3e-79    Cucumis melo [Oriental melon]
ref|NP_001185307.1|  reticulon-like protein B3                          252   3e-79    Arabidopsis thaliana [mouse-ear cress]
gb|KCW72350.1|  hypothetical protein EUGRSUZ_E00805                     251   4e-79    Eucalyptus grandis [rose gum]
gb|EPS73616.1|  hypothetical protein M569_01145                         251   4e-79    Genlisea aurea
gb|EMT06999.1|  Reticulon-like protein B1                               251   4e-79    
ref|XP_009109295.1|  PREDICTED: reticulon-like protein B1               252   5e-79    Brassica rapa
ref|XP_004961431.1|  PREDICTED: reticulon-like protein B1-like          251   6e-79    Setaria italica
ref|XP_010523772.1|  PREDICTED: reticulon-like protein B5               251   6e-79    Tarenaya hassleriana [spider flower]
ref|NP_191715.2|  reticulon-like protein B6                             251   9e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004510697.1|  PREDICTED: reticulon-like protein B1-like          250   1e-78    Cicer arietinum [garbanzo]
ref|XP_004965478.1|  PREDICTED: reticulon-like protein B2-like          248   8e-78    Setaria italica
ref|XP_002876621.1|  reticulon family protein                           248   1e-77    
ref|XP_010512508.1|  PREDICTED: reticulon-like protein B6               247   2e-77    Camelina sativa [gold-of-pleasure]
gb|EMT18983.1|  Reticulon-like protein B1                               246   4e-77    
ref|XP_006842617.1|  hypothetical protein AMTR_s00077p00178230          245   1e-76    Amborella trichopoda
ref|XP_006656127.1|  PREDICTED: reticulon-like protein B2-like          245   1e-76    Oryza brachyantha
ref|XP_008788043.1|  PREDICTED: reticulon-like protein B5               244   2e-76    Phoenix dactylifera
ref|XP_007040376.1|  Reticulan like protein B3, putative isoform 1      244   3e-76    
ref|NP_001057713.1|  Os06g0503400                                       244   3e-76    
ref|XP_008239009.1|  PREDICTED: reticulon-like protein B2               243   6e-76    Prunus mume [ume]
ref|XP_003592173.1|  Reticulon family protein                           243   7e-76    Medicago truncatula
ref|NP_001046501.1|  Os02g0265900                                       243   7e-76    
ref|XP_002317731.1|  hypothetical protein POPTR_0012s00980g             243   7e-76    
gb|EAY85291.1|  hypothetical protein OsI_06662                          242   1e-75    Oryza sativa Indica Group [Indian rice]
dbj|BAJ94514.1|  predicted protein                                      243   1e-75    
gb|KJB52679.1|  hypothetical protein B456_008G272900                    242   1e-75    
ref|XP_002438444.1|  hypothetical protein SORBIDRAFT_10g019720          242   2e-75    
ref|XP_006647139.1|  PREDICTED: reticulon-like protein B2-like          241   2e-75    
gb|ACG36034.1|  reticulon                                               240   1e-74    
ref|XP_008458672.1|  PREDICTED: reticulon-like protein B2               239   3e-74    
gb|ABB51093.1|  reticulon                                               237   5e-74    
gb|KJB24288.1|  hypothetical protein B456_004G137000                    238   5e-74    
ref|XP_010938076.1|  PREDICTED: reticulon-like protein B1               238   6e-74    
ref|XP_004159803.1|  PREDICTED: reticulon-like protein B2-like          238   7e-74    
gb|KHN21799.1|  Reticulon-like protein B1                               238   7e-74    
ref|NP_001130603.1|  uncharacterized protein LOC100191702               237   9e-74    
ref|XP_006589518.1|  PREDICTED: reticulon-like protein B1-like          238   1e-73    
ref|XP_004496510.1|  PREDICTED: reticulon-like protein B1-like          238   1e-73    
ref|XP_002275520.1|  PREDICTED: reticulon-like protein B5               238   1e-73    
ref|NP_001130091.1|  uncharacterized protein LOC100191184               237   2e-73    
ref|XP_010931411.1|  PREDICTED: reticulon-like protein B6               236   2e-73    
ref|NP_001042463.1|  Os01g0226300                                       234   3e-73    
ref|XP_007143486.1|  hypothetical protein PHAVU_007G075900g             236   3e-73    
gb|EMT25698.1|  Reticulon-like protein B2                               236   5e-73    
ref|XP_009419823.1|  PREDICTED: reticulon-like protein B2               236   6e-73    
gb|ABK22748.1|  unknown                                                 235   1e-72    
ref|XP_003563831.1|  PREDICTED: reticulon-like protein B1               235   2e-72    
ref|XP_010921231.1|  PREDICTED: reticulon-like protein B1 isoform X1    234   3e-72    
ref|XP_003555396.1|  PREDICTED: reticulon-like protein B1-like          234   3e-72    
gb|KHN12926.1|  Reticulon-like protein B1                               234   4e-72    
ref|XP_008793405.1|  PREDICTED: reticulon-like protein B1               233   4e-72    
gb|EMS49910.1|  Reticulon-like protein B3                               234   1e-71    
ref|XP_009399837.1|  PREDICTED: reticulon-like protein B5               231   3e-71    
ref|XP_003572248.1|  PREDICTED: reticulon-like protein B2               230   6e-71    
ref|XP_004951242.1|  PREDICTED: reticulon-like protein B2-like          230   7e-71    
ref|XP_010278922.1|  PREDICTED: reticulon-like protein B5               230   8e-71    
gb|EPS69502.1|  hypothetical protein M569_05265                         226   1e-69    
ref|XP_009400146.1|  PREDICTED: reticulon-like protein B1               226   2e-69    
ref|XP_009404680.1|  PREDICTED: reticulon-like protein B2               226   2e-69    
gb|EPS64109.1|  hypothetical protein M569_10676                         224   2e-68    
ref|XP_009787619.1|  PREDICTED: reticulon-like protein B5               223   7e-68    
ref|XP_004247011.1|  PREDICTED: reticulon-like protein B5               221   2e-67    
ref|XP_009601019.1|  PREDICTED: reticulon-like protein B8               220   8e-67    
ref|XP_006654252.1|  PREDICTED: reticulon-like protein B1-like          220   9e-67    
ref|XP_009621222.1|  PREDICTED: reticulon-like protein B5               219   1e-66    
ref|XP_009783850.1|  PREDICTED: reticulon-like protein B8               219   2e-66    
gb|EAY97489.1|  hypothetical protein OsI_19418                          218   5e-66    
gb|EMS50148.1|  Reticulon-like protein B2                               217   9e-66    
ref|NP_001055164.1|  Os05g0312500                                       217   1e-65    
gb|AFW77088.1|  hypothetical protein ZEAMMB73_846644                    216   2e-65    
gb|KJB39437.1|  hypothetical protein B456_007G013600                    216   2e-65    
gb|ABK26525.1|  unknown                                                 216   3e-65    
ref|XP_004962474.1|  PREDICTED: reticulon-like protein B1-like          215   6e-65    
ref|XP_006836413.1|  hypothetical protein AMTR_s00092p00151450          215   6e-65    
ref|XP_002521590.1|  conserved hypothetical protein                     214   2e-64    
ref|NP_001149072.1|  LOC100282693                                       214   2e-64    
ref|XP_008647873.1|  PREDICTED: LOC100282693 isoform X1                 214   2e-64    
ref|XP_002302126.2|  reticulon family protein                           213   2e-64    
ref|XP_010054120.1|  PREDICTED: reticulon-like protein B8 isoform X2    213   3e-64    
dbj|BAK06264.1|  predicted protein                                      213   3e-64    
ref|XP_004161550.1|  PREDICTED: reticulon-like protein B8-like          213   4e-64    
gb|EPS67049.1|  hypothetical protein M569_07727                         212   5e-64    
ref|XP_004499535.1|  PREDICTED: reticulon-like protein B8-like is...    213   5e-64    
ref|XP_011026205.1|  PREDICTED: reticulon-like protein B8               213   6e-64    
gb|EYU36885.1|  hypothetical protein MIMGU_mgv1a013116mg                212   7e-64    
ref|XP_006437080.1|  hypothetical protein CICLE_v10032550mg             212   7e-64    
gb|KCW89791.1|  hypothetical protein EUGRSUZ_A02040                     213   9e-64    
ref|XP_010904667.1|  PREDICTED: reticulon-like protein B8               211   2e-63    
ref|XP_006485002.1|  PREDICTED: reticulon-like protein B8-like is...    211   2e-63    
ref|NP_001150935.1|  seed maturation protein                            211   2e-63    
gb|KCW46474.1|  hypothetical protein EUGRSUZ_K00300                     209   3e-63    
gb|ABC69764.1|  unknown                                                 209   3e-63    
ref|XP_007048924.1|  Reticulon family protein                           210   4e-63    
ref|XP_008451843.1|  PREDICTED: reticulon-like protein B8 isoform X2    210   5e-63    
ref|XP_009777726.1|  PREDICTED: reticulon-like protein B8               209   7e-63    
ref|XP_008451841.1|  PREDICTED: reticulon-like protein B8 isoform X1    209   1e-62    
ref|XP_010054092.1|  PREDICTED: reticulon-like protein B8 isoform X1    209   2e-62    
ref|XP_010247587.1|  PREDICTED: reticulon-like protein B8               209   2e-62    
ref|XP_003568686.1|  PREDICTED: reticulon-like protein B1               208   2e-62    
gb|KDP36280.1|  hypothetical protein JCGZ_10290                         208   2e-62    
ref|XP_007215866.1|  hypothetical protein PRUPE_ppa010481mg             208   3e-62    
ref|XP_009596514.1|  PREDICTED: reticulon-like protein B8               208   3e-62    
gb|ABK23818.1|  unknown                                                 205   4e-62    
ref|XP_009631244.1|  PREDICTED: reticulon-like protein B2 isoform X1    207   4e-62    
ref|XP_002306759.1|  reticulon family protein                           207   4e-62    
ref|XP_009793495.1|  PREDICTED: reticulon-like protein B2               207   4e-62    
ref|XP_009631245.1|  PREDICTED: reticulon-like protein B2 isoform X2    207   5e-62    
gb|EEC80692.1|  hypothetical protein OsI_23118                          221   5e-62    
ref|XP_006339395.1|  PREDICTED: reticulon-like protein B5-like          207   7e-62    
ref|XP_008229593.1|  PREDICTED: reticulon-like protein B8               207   7e-62    
gb|KCW72351.1|  hypothetical protein EUGRSUZ_E00805                     206   1e-61    
gb|KFK30707.1|  hypothetical protein AALP_AA6G017300                    207   1e-61    
gb|EMS52545.1|  Reticulon-like protein B1                               207   1e-61    
ref|XP_011032749.1|  PREDICTED: reticulon-like protein B8 isoform X2    206   2e-61    
ref|XP_011032748.1|  PREDICTED: reticulon-like protein B8 isoform X1    206   2e-61    
ref|XP_010486627.1|  PREDICTED: reticulon-like protein B8               206   2e-61    
ref|NP_566371.1|  reticulon-like protein B8                             206   2e-61    
ref|XP_006366828.1|  PREDICTED: reticulon-like protein B2-like          206   3e-61    
ref|XP_011080610.1|  PREDICTED: reticulon-like protein B5               205   3e-61    
ref|XP_011467620.1|  PREDICTED: reticulon-like protein B8 isoform X2    205   4e-61    
ref|NP_850552.1|  reticulon-like protein B8                             206   4e-61    
gb|EEE65781.1|  hypothetical protein OsJ_21474                          217   6e-61    
ref|XP_010482050.1|  PREDICTED: reticulon-like protein B8               204   9e-61    
ref|XP_006407589.1|  hypothetical protein EUTSA_v10021400mg             204   1e-60    
emb|CDY41331.1|  BnaA01g31880D                                          204   1e-60    
gb|KDO44767.1|  hypothetical protein CISIN_1g025770mg                   204   1e-60    
ref|XP_010464699.1|  PREDICTED: reticulon-like protein B8               203   2e-60    
emb|CDP18758.1|  unnamed protein product                                203   2e-60    
gb|KHN11998.1|  Reticulon-like protein B8                               202   4e-60    
ref|XP_009123032.1|  PREDICTED: reticulon-like protein B8               202   5e-60    
ref|XP_003532073.1|  PREDICTED: reticulon-like protein B8-like is...    202   6e-60    
ref|XP_010552962.1|  PREDICTED: reticulon-like protein B8               201   8e-60    
ref|XP_006366629.1|  PREDICTED: reticulon-like protein B8-like is...    202   8e-60    
ref|XP_006366628.1|  PREDICTED: reticulon-like protein B8-like is...    202   1e-59    
ref|XP_009356582.1|  PREDICTED: reticulon-like protein B8 isoform X2    201   1e-59    
ref|XP_009146855.1|  PREDICTED: reticulon-like protein B8 isoform X2    201   2e-59    
ref|XP_011467618.1|  PREDICTED: reticulon-like protein B8 isoform X1    201   2e-59    
ref|XP_009146854.1|  PREDICTED: reticulon-like protein B8 isoform X1    201   3e-59    
ref|NP_001241930.1|  uncharacterized protein LOC100787981               200   4e-59    
ref|XP_008461104.1|  PREDICTED: reticulon-like protein B9               199   4e-59    
emb|CDY00916.1|  BnaC05g42840D                                          199   4e-59    
emb|CDY56712.1|  BnaC01g38700D                                          203   5e-59    
ref|XP_006351999.1|  PREDICTED: reticulon-like protein B8-like          199   7e-59    
ref|XP_007141449.1|  hypothetical protein PHAVU_008G196600g             199   8e-59    
sp|Q9M145.2|RTNLG_ARATH  RecName: Full=Reticulon-like protein B7;...    198   1e-58    
ref|XP_007146289.1|  hypothetical protein PHAVU_006G028000g             198   1e-58    
emb|CDY07184.1|  BnaCnng01990D                                          198   1e-58    
ref|XP_009111430.1|  PREDICTED: reticulon-like protein B7 isoform X1    198   2e-58    
ref|XP_009403393.1|  PREDICTED: reticulon-like protein B8               199   2e-58    
ref|NP_001051461.1|  Os03g0781700                                       198   2e-58    
ref|XP_002283026.1|  PREDICTED: reticulon-like protein B8               198   2e-58    
gb|KHG28741.1|  Reticulon-like protein B8                               198   2e-58    
ref|XP_009376960.1|  PREDICTED: reticulon-like protein B8               197   3e-58    
ref|XP_004243617.1|  PREDICTED: reticulon-like protein B8               197   4e-58    
gb|EAY92056.1|  hypothetical protein OsI_13754                          198   5e-58    
gb|EAY98925.1|  hypothetical protein OsI_20880                          196   5e-58    
ref|XP_008380166.1|  PREDICTED: reticulon-like protein B8 isoform X4    197   7e-58    
ref|XP_008380160.1|  PREDICTED: reticulon-like protein B8 isoform X2    197   9e-58    
ref|XP_002463790.1|  hypothetical protein SORBIDRAFT_01g006220          196   9e-58    
ref|XP_004251554.1|  PREDICTED: reticulon-like protein B8 isoform X2    196   9e-58    
ref|XP_011096983.1|  PREDICTED: reticulon-like protein B9               195   1e-57    
ref|XP_010688858.1|  PREDICTED: reticulon-like protein B8               196   2e-57    
ref|XP_010313685.1|  PREDICTED: reticulon-like protein B8 isoform X1    196   2e-57    
gb|AFK34561.1|  unknown                                                 196   2e-57    
ref|XP_004963616.1|  PREDICTED: reticulon-like protein B9-like          195   2e-57    
ref|XP_011085435.1|  PREDICTED: reticulon-like protein B8               195   3e-57    
ref|XP_011100485.1|  PREDICTED: reticulon-like protein B8               195   3e-57    
ref|XP_006298417.1|  hypothetical protein CARUB_v10014488mg             195   4e-57    
gb|EMT10142.1|  Reticulon-like protein B1                               196   4e-57    
gb|KJB52212.1|  hypothetical protein B456_008G250900                    194   4e-57    
gb|KCW46475.1|  hypothetical protein EUGRSUZ_K00300                     192   4e-57    
ref|XP_008811812.1|  PREDICTED: reticulon-like protein B8               194   4e-57    
ref|XP_008342327.1|  PREDICTED: reticulon-like protein B8               194   6e-57    
ref|XP_006650682.1|  PREDICTED: reticulon-like protein B8-like          194   6e-57    
ref|XP_011008495.1|  PREDICTED: reticulon-like protein B2               194   6e-57    
ref|XP_010906987.1|  PREDICTED: reticulon-like protein B2               193   7e-57    
ref|XP_006654743.1|  PREDICTED: reticulon-like protein B9-like          193   1e-56    
ref|XP_004299572.1|  PREDICTED: reticulon-like protein B9               193   1e-56    
ref|XP_009356580.1|  PREDICTED: reticulon-like protein B8 isoform X1    194   1e-56    
ref|XP_006413534.1|  hypothetical protein EUTSA_v10025959mg             192   2e-56    
ref|XP_003519525.1|  PREDICTED: uncharacterized LOC100500122 isof...    192   2e-56    
gb|KJB71174.1|  hypothetical protein B456_011G126300                    192   3e-56    
gb|KHN28537.1|  Reticulon-like protein B8                               192   3e-56    
ref|XP_002884786.1|  reticulon family protein                           192   3e-56    
ref|XP_010093192.1|  Reticulon-like protein                             192   4e-56    
dbj|BAH20346.1|  AT4G11220                                              189   4e-56    
ref|XP_004137485.1|  PREDICTED: reticulon-like protein B9-like          191   4e-56    
gb|ACG31942.1|  seed maturation protein                                 192   4e-56    
ref|XP_010036176.1|  PREDICTED: reticulon-like protein B8               192   6e-56    
emb|CDP04019.1|  unnamed protein product                                191   6e-56    
gb|KJB71173.1|  hypothetical protein B456_011G126300                    192   1e-55    
ref|XP_009416749.1|  PREDICTED: reticulon-like protein B8 isoform X1    191   1e-55    
ref|XP_010023631.1|  PREDICTED: reticulon-like protein B8 isoform X2    192   1e-55    
ref|XP_004981542.1|  PREDICTED: reticulon-like protein B8-like          193   1e-55    
ref|NP_001137021.1|  seed maturation protein isoform 1                  191   2e-55    
tpg|DAA51729.1|  TPA: seed maturation protein                           191   2e-55    
ref|XP_010906857.1|  PREDICTED: reticulon-like protein B8 isoform X1    191   2e-55    
gb|ACG26944.1|  seed maturation protein                                 191   2e-55    
ref|XP_010279360.1|  PREDICTED: reticulon-like protein B9               189   2e-55    
ref|XP_006602275.1|  PREDICTED: reticulon-like protein B8-like is...    190   3e-55    
ref|XP_010228928.1|  PREDICTED: reticulon-like protein B8               190   3e-55    
ref|NP_192032.1|  reticulon-like protein B7                             189   5e-55    
ref|XP_006432015.1|  hypothetical protein CICLE_v10002112mg             190   5e-55    
ref|XP_009111438.1|  PREDICTED: reticulon-like protein B7 isoform X2    189   5e-55    
ref|XP_006491909.1|  PREDICTED: reticulon-like protein B5-like is...    190   6e-55    
ref|XP_008380161.1|  PREDICTED: reticulon-like protein B8 isoform X3    189   8e-55    
emb|CAN77759.1|  hypothetical protein VITISV_034907                     189   8e-55    
ref|XP_008380159.1|  PREDICTED: reticulon-like protein B8 isoform X1    189   9e-55    
ref|XP_009415631.1|  PREDICTED: reticulon-like protein B2               188   9e-55    
ref|XP_008782310.1|  PREDICTED: reticulon-like protein B1               187   1e-54    
ref|XP_002319442.2|  hypothetical protein POPTR_0013s15680g             188   2e-54    
gb|KEH33647.1|  reticulon-like protein B2                               188   2e-54    
gb|ABK26009.1|  unknown                                                 187   2e-54    
ref|XP_007209013.1|  hypothetical protein PRUPE_ppa023407mg             187   2e-54    
ref|XP_006491907.1|  PREDICTED: reticulon-like protein B5-like is...    190   3e-54    
ref|XP_007139766.1|  hypothetical protein PHAVU_008G057300g             186   3e-54    
ref|XP_006491906.1|  PREDICTED: reticulon-like protein B5-like is...    190   3e-54    
ref|XP_010456226.1|  PREDICTED: reticulon-like protein B7 isoform X1    187   5e-54    
ref|XP_002872901.1|  reticulon family protein                           186   5e-54    
ref|XP_010023623.1|  PREDICTED: reticulon-like protein B8 isoform X1    188   7e-54    
gb|EYU42855.1|  hypothetical protein MIMGU_mgv1a012522mg                186   8e-54    
ref|NP_001058867.1|  Os07g0142000                                       186   1e-53    
ref|XP_010422782.1|  PREDICTED: reticulon-like protein B7 isoform X1    185   2e-53    
ref|XP_010323110.1|  PREDICTED: reticulon-like protein B2               183   2e-53    
ref|XP_010427652.1|  PREDICTED: reticulon-like protein B7 isoform X1    184   3e-53    
ref|XP_010921233.1|  PREDICTED: reticulon-like protein B1 isoform X2    183   5e-53    
ref|XP_006289795.1|  hypothetical protein CARUB_v10003398mg             184   5e-53    
dbj|BAK05980.1|  predicted protein                                      183   8e-53    
ref|XP_003565315.1|  PREDICTED: reticulon-like protein B4               182   1e-52    
ref|XP_004491277.1|  PREDICTED: reticulon-like protein B8-like is...    183   1e-52    
ref|XP_009347494.1|  PREDICTED: reticulon-like protein B9               182   1e-52    
ref|XP_004491276.1|  PREDICTED: reticulon-like protein B8-like is...    183   3e-52    
ref|XP_008792884.1|  PREDICTED: reticulon-like protein B6               181   3e-52    
ref|XP_006396287.1|  hypothetical protein EUTSA_v10029354mg             181   7e-52    
ref|XP_008240229.1|  PREDICTED: reticulon-like protein B9               180   7e-52    
ref|XP_010253410.1|  PREDICTED: reticulon-like protein B9               180   7e-52    
gb|KDP35031.1|  hypothetical protein JCGZ_09319                         180   1e-51    
ref|XP_006374288.1|  hypothetical protein POPTR_0015s05710g             179   1e-51    
ref|XP_007017116.1|  VIRB2-interacting protein 2, putative              181   1e-51    
emb|CDP00665.1|  unnamed protein product                                179   1e-51    
ref|XP_008363374.1|  PREDICTED: reticulon-like protein B4               180   1e-51    
gb|AGT16133.1|  hypothetical protein SHCRBa_127_N06_F_30                179   2e-51    
ref|XP_008374784.1|  PREDICTED: reticulon-like protein B9               179   2e-51    
ref|XP_002321491.1|  reticulon family protein                           178   4e-51    
ref|XP_006491908.1|  PREDICTED: reticulon-like protein B5-like is...    182   5e-51    



>ref|XP_004245560.1| PREDICTED: reticulon-like protein B4 [Solanum lycopersicum]
Length=270

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            +KVRRLFGR++PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYHLLT +C
Sbjct  63   SKVRRLFGRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLC  122

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            HGL++ALA LFLWSNAS+FI KSAPHIPEVHIPE+PVL+FASALRN++N  LAVLR+IAS
Sbjct  123  HGLMIALAGLFLWSNASTFIHKSAPHIPEVHIPEKPVLEFASALRNEINRALAVLREIAS  182

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLKMFL+VI GLW+ SI+G CCDFLTLFYI VV+LHTVPVLYEKYED+VDAFAEKA+H
Sbjct  183  GRDLKMFLLVIGGLWLASILGGCCDFLTLFYIIVVVLHTVPVLYEKYEDQVDAFAEKALH  242

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            ELKKQYAV DAKVLSKIPRGPLKDKK
Sbjct  243  ELKKQYAVLDAKVLSKIPRGPLKDKK  268



>ref|XP_006343915.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=270

 Score =   331 bits (848),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            +KVRRLFGR++PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYHLLT +C
Sbjct  63   SKVRRLFGRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLC  122

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            HGL++ALA LFLWSNAS+FI KSAPHIPEVHIPE+PVL FASALRN++N  LAVLR+IAS
Sbjct  123  HGLMVALAGLFLWSNASTFIHKSAPHIPEVHIPEKPVLAFASALRNEINRALAVLREIAS  182

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FL+VI GLW+ SI+G CCDFLTLFYI VV+LHTVPVLYEKYED+VDAFAEKA+H
Sbjct  183  GRDLKTFLLVIGGLWLASILGGCCDFLTLFYIIVVVLHTVPVLYEKYEDQVDAFAEKALH  242

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            ELKKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  243  ELKKQYAVFDAKVLSKIPRGPLKDKK  268



>ref|XP_009793558.1| PREDICTED: reticulon-like protein B4 [Nicotiana sylvestris]
Length=268

 Score =   329 bits (843),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            +KVRRLFGR++PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYH LT +C
Sbjct  61   SKVRRLFGRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLC  120

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            HGLI+ALA LFLWSNAS+FI KSAPHIPEVHIPE+PVL+FA+ LRN++N   AVLR+IA+
Sbjct  121  HGLIVALAGLFLWSNASAFIHKSAPHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAA  180

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FLMVI GLWI+S++GSCCDFL+LFYI VV+LHTVPVLYEKYED++D+FAEKA+H
Sbjct  181  GRDLKTFLMVIGGLWILSVLGSCCDFLSLFYIIVVVLHTVPVLYEKYEDQIDSFAEKALH  240

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            ELKKQYAVFDAKVLSKIPRGPL+DKK A
Sbjct  241  ELKKQYAVFDAKVLSKIPRGPLRDKKKA  268



>gb|KHG24129.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=250

 Score =   312 bits (799),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AKV RLFGR++PVH VLGGGK AD+FLWRNKKIS G LG AT IWILFE+LEYHLLT 
Sbjct  41   IKAKVFRLFGREKPVHHVLGGGKPADIFLWRNKKISAGALGVATVIWILFEMLEYHLLTL  100

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALAVLFLWSNA++FI KS P IPEV IP++PV++FA ALR ++N   AVLRDI
Sbjct  101  VCHLLILALAVLFLWSNAATFINKSPPRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDI  160

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGR+LK FL VI GLW++SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKA
Sbjct  161  ASGRELKKFLSVIAGLWVLSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKA  220

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            MHE+KKQYAVFDAKVLSKIPRGPLK+KK
Sbjct  221  MHEIKKQYAVFDAKVLSKIPRGPLKEKK  248



>emb|CDP12094.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   311 bits (797),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AKV RLFGR++PVHK+LGGGK ADVF+WRNK+IS GVLG ATAIW+LFE+LEYHLLT 
Sbjct  43   LKAKVFRLFGREKPVHKLLGGGKPADVFMWRNKQISAGVLGVATAIWVLFEILEYHLLTL  102

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCHGLI+ LAVLFLWSNAS+FI KS P IPEV +PE+PVLQFAS  R  +N   A+LRD+
Sbjct  103  VCHGLIIVLAVLFLWSNASTFINKSPPRIPEVSVPEKPVLQFASDARVAINQTFALLRDV  162

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGR+LK FL VI GLWI SI+GSCCDFLTL YI+ VLLHTVPV+Y+KYED+VD+FAEKA
Sbjct  163  ASGRNLKKFLSVIAGLWIFSILGSCCDFLTLLYISAVLLHTVPVIYDKYEDQVDSFAEKA  222

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            + ELKKQYAVFD KVLSKIPRGPLKDKK
Sbjct  223  LAELKKQYAVFDKKVLSKIPRGPLKDKK  250



>ref|XP_010251601.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=254

 Score =   310 bits (795),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + A V RLFGRQ+PVHKV GGGK ADVFLWRNKKIS GVLGGATA W+LFE+LEYHLLT 
Sbjct  45   VTAAVYRLFGRQKPVHKVFGGGKPADVFLWRNKKISAGVLGGATATWVLFELLEYHLLTL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI++LAVLFL+SNA +F+ K+ P IPEV+IPE+PVLQFASALR ++N   AVLRDI
Sbjct  105  VCHCLIVSLAVLFLYSNAIAFMHKTPPRIPEVYIPEDPVLQFASALRIEINRAFAVLRDI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++SIVGS C+FLTLFYIA VLLHTVPVLYEKYED+VD+FAEKA
Sbjct  165  ASGRDLKKFLAVIAGLWVLSIVGSWCNFLTLFYIAFVLLHTVPVLYEKYEDQVDSFAEKA  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            M E+KKQY +FDAKVLSKIP+GPLKDKK A
Sbjct  225  MAEIKKQYVIFDAKVLSKIPKGPLKDKKHA  254



>ref|XP_010658515.1| PREDICTED: reticulon-like protein B2 [Vitis vinifera]
 emb|CBI34409.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   309 bits (791),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AKV R+FGR++PVHKVLGGGK ADV LWRNKKIS GVLGGATA+WILFE+LEYHLLT VC
Sbjct  45   AKVYRIFGREKPVHKVLGGGKPADVVLWRNKKISAGVLGGATAVWILFELLEYHLLTLVC  104

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  ILALA+LFLWSNA++FI K+ PHIPEVHIPE+PVLQFASALR ++N    +LR++AS
Sbjct  105  HCSILALAILFLWSNATTFINKAPPHIPEVHIPEDPVLQFASALRIEINRGFTLLRNVAS  164

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            G+DLK FL VI GLW++SIVGS C+FLTLFYI  VLLHTVPVLYEKYED VD+FAEKAM 
Sbjct  165  GKDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYEDPVDSFAEKAMV  224

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            E+K+QYAVFDAKVLS+IPRGPLKDKK+A
Sbjct  225  EIKRQYAVFDAKVLSRIPRGPLKDKKIA  252



>ref|XP_002509881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51268.1| conserved hypothetical protein [Ricinus communis]
Length=260

 Score =   308 bits (790),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  578
            RLFGR++PVH VLGGGK AD+FLWRNKK+S GVLG ATA+W+LFE++EYHLLT +CHG I
Sbjct  57   RLFGREKPVHHVLGGGKPADIFLWRNKKVSAGVLGFATAVWVLFELIEYHLLTLICHGFI  116

Query  577  LALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDL  398
            LALA+LFLWSNAS+FI KS PHIPEVHIPEEPVLQ A+ALR ++N+  A+LRDIASGRDL
Sbjct  117  LALAILFLWSNASTFINKSPPHIPEVHIPEEPVLQVAAALRMEINYAFAILRDIASGRDL  176

Query  397  KMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKK  218
            K FL VI GLW++SIVGS C+FLTLFYIA VLLHTVPV YEKYED+VDAFAEKA  E+KK
Sbjct  177  KKFLSVIAGLWVLSIVGSWCNFLTLFYIAFVLLHTVPVFYEKYEDKVDAFAEKAAIEIKK  236

Query  217  QYAVFDAKVLSKIPRGPLKDKKLA  146
            QYAVFDAKVLSKIPRGPLKDKK A
Sbjct  237  QYAVFDAKVLSKIPRGPLKDKKKA  260



>ref|XP_009597328.1| PREDICTED: reticulon-like protein B5 [Nicotiana tomentosiformis]
Length=268

 Score =   307 bits (787),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            KV RLFGR++PVHKV GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH
Sbjct  62   KVWRLFGREKPVHKVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICH  121

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LI++LAVLFLWSNA++FI K  PHIPE+H+P++P LQ ASALR ++N  LA+LR+IASG
Sbjct  122  ILIISLAVLFLWSNATTFINKKPPHIPEIHLPQDPFLQVASALRIEINRALALLREIASG  181

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            R+LK FL V+ GLWIISIVGS C+FLTLFYI+ VLLHTVPVLYEKYED+VD  AEKAMHE
Sbjct  182  RELKKFLGVVAGLWIISIVGSWCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAMHE  241

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKK  152
            +KKQYAVFD KVLSKIPRGPLKDKK
Sbjct  242  IKKQYAVFDKKVLSKIPRGPLKDKK  266



>ref|XP_010915765.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=254

 Score =   305 bits (782),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+LFE+L+YHLLT 
Sbjct  46   VKAKIYRLFGREEPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVLFELLDYHLLTL  105

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            V H L+L+LA+LFLWSNAS+FI K  PHIPEV IPE+  +  A +LR ++N   AVLRDI
Sbjct  106  VGHCLVLSLAILFLWSNASTFINKIPPHIPEVSIPEDVAINVALSLRYEINRAFAVLRDI  165

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++SI+GSCC+FLTLFYI  V LHTVPVLYEKYED+VD+FAEKA
Sbjct  166  ASGRDLKKFLAVIAGLWVLSILGSCCNFLTLFYILFVTLHTVPVLYEKYEDKVDSFAEKA  225

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQY VFDAKVLSKIPRGPLKDKK
Sbjct  226  MAEIKKQYVVFDAKVLSKIPRGPLKDKK  253



>ref|XP_006339640.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=265

 Score =   306 bits (783),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  KV RLFGR++PVHKV GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT 
Sbjct  56   LKNKVWRLFGREKPVHKVFGGGKPADVFLWRNKKISGTVLGGATAIWVLFELLEYHLLTL  115

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH LI+ LAVLFLWSNA++FI K  PHIPEVH+PE P+LQ ASALR ++N  L +LR+I
Sbjct  116  ICHILIITLAVLFLWSNATTFINKKPPHIPEVHLPEGPILQVASALRIEINRALDLLREI  175

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGR+LK FL VI GLWI+SIVGS C+FLTLFYI+ VLLHT+PVLYEKYED+VD  AEKA
Sbjct  176  ASGRELKKFLAVIAGLWILSIVGSWCNFLTLFYISFVLLHTIPVLYEKYEDKVDPLAEKA  235

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            MHE+KKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  236  MHEIKKQYAVFDAKVLSKIPRGPLKDKK  263



>ref|XP_008805646.1| PREDICTED: reticulon-like protein B3 [Phoenix dactylifera]
Length=254

 Score =   305 bits (781),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVHKVLGGGK ADV LWRNKKIS GVLGGATA+W+LFE+LEYHLLT 
Sbjct  46   VKAKIYRLFGREKPVHKVLGGGKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTL  105

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            V H LIL+LA+LFLWSNAS+FI K+ PHIPEV IPE+  +  A +LR ++N   A+LRDI
Sbjct  106  VGHCLILSLAILFLWSNASTFISKTPPHIPEVSIPEDLAVNVALSLRYEINRAFAILRDI  165

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++SI+GSCC+FLTLFYI  V LHTVPVLYEKYED+VD FAEKA
Sbjct  166  ASGRDLKKFLAVIAGLWVLSILGSCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDPFAEKA  225

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQY VFDAKVLSKIPRGPLKDKK
Sbjct  226  MAEIKKQYVVFDAKVLSKIPRGPLKDKK  253



>ref|XP_009766982.1| PREDICTED: reticulon-like protein B5 [Nicotiana sylvestris]
Length=266

 Score =   305 bits (782),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            KV RLFGR++PVHKV GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH
Sbjct  60   KVWRLFGREKPVHKVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICH  119

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LI++LAVLFLWSNA++FI K  PHIPE+H+P++P LQ ASALR ++N  LA+LR+IASG
Sbjct  120  ILIISLAVLFLWSNATTFINKKPPHIPEIHLPQDPFLQVASALRIEINRALALLREIASG  179

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            R+LK FL V+ GLWI+SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKAMHE
Sbjct  180  RELKKFLGVVAGLWILSIVGSWCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAMHE  239

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKK  152
            +KKQYAVFD KVLSKIPRGPLKDKK
Sbjct  240  IKKQYAVFDEKVLSKIPRGPLKDKK  264



>ref|XP_004229935.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  KV RLFGR++PVHKV GGGK ADVFLWRNKKIS  V+GGATAIW+LFE+LEYHLLT 
Sbjct  54   LKNKVWRLFGREKPVHKVFGGGKPADVFLWRNKKISATVIGGATAIWVLFELLEYHLLTL  113

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH LI+ LAVLFLWSNA++FI K  PHIPEVH+PE P+LQ ASALR ++N  L +LR+I
Sbjct  114  ICHILIITLAVLFLWSNATTFINKKPPHIPEVHLPEGPILQVASALRIEINRALDLLREI  173

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGR+LK FL VI GLWI+SIVGS C+FLTLFYI+ VLLHTVPV+YEKYED+VD  AEKA
Sbjct  174  ASGRELKKFLAVIAGLWILSIVGSWCNFLTLFYISFVLLHTVPVIYEKYEDKVDPLAEKA  233

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            MHE+KKQYAVFD KVLSKIPRGPLKDKK
Sbjct  234  MHEIKKQYAVFDEKVLSKIPRGPLKDKK  261



>ref|XP_003633964.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_003633965.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_010661856.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 emb|CBI40444.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   303 bits (777),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AKV RLFGR++PVH VLGGGK ADVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT 
Sbjct  46   IKAKVFRLFGREKPVHTVLGGGKHADVFLWRNKKISAGVLGGATAMWVLFELLEYHLLTL  105

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL+LA+LFLWSNA++FI KS P IPEVHIPE+P LQ  +ALR ++N   AVLRDI
Sbjct  106  VCHILILSLAILFLWSNATTFINKSPPRIPEVHIPEDPFLQAVNALRIEINCGFAVLRDI  165

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL++I GLW++SI+GSCC+FLTLFYI  VLLHTVPV+YEKYED +D FAEKA
Sbjct  166  ASGRDLKKFLIIIAGLWVLSILGSCCNFLTLFYITFVLLHTVPVIYEKYEDRIDPFAEKA  225

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
              E+KKQYAVFDAKVLSKIP+ PLK KK+A
Sbjct  226  TIEIKKQYAVFDAKVLSKIPKVPLKYKKMA  255



>gb|KDP25363.1| hypothetical protein JCGZ_20519 [Jatropha curcas]
Length=257

 Score =   303 bits (777),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            + R+FGR++PVHKVLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CHG
Sbjct  52   IYRIFGREKPVHKVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHG  111

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            LIL+LAVLFLWSNAS+FI KS P IPEV+IPEEPVLQ A ALR+++N   AVLRDIASGR
Sbjct  112  LILSLAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQVADALRSEINWGFAVLRDIASGR  171

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL VI GLW++SIVGS  +FLTLFYI  VLL+TVPV YEKYED+VD+ AEKA+ EL
Sbjct  172  DLKKFLSVIAGLWVLSIVGSWVNFLTLFYIVFVLLYTVPVFYEKYEDKVDSLAEKALIEL  231

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAV DAKVLSKIPRGPLKDKK
Sbjct  232  KKQYAVLDAKVLSKIPRGPLKDKK  255



>ref|XP_011026963.1| PREDICTED: reticulon-like protein B2 [Populus euphratica]
Length=254

 Score =   302 bits (773),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE+LEYHLLT 
Sbjct  45   LKSKIYRLFGREKPVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALA+LFLWSNAS+FI KS P IPEVHIPEEPVLQ A+ALR ++N   AVLRDI
Sbjct  105  VCHCLILALALLFLWSNASTFINKSPPRIPEVHIPEEPVLQIAAALRIEINQGFAVLRDI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++SIVGS C+F+TLFYIA VLLHTVPV YEKYED+VDAFAEKA
Sbjct  165  ASGRDLKKFLTVIAGLWVLSIVGSWCNFVTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKA  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  225  MIEIKKQYAVFDAKVLSKIPRGPLKDKK  252



>ref|XP_009626480.1| PREDICTED: reticulon-like protein B2 isoform X1 [Nicotiana tomentosiformis]
Length=254

 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 182/209 (87%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVHKVLGGGK AD+FLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT 
Sbjct  45   VKAKIYRLFGRERPVHKVLGGGKPADIFLWRDKKITAGVLGFATAIWVLFELLEYHLLTL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALAVLFLWSNAS+FI KS P IPEV +PE+ VL  ASALR ++N  L +LRDI
Sbjct  105  VCHILILALAVLFLWSNASTFINKSPPQIPEVILPEDIVLGVASALRIEINRALEILRDI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG++LK FL VI GLW++SI+G+C +FLTLFYI  VLLHTVPVLYEKYED+VDAFAEKA
Sbjct  165  ASGKELKKFLAVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLYEKYEDQVDAFAEKA  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
              E+KKQYAVF+ KVLSKIPRGPLKDKKL
Sbjct  225  EAEIKKQYAVFNVKVLSKIPRGPLKDKKL  253



>ref|XP_006439447.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
 gb|ESR52687.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
Length=256

 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 182/210 (87%), Gaps = 1/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  KV RLFGR++PVHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE+LEYHLLT 
Sbjct  48   LKTKVFRLFGREKPVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTL  107

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI+ALAVLFLWSNAS+FI KS P IPEV+IPEEPVLQ ASALR ++N    +LR+I
Sbjct  108  VCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREI  167

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++SIVGS C+FLTLFYI  VLLHTVPV+YEKYED VD+F+EKA
Sbjct  168  ASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKA  227

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
              E+KKQYAVFDAKVLSKIPR  LKDKK A
Sbjct  228  WAEIKKQYAVFDAKVLSKIPRS-LKDKKKA  256



>ref|XP_008796064.1| PREDICTED: reticulon-like protein B2 [Phoenix dactylifera]
Length=253

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++ VH VLGGGK ADVFLWRNKKIS GV+GGATA+W+LFE+LEYHLL+ 
Sbjct  45   IKAKIYRLFGRERSVHNVLGGGKPADVFLWRNKKISAGVIGGATAVWVLFELLEYHLLSL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL+LA+LFLWSNAS+FI K+ P IPE  IPE+  +  A +LR ++N   AVLR+I
Sbjct  105  VCHCLILSLAILFLWSNASTFINKAPPRIPEASIPEDLAVNVALSLRYEINRAFAVLREI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL+VI GLW++SI+GSCC+FLTLFY  +V LHTVPVLYEKYED+VD+FAEKA
Sbjct  165  ASGRDLKKFLVVIAGLWVLSILGSCCNFLTLFYTMLVTLHTVPVLYEKYEDKVDSFAEKA  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQY VFDAKVLSKIPR PLKDKK
Sbjct  225  MAEIKKQYGVFDAKVLSKIPRSPLKDKK  252



>gb|AFK41983.1| unknown [Medicago truncatula]
Length=237

 Score =   300 bits (769),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  KV RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT 
Sbjct  28   LKNKVFRLFGREKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTL  87

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            + H  ILALAVLFLWSNAS+FI KS P IP+VHIPEEPVLQ ASA+R ++N   A+LRDI
Sbjct  88   ISHLAILALAVLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDI  147

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++SIVGS  +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA
Sbjct  148  ASGRDLKQFLSVIAGLWVLSIVGSWTNFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKA  207

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            +HE KKQYAVFD KVLSKIP+GPLKDKK
Sbjct  208  LHEFKKQYAVFDEKVLSKIPKGPLKDKK  235



>ref|NP_001239711.1| uncharacterized protein LOC100811024 [Glycine max]
 gb|ACU21063.1| unknown [Glycine max]
 gb|KHN16777.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +KV RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT 
Sbjct  45   LKSKVFRLFGREKPIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL LAVLFLWSNAS+FI KS P IP+VHIPE+PVL+FASALR ++N   A+LRDI
Sbjct  105  VCHFLILGLAVLFLWSNASTFINKSPPKIPQVHIPEKPVLEFASALRVEINRAFALLRDI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW+ SI+GS  +FLTLFYIA VLLHTVPVLYEKYED VD+F  KA
Sbjct  165  ASGRDLKKFLSVIAGLWVFSILGSWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGGKA  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            + E+KKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  225  IAEIKKQYAVFDAKVLSKIPRGPLKDKK  252



>ref|XP_007160119.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
 gb|ESW32113.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
Length=254

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +KV RLFGR++P+H VLGGGKQADVFLWRNKKIS   LG AT IWILFE+LEYHLLT 
Sbjct  45   LKSKVFRLFGREKPIHHVLGGGKQADVFLWRNKKISASTLGVATVIWILFELLEYHLLTL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH +ILALA LFLWSNAS+FI K  P IP+VHIPE+P+LQFASALR ++N   +VLRDI
Sbjct  105  VCHFVILALAGLFLWSNASTFINKRPPKIPQVHIPEDPILQFASALRIEINRAFSVLRDI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW+ SI+GS  +FLTLFYIA VLLHTVPVLYEKYED+VD+F EKA
Sbjct  165  ASGRDLKKFLSVIAGLWVFSILGSWANFLTLFYIAFVLLHTVPVLYEKYEDQVDSFGEKA  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            + E+KKQYAVFDAKVLSKIP+GPLKDKK
Sbjct  225  IAEIKKQYAVFDAKVLSKIPKGPLKDKK  252



>ref|XP_009763462.1| PREDICTED: reticulon-like protein B1 isoform X2 [Nicotiana sylvestris]
Length=263

 Score =   301 bits (770),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + A + RLFGR++PVH+V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLL  
Sbjct  54   VKATIWRLFGREKPVHQVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGL  113

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI  LA+LFLWSNA++FI K  PHIPE H+ EEP+L+ ASALR ++NH L VLR+I
Sbjct  114  VCHLLIFTLAILFLWSNATTFINKKRPHIPEFHLLEEPILEIASALRIEINHILHVLREI  173

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++S++G+CC+FLTLFYI+ VLLHTVPVLYEKYED+VD  AEKA
Sbjct  174  ASGRDLKKFLAVIAGLWVLSMLGNCCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKA  233

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            + E+KKQYAVFDA+VLSKIP+GPLKDKK A
Sbjct  234  VQEIKKQYAVFDARVLSKIPKGPLKDKKKA  263



>ref|XP_006476478.1| PREDICTED: reticulon-like protein B2-like [Citrus sinensis]
 gb|KDO76366.1| hypothetical protein CISIN_1g039009mg [Citrus sinensis]
Length=256

 Score =   300 bits (769),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 182/210 (87%), Gaps = 1/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  KV RLFGR++PVHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LF++LEYHLLT 
Sbjct  48   LKTKVFRLFGREKPVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFQLLEYHLLTL  107

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI+ALAVLFLWSNAS+FI KS P IPEV+IPEEPVLQ ASALR ++N    +LR+I
Sbjct  108  VCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFTLLREI  167

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++SIVGS C+FLTLFYI  VLLHTVPV+YEKYED VD+F+EKA
Sbjct  168  ASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKA  227

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
              E+KKQYAVFDAKVLSKIPR  LKDKK A
Sbjct  228  WAEIKKQYAVFDAKVLSKIPRS-LKDKKKA  256



>ref|XP_009765582.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=254

 Score =   300 bits (769),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 181/209 (87%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVHKVLGGGK ADVFLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT 
Sbjct  45   VKAKIYRLFGREKPVHKVLGGGKPADVFLWRDKKITAGVLGFATAIWVLFELLEYHLLTL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALAVLFLWSNAS+FI KS P IPEV +PE+ VL  ASALR ++N  L +LRDI
Sbjct  105  VCHILILALAVLFLWSNASTFINKSPPQIPEVILPEDIVLGVASALRIEINRALEILRDI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG++LK FL VI GLW++SI+G+C +FLTLFYI  VLLHTVPVLYEKYED+VDAFAEKA
Sbjct  165  ASGKELKKFLAVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLYEKYEDQVDAFAEKA  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
              E+KKQYAVF+ KVLSKIPRGPLKDKK 
Sbjct  225  EAEIKKQYAVFNVKVLSKIPRGPLKDKKF  253



>ref|XP_010925814.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=253

 Score =   300 bits (769),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + A + RLFGR++PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT 
Sbjct  45   IKANIYRLFGRERPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVLFELLEYHLLTL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL+LA+LFLWSNAS FI K+ P I EV IP++  +  A +LR ++N  +AVLR+I
Sbjct  105  VCHCLILSLAILFLWSNASIFINKAPPRILEVSIPKDLAVNVALSLRYEINRAIAVLREI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
             SG+DLK FL VI GLW++ ++GSCC+F+TLFYI VV LHTVPVLYEKYED+VD+FAEKA
Sbjct  165  TSGQDLKKFLAVIAGLWVLLVLGSCCNFMTLFYIMVVTLHTVPVLYEKYEDKVDSFAEKA  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQY VFDAKVLSKIPR PLKDKK
Sbjct  225  MTEIKKQYKVFDAKVLSKIPREPLKDKK  252



>ref|XP_010055800.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW72349.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=262

 Score =   300 bits (767),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  757  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  578
            RLFGR++PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LI
Sbjct  59   RLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLI  118

Query  577  LALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDL  398
            L LA+LFLWSNA++FI K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDL
Sbjct  119  LGLAILFLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDL  178

Query  397  KMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKK  218
            K FL+V+   W+ SIVGSCC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KK
Sbjct  179  KKFLLVVAVFWVFSIVGSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKK  238

Query  217  QYAVFDAKVLSKIPRGPLKDKK  152
            QYAVFD KVLSKIPRGPLKDKK
Sbjct  239  QYAVFDEKVLSKIPRGPLKDKK  260



>gb|ACJ84486.1| unknown [Medicago truncatula]
 gb|AFK36476.1| unknown [Medicago truncatula]
 gb|KEH21160.1| seed maturation protein [Medicago truncatula]
Length=260

 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  KV RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT 
Sbjct  51   LKNKVFRLFGREKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTL  110

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            + H  ILALAVLFLWSNAS+FI KS P IP+VHIPEEPVLQ ASA+R ++N   A+LRDI
Sbjct  111  ISHLAILALAVLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDI  170

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++SIVGS  +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA
Sbjct  171  ASGRDLKQFLSVIAGLWVLSIVGSWTNFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKA  230

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            +HE KKQYAVFD KVLSKIP+GPLKDKK
Sbjct  231  LHEFKKQYAVFDEKVLSKIPKGPLKDKK  258



>gb|KCW72347.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=265

 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  757  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  578
            RLFGR++PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LI
Sbjct  59   RLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLI  118

Query  577  LALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDL  398
            L LA+LFLWSNA++FI K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDL
Sbjct  119  LGLAILFLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDL  178

Query  397  KMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKK  218
            K FL+V+   W+ SIVGSCC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KK
Sbjct  179  KKFLLVVAVFWVFSIVGSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKK  238

Query  217  QYAVFDAKVLSKIPRGPLKDKK  152
            QYAVFD KVLSKIPRGPLKDKK
Sbjct  239  QYAVFDEKVLSKIPRGPLKDKK  260



>gb|KCW72348.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=296

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  757  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  578
            RLFGR++PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LI
Sbjct  59   RLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLI  118

Query  577  LALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDL  398
            L LA+LFLWSNA++FI K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDL
Sbjct  119  LGLAILFLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDL  178

Query  397  KMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKK  218
            K FL+V+   W+ SIVGSCC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KK
Sbjct  179  KKFLLVVAVFWVFSIVGSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKK  238

Query  217  QYAVFDAKVLSKIPRGPLKDKK  152
            QYAVFD KVLSKIPRGPLKDKK
Sbjct  239  QYAVFDEKVLSKIPRGPLKDKK  260



>ref|XP_008810936.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=253

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLG ATAIW+LFE++EYHLLT 
Sbjct  44   VKAKIYRLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGVATAIWVLFELMEYHLLTL  103

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL+LA+LFLWSNAS+FI KS+PHIPEV IPE+  +  A +LR ++N   AVLRDI
Sbjct  104  VCHCLILSLAILFLWSNASTFINKSSPHIPEVSIPEDVAVDVALSLRYEINRGFAVLRDI  163

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGR+LK FLMVI GLW++SI+G+CC+FLTLFYI  V LHTVPVLYEKYED+VD FAEK 
Sbjct  164  ASGRELKKFLMVIAGLWVLSIIGTCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDPFAEKV  223

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KK YA F AK LSKIPRGPLK+KK
Sbjct  224  MAEIKKHYATFHAKCLSKIPRGPLKEKK  251



>ref|XP_003525365.1| PREDICTED: reticulon-like protein B2-like isoform 1 [Glycine 
max]
 gb|KHM99936.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   298 bits (762),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            + V RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VC
Sbjct  47   SNVFRLFGREKPIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVC  106

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LILALA LFLWSNAS+FI KS P IP+VHIPEEPVL+FASALR ++N   AVLRDIAS
Sbjct  107  HFLILALAGLFLWSNASTFINKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIAS  166

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FL VI GLW+ SI+G   +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+ 
Sbjct  167  GRDLKKFLSVIAGLWVFSILGCWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIA  226

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            E+KKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  227  EIKKQYAVFDAKVLSKIPRGPLKDKK  252



>gb|ACU23452.1| unknown [Glycine max]
Length=253

 Score =   298 bits (762),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            + V RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VC
Sbjct  46   SNVFRLFGREKPIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVC  105

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LILALA LFLWSNAS+FI KS P IP+VHIPEEPVL+FASALR ++N   AVLRDIAS
Sbjct  106  HFLILALAGLFLWSNASTFINKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIAS  165

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FL VI GLW+ SI+G   +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+ 
Sbjct  166  GRDLKKFLSVIAGLWVFSILGCWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIA  225

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            E+KKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  226  EIKKQYAVFDAKVLSKIPRGPLKDKK  251



>ref|XP_008792381.1| PREDICTED: reticulon-like protein B2 isoform X2 [Phoenix dactylifera]
Length=251

 Score =   297 bits (760),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = -3

Query  757  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  578
            RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLGGATAIW+LF+++EYHLL  VCH LI
Sbjct  49   RLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLI  108

Query  577  LALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDL  398
            L+LA+LFLWSNA++FI KS P IPEV IPE+  + FA +LR ++N   AVLRDIASGRDL
Sbjct  109  LSLAILFLWSNATTFINKSPPRIPEVSIPEDVAVSFALSLRYEINRGFAVLRDIASGRDL  168

Query  397  KMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKK  218
            K FLMVI GLW++SIVGSCC+FLTLFYIA V LHT+PVLYEKYED+VD+FAEKAM ++KK
Sbjct  169  KKFLMVIAGLWVLSIVGSCCNFLTLFYIAFVTLHTLPVLYEKYEDKVDSFAEKAMTKVKK  228

Query  217  QYAVFDAKVLSKIPRGPLKDK  155
             YA F+AK LSKIPRGPLK K
Sbjct  229  NYATFNAKCLSKIPRGPLKKK  249



>ref|XP_009598008.1| PREDICTED: reticulon-like protein B2, partial [Nicotiana tomentosiformis]
Length=197

 Score =   295 bits (754),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = -3

Query  730  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  551
            H VL GG  ADVFLWRNKKIS G LGGATAIW+LFEV+EYH LT +CH LI+ALA LFLW
Sbjct  3    HDVLFGGAAADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHCLIVALAGLFLW  62

Query  550  SNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  371
            SNAS+FI KSAPHIPEVHIPE+PVL+FA+ LRN++N   AVLR+IA+GRDLKMFLMVI G
Sbjct  63   SNASAFIHKSAPHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAAGRDLKMFLMVIGG  122

Query  370  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  191
            LWI+S++GSCCDFL+LFYI VV+LHTVPVLYEKYED++D+FAEKA HELKKQYAVFDAKV
Sbjct  123  LWILSVLGSCCDFLSLFYIIVVVLHTVPVLYEKYEDQIDSFAEKAFHELKKQYAVFDAKV  182

Query  190  LSKIPRGPLKDKKLA  146
            LSKIPRGPL+DKK A
Sbjct  183  LSKIPRGPLRDKKKA  197



>ref|XP_011093062.1| PREDICTED: reticulon-like protein B1 [Sesamum indicum]
Length=257

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVHKV GGGK AD+FLWRNKKIS  VLGGATA+W+LFE+LEYHLLT VC
Sbjct  51   AKIYRLFGREKPVHKVFGGGKPADIFLWRNKKISATVLGGATAVWVLFELLEYHLLTLVC  110

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  ILAL++LFLWSNA++FI K  PHIPEV +PE+P L+ AS LR ++N   AVLR+IAS
Sbjct  111  HVSILALSLLFLWSNATTFINKRPPHIPEVRLPEDPFLEVASVLRTEINRGFAVLREIAS  170

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FLMV+ GLW +SIVGS C+FLTLFYI  +LLHTVPVLYEKY+D++DAFAEKAM 
Sbjct  171  GRDLKKFLMVVVGLWALSIVGSFCNFLTLFYIVFILLHTVPVLYEKYDDKIDAFAEKAMI  230

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            ++KKQYAVFDAKVLSKIPRGPL  K+
Sbjct  231  QIKKQYAVFDAKVLSKIPRGPLGKKR  256



>ref|XP_010924771.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=252

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            ++ RLFGR++PVH VLGGG  ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  VCH
Sbjct  46   QIYRLFGREKPVHTVLGGGTPADVFLWRNKKISAGVLGGATAIWVLFELMEYHLLALVCH  105

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LIL+LA+LFLWSNAS+FI KS P IPEV IPE+  +  A +LR ++N    VLRDIASG
Sbjct  106  CLILSLAILFLWSNASTFIHKSPPRIPEVSIPEDVAVNVALSLRYEINRGFTVLRDIASG  165

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RDLK FL+VI GLW++SIVGSCC+FLTLFYIA V LHTVPVLYEKYED+VD FAEK M E
Sbjct  166  RDLKKFLVVIAGLWVLSIVGSCCNFLTLFYIAFVTLHTVPVLYEKYEDKVDPFAEKVMTE  225

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKK  152
            +KK YA F AK LSKIPRGPLK+KK
Sbjct  226  VKKHYATFHAKCLSKIPRGPLKEKK  250



>ref|XP_002299504.1| reticulon family protein [Populus trichocarpa]
 gb|ABK93406.1| unknown [Populus trichocarpa]
 gb|EEE84309.1| reticulon family protein [Populus trichocarpa]
Length=254

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE+LEY+L+T 
Sbjct  45   LKSKIYRLFGREKPVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYNLVTL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALA+LFLWSNAS+FI KS P IPEV IPEEPVLQ A+ALR ++N   +VLRDI
Sbjct  105  VCHCLILALALLFLWSNASTFINKSPPRIPEVCIPEEPVLQTAAALRIEINQGFSVLRDI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++SIVGS C+F+TLFYIA VLLHTVPV YEKYED+VDAFAEKA
Sbjct  165  ASGRDLKNFLTVIAGLWVLSIVGSWCNFVTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKA  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  225  MIEIKKQYAVFDAKVLSKIPRGPLKDKK  252



>ref|XP_009603968.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
 ref|XP_009603969.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
Length=263

 Score =   295 bits (755),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + A + RLFGR++PVH+V GGGK ADVFLWRNKK+S  VLGGATAIW+LFE+LEYHLL  
Sbjct  54   VKAAIWRLFGREKPVHQVFGGGKPADVFLWRNKKVSASVLGGATAIWVLFELLEYHLLGL  113

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI  LA+LFLWSNA++FI K  PHIPEVH+PEEP+L+ ASALR ++N+ L VLR+I
Sbjct  114  VCHLLIFTLAILFLWSNATTFINKKRPHIPEVHLPEEPILEIASALRIEINYTLRVLREI  173

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDL  FL VI GLW++S++G+CC+FLTLFYI+ VLLHTVPVLYEKYED+VD   EKA
Sbjct  174  ASGRDLTKFLSVIAGLWVLSVLGNCCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLVEKA  233

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            + E+KKQYAVFDAKVLSKIP+GPL+DKK A
Sbjct  234  VKEIKKQYAVFDAKVLSKIPKGPLRDKKKA  263



>ref|XP_009763461.1| PREDICTED: reticulon-like protein B6 isoform X1 [Nicotiana sylvestris]
Length=267

 Score =   295 bits (754),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 181/214 (85%), Gaps = 4/214 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + A + RLFGR++PVH+V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLL  
Sbjct  54   VKATIWRLFGREKPVHQVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGL  113

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI  LA+LFLWSNA++FI K  PHIPE H+ EEP+L+ ASALR ++NH L VLR+I
Sbjct  114  VCHLLIFTLAILFLWSNATTFINKKRPHIPEFHLLEEPILEIASALRIEINHILHVLREI  173

Query  415  ASGRDLKMFLM----VITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAF  248
            ASGRDLK FL     VI GLW++S++G+CC+FLTLFYI+ VLLHTVPVLYEKYED+VD  
Sbjct  174  ASGRDLKKFLAVNCSVIAGLWVLSMLGNCCNFLTLFYISFVLLHTVPVLYEKYEDKVDPL  233

Query  247  AEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            AEKA+ E+KKQYAVFDA+VLSKIP+GPLKDKK A
Sbjct  234  AEKAVQEIKKQYAVFDARVLSKIPKGPLKDKKKA  267



>gb|AEZ00899.1| putative 24 kDa seed maturation protein [Elaeis guineensis]
Length=253

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            K+ RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLL+ VCH
Sbjct  47   KIYRLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCH  106

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LIL+LA+LFLWSNA++FI KS PHIPEV IPE+  +  A +LR D+N   AVLRDIASG
Sbjct  107  CLILSLAILFLWSNATTFINKSPPHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASG  166

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RDLK FL+VI GLW++SI+GSCC+FLTLFYI  V LHTVPVLYEKYED+VD+F EKAM E
Sbjct  167  RDLKKFLLVIAGLWVLSIIGSCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDSFGEKAMAE  226

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKK  152
            +KK YA   AK LSKIP+G LK+KK
Sbjct  227  IKKHYATVHAKCLSKIPKGALKEKK  251



>ref|XP_010676393.1| PREDICTED: reticulon-like protein B2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 176/210 (84%), Gaps = 0/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR +PVHKVLGGGK AD+ LWR+KKIS  VLG  TA+W LFE+ EYHLL+ 
Sbjct  39   LKSKIYRLFGRDKPVHKVLGGGKPADILLWRDKKISATVLGTVTAVWALFEIFEYHLLSL  98

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH L+L + VLFLWSNAS+FI K+ P IP+V IPE PVL+ ASAL+ ++N  LA LR+I
Sbjct  99   ICHLLMLTITVLFLWSNASTFINKAPPKIPDVRIPEGPVLEIASALKYEINRGLASLREI  158

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL VI GLWI SI+GSCC+FLTLFYI  V+LHT+PVLYEKYED+VDAFAEKA
Sbjct  159  ASGKDLKKFLAVIAGLWIFSILGSCCNFLTLFYICFVMLHTLPVLYEKYEDQVDAFAEKA  218

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            M E+KKQY VFDAKVLSKIPRGPLKDKK A
Sbjct  219  MIEIKKQYIVFDAKVLSKIPRGPLKDKKAA  248



>ref|XP_004503660.1| PREDICTED: reticulon-like protein B2-like [Cicer arietinum]
Length=255

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +KV RLFGR++P+H VLGGGK ADVFLWRNKKIS  VLG ATA WILFE+LEYHLLT 
Sbjct  46   LKSKVFRLFGREKPLHNVLGGGKPADVFLWRNKKISATVLGVATASWILFELLEYHLLTL  105

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH  ILALAVLFLWSNAS+FI K+ P IP+VHIPEEPVLQ A+ALR ++N   AVLRDI
Sbjct  106  VCHLAILALAVLFLWSNASTFINKAPPKIPQVHIPEEPVLQIAAALRIEINRVFAVLRDI  165

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL VI GLW++SIVGS  +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA
Sbjct  166  ASGKDLKKFLSVIAGLWVLSIVGSWANFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKA  225

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            + E KKQYAVFDAKVLSKIP+G LK+KK
Sbjct  226  LAEFKKQYAVFDAKVLSKIPKGALKNKK  253



>ref|XP_004234204.1| PREDICTED: reticulon-like protein B2 [Solanum lycopersicum]
Length=255

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVHKVLGGGK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VC
Sbjct  48   AKIYRLFGRERPVHKVLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVC  107

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LILALAVLFLWSNAS+FI KS P IP+V +PE+ VL  A+ALR ++N  L V RDIAS
Sbjct  108  HILILALAVLFLWSNASTFINKSPPQIPDVILPEDIVLGVAAALRIEINRALEVFRDIAS  167

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            G++LK FL VI GLW++SI+G+C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAEKA  
Sbjct  168  GKELKKFLGVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAEKAEA  227

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKKL  149
            E+KKQYAVF+ KVLSKIPRGPLKDKKL
Sbjct  228  EIKKQYAVFNVKVLSKIPRGPLKDKKL  254



>ref|XP_007038874.1| VIRB2-interacting protein 2 [Theobroma cacao]
 gb|EOY23375.1| VIRB2-interacting protein 2 [Theobroma cacao]
Length=247

 Score =   293 bits (749),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +KV RLFGR++P+H VLG GK ADVFLWR+KKIS GVLGGATA+WILFE+LEYHL+T 
Sbjct  38   LKSKVYRLFGREKPIHHVLGAGKPADVFLWRDKKISAGVLGGATALWILFEMLEYHLITL  97

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH LIL+LA+LFLWSNAS+FI KS P+IPEV +PE+ VL+ ASALR +VN  L V+RDI
Sbjct  98   LCHTLILSLAILFLWSNASTFINKSPPNIPEVVLPEKCVLEVASALRIEVNRALDVVRDI  157

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG DLK FL VI GLW +S+VG+CC+FLTLFYI  VLLHTVPV YE YED+VD+F+EKA
Sbjct  158  ASGNDLKKFLGVIVGLWALSLVGNCCNFLTLFYIVFVLLHTVPVFYEIYEDQVDSFSEKA  217

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            + E+KKQYA FD KVLSKIP+GPLK+KK
Sbjct  218  IIEIKKQYAAFDEKVLSKIPKGPLKEKK  245



>gb|ABC01908.1| putative 24 kDa seed maturation protein-like protein [Solanum 
tuberosum]
Length=255

 Score =   292 bits (747),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVHKVLGGGK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VC
Sbjct  48   AKIYRLFGRERPVHKVLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVC  107

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LILALAVLFLWSNAS+FI KS P IP+V +PE+ VL  A+ALR ++N  L + RDIAS
Sbjct  108  HILILALAVLFLWSNASTFINKSPPQIPDVILPEDIVLGVAAALRIEINKALEIFRDIAS  167

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            G++LK FL VI GLW++SI+G+C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAEKA  
Sbjct  168  GKELKKFLAVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAEKAEA  227

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKKL  149
            E+KKQYAVF+ KVLSKIPRGPLKDKK 
Sbjct  228  EIKKQYAVFNVKVLSKIPRGPLKDKKF  254



>gb|KHG04885.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=255

 Score =   292 bits (747),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 177/209 (85%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT 
Sbjct  47   VKAKIYRLFGRERPVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTL  106

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH  IL LA+LFLWSNA +FI KS P IPE+H+PEEP LQ ASAL  ++N  L +LRDI
Sbjct  107  ICHISILCLALLFLWSNAHTFIHKSPPRIPEIHLPEEPFLQVASALAIELNQGLKLLRDI  166

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGR+LK FLMVI   W++SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKA
Sbjct  167  ASGRNLKEFLMVIAAFWVLSIVGSWCNFLTLFYICFVLLHTVPVLYEKYEDKVDPFAEKA  226

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
              E+KKQYAVFDAKVLSKIP GPLK KK+
Sbjct  227  AIEVKKQYAVFDAKVLSKIPMGPLKAKKV  255



>gb|EYU19605.1| hypothetical protein MIMGU_mgv1a012182mg [Erythranthe guttata]
Length=259

 Score =   291 bits (745),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            + RLFGR+QPVHKVLGGGK AD+FLWR+KK+S GVLG ATAIW+LFE++EYHLL+ VCH 
Sbjct  54   IYRLFGREQPVHKVLGGGKPADIFLWRDKKVSAGVLGFATAIWVLFELIEYHLLSLVCHI  113

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            LIL LA++FLWSNASSFI KS P IPEV + E+ V+  A+ALR + N   A+LRDI SG+
Sbjct  114  LILGLAIIFLWSNASSFINKSPPKIPEVVVREDIVIGVANALRIEFNRAFAILRDIVSGK  173

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL VI GLW++S++GSC +FLTLFYI  VLLHTVP+LYEKY+D++DAFAEKA  EL
Sbjct  174  DLKKFLAVIAGLWVLSMLGSCFNFLTLFYICFVLLHTVPLLYEKYDDQIDAFAEKAEAEL  233

Query  223  KKQYAVFDAKVLSKIPRGPLKDKKL  149
            KKQYAVFDAKVLSKIP+GPLKDKK 
Sbjct  234  KKQYAVFDAKVLSKIPKGPLKDKKF  258



>ref|XP_006358652.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=255

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVH V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEY L+  VC
Sbjct  48   AKIWRLFGREKPVHHVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVC  107

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LI  LAVLFLWSNA++FI K  PHIPEV +PEEP+L+ ASAL  ++N  L++LR+IA+
Sbjct  108  HLLIFTLAVLFLWSNATTFINKKRPHIPEVQLPEEPILEIASALSIEINRALSMLREIAT  167

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            G+DLK FL V+ GLWI+S+VG+CC+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKAM 
Sbjct  168  GKDLKKFLAVVAGLWILSVVGNCCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAMQ  227

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            E+KKQYAVFDA+VLSKIP GPLKDKK A
Sbjct  228  EIKKQYAVFDARVLSKIPIGPLKDKKNA  255



>gb|KJB24634.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=255

 Score =   290 bits (743),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 176/209 (84%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  
Sbjct  47   VKAKIYRLFGRERPVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLAL  106

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH  IL LA+LFLWSNA +FI KS P IPE+H+PEEP LQ ASAL  ++N  L +LRDI
Sbjct  107  ICHISILCLALLFLWSNAHTFIHKSPPRIPEIHLPEEPFLQVASALAIELNQGLKLLRDI  166

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGR+LK FLMVI   W++SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKA
Sbjct  167  ASGRNLKEFLMVIAAFWVLSIVGSWCNFLTLFYICFVLLHTVPVLYEKYEDKVDPFAEKA  226

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
              E+KKQYAVFDAKVLSKIP GPLK KK+
Sbjct  227  AIEIKKQYAVFDAKVLSKIPMGPLKAKKV  255



>gb|KJB52210.1| hypothetical protein B456_008G250900 [Gossypium raimondii]
Length=250

 Score =   290 bits (742),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AKV  LFGR++PVH VLGGGK AD+FLWRNKKIS G LG AT IWILFE+LEYHLLT 
Sbjct  41   IKAKVFHLFGREKPVHHVLGGGKPADIFLWRNKKISAGALGVATVIWILFEMLEYHLLTL  100

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALA+LFLWSNA++F+ KS P IPEV IP++PV++FA ALR ++N   AVLRDI
Sbjct  101  VCHLLILALALLFLWSNAATFVNKSPPRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDI  160

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLWI+SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKA
Sbjct  161  ASGRDLKKFLSVIAGLWILSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKA  220

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            MHE+KKQYAVFDAKVL KIPRGPLK+KK
Sbjct  221  MHEIKKQYAVFDAKVLRKIPRGPLKEKK  248



>ref|NP_001149653.1| LOC100283279 [Zea mays]
 gb|ACG36248.1| seed maturation protein [Zea mays]
 gb|ACN31840.1| unknown [Zea mays]
 tpg|DAA57749.1| TPA: Seed maturation protein isoform 1 [Zea mays]
 tpg|DAA57750.1| TPA: Seed maturation protein isoform 2 [Zea mays]
Length=257

 Score =   290 bits (741),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M AK+ RLFGR++PVH VLGGGK AD+ LWRN+KIS GVL GATAIW+LFEV+EYHLLT 
Sbjct  49   MKAKIYRLFGRERPVHSVLGGGKPADLILWRNRKISGGVLAGATAIWLLFEVMEYHLLTL  108

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL+LA+LFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I
Sbjct  109  VCHCLILSLAILFLWSNASTFINKSPPNIPEVKIPEDVAVNVALSLRYEINRGFATLREI  168

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
              GRDLK FL+VI GLW++S++GSCC+FLTLFYI  V L+TVPVLYEKYED+VDAF EKA
Sbjct  169  GHGRDLKKFLIVIAGLWLLSVLGSCCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKA  228

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M ELKK YA+FD K LSKIP+GPLKDKK
Sbjct  229  MTELKKYYAIFDEKCLSKIPKGPLKDKK  256



>ref|XP_010545343.1| PREDICTED: reticulon-like protein B3 [Tarenaya hassleriana]
Length=259

 Score =   290 bits (741),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 173/212 (82%), Gaps = 4/212 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR+ PVH VLGGGK AD+ LWRNKK+S GVLG ATA W+LFE+LEYHLL+ 
Sbjct  47   LKAKIYRLFGRENPVHNVLGGGKPADIVLWRNKKVSGGVLGAATAAWVLFELLEYHLLSL  106

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH  ILALAVLFLWSNAS+FI K+ P IPEVHIPEE VLQ AS LR ++N   A LRDI
Sbjct  107  VCHSSILALAVLFLWSNASTFIHKTPPRIPEVHIPEEHVLQLASGLRTEINRGFAALRDI  166

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FLMVI GLW++SI+GSCC+F+TLFYIA VLL T+PVLYEKYED+VDAF EKA
Sbjct  167  ASGRDLKKFLMVIAGLWVLSILGSCCNFVTLFYIATVLLFTIPVLYEKYEDKVDAFGEKA  226

Query  235  MHELKKQYAVFDAKVL----SKIPRGPLKDKK  152
            M E+KKQY V D KVL    SKIPRG L  KK
Sbjct  227  MKEIKKQYEVLDEKVLSKIMSKIPRGALSKKK  258



>ref|XP_006645662.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=249

 Score =   289 bits (739),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            A+V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VC
Sbjct  43   ARVFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVC  102

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            HGLI +L +LFLWSNASSFI KS+P IPEV IPE+ V+  A + R ++N   A LR IA 
Sbjct  103  HGLIFSLGLLFLWSNASSFINKSSPRIPEVVIPEDLVVNIALSTRYEINRAFANLRQIAL  162

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRD+K FL+VI GLW++S++GSCC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   
Sbjct  163  GRDIKKFLIVIAGLWLLSVLGSCCNFLTLLYIVFVVLHTVPILYEKYEDQIDSYGEKGWV  222

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            E+KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  223  EIKKQYAVFDAKVLSKVPRGPLKDKK  248



>gb|KJB06451.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=257

 Score =   289 bits (740),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 177/209 (85%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++P+H VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT 
Sbjct  49   VKAKIYRLFGRERPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTL  108

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH  IL+LAVLFLWSN  +FI K+ P IP+VH+PEEP LQ ASAL  ++N  L +LRDI
Sbjct  109  LCHISILSLAVLFLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASALTIELNQALELLRDI  168

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGR+LK FL+V+   W++S+VGS C+FLTLFY + VLLHTVPVLYEKYED+VD FAEKA
Sbjct  169  ASGRNLKKFLVVVAAFWVLSVVGSWCNFLTLFYTSFVLLHTVPVLYEKYEDKVDPFAEKA  228

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
            + E+KKQYAVFDA VLSKIP GPLK KK+
Sbjct  229  VIEIKKQYAVFDANVLSKIPTGPLKSKKV  257



>ref|XP_009388111.1| PREDICTED: reticulon-like protein B1 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 170/209 (81%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVHKVLGGGK ADVFLWRNKK+S   LGGATAIW+LFE++EYHLLT 
Sbjct  49   VKAKIYRLFGREKPVHKVLGGGKPADVFLWRNKKVSAATLGGATAIWVLFELMEYHLLTF  108

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL+LA++FLWSNAS+FI KS P IPEV IPE+  +  A +LR ++N   A LRDI
Sbjct  109  VCHSLILSLAIMFLWSNASTFINKSPPRIPEVSIPEDMAVNIALSLRYEINWAFAALRDI  168

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A GRDLK FL VI GLW+ SI+G+ C+FLTLFYIA V LHTVP LYEKYED+VDAFAEKA
Sbjct  169  ALGRDLKKFLSVIAGLWVFSIIGNFCNFLTLFYIAFVTLHTVPPLYEKYEDKVDAFAEKA  228

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
              E KK Y+V  AK LSKIP+GPLKDKK 
Sbjct  229  QTEFKKHYSVIHAKYLSKIPKGPLKDKKF  257



>ref|XP_004248066.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 178/210 (85%), Gaps = 0/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVH V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEY L+  
Sbjct  54   VKAKIWRLFGREKPVHHVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGL  113

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI  LAVLFLWSNA++FI K  PHIPEV +PEEP+L+ ASAL  ++N  L++LR+I
Sbjct  114  VCHLLIFTLAVLFLWSNATTFINKKRPHIPEVQLPEEPILEIASALSIEINRALSMLREI  173

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A+G+D K FL V+TGLWI+S+VG+CC+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKA
Sbjct  174  ATGKDPKKFLAVVTGLWILSVVGNCCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKA  233

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            + E+KKQYA+FDAKVLSKIP GPLKDKK A
Sbjct  234  VQEIKKQYAIFDAKVLSKIPIGPLKDKKNA  263



>ref|XP_010916969.1| PREDICTED: reticulon-like protein B3 [Elaeis guineensis]
Length=310

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 186/242 (77%), Gaps = 5/242 (2%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            K+ RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLL+ VCH
Sbjct  47   KIYRLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCH  106

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LIL+LA+LFLWSNA++FI KS PHIPEV IPE+  +  A +LR D+N   AVLRDIASG
Sbjct  107  CLILSLAILFLWSNATTFINKSPPHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASG  166

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RDLK FL+VI GLW++SI+GSCC+FLTLFYI  V LHTVPVLYEKYED+VD+F EKAM E
Sbjct  167  RDLKKFLLVIAGLWVLSIIGSCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDSFGEKAMAE  226

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKKLA*DCNSVWCHYVRMCN*SLKNLCFSVIYQQTCWI  47
            +KK YA   AK LSKIP+G LK +     C   +C +V  C      +  S++ + + W 
Sbjct  227  IKKHYATVHAKCLSKIPKGALKRRS---SCR--FCQFVASCGFLCVVVTLSILLRTSTWC  281

Query  46   CH  41
             H
Sbjct  282  MH  283



>ref|XP_010053196.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW77460.1| hypothetical protein EUGRSUZ_D01798 [Eucalyptus grandis]
Length=256

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  578
            RLFGR++PVH+VLGGGK ADVFLWRNKK+S G LG  T IW LFE+ EYHLLT   H LI
Sbjct  52   RLFGRERPVHQVLGGGKPADVFLWRNKKVSAGALGVVTVIWALFELAEYHLLTLAAHCLI  111

Query  577  LALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDL  398
            L LAVLFLWSNA +FI KS P IPEV IPEEPVLQFASALR ++N   AVLRDIASG+DL
Sbjct  112  LTLAVLFLWSNAHAFIHKSPPRIPEVSIPEEPVLQFASALRLEINQAFAVLRDIASGKDL  171

Query  397  KMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKK  218
            K FL+VI GLW++SI G+ C+FLTLFYI  VLLHTVPVLYEK+ED++D FAE+AM ELKK
Sbjct  172  KKFLLVIAGLWLLSIAGNWCNFLTLFYIVFVLLHTVPVLYEKFEDKIDPFAERAMGELKK  231

Query  217  QYAVFDAKVLSKIPRGPLKDKKLA  146
            QYAVFDAKVLSKIP GPLKDKK A
Sbjct  232  QYAVFDAKVLSKIPLGPLKDKKKA  255



>ref|XP_010541290.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   289 bits (739),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AKV RLFGR++PVHKVLGGGK AD+F+WRNKK+S GVLGG TA+W+LFE+++YHLLT 
Sbjct  58   LQAKVYRLFGREKPVHKVLGGGKPADIFMWRNKKMSGGVLGGITAVWVLFELMQYHLLTL  117

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
             CH LI+ LAVLFLWSNAS FI KS P IPEVHIPEE +LQ AS LR ++N     LRDI
Sbjct  118  FCHILIVVLAVLFLWSNASIFINKSPPKIPEVHIPEEHILQLASGLRIEINRAFTCLRDI  177

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL  I GLW++S++GS C+FLTL YIA+V+L TVPV+YEKYED+VDAF EKA
Sbjct  178  ASGRDLKKFLSAIAGLWVLSVIGSWCNFLTLSYIAMVMLFTVPVMYEKYEDKVDAFGEKA  237

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQYAV D KV SKIPRGPLKDKK
Sbjct  238  MVEIKKQYAVLDEKVFSKIPRGPLKDKK  265



>ref|XP_007051689.1| Reticulon family protein [Theobroma cacao]
 gb|EOX95846.1| Reticulon family protein [Theobroma cacao]
Length=255

 Score =   288 bits (737),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 179/209 (86%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EY+LLT 
Sbjct  47   VKAKIYRLFGRERPVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYNLLTL  106

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH  IL+LA++FLWSNA +FI KS P IPEVH+PEEP LQ A+AL  ++N  L +LRDI
Sbjct  107  VCHISILSLALMFLWSNAHTFIHKSPPRIPEVHLPEEPFLQVAAALTFELNQALKLLRDI  166

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGR+LK FLMVI   W++SIVGS C+FLTLFYI+ VLLHTV VLYEKYED+VD  AEKA
Sbjct  167  ASGRNLKKFLMVIAAFWVLSIVGSWCNFLTLFYISFVLLHTVLVLYEKYEDKVDPCAEKA  226

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
            M E+KKQYAVFDAKVLSKIP+GPLK KK+
Sbjct  227  MIEIKKQYAVFDAKVLSKIPKGPLKTKKV  255



>ref|XP_010529625.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   288 bits (737),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AKV RLFGR++PVHKVLGGGK AD+F+WRNKK+S  VLGG TA+W+LFE+ EYHLLT 
Sbjct  58   LKAKVYRLFGREKPVHKVLGGGKPADIFMWRNKKMSASVLGGITAVWVLFELAEYHLLTL  117

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH LI  +AVLFLWSNAS FI KS P IPEVHIPEEP+LQ AS LR ++N     LRDI
Sbjct  118  LCHVLIAVIAVLFLWSNASMFIHKSPPKIPEVHIPEEPILQLASGLRIEINRAFTCLRDI  177

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL  I GLW++SI+G CC+FLTL YIA+V+L T+PVLYEKYED+VDA+ EKA
Sbjct  178  ASGRDLKKFLSAIAGLWVLSILGGCCNFLTLSYIAMVMLFTIPVLYEKYEDKVDAYGEKA  237

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQYAV D KVLSKIPRGPLK KK
Sbjct  238  MVEIKKQYAVLDEKVLSKIPRGPLKGKK  265



>ref|XP_011022600.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=250

 Score =   288 bits (736),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 183/208 (88%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKVLGGGK AD+FLWRNKKIS G+LGGATAIW+LFE+LE HLLT 
Sbjct  41   LKSKIYRLFGREKPVHKVLGGGKPADIFLWRNKKISAGLLGGATAIWVLFELLECHLLTL  100

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VC+ LILAL +LFLWSNAS+FI KS PHIPEV IPEEPVLQ A+AL  ++N   +VLRDI
Sbjct  101  VCYFLILALVLLFLWSNASTFINKSPPHIPEVRIPEEPVLQIAAALTTEINWAFSVLRDI  160

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++SIVGS C+FLTLFYIA VLLHTVPV YEKYED+VDAFAEKA
Sbjct  161  ASGRDLKKFLSVIAGLWVLSIVGSWCNFLTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKA  220

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQYAVFDAKVLSKIPRGPLK KK
Sbjct  221  MIEIKKQYAVFDAKVLSKIPRGPLKGKK  248



>ref|XP_003528823.2| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=314

 Score =   290 bits (741),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 174/210 (83%), Gaps = 0/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  KV RLFGR++PVH VLGGGK ADV LWRNKKIS GVLG ATAIWI FE+LEYHLLT 
Sbjct  105  IKEKVFRLFGREKPVHSVLGGGKPADVLLWRNKKISAGVLGVATAIWIFFELLEYHLLTL  164

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH  IL LAVLFLWSNA +FI K+ P IP VHIPEEP+LQFASAL  ++N   A LR I
Sbjct  165  VCHISILLLAVLFLWSNAHTFIHKAPPRIPVVHIPEEPILQFASALTIEINRGFAALRAI  224

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
             SGRDLK FL+VI G WIISIVGS C+FLTLFYIA VLLHTVPVLY+KYED++D  AEKA
Sbjct  225  GSGRDLKTFLIVIVGTWIISIVGSWCNFLTLFYIAFVLLHTVPVLYDKYEDKIDPLAEKA  284

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            + E KKQYAVFD KVLSKIP+GPLK+KKLA
Sbjct  285  LVEFKKQYAVFDEKVLSKIPKGPLKEKKLA  314



>ref|XP_010533622.1| PREDICTED: reticulon-like protein B4 [Tarenaya hassleriana]
Length=259

 Score =   287 bits (735),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 175/212 (83%), Gaps = 4/212 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVH VLGGGK AD+FLWRNKK+S G LG ATA W+LFE+LEYHLLT 
Sbjct  47   LKAKIYRLFGREKPVHSVLGGGKPADIFLWRNKKVSGGALGVATAAWVLFELLEYHLLTL  106

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH  I ALAVLFLWSNAS+FI K+ P IP VHIPEEPV+Q AS LR +VN     LRDI
Sbjct  107  VCHSSIFALAVLFLWSNASTFIHKTPPRIPHVHIPEEPVIQLASGLRFEVNRGFTALRDI  166

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL+VI+GLW++SI+GSCC+F+TLFYIA VLL TVPVLYEKYED+VDAF EKA
Sbjct  167  ASGRDLKKFLVVISGLWVLSILGSCCNFVTLFYIATVLLFTVPVLYEKYEDQVDAFGEKA  226

Query  235  MHELKKQYAVFD----AKVLSKIPRGPLKDKK  152
            M E+KKQYAV D    +KV+SKIPRG L  KK
Sbjct  227  MKEIKKQYAVLDEKVLSKVMSKIPRGALTKKK  258



>ref|XP_006366650.1| PREDICTED: putative 24 kDa seed maturation protein-like protein 
[Solanum tuberosum]
Length=403

 Score =   292 bits (747),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 179/209 (86%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVHKVLGGGK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT 
Sbjct  194  VKAKIYRLFGRERPVHKVLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTL  253

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALAVLFLWSNAS+FI KS P IP+V +PE+ VL  A+ALR ++N  L + RDI
Sbjct  254  VCHILILALAVLFLWSNASTFINKSPPQIPDVILPEDIVLGVAAALRIEINKALEIFRDI  313

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG++LK FL VI GLW++SI+G+C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAE A
Sbjct  314  ASGKELKKFLAVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAENA  373

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
              E+KKQYAVF+ KVLSKIPRGPLKDKK 
Sbjct  374  EAEIKKQYAVFNVKVLSKIPRGPLKDKKF  402



>gb|KHG29253.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=251

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 176/209 (84%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++P+H VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT 
Sbjct  43   VKAKIYRLFGRERPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTL  102

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH  IL LAVLFLWSN  +FI K+ P IP+VH+PEEP LQ ASAL  ++N  L +LRDI
Sbjct  103  LCHISILCLAVLFLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASALTIELNQALKLLRDI  162

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGR+LK FL+V+   W++S+VGS C+FLTLFY + VLLHTVPVLYEKYED+VD FAEKA
Sbjct  163  ASGRNLKKFLVVVAAFWVLSVVGSWCNFLTLFYTSFVLLHTVPVLYEKYEDKVDPFAEKA  222

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
            + E+KKQYAVFDAKVL KIP GPLK KK+
Sbjct  223  VIEIKKQYAVFDAKVLGKIPTGPLKTKKV  251



>ref|XP_002303615.1| reticulon family protein [Populus trichocarpa]
 gb|EEE78594.1| reticulon family protein [Populus trichocarpa]
Length=250

 Score =   286 bits (731),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 184/208 (88%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ R+FGR++PVHKVLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE+LE HLLT 
Sbjct  41   LKSKIYRIFGREKPVHKVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELLECHLLTL  100

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VC+ LILALA+LFLWSNAS+FI KS PHIPEV IPEEPVLQ A+ALR ++N   +VLRDI
Sbjct  101  VCYFLILALALLFLWSNASTFINKSPPHIPEVRIPEEPVLQIAAALRIEINWAFSVLRDI  160

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++SIVGS C+FLTLFYIA VLL+TVPV YEKYED+VDAFAEKA
Sbjct  161  ASGRDLKKFLTVIAGLWVLSIVGSWCNFLTLFYIAFVLLYTVPVFYEKYEDQVDAFAEKA  220

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQYAVFDAKVLSKIP GPLK KK
Sbjct  221  MIEIKKQYAVFDAKVLSKIPMGPLKGKK  248



>ref|XP_003565836.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=286

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = -3

Query  757  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  578
            RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  +CHGLI
Sbjct  84   RLFGREQPIHKVLGGGKPADVFMWRNKNISAGVLGGATAIWILFELLGYHLLAFLCHGLI  143

Query  577  LALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDL  398
             +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R+++N   A LR+IA GRD+
Sbjct  144  FSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNVALSTRHEINRAFANLREIALGRDI  203

Query  397  KMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKK  218
            K FL+VI GLW++SI+GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+KK
Sbjct  204  KKFLIVIAGLWLLSILGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEVKK  263

Query  217  QYAVFDAKVLSKIPRGPLKDKK  152
            QY+VFDAKVLSK+PRGPLKDKK
Sbjct  264  QYSVFDAKVLSKVPRGPLKDKK  285



>ref|XP_002511930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50599.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   285 bits (730),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVH VLGGGK ADVFLWRNKKIS  VLG ATAIWILFE++EYHLLT 
Sbjct  45   VKAKIFRLFGRERPVHHVLGGGKPADVFLWRNKKISASVLGTATAIWILFELIEYHLLTL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH  IL LA+LFLWSNA +FI K+ P IP+VHIPEEPVLQ ASAL  ++NH  AVLR I
Sbjct  105  VCHISILTLAILFLWSNAHTFINKTPPRIPQVHIPEEPVLQVASALTMEINHGFAVLRSI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL+VI   W +SIVG  C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKA
Sbjct  165  ASGKDLKKFLVVIAAFWALSIVGCWCNFLTLFYITFVLLHTVPVLYEKYEDKVDPFAEKA  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
            M E+KKQYA+FDAKVLSKIP G LK K++
Sbjct  225  MIEIKKQYAMFDAKVLSKIPVGALKAKRV  253



>gb|KJB19087.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
 gb|KJB19090.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=252

 Score =   285 bits (729),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            KV RLFGR++PVH V GGGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH
Sbjct  46   KVFRLFGREKPVHHVFGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCH  105

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LILALA+LFLWSNA+ FI KS PHIPEV IP+EPVL+F  ALR ++N   AVLRDIA G
Sbjct  106  LLILALALLFLWSNATQFINKSTPHIPEVQIPKEPVLEFVMALRFEINRAFAVLRDIALG  165

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RDLKMFL VI GLW++SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAMHE
Sbjct  166  RDLKMFLSVIAGLWVLSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHE  225

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKK  152
            +KKQYAVFDAKVLSKIPRGPLK KK
Sbjct  226  IKKQYAVFDAKVLSKIPRGPLKQKK  250



>ref|XP_008437352.1| PREDICTED: reticulon-like protein B2 [Cucumis melo]
Length=257

 Score =   285 bits (730),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 179/210 (85%), Gaps = 0/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKV GGGK AD+FLWR+KK+S GVLGGAT  WILFE+LEYH LT 
Sbjct  48   IKSKIYRLFGRERPVHKVFGGGKPADIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTL  107

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH  + ALAV+FLWSNAS FI KS PHIP+VHIPE+PV++ ASALR ++N  +AVLRDI
Sbjct  108  ICHIFMAALAVVFLWSNASFFINKSLPHIPQVHIPEDPVIEIASALRVEINRAIAVLRDI  167

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL  I GLW++SI+GS  +FLTL YI V++L TVPV YEKY+D+VDAFAEKA
Sbjct  168  ASGRDLKSFLYAIAGLWVLSILGSWFNFLTLLYIGVIVLFTVPVFYEKYDDKVDAFAEKA  227

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            M E+KKQY VFDAKVLSKIPRGPLKDKK+A
Sbjct  228  MAEIKKQYVVFDAKVLSKIPRGPLKDKKIA  257



>gb|EAY73097.1| hypothetical protein OsI_00974 [Oryza sativa Indica Group]
Length=279

 Score =   286 bits (731),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            LI +L +LFLWSNASSFI KS P IPEV IPE+ V+  A + R ++N   A LR IA GR
Sbjct  135  LIFSLGLLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGR  194

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            D+K FL+VI GLW++S++GSCC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   E+
Sbjct  195  DIKKFLIVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEI  254

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  255  KKQYAVFDAKVLSKVPRGPLKDKK  278



>gb|KDP28552.1| hypothetical protein JCGZ_14323 [Jatropha curcas]
Length=254

 Score =   285 bits (728),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 176/209 (84%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVH VLGGGK ADV LWRNKKIS  VLG ATAIW+LFE++EYHLLT 
Sbjct  46   VKAKIFRLFGRERPVHHVLGGGKPADVLLWRNKKISASVLGVATAIWVLFELIEYHLLTL  105

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
             CH LIL+LAVLFLWSNA +FI K+ P IP++H+PEEP L  ASAL  ++N  LAVLRDI
Sbjct  106  ACHILILSLAVLFLWSNAHTFINKTPPRIPQIHLPEEPFLLVASALTLEINRGLAVLRDI  165

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL+VI  LW++SIVGS C+FLTLFYI+ VLLHTVPVLYEKYED+VD FAEKA
Sbjct  166  ASGKDLKKFLIVIAALWVVSIVGSWCNFLTLFYISFVLLHTVPVLYEKYEDKVDPFAEKA  225

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
              E+KKQYAVFDAKVLSKIP G LK K++
Sbjct  226  TIEIKKQYAVFDAKVLSKIPVGALKAKRV  254



>ref|NP_001056102.1| Os05g0526400 [Oryza sativa Japonica Group]
 gb|AAU44062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18016.1| Os05g0526400 [Oryza sativa Japonica Group]
 dbj|BAG96540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00639.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64429.1| hypothetical protein OsJ_19273 [Oryza sativa Japonica Group]
Length=251

 Score =   285 bits (728),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVH VLGGGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT 
Sbjct  43   LKAKIYRLFGREKPVHSVLGGGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTL  102

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH +IL LA+LFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I
Sbjct  103  LCHCIILTLAMLFLWSNASTFINKSPPNIPEVKIPEDLAVNVARSLRFEINRGFATLREI  162

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
              G DLK FL+V+ GLW++S++GSCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKA
Sbjct  163  GQGHDLKKFLIVVVGLWVLSVLGSCCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKA  222

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M ELKK YA+FD K LSKIP+GPLK+KK
Sbjct  223  MIELKKYYAIFDEKCLSKIPKGPLKNKK  250



>gb|KDO56851.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=255

 Score =   285 bits (728),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 176/209 (84%), Gaps = 4/209 (2%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            +KV RLFGR++P+H VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VC
Sbjct  46   SKVFRLFGREKPIHHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVC  105

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  IL+LAVLFLWSNAS+FI KS P IP V +PE+ VL+FASALR ++N  LAVLR+IAS
Sbjct  106  HISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIAS  165

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FL VI GLW++SIVG+ C+F+TLFYI  VLLHTVPV+YEKYED++D+F EKA  
Sbjct  166  GRDLKKFLGVIAGLWLLSIVGNWCNFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATI  225

Query  229  ELKKQYAVFDA----KVLSKIPRGPLKDK  155
            E+KKQYAVFD     KVLS+IP+G LK K
Sbjct  226  EIKKQYAVFDEKVLKKVLSRIPKGALKKK  254



>ref|XP_006422079.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 ref|XP_006490603.1| PREDICTED: reticulon-like protein B3-like [Citrus sinensis]
 gb|ESR35319.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=255

 Score =   285 bits (728),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 176/209 (84%), Gaps = 4/209 (2%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            +KV RLFGR++P+H VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VC
Sbjct  46   SKVFRLFGREKPIHHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVC  105

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  IL+LAVLFLWSNAS+FI KS P IP V +PE+ VL+FASALR ++N  LAVLR+IAS
Sbjct  106  HISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIAS  165

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FL VI GLW++SIVG+ C+F+TLFYI  VLLHTVPV+YEKYED++D+F EKA  
Sbjct  166  GRDLKKFLGVIAGLWLLSIVGNWCNFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATI  225

Query  229  ELKKQYAVFDA----KVLSKIPRGPLKDK  155
            E+KKQYAVFD     KVLS+IP+G LK K
Sbjct  226  EIKKQYAVFDEKVLKKVLSRIPKGALKKK  254



>ref|XP_009415169.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   284 bits (727),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 176/209 (84%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVH++LGGGK ADVFLW+NKK S  VLGGATAIW+LFE++EYHLLT 
Sbjct  42   VKSKIFRLFGREKPVHRILGGGKPADVFLWKNKKASAIVLGGATAIWVLFELMEYHLLTL  101

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL+LA+LFLWSNA++FI KS PHIPEV IPE+  +  A +LR ++N   AVLR+I
Sbjct  102  VCHCLILSLAILFLWSNATTFINKSPPHIPEVIIPEDLSVNIALSLRYEINRGFAVLREI  161

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A+GRD+K FL VI GLW++S++G+CC+FLTLFYIA V LHTVP LY+KYED+VD+FAEKA
Sbjct  162  AAGRDVKKFLAVIVGLWVLSVIGNCCNFLTLFYIAFVTLHTVPFLYDKYEDQVDSFAEKA  221

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
              E KK YAV  AK LSKIPRGPLKDKK+
Sbjct  222  TVEFKKHYAVIHAKYLSKIPRGPLKDKKV  250



>ref|NP_001150474.1| seed maturation protein [Zea mays]
 gb|ACG39226.1| seed maturation protein [Zea mays]
Length=283

 Score =   285 bits (730),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR+QP+HK LGGGK ADVFLWRNK IS G+LGGATAIWILFE+L YHLLT VCHG
Sbjct  79   VFRLFGREQPIHKALGGGKPADVFLWRNKNISAGILGGATAIWILFELLGYHLLTFVCHG  138

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            LI AL VLFLWSNASSFI K+ P IPEV IPE+ V+  A + R ++N   A LR IA GR
Sbjct  139  LIFALGVLFLWSNASSFIHKAPPKIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGR  198

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FLMVI G W++S++GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+
Sbjct  199  DLKKFLMVIAGFWLLSVLGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWAEI  258

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAVFD KVLSK+PRGP KDKK
Sbjct  259  KKQYAVFDEKVLSKVPRGPAKDKK  282



>gb|EYU23406.1| hypothetical protein MIMGU_mgv1a012325mg [Erythranthe guttata]
Length=254

 Score =   284 bits (727),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +KV RLFGR++PVHKVLGGG+ AD+ LW++KK+S GVLGG TAIW+LF++LEYHLL  
Sbjct  45   LKSKVYRLFGREKPVHKVLGGGQPADLLLWKDKKVSGGVLGGVTAIWVLFDLLEYHLLAL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCHGLIL L  LFL+SNAS+FIKKS P IP V IPEEPVL FASALR  +N   A LRDI
Sbjct  105  VCHGLILGLVGLFLYSNASTFIKKSPPKIPVVSIPEEPVLNFASALRIGINEGFATLRDI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL VI GLW++S  GSCCDFLTL Y   VLL TVP++Y+KYED+VD FAEKA
Sbjct  165  ASGKDLKKFLSVIAGLWVLSFFGSCCDFLTLLYSITVLLFTVPLVYDKYEDQVDCFAEKA  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQYAVF+ KVLSKIPRGPLK+KK
Sbjct  225  MVEIKKQYAVFNTKVLSKIPRGPLKEKK  252



>ref|XP_010261408.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
 ref|XP_010261409.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=255

 Score =   284 bits (727),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 174/212 (82%), Gaps = 2/212 (1%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + A V RLFGRQ+PVHKVLGGGK ADVFLWRNKKIS  VLGGATA W+LFE+LEYH LT 
Sbjct  44   VKAAVYRLFGRQKPVHKVLGGGKPADVFLWRNKKISASVLGGATAAWVLFELLEYHFLTL  103

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeep--VLQFASALRNDVNHCLAVLR  422
            VCH LIL+L++LFLWSNA++FI KS        +      VLQFASALR ++N   +VLR
Sbjct  104  VCHCLILSLSLLFLWSNATTFINKSQSPPRIPEVYIPEDPVLQFASALRIEINSGFSVLR  163

Query  421  DIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAE  242
            DIASGRDLK FL+VI GLW++SIVGS C+FLTLFYI  VLLHTVPV YEKYED+VD+FAE
Sbjct  164  DIASGRDLKKFLVVIAGLWVLSIVGSWCNFLTLFYIVFVLLHTVPVFYEKYEDKVDSFAE  223

Query  241  KAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            KAM E+KKQY VFDAKVLSKIPRGPLKDKK A
Sbjct  224  KAMAEIKKQYVVFDAKVLSKIPRGPLKDKKRA  255



>ref|XP_006288443.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
 gb|EOA21341.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
Length=271

 Score =   285 bits (729),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH 
Sbjct  66   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHV  125

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ALAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGR
Sbjct  126  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLREIASGR  185

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL  I GLW++SI+G CC FLTL YIA+VLL TVP+LY+KYED+VD++ EKAM EL
Sbjct  186  DLKKFLSAIAGLWVLSILGGCCSFLTLSYIALVLLFTVPLLYDKYEDKVDSYGEKAMAEL  245

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAV DAKVLSKIPRGPLKDKK
Sbjct  246  KKQYAVLDAKVLSKIPRGPLKDKK  269



>tpg|DAA52789.1| TPA: seed maturation protein [Zea mays]
Length=283

 Score =   285 bits (730),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR+QP+HK LGGGK ADVFLWRNK IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  79   VFRLFGREQPIHKALGGGKPADVFLWRNKNISAGVLGGATAIWILFELLGYHLLTFVCHG  138

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            LI AL VLFLWSNASSFI K+ P IPEV IPE+ V+  A + R ++N   A LR IA GR
Sbjct  139  LIFALGVLFLWSNASSFIHKAPPKIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGR  198

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FLMVI G W++S++GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+
Sbjct  199  DLKKFLMVIAGFWLLSVLGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEI  258

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAVFD KVLSK+PRGP KDKK
Sbjct  259  KKQYAVFDEKVLSKVPRGPAKDKK  282



>gb|KHG20258.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=251

 Score =   284 bits (726),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M AKV RLFGR++PVH V GGGKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT 
Sbjct  42   MKAKVFRLFGRERPVHDVFGGGKQADIFLWRNKKISAGTLGVATVIWVLFELLEYHLLTL  101

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALA+LFLWSNA++FI KS P IPEV IP++PVL+FA ALR ++N   AVLRDI
Sbjct  102  VCHLLILALALLFLWSNAATFIHKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDI  161

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW+ SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKA
Sbjct  162  ASGRDLKKFLSVIVGLWVSSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPLAEKA  221

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
             HE+KKQYAVFDAKVLSKIP+ PLK+KK
Sbjct  222  WHEIKKQYAVFDAKVLSKIPKRPLKEKK  249



>ref|XP_008234814.1| PREDICTED: reticulon-like protein B1 [Prunus mume]
Length=259

 Score =   284 bits (727),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VC
Sbjct  52   SKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVC  111

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LIL+LAV FLWSNAS+FI KS P IP+V + E  VL  ASALR ++N    +LRDIAS
Sbjct  112  HLLILSLAVFFLWSNASTFINKSPPQIPKVQLSERTVLDLASALRIELNRAFHILRDIAS  171

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLKMFL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+ ++DAF+EKA+ 
Sbjct  172  GRDLKMFLGVIAVLWIVSLVGKWFNFLTLFYITFVLLHTLPVIYEKYDVQIDAFSEKALI  231

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            E KKQYAVFDAKVLSKIP+GPLK+KK
Sbjct  232  EFKKQYAVFDAKVLSKIPKGPLKEKK  257



>ref|XP_006847055.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
 gb|ERN08636.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
Length=291

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            K+ RLFGRQ+PVHKVLGGGK ADVFLWRNKKIS  VLGGAT IWILFE LEYH +T +CH
Sbjct  86   KINRLFGRQKPVHKVLGGGKPADVFLWRNKKISASVLGGATLIWILFECLEYHFVTLLCH  145

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LIL LA+LFLWSN ++FI KS PHIPEV IPE+     A +LR ++N   +VLRDIASG
Sbjct  146  CLILTLALLFLWSNGTAFINKSPPHIPEVKIPEDVATNIALSLRYEINRAFSVLRDIASG  205

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RDLKMFL V+ GLW++SI+GSCC+FLTLFYI  V+LHTVPVLYEKYED+VD+F+EKAM E
Sbjct  206  RDLKMFLTVVAGLWVLSILGSCCNFLTLFYITFVVLHTVPVLYEKYEDQVDSFSEKAMIE  265

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKK  152
            +KKQYAVFDAKVLSKIPRGPLK KK
Sbjct  266  IKKQYAVFDAKVLSKIPRGPLKSKK  290



>ref|XP_011073407.1| PREDICTED: reticulon-like protein B2 isoform X1 [Sesamum indicum]
Length=248

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 171/208 (82%), Gaps = 6/208 (3%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AKV RLFGR++PVH+VLGGGK AD+FLW          GGATAIW+LF+VLEYHLLT 
Sbjct  45   LKAKVYRLFGREKPVHRVLGGGKPADIFLWXX------XXGGATAIWVLFDVLEYHLLTL  98

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCHGLI+ LA+LFLWS+  +FI KS P IPEV IPEEP L+FASALR ++NH  AVLRDI
Sbjct  99   VCHGLIVGLALLFLWSSIMTFINKSPPRIPEVSIPEEPALKFASALRVEINHGFAVLRDI  158

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL V+ GLWI+S+VG CCDFLTL Y   VLL TVP+ YEKYED+VD+FAEKA
Sbjct  159  ASGRDLKKFLSVVAGLWILSVVGGCCDFLTLLYTITVLLFTVPLFYEKYEDQVDSFAEKA  218

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQY VFDA+VLSKIPRGPLKDKK
Sbjct  219  MAEVKKQYVVFDARVLSKIPRGPLKDKK  246



>ref|XP_009772131.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=260

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVHKVLGGGK A++FLWR+KK+S GVLG AT IW LFE+L+YHLLT VC
Sbjct  53   AKIYRLFGRERPVHKVLGGGKPAEIFLWRDKKVSAGVLGFATVIWALFELLQYHLLTLVC  112

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LI+A+ VLFLWSNAS+FI  + P IPEV +P + VL  ASALR ++N  L +LRDIAS
Sbjct  113  HILIVAITVLFLWSNASAFINTAPPQIPEVVLPRDIVLGVASALRIEMNRILEILRDIAS  172

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            G+DLK FL+VI GLW++SI+G+C +FLTLFYI  VLLHTVPVLY+KYED+VDAFAEKA  
Sbjct  173  GKDLKKFLVVILGLWVVSILGNCWNFLTLFYIVFVLLHTVPVLYDKYEDKVDAFAEKAEA  232

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            E+KK YAVF+ +VLSKIPRGPL+DK+LA
Sbjct  233  EIKKHYAVFNDQVLSKIPRGPLRDKRLA  260



>ref|XP_004143883.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 ref|XP_004170740.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 gb|KGN50045.1| hypothetical protein Csa_5G151610 [Cucumis sativus]
Length=257

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 178/210 (85%), Gaps = 0/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKV GGGK AD+FLWR+KK+S GVLGGAT  WILFE+LEYH LT 
Sbjct  48   IKSKIYRLFGRERPVHKVFGGGKPADIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTL  107

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH  + ALAV+FLWSNAS FI KS PHIP+VHIPE PV++ ASALR ++N  +AVLR+I
Sbjct  108  ICHIFMAALAVVFLWSNASFFINKSLPHIPQVHIPEGPVVEIASALRVEINRAIAVLREI  167

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL  I GLW++SIVGS  +FLTL YI V++L TVP+ YEKY+D+VDAFAEKA
Sbjct  168  ASGRDLKSFLYAIAGLWVLSIVGSWFNFLTLLYIGVIVLFTVPLFYEKYDDKVDAFAEKA  227

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            M E+KKQY VFDAKVLSKIPRGPLKDKK+A
Sbjct  228  MAEIKKQYVVFDAKVLSKIPRGPLKDKKIA  257



>gb|KHG15548.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=248

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AKV RLFGR++ VH V GGGK AD FLWRNKKIS GVLG AT IW+LFE+LEYHLLT 
Sbjct  39   IKAKVFRLFGRERSVHHVFGGGKSADTFLWRNKKISAGVLGVATVIWVLFELLEYHLLTL  98

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI AL +LFLWSNA +FI KS   IPEVHIP++PV++FA ALR + N    VLRDI
Sbjct  99   VCHVLIFALVILFLWSNAYAFINKSPLCIPEVHIPKDPVIEFAEALRFESNLAFTVLRDI  158

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A GRDLK FL VI GLWI+SIVGS C+F+TLFY+  VLLH+VPVLYEKYED+VD FAEKA
Sbjct  159  APGRDLKKFLYVIAGLWILSIVGSWCNFVTLFYLVFVLLHSVPVLYEKYEDKVDPFAEKA  218

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            MHE+KKQ AVF+AKVLSKIPRGP K+K 
Sbjct  219  MHEIKKQCAVFNAKVLSKIPRGPSKEKN  246



>gb|KHG09260.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=252

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            KV RLFGR++PVH V GGGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH
Sbjct  46   KVFRLFGREKPVHHVFGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCH  105

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LILALA+LFLWSNA+ FI KS PHIPEV IP+EPVL+FA ALR ++N   AVLRDIA G
Sbjct  106  LLILALALLFLWSNATQFINKSTPHIPEVQIPKEPVLEFAMALRFEINRAFAVLRDIALG  165

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RDLKMFL VI GLW++SIVGS C+FLTLFYI  V+LHTVPVLYEKYED+VD FAEKAMHE
Sbjct  166  RDLKMFLSVIAGLWVLSIVGSWCNFLTLFYIVFVVLHTVPVLYEKYEDKVDPFAEKAMHE  225

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKK  152
            +KKQYAVFDAKVLSKIP GPLK KK
Sbjct  226  IKKQYAVFDAKVLSKIPMGPLKQKK  250



>emb|CDP05124.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   283 bits (723),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 180/209 (86%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVHKVLGGGK ADVFLWR+KKIS  VLG  TAIW+LFE+LEY+LLT 
Sbjct  47   IKAKIYRLFGREKPVHKVLGGGKPADVFLWRDKKISASVLGVVTAIWVLFELLEYYLLTL  106

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALAVLFLWSNAS+FI KS P  PEV +PE+ VL  ASALR +VN  LA LR+I
Sbjct  107  VCHILILALAVLFLWSNASTFINKSPPQFPEVILPEDIVLGVASALRIEVNRALAALREI  166

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW+ SI+GSCC+FLTLFYI+ +LLHTVPVLYEKYED+VD+FAEKA
Sbjct  167  ASGRDLKKFLAVIAGLWVFSILGSCCNFLTLFYISFILLHTVPVLYEKYEDQVDSFAEKA  226

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
              E+KKQYAVF+AKVLSKIPRGPLKDKK 
Sbjct  227  EAEIKKQYAVFNAKVLSKIPRGPLKDKKF  255



>dbj|BAB32723.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB92114.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ11106.1| hypothetical protein OsJ_00954 [Oryza sativa Japonica Group]
Length=279

 Score =   283 bits (725),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            LI +L +LFLWSNASSFI KS P IPEV IPE+ V+  A + R ++N   A LR IA GR
Sbjct  135  LIFSLGLLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGR  194

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            D+K FL+VI GLW++S++GSCC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   E+
Sbjct  195  DIKKFLIVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEI  254

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAV DAKVLSK+PRGPLKDKK
Sbjct  255  KKQYAVLDAKVLSKVPRGPLKDKK  278



>emb|CDP08746.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   283 bits (723),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            K+ RLFGR++PVH+V GGGK ADVFLWRNK+IS  VLGGATA+W+LFE+LEYHLLT VCH
Sbjct  57   KIFRLFGREKPVHQVFGGGKPADVFLWRNKRISAAVLGGATAVWVLFELLEYHLLTLVCH  116

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LILALA+LFLWSNA++FI KS P IPEV + EEP LQ A+A+R ++N  LAVLR+IASG
Sbjct  117  ILILALAILFLWSNATTFINKSPPRIPEVRLSEEPFLQVAAAVRFEINRALAVLREIASG  176

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RDLK FL V++GLW  SI+GS C+FLTLFYI  VLLHT+PVLYEKYED+VD+FAEKAM E
Sbjct  177  RDLKKFLAVVSGLWFFSILGSYCNFLTLFYITFVLLHTLPVLYEKYEDKVDSFAEKAMIE  236

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            ++K+YAVFD KVLSKIPRGP KDKK A
Sbjct  237  IRKKYAVFDEKVLSKIPRGPSKDKKRA  263



>ref|XP_004967455.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=278

 Score =   283 bits (724),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            KV RLFGR+QP+HK LGGGK ADVFLWRN+ IS GVLGG TAIWILFE L YHLLT VCH
Sbjct  73   KVFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGVTAIWILFECLGYHLLTFVCH  132

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
            GLI +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R ++N     LR IA G
Sbjct  133  GLIFSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRYEINRAFVNLRQIALG  192

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RD+K FLMVI GLW++S++GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E
Sbjct  193  RDIKKFLMVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVE  252

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKK  152
            +KKQYAVFD KVLSK+PRGP KDKK
Sbjct  253  IKKQYAVFDEKVLSKVPRGPAKDKK  277



>gb|EMS62606.1| Reticulon-like protein B1 [Triticum urartu]
Length=248

 Score =   281 bits (720),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 169/206 (82%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVH VLGGGK AD+FLWRNKKIS GVL GATAIW+LFEVLEYHLLT +C
Sbjct  41   AKIYRLFGREKPVHSVLGGGKPADLFLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLC  100

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            HG IL L +LFLWSNAS+F+ K  P+IPEV IPE+  +  A +LR ++N   A LR I  
Sbjct  101  HGFILTLGILFLWSNASAFVNKCPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQ  160

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FL+V+ GLWI+S +GSCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM 
Sbjct  161  GRDLKKFLIVVAGLWILSFLGSCCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMV  220

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            ELKK YA+FD K LSKIP+GP KDKK
Sbjct  221  ELKKYYAIFDEKCLSKIPKGPSKDKK  246



>ref|XP_006360189.1| PREDICTED: reticulon-like protein B2-like [Solanum tuberosum]
Length=253

 Score =   282 bits (721),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
             K+ RLFGR++P+HKVLGGGK AD+FLWR+KK++ GVLG AT IW LFE+LEYHLLT VC
Sbjct  47   TKIYRLFGREKPLHKVLGGGKPADIFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVC  106

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LI+A+AVLFLWSNAS+FI  + P IPEV +P++ VL  ASALR ++N  L +LRDIAS
Sbjct  107  HILIVAVAVLFLWSNASAFINTAPPQIPEVVLPKDIVLGVASALRIEINRALEILRDIAS  166

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            G+DLK FL+VI GLW++S++G+  +FLTLFYI  VLLHTVP+LYEKYED+VDAFAEKA  
Sbjct  167  GKDLKKFLVVIVGLWVVSVLGNIWNFLTLFYIVFVLLHTVPLLYEKYEDKVDAFAEKAEA  226

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            E+KK YAVFDA VLSKIPRGPLK KK
Sbjct  227  EIKKHYAVFDANVLSKIPRGPLKGKK  252



>ref|XP_002874678.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50937.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score =   282 bits (722),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GV GGAT  W+LFE++EYHLLT +CH 
Sbjct  66   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVFGGATVAWVLFELMEYHLLTLLCHV  125

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ALAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ  S LR ++N   + LR+IASGR
Sbjct  126  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLVSGLRIEINCGFSSLREIASGR  185

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL  I GLW++SI+G CC FLTL YIA+VLL TVP+ Y+KYED+VDA+ EKAM EL
Sbjct  186  DLKKFLSAIAGLWVLSILGGCCSFLTLAYIALVLLFTVPLFYDKYEDKVDAYGEKAMAEL  245

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  246  KKQYAVFDAKVLSKIPRGPLKDKK  269



>gb|EAY75742.1| hypothetical protein OsI_03655 [Oryza sativa Indica Group]
Length=253

 Score =   281 bits (720),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M AK+ RLFGR++PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT 
Sbjct  45   MKAKIYRLFGRERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL+LAVLFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I
Sbjct  105  VCHCLILSLAVLFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
              GRDLK FL+VI GLWI+S++GS C+FLTLFYI  V L+TVPVLYEKYED++DAF EKA
Sbjct  165  GHGRDLKKFLIVIAGLWILSVLGSSCNFLTLFYIVFVALYTVPVLYEKYEDKIDAFGEKA  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              ELKK YA+F+ K LSKIP+GPLKDKK
Sbjct  225  EIELKKYYALFEEKCLSKIPKGPLKDKK  252



>ref|XP_008655792.1| PREDICTED: reticulon-like protein B1 [Zea mays]
 gb|AFW80459.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=279

 Score =   282 bits (722),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR+QP+HK LGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            LI +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R ++N   A LR IA GR
Sbjct  135  LIFSLGVLFLWSNASSFIHKSPPKIPEVVIPEDLVVNIAVSTRYEINRAFANLRRIALGR  194

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            D+K FLMVI GLW++S++GSCC+ LTL YI  V+LHTVPVLYEKYED++D + EK   E+
Sbjct  195  DIKKFLMVIAGLWLLSVLGSCCNLLTLVYIVFVVLHTVPVLYEKYEDQIDTYGEKGWVEI  254

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAVFD KVLSK+PRGP KDKK
Sbjct  255  KKQYAVFDEKVLSKVPRGPAKDKK  278



>ref|XP_010669728.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   283 bits (723),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVHKVLGGGK ADVFLWRNKKIS  VL  ATAIWILFE+LEYHLLT 
Sbjct  76   VQAKIYRLFGREKPVHKVLGGGKPADVFLWRNKKISGSVLASATAIWILFELLEYHLLTL  135

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH LI +LAVLFLW+NAS+FI KS PHIPEV +PE+P+L+  + LR+++N  LA+L DI
Sbjct  136  ICHSLIFSLAVLFLWANASTFINKSPPHIPEVILPEKPILEAVAGLRHELNRGLAMLHDI  195

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A G+DLK FL VI GLWI+SIVG  C F+TLFYI  VLLHT+P+LYEKYED+VDAFAEKA
Sbjct  196  AMGKDLKKFLAVIAGLWILSIVGKSCGFITLFYINFVLLHTIPILYEKYEDKVDAFAEKA  255

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E KK Y V + K +SKIPRGPLK+KK
Sbjct  256  MAEAKKHYGVINEKYISKIPRGPLKNKK  283



>ref|XP_004240710.1| PREDICTED: reticulon-like protein B6 [Solanum lycopersicum]
Length=253

 Score =   281 bits (719),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
             K+ RLFGR++PVHKVLGGGK ADVFLWR+KK++ GVLG AT IW LFE+LEYHLLT VC
Sbjct  47   TKIYRLFGREKPVHKVLGGGKPADVFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVC  106

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LI+A+AVLFLWSNAS+FI  + PHIPEV +P++ VL  ASALR ++N  L +LRDIAS
Sbjct  107  HILIVAVAVLFLWSNASAFINTAPPHIPEVVLPKDIVLSVASALRIEINRALEILRDIAS  166

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            G+DLK FL+VI GLWI+SI+G+  +FLTLFYI  VLLHTVPVLYEK+ED+VDA AEKA  
Sbjct  167  GKDLKKFLVVIVGLWIVSILGNIWNFLTLFYIVFVLLHTVPVLYEKHEDKVDAVAEKAEA  226

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            E+KK YAVFDA VLSKIPRGPLK KK
Sbjct  227  EIKKHYAVFDANVLSKIPRGPLKGKK  252



>ref|XP_006374289.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52086.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=254

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T 
Sbjct  45   VKSKIFRLFGREKPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH  I +LAVLFLWSNAS+F+ KS P IPEV +PE+ V + AS LR ++N   AVL DI
Sbjct  105  VCHLSIFSLAVLFLWSNASNFLNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GL ++S+VGSCC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EKA
Sbjct  165  ASGRDLKKFLAVIAGLLVLSLVGSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGNSEKA  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              ++KKQYAV D K +SKIPRGP K+KK
Sbjct  225  WTQIKKQYAVLDEKYISKIPRGPFKEKK  252



>gb|EMT19773.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=286

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            K+ RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  + H
Sbjct  81   KMFRLFGREQPIHKVLGGGKPADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGH  140

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LI +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R+++N   A LR IA G
Sbjct  141  ALIFSLGVLFLWSNASSFINKSPPKIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALG  200

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RD+K FL+VI GLW++SI+GSCC+FLTLFYI  V+LHTVPV+YEKYED++D + EK   E
Sbjct  201  RDIKKFLIVIAGLWLLSILGSCCNFLTLFYIVFVVLHTVPVIYEKYEDQIDTYGEKGWIE  260

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKK  152
            +KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  261  VKKQYAVFDAKVLSKVPRGPLKDKK  285



>ref|XP_010092876.1| Reticulon-like protein [Morus notabilis]
 gb|EXB52694.1| Reticulon-like protein [Morus notabilis]
Length=255

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 172/210 (82%), Gaps = 0/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVH+VLGGGK ADV LWRNKKIS   LGG T  W+ FE+LEYHLLT 
Sbjct  46   VKAKIFRLFGREKPVHQVLGGGKPADVLLWRNKKISASFLGGVTGAWVFFELLEYHLLTL  105

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VC+ LI++LA+LFLWSNA +FI KS P IPEVHIPE+P LQ  SAL  ++N   A LR I
Sbjct  106  VCYTLIVSLAILFLWSNAHTFIHKSPPRIPEVHIPEDPFLQVVSALTIEINQGFAALRSI  165

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL+VI GLW++SIVGS  +FLTLFYI+VVLLHTVPVLYEKYED++D  AEKA
Sbjct  166  ASGRDLKKFLIVIAGLWVLSIVGSWANFLTLFYISVVLLHTVPVLYEKYEDKIDPLAEKA  225

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            + ELKKQY VFD KVLSKIP+GPLK KK A
Sbjct  226  LIELKKQYTVFDEKVLSKIPKGPLKGKKRA  255



>ref|XP_006374290.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52087.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=263

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T 
Sbjct  54   VKSKIFRLFGREKPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITL  113

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH  I +LAVLFLWSNAS+F+ KS P IPEV +PE+ V + AS LR ++N   AVL DI
Sbjct  114  VCHLSIFSLAVLFLWSNASNFLNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDI  173

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GL ++S+VGSCC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EKA
Sbjct  174  ASGRDLKKFLAVIAGLLVLSLVGSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGNSEKA  233

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              ++KKQYAV D K +SKIPRGP K+KK
Sbjct  234  WTQIKKQYAVLDEKYISKIPRGPFKEKK  261



>ref|XP_009416410.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 170/209 (81%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+  LFGR++PVH++LGGGK ADVFLW+NKK S  VLGGATAIWILFE++EYHLLT 
Sbjct  42   VKSKIYHLFGREKPVHQILGGGKPADVFLWKNKKASAVVLGGATAIWILFELMEYHLLTL  101

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL+LA+LFLWSNA++ I KS PHIP V IPE+  +  + +L  ++N   +VLR+I
Sbjct  102  VCHCLILSLAILFLWSNATTLINKSPPHIPVVSIPEDLAVNISRSLTYEINRGFSVLREI  161

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A+GR+LK FL VI GLWI+SI+GSCC+FLTLFYIA V LHTVP LY+KYED VD FAEKA
Sbjct  162  ATGRELKKFLAVIAGLWILSIIGSCCNFLTLFYIAFVTLHTVPFLYDKYEDRVDTFAEKA  221

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
              E KK YAVF AK LSKIPRGPLKDKK 
Sbjct  222  TVEFKKHYAVFHAKCLSKIPRGPLKDKKF  250



>ref|XP_008376662.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=261

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VC
Sbjct  54   SKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVC  113

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LIL+LAV FLWS AS+FI KS P IP+V IPE+ VL+ ASALR ++N    VLRDIAS
Sbjct  114  HLLILSLAVFFLWSYASTFINKSPPQIPKVQIPEKTVLELASALRIEINKGFYVLRDIAS  173

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  
Sbjct  174  GRDLKTFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWI  233

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            E+KKQYAVFDAKVLSKIPRGP+K+KK
Sbjct  234  EIKKQYAVFDAKVLSKIPRGPVKEKK  259



>ref|XP_007218819.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
 gb|EMJ20018.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
Length=265

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 170/206 (83%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VC
Sbjct  58   SKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVC  117

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LIL+LAV FLWSNAS+FI KS P IP+V + E  VL  ASALR ++N    +LRDIAS
Sbjct  118  HLLILSLAVFFLWSNASTFINKSPPQIPKVQLSERTVLDLASALRIELNRAFHILRDIAS  177

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+ ++DAF+EKA+ 
Sbjct  178  GRDLKTFLGVIAILWILSVVGKWFNFLTLFYITFVLLHTLPVIYEKYDVQIDAFSEKALI  237

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            E KKQYAVFDAKVLSKIP+GPLK+KK
Sbjct  238  EFKKQYAVFDAKVLSKIPKGPLKEKK  263



>emb|CDJ26559.1| unnamed protein product, partial [Triticum aestivum]
Length=290

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            K+ RLFGR+QP+HKVLGGGK ADVF+WRNK +S GVLGGATAIWILFE+L YHLL  + H
Sbjct  85   KMFRLFGREQPIHKVLGGGKPADVFMWRNKHVSAGVLGGATAIWILFELLGYHLLAFLGH  144

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LI +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R+++N   A LR IA G
Sbjct  145  ALIFSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALG  204

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RD+K FL+VI GLW++SI+GSCC+FLTLFYI  V+LHTVPV+YEKYED++D + EK   E
Sbjct  205  RDIKKFLIVIAGLWLLSILGSCCNFLTLFYIVFVVLHTVPVIYEKYEDQIDTYGEKGWIE  264

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKK  152
            +KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  265  VKKQYAVFDAKVLSKVPRGPLKDKK  289



>ref|XP_009406786.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406787.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=252

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 169/209 (81%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVH++LGGGK ADVFLW+NKK S  VLGGATAIWI FE++EYHLLT 
Sbjct  43   VKSKINRLFGREKPVHQILGGGKPADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTL  102

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
             CH LIL+LA++FLWSNA+  I KS PHIP V IPE  V+  A +LR ++N   AVLR+I
Sbjct  103  FCHCLILSLAIIFLWSNATFLINKSPPHIPVVSIPENLVVDIALSLRYEINRGFAVLREI  162

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A+GRDLK FL+VI GLW++S VG CC+FLTLFYI  V LHT+P LY+KYED+VDAFAEKA
Sbjct  163  ATGRDLKKFLIVIAGLWVLSTVGRCCNFLTLFYIVFVTLHTLPFLYDKYEDKVDAFAEKA  222

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
              E KK YAVF AK LSKIPRGPLKDKK 
Sbjct  223  SVEFKKHYAVFQAKYLSKIPRGPLKDKKF  251



>ref|XP_008792378.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
 ref|XP_008792379.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
Length=280

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 174/230 (76%), Gaps = 29/230 (13%)
 Frame = -3

Query  757  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  578
            RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLGGATAIW+LF+++EYHLL  VCH LI
Sbjct  49   RLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLI  108

Query  577  LALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDL  398
            L+LA+LFLWSNA++FI KS P IPEV IPE+  + FA +LR ++N   AVLRDIASGRDL
Sbjct  109  LSLAILFLWSNATTFINKSPPRIPEVSIPEDVAVSFALSLRYEINRGFAVLRDIASGRDL  168

Query  397  KMFLM-----------------------------VITGLWIISIVGSCCDFLTLFYIAVV  305
            K FLM                             VI GLW++SIVGSCC+FLTLFYIA V
Sbjct  169  KKFLMVCCSVFLSNVSGSWSISMGVILFGILVFQVIAGLWVLSIVGSCCNFLTLFYIAFV  228

Query  304  LLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  155
             LHT+PVLYEKYED+VD+FAEKAM ++KK YA F+AK LSKIPRGPLK K
Sbjct  229  TLHTLPVLYEKYEDKVDSFAEKAMTKVKKNYATFNAKCLSKIPRGPLKKK  278



>ref|XP_009368711.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=250

 Score =   280 bits (716),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T 
Sbjct  41   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITL  100

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL+LAV FLWS AS+FI KS P IP+V IPE+ VL+ ASALR ++N    VLRDI
Sbjct  101  VCHLLILSLAVFFLWSYASTFINKSPPQIPKVQIPEKTVLELASALRIEINKGFYVLRDI  160

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA
Sbjct  161  ASGRDLKTFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKA  220

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              E+KKQYAVFDAKVLSKIP+GP+K+KK
Sbjct  221  WIEIKKQYAVFDAKVLSKIPKGPVKEKK  248



>ref|XP_009134231.1| PREDICTED: reticulon-like protein B2 [Brassica rapa]
Length=267

 Score =   280 bits (715),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGAT  W+LFE++EYHLLT +CH 
Sbjct  62   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVLGGATVAWVLFELMEYHLLTLLCHV  121

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ALAVLFLWSNA+ FI KS P IPEVHIPE+P+LQ AS LR ++N   + L +IASGR
Sbjct  122  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGR  181

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL  + GLWI+SI+G CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM EL
Sbjct  182  DLKKFLSALFGLWILSILGGCCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAEL  241

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAV DAKVLSKIPRGPLKDKK
Sbjct  242  KKQYAVLDAKVLSKIPRGPLKDKK  265



>ref|XP_009380544.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   279 bits (713),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 168/206 (82%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AKV RLFGR++PVH+VLGGGK ADV LWR+KKIS G L  ATAIW++FE++ YHLLT VC
Sbjct  46   AKVYRLFGREKPVHQVLGGGKSADVMLWRDKKISAGALSAATAIWVMFELVGYHLLTFVC  105

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            HGLIL+L +LFLWS A +FI KS P IPEV IPE+  +Q A  LR ++N  LAVLR++A 
Sbjct  106  HGLILSLVILFLWSKACTFINKSPPRIPEVSIPEDQAVQVARTLRYEMNRALAVLREVAL  165

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRD+K FL VI GLW++S+VGS  +FLTL YI  V LHTVPVLYEKYED+VDA AEKAM 
Sbjct  166  GRDVKKFLTVIAGLWLLSMVGSSVNFLTLVYILFVTLHTVPVLYEKYEDKVDAAAEKAMA  225

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            E+KKQYAV D KVLSKIPRGPLKDKK
Sbjct  226  EIKKQYAVLDDKVLSKIPRGPLKDKK  251



>ref|XP_010422067.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=265

 Score =   279 bits (714),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH 
Sbjct  60   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHV  119

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ALAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + L +IASGR
Sbjct  120  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLHEIASGR  179

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            D+K FL  I GLW++SI+G CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM EL
Sbjct  180  DIKKFLSAIFGLWVLSILGGCCSFLTLAYIALVLLFTVPLIYDKYEDKIDPYGEKAMAEL  239

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAVFDAKVLSKIPRGPLK+KK
Sbjct  240  KKQYAVFDAKVLSKIPRGPLKNKK  263



>ref|XP_010544774.1| PREDICTED: reticulon-like protein B6 [Tarenaya hassleriana]
Length=253

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            K+ RLFGR++PVHKV GGGK ADV LWR+KK+S  VLG ATAIW+LFE++EYHLL+ VCH
Sbjct  48   KIYRLFGREKPVHKVFGGGKPADVLLWRDKKLSAAVLGTATAIWVLFELVEYHLLSLVCH  107

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LILAL+VLFLWSNA SFI KS P IPE+H+ EE  L  ASALRN+VN    VLRDIA G
Sbjct  108  ILILALSVLFLWSNAHSFINKSPPQIPEIHLHEEHFLLVASALRNEVNQAFTVLRDIALG  167

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RDLK FLMV+ GLW+IS+VGS C FLTL YI  VLLHTVPVLYEK+ED+VD  AEKA  E
Sbjct  168  RDLKKFLMVVAGLWVISVVGSWCHFLTLIYICFVLLHTVPVLYEKHEDKVDPMAEKAFVE  227

Query  226  LKKQYAVFDAKVLSKIPRGPLKDK  155
            LKKQY V D KVLSKIP GPLK K
Sbjct  228  LKKQYGVLDEKVLSKIPIGPLKAK  251



>gb|ACF87936.1| unknown [Zea mays]
Length=208

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 170/208 (82%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M AK+ RLFGR++PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT 
Sbjct  1    MKAKIYRLFGRERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTL  60

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI++LA+LFLWSNASSFI KS P+IPEV IPE+  +  A  LR ++N   A LR+I
Sbjct  61   VCHCLIVSLAILFLWSNASSFINKSPPNIPEVKIPEDVSVNVALTLRYEINRGFATLREI  120

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
              G DLK FL+VI GLW+ S++GSCC+FLTLFYI  V L+T+PVLYEKYED+VDAF EKA
Sbjct  121  GHGHDLKKFLIVIAGLWLFSVLGSCCNFLTLFYIVFVALYTIPVLYEKYEDKVDAFGEKA  180

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M ELKK YA+FD K LSKIP+G LKDKK
Sbjct  181  MIELKKYYAIFDEKCLSKIPKG-LKDKK  207



>ref|XP_008354289.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VL GAT +W+ FE+LEYHL+T 
Sbjct  42   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITL  101

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL+LAV +LWSNAS+FI KS P IP V IPE+ VL+ ASALR ++N    VLR+I
Sbjct  102  VCHLLILSLAVFYLWSNASNFINKSQPQIPXVQIPEKTVLELASALRIELNKGFYVLRBI  161

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA
Sbjct  162  ASGRDLKAFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKA  221

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              E+KKQYAVFDAKVLSKIP+GP+K+KK
Sbjct  222  WIEIKKQYAVFDAKVLSKIPKGPVKEKK  249



>ref|XP_010455527.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=268

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH 
Sbjct  63   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHV  122

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ALAVLFLWSNA+ FI KS P IPE+HIPE+P+LQ AS LR ++N   + L +IASGR
Sbjct  123  MIVALAVLFLWSNATMFIHKSPPKIPEIHIPEDPLLQLASGLRIEINRGFSSLHEIASGR  182

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            D+K FL  I GLW++SI+G CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM EL
Sbjct  183  DIKKFLSAIFGLWVLSILGGCCSFLTLAYIALVLLFTVPLIYDKYEDKIDPYGEKAMAEL  242

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAVFDAKVLSKIPRGPLK+KK
Sbjct  243  KKQYAVFDAKVLSKIPRGPLKNKK  266



>ref|XP_003568063.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=244

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 168/206 (82%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVH VLGGGK AD+FLWRNKKIS GVL GATAIW+LFEV+EYHLLT +C
Sbjct  38   AKIYRLFGREKPVHSVLGGGKPADLFLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLLC  97

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  IL L +LFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N   A LRDI  
Sbjct  98   HCFILTLGILFLWSNASAFINKSPPNIPEVRIPEDLAVNVARSLRYEINRGFASLRDIGQ  157

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FL+VI GLW +S +GS C+FLTLFYI  ++L+TVPVLYEKYED++DA+ EKAM 
Sbjct  158  GRDLKKFLIVIAGLWTLSALGSSCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAYGEKAMI  217

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            ELKK YA+FD K LSKIP+GP KDKK
Sbjct  218  ELKKYYAIFDEKCLSKIPKGPSKDKK  243



>ref|XP_008232963.1| PREDICTED: reticulon-like protein B6 [Prunus mume]
Length=257

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
             KV R+FGR++PVH V GGGK ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V 
Sbjct  52   PKVFRIFGREKPVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVG  111

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LI  LAVLFLWSNA SFI K+ P IPEVH+PEEP LQ AS LR  +N   AVL DIAS
Sbjct  112  HILIGTLAVLFLWSNAHSFIHKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIAS  171

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GR+LK FL+VI GLW++SIVG+ C+FLTLFYI+ VLLHTVPV+YEKYED++D FAEKA  
Sbjct  172  GRELKKFLIVIAGLWVLSIVGTWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPFAEKATI  231

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            E KK YAVFDAKVLSKIP+G LK+K+
Sbjct  232  EFKKHYAVFDAKVLSKIPQG-LKNKR  256



>gb|EYU25170.1| hypothetical protein MIMGU_mgv1a012274mg [Erythranthe guttata]
Length=255

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 169/209 (81%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR+ PVHKVLGGGK AD+FLWR+KK +  VLG ATAIW+LFE+LEYHLL+ 
Sbjct  47   VKAKIYRLFGRETPVHKVLGGGKPADIFLWRDKKTTGYVLGVATAIWVLFELLEYHLLSL  106

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL LA+LFLWSNAS+FI KS P  PEV I E  V+  ASAL  + N   A+LR++
Sbjct  107  VCHFLILGLAILFLWSNASTFISKSRPKFPEVIISENVVVSVASALTIEFNRAFAILREV  166

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL VI GLW++S++GSC +FLTLFY   VLLHTVPVLYEKYED+VDAFAEKA
Sbjct  167  ASGKDLKKFLAVIAGLWVLSVLGSCFNFLTLFYTCFVLLHTVPVLYEKYEDQVDAFAEKA  226

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
             HE+KKQYAVFD KVLSK+P+  LK KK 
Sbjct  227  EHEIKKQYAVFDVKVLSKLPKAILKYKKF  255



>ref|XP_011080892.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=257

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  KV RLFGR++PVHK+LGGG+ ADV LWR+KK+S GVLGGA A+W LF+VLEYH LT 
Sbjct  48   LKTKVYRLFGREKPVHKILGGGQGADVLLWRDKKVSAGVLGGAAALWFLFDVLEYHFLTL  107

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CHGLIL L  +FL SNAS+F+KK+ P IPEV +PEEPVL+FASALR ++N   A LRDI
Sbjct  108  ICHGLILGLVAMFLLSNASTFVKKAPPRIPEVVLPEEPVLKFASALRIEINRVFADLRDI  167

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL VI GLW++S+VG  CDF+TL +   +LL TVP LYEK ED+VD +AEKA
Sbjct  168  ASGKDLKKFLYVIGGLWVLSVVGGICDFMTLIFSITLLLFTVPFLYEKNEDQVDCYAEKA  227

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            + ELKKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  228  IAELKKQYAVFDAKVLSKIPRGPLKDKK  255



>gb|EAY98759.1| hypothetical protein OsI_20691 [Oryza sativa Indica Group]
Length=251

 Score =   277 bits (709),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVH VLGGGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT 
Sbjct  43   LKAKIYRLFGREKPVHSVLGGGKPADLFLWRNKKISVGVLTGATAIWLLFEVMDYHLLTL  102

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH +IL LA+LFLWSNAS+FI KS P+IPEV IPE+  +  A ++R ++N   A LR+I
Sbjct  103  LCHCIILTLAMLFLWSNASTFINKSPPNIPEVKIPEDLAVNVARSVRFEINRGFATLREI  162

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
              G DLK FL+V+ GLW++S++GSCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKA
Sbjct  163  GLGHDLKKFLIVVAGLWVLSVLGSCCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKA  222

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            + ELKK YA+FD K LSKIP+GP K+KK
Sbjct  223  VIELKKYYAIFDEKCLSKIPKGPSKNKK  250



>ref|NP_001130478.1| Seed maturation protein [Zea mays]
 ref|XP_008654247.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 ref|XP_008654248.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACF78704.1| unknown [Zea mays]
 gb|ACF84299.1| unknown [Zea mays]
 gb|ACG48055.1| seed maturation protein [Zea mays]
 gb|ACR34851.1| unknown [Zea mays]
 gb|AFW85129.1| Seed maturation protein [Zea mays]
Length=253

 Score =   277 bits (709),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 170/208 (82%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M AK+ RLFGR++PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT 
Sbjct  46   MKAKIYRLFGRERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTL  105

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI++LA+LFLWSNASSFI KS P+IPEV IPE+  +  A  LR ++N   A LR+I
Sbjct  106  VCHCLIVSLAILFLWSNASSFINKSPPNIPEVKIPEDVSVNVALTLRYEINRGFATLREI  165

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
              G DLK FL+VI GLW+ S++GSCC+FLTLFYI  V L+T+PVLYEKYED+VDAF EKA
Sbjct  166  GHGHDLKKFLIVIAGLWLFSVLGSCCNFLTLFYIVFVALYTIPVLYEKYEDKVDAFGEKA  225

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M ELKK YA+FD K LSKIP+G LKDKK
Sbjct  226  MIELKKYYAIFDEKCLSKIPKG-LKDKK  252



>ref|XP_011084470.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=258

 Score =   277 bits (709),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 179/209 (86%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKVLGGGK AD+FLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT 
Sbjct  49   VKSKIYRLFGREKPVHKVLGGGKPADIFLWRDKKITAGVLGVATAIWVLFELLEYHLLTL  108

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALA++FLWSNAS+FI KS P IPE+ +PE+ VL  A+A R + N  LA+LRDI
Sbjct  109  VCHILILALALIFLWSNASTFINKSPPKIPEIIVPEDIVLGIAAAFRIEFNRALAILRDI  168

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGR+LK FL VI GLW++SI+G+  +FLTLFY   VLLHTVPVLYEKYED+VDAFAEKA
Sbjct  169  ASGRELKKFLAVIAGLWVLSILGNYFNFLTLFYTCFVLLHTVPVLYEKYEDQVDAFAEKA  228

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
              ELKKQYAVF+ KVLSKIPRGPLKDKKL
Sbjct  229  EAELKKQYAVFNTKVLSKIPRGPLKDKKL  257



>gb|KHN15986.1| Reticulon-like protein B5, partial [Glycine soja]
Length=242

 Score =   277 bits (708),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  KV RLFGR++PVH VLGGGK ADV LWRNKKIS  VLG ATA+WI FE+LEYHLLT 
Sbjct  33   IKEKVFRLFGREKPVHSVLGGGKPADVLLWRNKKISASVLGVATAVWIFFELLEYHLLTL  92

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH  IL LAVLFLWSNA +FI K+ P IP VH+PEEP+ QFASAL  ++N   A L  I
Sbjct  93   VCHISILVLAVLFLWSNAHTFIHKAPPCIPTVHLPEEPIRQFASALTIEINRGFAALHAI  152

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
             SGRDLK FL++I G WIISIVGS C+FLTLFYI  VLLHTVPV+Y+KYED++D  AEKA
Sbjct  153  GSGRDLKTFLIIIVGTWIISIVGSWCNFLTLFYIVFVLLHTVPVIYDKYEDKIDPLAEKA  212

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            + E KKQYAVFD KVL+KIP+GPLK KKLA
Sbjct  213  LIEFKKQYAVFDEKVLNKIPKGPLKGKKLA  242



>ref|NP_001241367.1| uncharacterized protein LOC100796111 [Glycine max]
 gb|ACU22605.1| unknown [Glycine max]
Length=256

 Score =   277 bits (709),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  KV RLFGR++PVH VLGGGK ADV LWRNKKIS  VLG ATA+WI FE+LEYHLLT 
Sbjct  47   IKEKVFRLFGREKPVHSVLGGGKPADVLLWRNKKISASVLGVATAVWIFFELLEYHLLTL  106

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH  IL LAVLFLWSNA +FI K+ P IP VH+PEEP+ QFASAL  ++N   A L  I
Sbjct  107  VCHISILVLAVLFLWSNAHTFIHKAPPCIPTVHLPEEPIRQFASALTIEINRGFAALHAI  166

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
             SGRDLK FL++I G WIISIVGS C+FLTLFYI  VLLHTVPV+Y+KYED++D  AEKA
Sbjct  167  GSGRDLKTFLIIIVGTWIISIVGSWCNFLTLFYIVFVLLHTVPVIYDKYEDKIDPLAEKA  226

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            + E KKQYAVFD KVL+KIP+GPLK KKLA
Sbjct  227  LIEFKKQYAVFDEKVLNKIPKGPLKGKKLA  256



>ref|XP_004969875.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=257

 Score =   277 bits (708),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            + RLFGR++ VH VLGGGK AD+ LWRNKKIS GVL  ATAIW+LFEV+EYHLLT VCH 
Sbjct  53   IYRLFGRERDVHSVLGGGKTADLVLWRNKKISGGVLASATAIWLLFEVMEYHLLTLVCHC  112

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            LIL+LA+LFLWSNAS+FI KS P+IPEV I E+  +  A +LR ++N   A LR+I  GR
Sbjct  113  LILSLAILFLWSNASTFINKSPPNIPEVKISEDVAVNVALSLRYEINRGFATLREIGHGR  172

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL+VI G W++S++GSCC+FLTLFYI  V+L+TVPVLYEKYED+VDAF EKAM EL
Sbjct  173  DLKKFLIVIAGFWLLSVLGSCCNFLTLFYIVFVVLYTVPVLYEKYEDKVDAFGEKAMIEL  232

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KK YA+FD K LSKIP+GPLKDKK
Sbjct  233  KKYYAIFDEKCLSKIPKGPLKDKK  256



>ref|XP_009375555.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009375556.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=264

 Score =   277 bits (709),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKVLGGGK ADVFLWRNKKIS  VL GAT +W+ FE+LEYHL+T 
Sbjct  55   VKSKIFRLFGREKPVHKVLGGGKPADVFLWRNKKISASVLAGATVLWVFFELLEYHLITL  114

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI  LAV +LWSNAS+FI KS P IP+V IPE+ VL+ ASALR ++N    VLRDI
Sbjct  115  VCHLLITFLAVFYLWSNASNFINKSQPQIPKVQIPEKTVLELASALRIELNKGFYVLRDI  174

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL V+  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA
Sbjct  175  ASGRDLKAFLGVVAVLWILSVVGKWFNFLTLFYILFVLLHTLPVIYEKYDDQIDAFGEKA  234

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              E+KKQYAVFDAKVLSKIP+GP+K+KK
Sbjct  235  WIEIKKQYAVFDAKVLSKIPKGPVKEKK  262



>ref|XP_008343772.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   276 bits (707),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VL GAT +W+ FE+LEYHL+T 
Sbjct  42   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITL  101

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL+LAV +LWSNAS+FI KS P IP+V IPE+ VL+ ASALR ++N    VLR+I
Sbjct  102  VCHLLILSLAVFYLWSNASNFINKSQPQIPKVQIPEKTVLELASALRIELNKGFYVLRNI  161

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA
Sbjct  162  ASGRDLKAFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKA  221

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              E+KKQYAVFDAKVLSKIP+GP+K+KK
Sbjct  222  WIEIKKQYAVFDAKVLSKIPKGPVKEKK  249



>ref|XP_011047748.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=254

 Score =   276 bits (707),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T 
Sbjct  45   VKSKIFRLFGREKPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VC+  I +LAVLFLWSNAS+F+ KS P IPEV +PE+ V + AS LR ++N  +AVL DI
Sbjct  105  VCYLSIFSLAVLFLWSNASNFLNKSPPKIPEVLLPEKCVREVASGLRIEINRGVAVLHDI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GL ++S+VGSCC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EK+
Sbjct  165  ASGRDLKKFLAVIAGLLVLSLVGSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGCSEKS  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              ++KKQYA+ D K LSKIPRGP K+KK
Sbjct  225  WIQIKKQYALLDEKYLSKIPRGPFKEKK  252



>ref|XP_010435260.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=273

 Score =   277 bits (709),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLL  +CH 
Sbjct  68   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLAVLCHV  127

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ALAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + L +IASGR
Sbjct  128  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLHEIASGR  187

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            D+K FL  I GLW++SI+G CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM EL
Sbjct  188  DIKKFLSAIFGLWVLSILGGCCSFLTLAYIALVLLFTVPLVYDKYEDKIDPYGEKAMAEL  247

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAVFDAKVLSKIPRGPLK+KK
Sbjct  248  KKQYAVFDAKVLSKIPRGPLKNKK  271



>dbj|BAJ89699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   276 bits (705),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFEVLEYHLLT +C
Sbjct  50   AKIYRLFGREKPVHSVLGGGKPADLLLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLC  109

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            HG IL L +LFLWSNAS+F+ K  P+IPEV IPE+  +  A +LR ++N   A LR I  
Sbjct  110  HGFILTLGILFLWSNASAFVNKCPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQ  169

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FL+V+ GLWI+S +GS C+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM 
Sbjct  170  GRDLKKFLIVVAGLWILSALGSSCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMV  229

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            ELKK YA+FD K LSKIP+GP KDKK
Sbjct  230  ELKKYYAIFDEKCLSKIPKGPSKDKK  255



>ref|XP_010035177.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW46473.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=255

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            +KV RLFGR++PVHKVLGGGK AD+FLWR+KK+S GVLG ATAIWILFE++EYHL+T VC
Sbjct  48   SKVYRLFGREKPVHKVLGGGKPADIFLWRDKKVSAGVLGVATAIWILFELMEYHLITLVC  107

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LI  LA++FLW++AS+ I KS P+IPEV +PE+ VL+ AS LR + N  LA+LR+IAS
Sbjct  108  HILIATLAIIFLWASASTHITKSPPNIPEVQLPEKCVLEVASVLRFEANRGLALLREIAS  167

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GR+LK FL  I GLW++S+VGS  + +TLFYI  VLLHTVPV YEKYED+VD FAEKAM 
Sbjct  168  GRELKKFLAFIAGLWVLSMVGSWFNSVTLFYITFVLLHTVPVFYEKYEDQVDPFAEKAMV  227

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            E+KKQ+AVF+ KVLSK+PRGPLKDKK
Sbjct  228  EIKKQFAVFNEKVLSKVPRGPLKDKK  253



>ref|XP_006654676.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=247

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVH VLGGGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +C
Sbjct  41   AKIYRLFGREKPVHSVLGGGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLC  100

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H +IL LA+LFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  
Sbjct  101  HCVILTLAILFLWSNASTFINKSPPNIPEVRIPEDLAVNVARSLRFEINRGFATLREIGQ  160

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            G DLK FL+V+ GLWI+S++GSCC+FLTLFYI  + L+TVPVLYEKY+D++DAF EKAM 
Sbjct  161  GHDLKKFLIVVAGLWILSVLGSCCNFLTLFYIVFMALYTVPVLYEKYDDKIDAFGEKAMI  220

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            ELKK  A+FD K L+KIP+GP K+KK
Sbjct  221  ELKKYCAIFDEKCLAKIPKGPSKNKK  246



>ref|XP_009406784.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406785.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=253

 Score =   275 bits (703),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVH++LGGGK ADVFLW+NKK S  VLGGATAIWI FE++EYHLLT 
Sbjct  43   VKSKINRLFGREKPVHQILGGGKPADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTL  102

Query  595  VCHGLILALAVLFLWSNASSFIK-KSAphipevhipeepVLQFASALRNDVNHCLAVLRD  419
             CH LIL+LA++FLWSNA+  I  +S PHIP V IPE  V+  A +LR ++N   AVLR+
Sbjct  103  FCHCLILSLAIIFLWSNATFLINNRSPPHIPVVSIPENLVVDIALSLRYEINRGFAVLRE  162

Query  418  IASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEK  239
            IA+GRDLK FL+VI GLW++S VG CC+FLTLFYI  V LHT+P LY+KYED+VDAFAEK
Sbjct  163  IATGRDLKKFLIVIAGLWVLSTVGRCCNFLTLFYIVFVTLHTLPFLYDKYEDKVDAFAEK  222

Query  238  AMHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
            A  E KK YAVF AK LSKIPRGPLKDKK 
Sbjct  223  ASVEFKKHYAVFQAKYLSKIPRGPLKDKKF  252



>ref|XP_002320163.1| reticulon family protein [Populus trichocarpa]
 gb|ABK92738.1| unknown [Populus trichocarpa]
 gb|EEE98478.1| reticulon family protein [Populus trichocarpa]
Length=251

 Score =   275 bits (702),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            K+ RLFGR++PVH+VLGGGK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH
Sbjct  46   KIWRLFGREKPVHRVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCH  105

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LIL+LA+ FLWSNA SFI KS P IP+VH+PEEPVLQ ASAL  ++N    VLR IA+G
Sbjct  106  ILILSLALSFLWSNAHSFINKSPPRIPQVHLPEEPVLQVASALCVEINGAFVVLRSIAAG  165

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            +DLK FL+VI GLW++SIVGS C FLTLFYI  VLLHTVPVLYEK+ED++D  AEKAM E
Sbjct  166  KDLKKFLIVIAGLWVMSIVGSWCHFLTLFYICFVLLHTVPVLYEKFEDKIDPLAEKAMIE  225

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKKL  149
            +K+QYAVFDAKVLSKIP   LK KK+
Sbjct  226  IKRQYAVFDAKVLSKIPVAALKAKKV  251



>ref|NP_001044177.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAB89453.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF06091.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAG89426.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   275 bits (702),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            + RLFGR++PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH 
Sbjct  49   IYRLFGRERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHC  108

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            LIL+LAVLFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GR
Sbjct  109  LILSLAVLFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGR  168

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL+VI GLWI+S++GS C+FLTLFYI  V L+TVPVLYEKYED+VDAF EKA  E 
Sbjct  169  DLKKFLIVIAGLWILSVLGSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEF  228

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KK YA+F+ K LSKIP+GPLKDKK
Sbjct  229  KKYYALFEEKCLSKIPKGPLKDKK  252



>gb|ABK94480.1| unknown [Populus trichocarpa]
Length=251

 Score =   275 bits (702),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            K+ RLFGR++PVH+VLGGGK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH
Sbjct  46   KIWRLFGREKPVHRVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCH  105

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LIL+LA+ FLWSNA SFI KS P IP+VH+PEEPVLQ ASAL  ++N    VLR IA+G
Sbjct  106  ILILSLALSFLWSNAHSFINKSPPRIPQVHLPEEPVLQVASALCVEINGAFVVLRSIAAG  165

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            +DLK FL+VI GLW++SIVGS C FLTLFYI  VLLHTVPVLYEK+ED++D  AEKAM E
Sbjct  166  KDLKKFLIVIAGLWVMSIVGSWCHFLTLFYICFVLLHTVPVLYEKFEDKIDPLAEKAMIE  225

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKKL  149
            +K+QYAVFDAKVLSKIP   LK KK+
Sbjct  226  IKRQYAVFDAKVLSKIPVAALKAKKV  251



>gb|KJB24285.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=255

 Score =   275 bits (702),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M AKV RLFGR++PVH V GGGKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT 
Sbjct  42   MKAKVFRLFGRERPVHDVFGGGKQADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTL  101

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALA+LFLWSNA++FI KS P IPEV IP++PVL+FA ALR ++N   AVLRDI
Sbjct  102  VCHLLILALALLFLWSNAATFIHKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDI  161

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++SIVG+ C+FLTLFYI  VLLHT+PVLYEKYED+VD   EKA
Sbjct  162  ASGRDLKKFLSVIAGLWVLSIVGNWCNFLTLFYIVFVLLHTLPVLYEKYEDKVDQLTEKA  221

Query  235  MHELKKQYAVFDAKVLSKIPRGPL  164
             HE+KKQYAVFDAKVLSKIP+ PL
Sbjct  222  WHEIKKQYAVFDAKVLSKIPKRPL  245



>ref|NP_192861.1| reticulon-like protein B2 [Arabidopsis thaliana]
 sp|Q9SUT9.1|RTNLB_ARATH RecName: Full=Reticulon-like protein B2; Short=AtRTNLB2; AltName: 
Full=VirB2-interacting protein 2 [Arabidopsis thaliana]
 emb|CAB51406.1| putative protein [Arabidopsis thaliana]
 emb|CAB81223.1| putative protein [Arabidopsis thaliana]
 gb|AAK59408.1| unknown protein [Arabidopsis thaliana]
 gb|AAK82535.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAL14401.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAM64366.1| unknown [Arabidopsis thaliana]
 gb|AAN86201.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82986.1| reticulon-like protein B2 [Arabidopsis thaliana]
Length=271

 Score =   275 bits (703),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++PVHKVLGGGK AD+F+W++KK+S GV GGAT  W+LFE++EYHLLT +CH 
Sbjct  66   VYRLFGRERPVHKVLGGGKPADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHV  125

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ALAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N  ++ LR+IASGR
Sbjct  126  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGISSLREIASGR  185

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            D+K FL  I GLW++SI+G C  FLTL YIA+VLL TVP+ Y+KYED+VD++ EKAM EL
Sbjct  186  DIKKFLSAIAGLWVLSILGGCYSFLTLAYIALVLLFTVPLFYDKYEDKVDSYGEKAMAEL  245

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAV DAKV SKIPRGPLKDKK
Sbjct  246  KKQYAVLDAKVFSKIPRGPLKDKK  269



>ref|XP_010433883.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=276

 Score =   275 bits (702),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT 
Sbjct  67   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTL  126

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+I
Sbjct  127  ICHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSTLREI  186

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGR+LK FL+ I GLWI+SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA
Sbjct  187  ASGRELKKFLIAIFGLWILSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKA  246

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            + ELKKQYAV D KVLSKIP GPLK+KK
Sbjct  247  VIELKKQYAVLDEKVLSKIPLGPLKNKK  274



>ref|XP_006644671.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=253

 Score =   273 bits (699),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            + RLFGR++PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH 
Sbjct  49   IYRLFGRERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHC  108

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            LIL+LAVLFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GR
Sbjct  109  LILSLAVLFLWSNASTFINKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGR  168

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            +LK FL+VI GLWI+S++GS C+FLTLFYI  V L+TVPVLYEKYED+VDA  EKA  EL
Sbjct  169  ELKKFLIVIAGLWILSVLGSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDALGEKAEIEL  228

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KK YA+F+ K LSKIP+GPLKDKK
Sbjct  229  KKYYALFEEKCLSKIPKGPLKDKK  252



>ref|XP_010509305.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=275

 Score =   274 bits (701),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT 
Sbjct  66   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTL  125

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH +I+ LAVLFLWSNA+ FI KS P IPE+HIPEEP+LQ AS LR ++N   + LR+I
Sbjct  126  ICHVMIVVLAVLFLWSNATMFINKSPPKIPEIHIPEEPILQLASGLRIEINRGFSSLREI  185

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGR+LK FL+ I GLWI+SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA
Sbjct  186  ASGRELKKFLIAIFGLWILSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKA  245

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            + ELKKQYAV D KVLSKIP GPLK+KK
Sbjct  246  VIELKKQYAVLDEKVLSKIPLGPLKNKK  273



>ref|XP_010439152.1| PREDICTED: reticulon-like protein B1 isoform X1 [Camelina sativa]
Length=276

 Score =   274 bits (701),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT 
Sbjct  67   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTL  126

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+I
Sbjct  127  ICHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREI  186

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGR+LK FL+ I GLWI+SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA
Sbjct  187  ASGRELKKFLIAIFGLWILSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKA  246

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            + ELKKQYAV D KVLSKIP GPLK+KK
Sbjct  247  VIELKKQYAVLDEKVLSKIPLGPLKNKK  274



>ref|XP_007218268.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19467.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=339

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
             KV R+FGR++PVH V GGGK ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V 
Sbjct  134  PKVFRIFGREKPVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVG  193

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LI  LAVLFLWSNA SFI K+ P IPEVH+PEEP LQ AS LR  +N   AVL DIAS
Sbjct  194  HILIGTLAVLFLWSNAHSFIHKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIAS  253

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GR+LK FL+VI GLW++SIVG+ C+FLTLFYI+ VLLHTVPV+YEKYED++D FAEKA  
Sbjct  254  GRELKKFLIVIAGLWVLSIVGTWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPFAEKATI  313

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            E KK YAVFDAKVLSKIP+G LK+K+
Sbjct  314  EFKKHYAVFDAKVLSKIPQG-LKNKR  338



>ref|NP_194094.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
 sp|Q9SUR3.1|RTNLA_ARATH RecName: Full=Reticulon-like protein B1; Short=AtRTNLB1; AltName: 
Full=VirB2-interacting protein 1 [Arabidopsis thaliana]
 emb|CAA23029.1| putative protein [Arabidopsis thaliana]
 emb|CAB79318.1| putative protein [Arabidopsis thaliana]
 gb|AAK91338.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AAM65433.1| unknown [Arabidopsis thaliana]
 gb|AAM91465.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AEE84787.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
Length=275

 Score =   273 bits (698),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR+QPVHKVLGGGK AD+F+W+NKK+S GVLGGATA W++FE++EYHLLT +CH 
Sbjct  70   VYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHV  129

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGR
Sbjct  130  MIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGR  189

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL+ I GLW++SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM EL
Sbjct  190  DLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIEL  249

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAV D KVLSKIP GPLK+KK
Sbjct  250  KKQYAVLDEKVLSKIPLGPLKNKK  273



>gb|KDO86331.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=249

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + A + RLFGR++PVH+V GGGK ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT 
Sbjct  44   VKADIYRLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTL  103

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALA+LFLW+NA +FIKK+ P IPEVH+PEEP LQ ASA R ++NH  AVLR I
Sbjct  104  VCHTLILALAILFLWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSI  163

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FLM I  LW++S+VGS C+FLTLFYIA+VLLH VPVLYEKYED++D  AEKA
Sbjct  164  ASGRDLKSFLMAIAALWVLSVVGSWCNFLTLFYIALVLLHIVPVLYEKYEDKIDPLAEKA  223

Query  235  MHELKKQYAVFDAKVLSKIP  176
            M E+KKQYAVFDAKVLSKIP
Sbjct  224  MIEIKKQYAVFDAKVLSKIP  243



>gb|KFK31901.1| hypothetical protein AALP_AA6G173800 [Arabis alpina]
Length=259

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++PVHKVLGGGK AD+F+W+ KK+S GV GGAT  W+LFE++EYHLLT + H 
Sbjct  54   VYRLFGREKPVHKVLGGGKPADIFMWKKKKMSGGVFGGATVAWVLFELMEYHLLTLLSHV  113

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +IL LAVLFLWSNA+ FI KS P IP++HIPEEP+LQ AS LR ++N   + L +IASGR
Sbjct  114  MILLLAVLFLWSNATMFIHKSPPKIPQLHIPEEPLLQLASGLRIEINRGFSSLHEIASGR  173

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL VI GLW++SI+G CC FLTL YIA+VLL TVP+LY+KYED+VD + EKAM EL
Sbjct  174  DLKKFLSVIAGLWVLSILGGCCSFLTLAYIALVLLFTVPLLYDKYEDKVDPYGEKAMLEL  233

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAVFDAKVLSKIP GPLK+KK
Sbjct  234  KKQYAVFDAKVLSKIPMGPLKNKK  257



>ref|XP_006284300.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
 gb|ACC91263.1| reticulon family protein [Capsella rubella]
 gb|EOA17198.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
Length=274

 Score =   273 bits (698),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLG ATA W+LFE++EYHLLT 
Sbjct  65   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTL  124

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+I
Sbjct  125  LCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREI  184

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL+ I GLW++SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA
Sbjct  185  ASGRDLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKA  244

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            + ELKKQYAV D KVLSKIP GPLK+KK
Sbjct  245  VIELKKQYAVLDEKVLSKIPLGPLKNKK  272



>gb|EAZ13460.1| hypothetical protein OsJ_03377 [Oryza sativa Japonica Group]
Length=253

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            + RLFGR++PV  VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH 
Sbjct  49   IYRLFGRERPVQSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHC  108

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            LIL+LAVLFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GR
Sbjct  109  LILSLAVLFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGR  168

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL+VI GLWI+S++GS C+FLTLFYI  V L+TVPVLYEKYED+VDAF EKA  E 
Sbjct  169  DLKKFLIVIAGLWILSVLGSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEF  228

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KK YA+F+ K LSKIP+GPLKDKK
Sbjct  229  KKYYALFEEKCLSKIPKGPLKDKK  252



>gb|KJB06453.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=288

 Score =   273 bits (698),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 177/240 (74%), Gaps = 31/240 (13%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++P+H VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT 
Sbjct  49   VKAKIYRLFGRERPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTL  108

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH  IL+LAVLFLWSN  +FI K+ P IP+VH+PEEP LQ ASAL  ++N  L +LRDI
Sbjct  109  LCHISILSLAVLFLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASALTIELNQALELLRDI  168

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYI--------------------------  314
            ASGR+LK FL+V+   W++S+VGS C+FLTLFY                           
Sbjct  169  ASGRNLKKFLVVVAAFWVLSVVGSWCNFLTLFYTCNDTGLLFLVPSSFIYTNFILNFDPS  228

Query  313  -----AVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
                 A VLLHTVPVLYEKYED+VD FAEKA+ E+KKQYAVFDA VLSKIP GPLK KK+
Sbjct  229  SLWKSAFVLLHTVPVLYEKYEDKVDPFAEKAVIEIKKQYAVFDANVLSKIPTGPLKSKKV  288



>emb|CDY57657.1| BnaC01g15350D [Brassica napus]
Length=275

 Score =   272 bits (695),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M +KV RLFGR++PVHKVLGGGK AD+F+W++KKIS GVLGGATA W+LFE++EYHLLT 
Sbjct  66   MKSKVYRLFGREKPVHKVLGGGKPADIFMWKDKKISGGVLGGATAAWVLFELMEYHLLTL  125

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N  L+ LR+I
Sbjct  126  LCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREI  185

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL  I GLW++SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKA
Sbjct  186  ASGRDLKKFLCAIVGLWVLSIMGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKA  245

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  246  MIEIKKQYAVLDEKVLSKIPMGPLKNKK  273



>ref|XP_002869770.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46029.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR+QPVHKVLGGGK AD+F+W+NKK+S GVLGGATA W++FE++EYHLLT +CH 
Sbjct  67   VYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHV  126

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGR
Sbjct  127  MIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSTLREIASGR  186

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL+ I GLW++SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ EL
Sbjct  187  DLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIEL  246

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAV D KVLSKIP GPLK+KK
Sbjct  247  KKQYAVLDEKVLSKIPLGPLKNKK  270



>ref|XP_006444935.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
 ref|XP_006491199.1| PREDICTED: reticulon-like protein B5-like [Citrus sinensis]
 gb|ESR58175.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
Length=249

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + A + RLFGR++PVH+V GGGK ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT 
Sbjct  44   VKADIYRLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTL  103

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALA+LFLW+NA +FIKK+ P IPEVH+PEEP LQ ASA R ++NH  AVLR I
Sbjct  104  VCHTLILALAILFLWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSI  163

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FLM I  LW++S+VGS C+FLTLFYIA+VLLH +PVLYEKYED++D  AEKA
Sbjct  164  ASGRDLKSFLMAIAALWVLSVVGSWCNFLTLFYIALVLLHILPVLYEKYEDKIDPLAEKA  223

Query  235  MHELKKQYAVFDAKVLSKIP  176
            M E+KKQYAVFDAKVLSKIP
Sbjct  224  MIEIKKQYAVFDAKVLSKIP  243



>ref|XP_010112604.1| Reticulon-like protein [Morus notabilis]
 gb|EXC34329.1| Reticulon-like protein [Morus notabilis]
Length=254

 Score =   270 bits (689),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKVLGGGK AD+FLWRNKK+S GVLG AT IWILFE++EYHLLT 
Sbjct  48   LKSKIYRLFGREKPVHKVLGGGKPADIFLWRNKKVSAGVLGVATVIWILFELVEYHLLTL  107

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALA+LFLWSNAS+FI KS P +P+V+IPE+PVLQ A+ALR ++N  LA+LR+I
Sbjct  108  VCHLLILALALLFLWSNASTFINKSPPRLPDVYIPEDPVLQVAAALRIEINRGLAILREI  167

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++S+ G+  +FLTLFY A VLL TVPV+YEKYED+VD FAEKA
Sbjct  168  ASGRDLKKFLSVIAGLWVLSVAGNLFNFLTLFYTAFVLLFTVPVIYEKYEDKVDPFAEKA  227

Query  235  MHELKKQYAVFDAKVLSKIPRGPLK  161
            + E+KKQY VFDAKVLSK+PRGPLK
Sbjct  228  IIEIKKQYKVFDAKVLSKLPRGPLK  252



>emb|CDY44123.1| BnaA01g13310D [Brassica napus]
Length=276

 Score =   270 bits (691),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M +KV RLFGR++PVHKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT 
Sbjct  67   MKSKVYRLFGREKPVHKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTL  126

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N  L+ LR+I
Sbjct  127  LCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREI  186

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL  I GLW++SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKA
Sbjct  187  ASGRDLKKFLCAIFGLWVLSIMGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKA  246

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  247  MIEIKKQYAVLDEKVLSKIPMGPLKNKK  274



>ref|XP_004149448.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 ref|XP_004167648.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 gb|KGN57883.1| hypothetical protein Csa_3G363160 [Cucumis sativus]
Length=250

 Score =   269 bits (688),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR +PVH VLGGGK ADVFLW+NKK S GVLGGATA+WILFE+LEY L+T VCH 
Sbjct  45   VYRLFGRDKPVHTVLGGGKPADVFLWKNKKNSAGVLGGATALWILFELLEYQLITLVCHI  104

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            LI+ LA+ FLWS A++FI K+ P IP+V +PE+ +LQ  ++LR ++N  ++ LRD+ASGR
Sbjct  105  LIILLAIPFLWSYANTFINKTPPQIPDVRLPEDCLLQVVTSLRIEINRIISTLRDVASGR  164

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DL+ FL    GLWI+SI GS C+FLTL Y+  +LLHTVPVLYEKYED+VD FAEKA+ EL
Sbjct  165  DLRKFLSAFLGLWILSIAGSWCNFLTLLYMCFILLHTVPVLYEKYEDQVDPFAEKALIEL  224

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYA FDAKVLSKIP GPL++KK
Sbjct  225  KKQYAEFDAKVLSKIPLGPLQEKK  248



>ref|XP_009137263.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=276

 Score =   270 bits (691),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M +KV RLFGR++PVHKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT 
Sbjct  67   MKSKVYRLFGREKPVHKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTL  126

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N  L+ LR+I
Sbjct  127  LCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREI  186

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL  I GLW++SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKA
Sbjct  187  ASGRDLKKFLCAIFGLWVLSIMGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKA  246

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  247  MIEIKKQYAVLDEKVLSKIPMGPLKNKK  274



>ref|XP_006413535.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54988.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=275

 Score =   269 bits (688),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLG ATA W+LFE++EYHLLT 
Sbjct  66   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTL  125

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+I
Sbjct  126  LCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREI  185

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL  + GLW++S++G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKA
Sbjct  186  ASGRDLKKFLSAVAGLWVLSVLGGWFNFLTLAYIALVLLFTVPIVYDKYEDKVDPLGEKA  245

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  246  MIEIKKQYAVLDEKVLSKIPLGPLKNKK  273



>ref|XP_006396933.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
 dbj|BAJ34499.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38386.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
Length=265

 Score =   269 bits (687),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GV GGAT  W+LFE++EYHLLT 
Sbjct  56   LKSKVYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVFGGATVAWVLFELIEYHLLTL  115

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR I
Sbjct  116  LCHVMIVLLAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLRQI  175

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL  I GLW++S++G CC FLTL YIA+VLL T+P+LY+KYED+VD++ EKA
Sbjct  176  ASGRDLKKFLSAIVGLWVLSVLGGCCSFLTLAYIALVLLFTLPLLYDKYEDKVDSYGEKA  235

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M ELKKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  236  MAELKKQYAVFDAKVLSKIPRGPLKDKK  263



>gb|ABR17571.1| unknown [Picea sitchensis]
 gb|ACN40850.1| unknown [Picea sitchensis]
Length=259

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 159/209 (76%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + + V+RLFGR++PVH + GGGK ADV LWRNK+ S GVL GAT +W+LFE L Y+LLT 
Sbjct  51   ISSSVKRLFGREKPVHTLFGGGKSADVILWRNKQTSAGVLAGATVMWLLFEWLGYYLLTL  110

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH LIL + +LF+WSNAS+FI K    IP++   E+     ASALR ++N    V+ D+
Sbjct  111  ICHVLILGITILFVWSNASAFINKQPVRIPQISFSEQLFQDVASALRFEINRLFTVIHDV  170

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FLMV+ GLWI+S++GS  +FLTLFY+A V  HTVPVLYEKYED+VDAF  KA
Sbjct  171  ASGRDLKKFLMVVAGLWILSVIGSWANFLTLFYVAFVFAHTVPVLYEKYEDQVDAFTFKA  230

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
            M E KK Y  FDAKVLSKIPRGPLKDKK 
Sbjct  231  MDEAKKHYGTFDAKVLSKIPRGPLKDKKF  259



>ref|XP_010538815.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AKV RLFGR++PVHKVLGGGK AD+F+WR+KK+S  VLGG TA+W+LFE++EYHLL+ 
Sbjct  58   LKAKVYRLFGREKPVHKVLGGGKPADIFMWRDKKMSASVLGGITAVWVLFELMEYHLLSL  117

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            + H LI+ LAVLF+WSNAS FI KS P IPEVHIPEEP+LQ AS LR ++N     LRDI
Sbjct  118  LSHVLIVVLAVLFIWSNASMFINKSPPKIPEVHIPEEPILQLASGLRIEINRAFTCLRDI  177

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL  I GLW++SIVG CC+FLTL YI +V+L T+PVLYEK+ED+VDA+ EKA
Sbjct  178  ASGRDLKKFLTAIAGLWVLSIVGGCCNFLTLSYIGMVMLFTIPVLYEKHEDKVDAYGEKA  237

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQYAV D KVLSKIPRGPLK KK
Sbjct  238  MVEMKKQYAVLDEKVLSKIPRGPLKGKK  265



>gb|KDP22201.1| hypothetical protein JCGZ_26032 [Jatropha curcas]
Length=248

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +K+ RLFGR++PVHKVLGGGK ADV LWRNK++S  VLGGAT +W+LFE+LEYHL+T 
Sbjct  39   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKQVSASVLGGATVVWVLFELLEYHLITL  98

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH  IL LA+LFLWSNAS+F+ KS P IP++ +PE+ VL+ ASALR ++N  LAVL DI
Sbjct  99   VCHISILTLAILFLWSNASTFVNKSPPEIPQIVLPEKYVLEIASALRIEINRALAVLHDI  158

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A+GRD+K FL VI  LW++SI+GS  +FLTL YI  VLLHTVP+ YEKYED++D  AEKA
Sbjct  159  AAGRDVKTFLTVIASLWVLSIIGSWFNFLTLLYIVFVLLHTVPLAYEKYEDQIDPIAEKA  218

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              E+KKQY VFD KVLSKIP G LK+ K
Sbjct  219  WIEIKKQYVVFDEKVLSKIPVGLLKELK  246



>dbj|BAJ98297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR+QPVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT 
Sbjct  47   VKAKIYRLFGREQPVHAVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTL  106

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            V H LIL+LA LFLWSN   FI KS P+IPEV IPE+  +  A +LR+++N  L  LR+I
Sbjct  107  VGHCLILSLATLFLWSNVCIFIHKSPPNIPEVKIPEDLTVNIALSLRHEINRGLFTLREI  166

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
              GRDLK FL+VI GLW++S++GSCC+FLTL YI  V+L+TVPVLYEKY+D+VDAF EKA
Sbjct  167  GHGRDLKKFLIVIGGLWVLSVLGSCCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKA  226

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M ELKK YA+F+ KVLSKIP+G LK+KK
Sbjct  227  MIELKKYYAIFEEKVLSKIPKGALKNKK  254



>gb|EYU32181.1| hypothetical protein MIMGU_mgv1a012219mg [Erythranthe guttata]
Length=258

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 164/208 (79%), Gaps = 1/208 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            + V+   GR++PVHKV GGGK AD+FLWR+KKIS GVLGG TA+W+LFE+LEYHLLT VC
Sbjct  52   SPVKEEIGREKPVHKVFGGGKPADIFLWRDKKISGGVLGGVTAVWVLFELLEYHLLTLVC  111

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H +I  L++LFLWSN + FI K  P IP V + EEP +  A ALRN++N   AVLR+IAS
Sbjct  112  HIVIFTLSMLFLWSNVTIFINKRPPPIPVVSLSEEPFVGVALALRNEINRTCAVLREIAS  171

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FL+V+  LW  SIVGSCC+FLTLFY+  VLLHTVPVLYEKY +++DAF EKA  
Sbjct  172  GRDLKKFLVVVAVLWFFSIVGSCCNFLTLFYLVFVLLHTVPVLYEKYNEKIDAFTEKATV  231

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            E+KKQYAVFDAK L KIP+GP  DKK A
Sbjct  232  EIKKQYAVFDAKFLCKIPKGPF-DKKRA  258



>gb|ACN40158.1| unknown [Picea sitchensis]
Length=259

 Score =   267 bits (683),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 159/209 (76%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + + V+RLFGR++PVH + GGGK ADV LWRNK+ S GVL GAT +W+LFE L Y+LLT 
Sbjct  51   ISSSVKRLFGREKPVHTLFGGGKSADVILWRNKQTSAGVLAGATVMWLLFEWLGYYLLTL  110

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH LIL + +LF+WSNAS+FI K    IP++   E+     ASALR ++N    V+ ++
Sbjct  111  ICHVLILGITILFVWSNASAFINKQPVRIPQISFSEQLFQDVASALRFEINRLFTVIHNV  170

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FLMV+ GLWI+S++GS  +FLTLFY+A V  HTVPVLYEKYED+VDAF  KA
Sbjct  171  ASGRDLKKFLMVVAGLWILSVIGSWANFLTLFYVAFVFAHTVPVLYEKYEDQVDAFTFKA  230

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
            M E KK Y  FDAKVLSKIPRGPLKDKK 
Sbjct  231  MDEAKKHYGTFDAKVLSKIPRGPLKDKKF  259



>dbj|BAJ33905.1| unnamed protein product [Thellungiella halophila]
Length=275

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M +KV RLFGR++PVHKVLGGGK A++F+W+NKK+S GVLG ATA W+LFE++EYHLLT 
Sbjct  66   MQSKVYRLFGREKPVHKVLGGGKPAEIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTL  125

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+I
Sbjct  126  LCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREI  185

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL  + GLW++S++G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKA
Sbjct  186  ASGRDLKKFLSAVAGLWVLSVLGGWFNFLTLAYIALVLLFTVPIVYDKYEDKVDPLGEKA  245

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  246  MIEIKKQYAVLDEKVLSKIPLGPLKNKK  273



>ref|XP_002870630.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46889.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   267 bits (682),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 170/208 (82%), Gaps = 4/208 (2%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            + RLFGR++PVHKVLGGGK AD+FLWRNKK+S GV G  TA W+LFE+ EYHLL  +CH 
Sbjct  49   IYRLFGREKPVHKVLGGGKPADIFLWRNKKVSGGVFGAVTASWVLFELFEYHLLAFLCHF  108

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
             I ALA LFLWSNA +FI K++PHIPEV+IPE+PVLQ  S LR ++N  L VLR+IASG+
Sbjct  109  AIFALAALFLWSNACTFIHKASPHIPEVNIPEDPVLQLVSGLRIEINRGLTVLRNIASGK  168

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            D+K F++VI GLW++SI+GSC +FLTLFYIA VLL T+PVLYEKYED+VDAF EKAM E+
Sbjct  169  DVKKFILVIAGLWVLSIIGSCYNFLTLFYIATVLLFTIPVLYEKYEDKVDAFGEKAMKEI  228

Query  223  KKQYAVFD----AKVLSKIPRGPLKDKK  152
            KKQYAV D    +KVLSKIPRG L  KK
Sbjct  229  KKQYAVLDEKVLSKVLSKIPRGALNKKK  256



>gb|EMS62854.1| Reticulon-like protein B1 [Triticum urartu]
Length=237

 Score =   266 bits (680),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 168/234 (72%), Gaps = 32/234 (14%)
 Frame = -3

Query  757  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  578
            RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  + H LI
Sbjct  3    RLFGREQPIHKVLGGGKPADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGHALI  62

Query  577  LALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDL  398
             +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R+++N   A LR IA GRD+
Sbjct  63   FSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALGRDI  122

Query  397  KMFLMVITGLWIISIVGSCCDFLTLFYIA-------------------------------  311
            K FL+VI GLW++SI+GSCC+FLTLFYI                                
Sbjct  123  KKFLIVIAGLWLLSILGSCCNFLTLFYIGEGSQLSIPFLAPLLPNVDLVFTVDLSLLCQT  182

Query  310  -VVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              V+LHTVPV+YEKYED++D + EK   E+KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  183  VFVVLHTVPVIYEKYEDQIDTYGEKGWIEVKKQYAVFDAKVLSKVPRGPLKDKK  236



>ref|XP_006422078.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 gb|ESR35318.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=287

 Score =   268 bits (684),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 147/241 (61%), Positives = 176/241 (73%), Gaps = 36/241 (15%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            +KV RLFGR++P+H VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VC
Sbjct  46   SKVFRLFGREKPIHHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVC  105

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  IL+LAVLFLWSNAS+FI KS P IP V +PE+ VL+FASALR ++N  LAVLR+IAS
Sbjct  106  HISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIAS  165

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIA---------------------------  311
            GRDLK FL VI GLW++SIVG+ C+F+TLFYI                            
Sbjct  166  GRDLKKFLGVIAGLWLLSIVGNWCNFVTLFYIGKKHSLVLMAYFLKWIVFLLKCLDLLYG  225

Query  310  -----VVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA----KVLSKIPRGPLKD  158
                  VLLHTVPV+YEKYED++D+F EKA  E+KKQYAVFD     KVLS+IP+G LK 
Sbjct  226  SFETVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKVLKKVLSRIPKGALKK  285

Query  157  K  155
            K
Sbjct  286  K  286



>ref|XP_003569752.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=257

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M +K+ RLFGR++PVH VLGGGK AD+ LWRNKK S  VL GAT+IW+LFEV+EYHLL  
Sbjct  49   MKSKIYRLFGREKPVHSVLGGGKPADLVLWRNKKTSGVVLAGATSIWLLFEVMEYHLLNL  108

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LIL+LA LFLWSNA +FI KS P+IPEV IPE+  +  A +LR ++N   + LRDI
Sbjct  109  VCHCLILSLATLFLWSNACTFINKSPPNIPEVKIPEDLTVNIALSLRYEINRGFSTLRDI  168

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
              GRDLK FL+VI  LW++S++G+CC+FLTL YI  V+L+TVPVLYEKYED+VDAF EKA
Sbjct  169  GHGRDLKKFLIVIASLWVLSVLGNCCNFLTLSYIVFVVLYTVPVLYEKYEDKVDAFGEKA  228

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M ELKK YA+F+ K LSKIP+G LK+KK
Sbjct  229  MIELKKYYAIFEEKCLSKIPKGHLKNKK  256



>gb|KDO56850.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=287

 Score =   268 bits (684),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 147/241 (61%), Positives = 176/241 (73%), Gaps = 36/241 (15%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            +KV RLFGR++P+H VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VC
Sbjct  46   SKVFRLFGREKPIHHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVC  105

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  IL+LAVLFLWSNAS+FI KS P IP V +PE+ VL+FASALR ++N  LAVLR+IAS
Sbjct  106  HISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIAS  165

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIA---------------------------  311
            GRDLK FL VI GLW++SIVG+ C+F+TLFYI                            
Sbjct  166  GRDLKKFLGVIAGLWLLSIVGNWCNFVTLFYIGKKHSLVLMAYFLKWIVFLLKCLDLLYG  225

Query  310  -----VVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA----KVLSKIPRGPLKD  158
                  VLLHTVPV+YEKYED++D+F EKA  E+KKQYAVFD     KVLS+IP+G LK 
Sbjct  226  SFETVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKVLKKVLSRIPKGALKK  285

Query  157  K  155
            K
Sbjct  286  K  286



>gb|KFK37395.1| hypothetical protein AALP_AA4G251600 [Arabis alpina]
Length=249

 Score =   266 bits (680),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +C
Sbjct  43   AKIYRLFGREKPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLC  102

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  ILAL  LFLWSNA +FIKKS P IPE+H+PEE  L  AS+LRN+VN    +LR IA 
Sbjct  103  HISILALGGLFLWSNAHTFIKKSPPQIPEIHVPEEAFLVIASSLRNEVNQAFVILRSIAL  162

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FLMVI GLWIIS+VG+  +FLTL YI  V+LHTVP++YEK+ED+VD FAEKAM 
Sbjct  163  GRDLKKFLMVIVGLWIISVVGNWFNFLTLVYICFVVLHTVPMMYEKHEDKVDPFAEKAMK  222

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDK  155
            EL+KQY VFD KV+SKIP   LK K
Sbjct  223  ELQKQYLVFDEKVISKIPIASLKAK  247



>ref|XP_009338786.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   266 bits (681),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 169/208 (81%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AKV R+FGR++PVH VLGGGK ADVFLWRNKK+S GVLGGAT +W+LFE+L+YHLLT 
Sbjct  52   VKAKVFRIFGREKPVHHVLGGGKSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTL  111

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            V H LI  LA+LFLWSNA +FI K+ P IPEV +PEEP LQ AS LR  +N   A+L  I
Sbjct  112  VAHILIATLAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASELRVVINCAFALLHSI  171

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL VI GLW++S+VG  C+FLTLFYI+ VLLHTVP +YEKYED++D  AEK 
Sbjct  172  ASGKDLKKFLAVIAGLWVLSVVGKWCNFLTLFYISFVLLHTVPFIYEKYEDKIDPLAEKV  231

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            + E KKQYAVFDAKVLSKIPRG LK+K+
Sbjct  232  IIEFKKQYAVFDAKVLSKIPRG-LKNKR  258



>ref|XP_009341126.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   266 bits (681),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 170/208 (82%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AKV R+FGR++PVH VLGGGK ADVFLWRNKK+S GVL G TAIW+LFE+LEYHLLT 
Sbjct  53   VKAKVFRIFGRERPVHHVLGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTL  112

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            V + LI ALA+LFLWSNA +FI K+ PHIP+VH+PEEP LQ AS LR  +N   A+L DI
Sbjct  113  VGYILICALAILFLWSNAHAFIHKTPPHIPKVHLPEEPFLQVASELRVQINCGFALLHDI  172

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++S+VG  C+FLTLFYI  VLLHTVPV+YEKYED++D  AEKA
Sbjct  173  ASGRDLKKFLAVIAGLWVLSVVGKWCNFLTLFYICFVLLHTVPVIYEKYEDKIDPLAEKA  232

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              E KKQYAVFDAKVLSKIP G LK K+
Sbjct  233  TIEFKKQYAVFDAKVLSKIPHG-LKSKR  259



>ref|XP_010518282.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   266 bits (680),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +C
Sbjct  47   AKIYRLFGREKPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLC  106

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  ILAL  LFLWSNA +FI K+ P IPEVH+PE+  L  AS+LRN++N    +LR IA 
Sbjct  107  HISILALGGLFLWSNAHTFINKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIAL  166

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FLMV+ GLWIIS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM 
Sbjct  167  GRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMK  226

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDK  155
            EL+KQY VFD KVLSKIP   LK K
Sbjct  227  ELQKQYVVFDEKVLSKIPVASLKAK  251



>emb|CDY10954.1| BnaA03g46130D [Brassica napus]
Length=270

 Score =   266 bits (681),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH 
Sbjct  65   VYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHV  124

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGR
Sbjct  125  MIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRVEINRGFSSLREIASGR  184

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL  I GLW++SI+G   +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM E+
Sbjct  185  DLKKFLTAIAGLWVMSILGGWFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIEI  244

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAV D KVLSKIP GPLK+KK
Sbjct  245  KKQYAVLDEKVLSKIPLGPLKNKK  268



>ref|XP_008375931.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=255

 Score =   266 bits (680),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 169/208 (81%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  KV R+FGR++PVH VLGGGK ADVFLWRNKK+S GVLGGAT +WILFE+LEY+LLT 
Sbjct  48   VKTKVFRIFGREKPVHHVLGGGKTADVFLWRNKKVSGGVLGGATVVWILFELLEYNLLTL  107

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            V H LI  LA+LFLWSNA +FI K+ P IPEV +PEEP LQ AS LR  +N   A+L +I
Sbjct  108  VAHILIATLAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASELRVVINCAFALLHNI  167

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL VI GLW++S+VG  C+FLTLFYI+ VLLHTVPV+YEKYED++D  AEK 
Sbjct  168  ASGKDLKKFLAVIAGLWVLSVVGKWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPLAEKV  227

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              E KKQYAVFDAKVL+KIPRG LK+K+
Sbjct  228  TIEFKKQYAVFDAKVLNKIPRG-LKNKR  254



>ref|XP_008344578.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=260

 Score =   266 bits (680),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 168/208 (81%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AKV R+FGR++PVH VLGGGK ADVFLWRNKK+S GVL GAT IW+LFE+L+YHLLT 
Sbjct  53   VKAKVFRIFGRERPVHHVLGGGKXADVFLWRNKKVSAGVLSGATVIWVLFELLQYHLLTL  112

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            V H LI ALA+LFLWSNA +FI K+ P IPEV +PEEP LQ AS LR  +N   A+L DI
Sbjct  113  VGHILIGALAILFLWSNAHAFIHKTPPRIPEVRLPEEPFLQVASELRVQINCAFALLHDI  172

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++S+VG  C+FLTLFYI  V+LHTVPV+YEKYED++D  AE+A
Sbjct  173  ASGRDLKKFLAVIAGLWVLSVVGKWCNFLTLFYICFVVLHTVPVIYEKYEDKIDPLAERA  232

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              E KKQYA FDAKVLSKIP G LK+K+
Sbjct  233  TIEFKKQYAXFDAKVLSKIPHG-LKNKR  259



>ref|XP_010506615.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ R+FGR++PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +C
Sbjct  47   AKIYRMFGREKPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLC  106

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  ILAL  LFLWSNA +FI K+ P IPEVH+PE+  L  AS+LRN++N    +LR IA 
Sbjct  107  HISILALGGLFLWSNAHTFINKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIAL  166

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FLMV+ GLWIIS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM 
Sbjct  167  GRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMK  226

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDK  155
            EL+KQY VFD KVLSKIP   LK K
Sbjct  227  ELQKQYVVFDEKVLSKIPVASLKAK  251



>ref|XP_010508058.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=256

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ R+FGR++PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +C
Sbjct  48   AKIYRMFGREKPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLC  107

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  ILAL  LFLWSNA +FI K+ P IPEVH+PE+  L  AS+LRN++N    +LR IA 
Sbjct  108  HISILALGGLFLWSNAHTFINKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIAL  167

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FLMV+ GLWIIS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM 
Sbjct  168  GRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMK  227

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDK  155
            EL+KQY VFD KVLSKIP   LK K
Sbjct  228  ELQKQYVVFDEKVLSKIPVASLKAK  252



>ref|XP_010473658.1| PREDICTED: reticulon-like protein B3 isoform X3 [Camelina sativa]
Length=267

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 168/212 (79%), Gaps = 4/212 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  KV RLFGR+QPVHKV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT 
Sbjct  55   LKTKVYRLFGREQPVHKVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTL  114

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  IL LAVLFLWS+AS+FI K+ PHIPEVHIPEE VLQ AS LR ++N    VLRDI
Sbjct  115  FGHISILTLAVLFLWSSASTFIHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDI  174

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKY+D+VD F EKA
Sbjct  175  ASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKA  234

Query  235  MHELKKQYAVFD----AKVLSKIPRGPLKDKK  152
            M E+KKQY VFD    +KV+SKIP+G    KK
Sbjct  235  MREIKKQYVVFDEKVLSKVMSKIPKGAFYKKK  266



>ref|XP_010418453.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
 ref|XP_010473656.1| PREDICTED: reticulon-like protein B3 isoform X1 [Camelina sativa]
 ref|XP_010473657.1| PREDICTED: reticulon-like protein B3 isoform X2 [Camelina sativa]
Length=254

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 168/212 (79%), Gaps = 4/212 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  KV RLFGR+QPVHKV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT 
Sbjct  42   LKTKVYRLFGREQPVHKVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTL  101

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  IL LAVLFLWS+AS+FI K+ PHIPEVHIPEE VLQ AS LR ++N    VLRDI
Sbjct  102  FGHISILTLAVLFLWSSASTFIHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDI  161

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKY+D+VD F EKA
Sbjct  162  ASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKA  221

Query  235  MHELKKQYAVFD----AKVLSKIPRGPLKDKK  152
            M E+KKQY VFD    +KV+SKIP+G    KK
Sbjct  222  MREIKKQYVVFDEKVLSKVMSKIPKGAFYKKK  253



>ref|XP_010430525.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
Length=255

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 168/212 (79%), Gaps = 4/212 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  KV RLFGR+QPVHKV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT 
Sbjct  43   LKTKVYRLFGREQPVHKVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTL  102

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  IL LAVLFLWS+AS+FI K+ PHIPEVHIPEE VLQ AS LR ++N    VLRDI
Sbjct  103  FGHISILTLAVLFLWSSASTFIHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDI  162

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKY+D+VD F EKA
Sbjct  163  ASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKA  222

Query  235  MHELKKQYAVFD----AKVLSKIPRGPLKDKK  152
            M E+KKQY VFD    +KV+SKIP+G    KK
Sbjct  223  MREIKKQYVVFDEKVLSKVMSKIPKGAFYKKK  254



>ref|XP_011003673.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=251

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +KV RLFGR++PVHKVLGGGK ADVFLWRN KIS GVLGGAT +W+LFE+L YHL+T 
Sbjct  42   VKSKVFRLFGRERPVHKVLGGGKPADVFLWRNTKISAGVLGGATTVWVLFELLGYHLITL  101

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VC+  I  LAVLFLWSN S F+ K  P IPEV +PE+ V + ASALR ++N   AVL DI
Sbjct  102  VCYLSIFFLAVLFLWSNTSDFLNKPPPKIPEVVLPEQCVREVASALRIEINRGFAVLHDI  161

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK  L VI GLW++S++GSC + LTL YI+ VLLHTVPVLYEKYED+VDA++EK 
Sbjct  162  ASGRDLKKVLAVIAGLWVLSLIGSCINILTLLYISFVLLHTVPVLYEKYEDQVDAYSEKT  221

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              E+KKQYAVFD K LSKIP+G LK +K
Sbjct  222  WIEIKKQYAVFDEKYLSKIPKGALKGEK  249



>ref|XP_009137373.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=268

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH 
Sbjct  63   VYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHV  122

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGR
Sbjct  123  MIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRVEINRGFSSLREIASGR  182

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL  I GLW +SI+G   +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM E+
Sbjct  183  DLKKFLAAIAGLWFVSILGGWFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIEI  242

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAV D KVLSKIP GPLK+KK
Sbjct  243  KKQYAVLDEKVLSKIPLGPLKNKK  266



>ref|XP_006397801.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
 gb|ESQ39254.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
Length=253

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +C
Sbjct  47   AKIYRLFGREKPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLC  106

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  ILAL  LFLWSNA +FI K+ P IPEVH+PEE  L  AS+LRN++N    +LR IA 
Sbjct  107  HISILALGGLFLWSNAHTFINKTPPQIPEVHVPEEAFLTIASSLRNELNQAFVILRSIAL  166

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FLMV+ GLWIIS+VG+ C+FLTL YI  V+LHTVP++YEK+ED+VD  AEKAM 
Sbjct  167  GRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVVLHTVPMMYEKHEDKVDPLAEKAMK  226

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDK  155
            EL+KQY VFD KV+SKIP   LK K
Sbjct  227  ELQKQYLVFDEKVISKIPIASLKAK  251



>ref|XP_009345612.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009345624.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 170/208 (82%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AKV R+FGR++PVH VLGGGK ADVFLWRNKK+S GVL G TAIW+LFE+LEYHLLT 
Sbjct  53   VKAKVFRIFGRERPVHHVLGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTL  112

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            V + LI ALA+LFLWSNA +FI K+ PHIP+VH+PEEP LQ AS LR  +N   A+L DI
Sbjct  113  VGYILICALAILFLWSNAHAFIHKTPPHIPKVHLPEEPFLQVASELRVQINCGFALLHDI  172

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++S+VG  C+FLTLFYI  VLLHTVPV+YE+YED++D  AEKA
Sbjct  173  ASGRDLKKFLAVIAGLWVLSVVGKWCNFLTLFYICFVLLHTVPVIYERYEDKIDPLAEKA  232

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              E KKQYAVFDAKVLSKIP G LK K+
Sbjct  233  TIEFKKQYAVFDAKVLSKIPHG-LKSKR  259



>ref|XP_006294850.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
 gb|EOA27748.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
Length=255

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ R+FGR++PVHKVLGGGK ADVFLWR+KK+S  VLG AT IW+LFE++EYHLL+ +C
Sbjct  47   AKIYRMFGREKPVHKVLGGGKPADVFLWRDKKLSAAVLGVATVIWVLFELVEYHLLSLLC  106

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  ILAL  LFLWSNA +FI K++P IPE+H+PEE  L  AS+LRN++N    +LR IA 
Sbjct  107  HISILALGGLFLWSNAHTFINKTSPQIPEIHVPEEAFLVIASSLRNELNQAFVILRSIAL  166

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FLMV+ GLWIIS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM 
Sbjct  167  GRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMK  226

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDK  155
            EL+KQY VFD KVLSKIP   LK K
Sbjct  227  ELQKQYVVFDEKVLSKIPVASLKAK  251



>ref|XP_006391670.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
 gb|ESQ28956.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
Length=256

 Score =   265 bits (676),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 168/212 (79%), Gaps = 4/212 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M  K+ RLFGR++PVHKV GGGK AD+FLWRNKK+S GVLG AT  W+LFE+LEY+LLT 
Sbjct  44   MKKKIYRLFGREKPVHKVFGGGKPADIFLWRNKKVSGGVLGVATISWVLFELLEYNLLTL  103

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  ILALA LFLWS+A +FI K+ PHIPE+HIPEE VLQ AS LR ++N     LRDI
Sbjct  104  FGHITILALACLFLWSSAITFIHKTPPHIPEIHIPEEVVLQLASGLRIEINRGFTTLRDI  163

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL+VI GLW++SIVGS C+FLTL YIA +LL TVPVLYEKYED+VD F EKA
Sbjct  164  ASGRDLKKFLLVIAGLWLLSIVGSSCNFLTLIYIATILLFTVPVLYEKYEDKVDDFGEKA  223

Query  235  MHELKKQYAVFD----AKVLSKIPRGPLKDKK  152
            M E+KKQYAVFD    +KV+SKIPRG    KK
Sbjct  224  MKEIKKQYAVFDEKVLSKVMSKIPRGAFNKKK  255



>ref|XP_004298843.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=246

 Score =   264 bits (675),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 166/209 (79%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            M  KV R+FGR++PVH V GGGK AD+FLWR+KK+S G+LGGAT +W+LFE+LEYHLLT 
Sbjct  38   MQDKVFRIFGRERPVHHVFGGGKLADIFLWRDKKLSGGILGGATVMWLLFELLEYHLLTL  97

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            V H LI A+ + FLWSN   FI KS P IPE+ IPE+ +LQ  S++  ++N  L V+RDI
Sbjct  98   VAHVLIAAITLFFLWSNGLGFINKSPPKIPEIQIPEKTLLQIVSSITFEINRALVVIRDI  157

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL VI GLW++SI+G  C+FLTL YIA+VLL +VPV YEKY+ ++D  AEKA
Sbjct  158  ASGKDLKQFLSVIAGLWVVSILGKSCNFLTLLYIAIVLLFSVPVFYEKYDHKIDPLAEKA  217

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
            M E+KKQYAVFDAKVLSKIPRG LK KK+
Sbjct  218  MFEIKKQYAVFDAKVLSKIPRGALKAKKI  246



>ref|NP_198975.1| reticulon-like protein B4 [Arabidopsis thaliana]
 sp|Q9FFS0.1|RTNLD_ARATH RecName: Full=Reticulon-like protein B4; Short=AtRTNLB4; AltName: 
Full=VirB2-interacting protein 3 [Arabidopsis thaliana]
 dbj|BAB11466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59673.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15269.1| AT5g41600/MBK23_13 [Arabidopsis thaliana]
 gb|AAN12890.1| unknown protein [Arabidopsis thaliana]
 gb|AED94696.1| reticulon-like protein B4 [Arabidopsis thaliana]
Length=257

 Score =   264 bits (675),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 168/208 (81%), Gaps = 4/208 (2%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            + RLFGR++PVHKVLGGGK AD+FLWRNKK+S GVLG  TA W+LFE+ EYHLL  +CH 
Sbjct  49   IYRLFGREKPVHKVLGGGKPADIFLWRNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHF  108

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
             I ALA LFLWSNA +FI KS PHIPEVHIPE+P+LQ  S LR ++N  L +LR+IASG+
Sbjct  109  AIFALAALFLWSNACTFIHKSTPHIPEVHIPEDPILQLVSGLRIEINRGLTLLRNIASGK  168

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            D+K F++VI GLW++SI+GSC +FLTLFY A VLL T+PVLYEKYED+VDA+ EKAM E+
Sbjct  169  DVKKFILVIAGLWVLSIIGSCYNFLTLFYTATVLLFTIPVLYEKYEDKVDAYGEKAMREI  228

Query  223  KKQYAVFDAKVL----SKIPRGPLKDKK  152
            KKQYAV D KVL    SKIPRG L  KK
Sbjct  229  KKQYAVLDEKVLRKVISKIPRGALNKKK  256



>emb|CDY05135.1| BnaC03g29330D [Brassica napus]
Length=313

 Score =   266 bits (680),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGAT  W+LFE++EYHLLT +CH 
Sbjct  108  VYRLFGRERPVHKVLGGGKPADIFMWKNKKVSGGVLGGATVAWVLFELMEYHLLTLLCHV  167

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ LA LFLWSNA+ FI+KS P IPEVHIPE+P+LQ AS LR ++N   + L +IASGR
Sbjct  168  MIVTLAALFLWSNATMFIRKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGR  227

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL  + GLWI+SI+G CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM EL
Sbjct  228  DLKKFLSALFGLWILSILGGCCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAEL  287

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            K QYAV DAKVLSKIPR   K+KK
Sbjct  288  KNQYAVLDAKVLSKIPRWTSKNKK  311



>emb|CDY25557.1| BnaC09g11820D [Brassica napus]
Length=251

 Score =   263 bits (673),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 169/212 (80%), Gaps = 4/212 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  K+ RLFGR++PVHKV GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT 
Sbjct  39   IKTKIYRLFGREKPVHKVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTL  98

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  ILALAVLFLWS+A++FI K+ PHIPEVHIPE+ VLQ AS LRN++N    +LR+I
Sbjct  99   FGHISILALAVLFLWSSATTFIHKTPPHIPEVHIPEDVVLQLASGLRNEINRGFTLLRNI  158

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A GRDLK FLMV+ GLW++S VGS C+FLTL YIA VLL TVPVLYEKYED+VD F EKA
Sbjct  159  ALGRDLKKFLMVVAGLWVLSKVGSSCNFLTLIYIATVLLFTVPVLYEKYEDKVDDFGEKA  218

Query  235  MHELKKQYAVFD----AKVLSKIPRGPLKDKK  152
            M E+KKQYAV D    +KV+SKIPRG    KK
Sbjct  219  MKEIKKQYAVLDEKVLSKVMSKIPRGAFNKKK  250



>ref|XP_009142682.1| PREDICTED: reticulon-like protein B5 [Brassica rapa]
 emb|CDX79993.1| BnaA05g01630D [Brassica napus]
Length=251

 Score =   263 bits (673),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +C
Sbjct  45   AKIYRLFGREKPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLC  104

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  ILAL  LFLWSNA +FIKKS P IPE+H+PEEP L  AS+LRN++N    +LR IA 
Sbjct  105  HVSILALGGLFLWSNAHTFIKKSPPQIPEIHVPEEPFLLIASSLRNELNQGFVILRSIAL  164

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FLMV+ GLWIIS+VG+ C+FLTL YI  VLLHTVP++YEK+ED+VD FAEKA  
Sbjct  165  GRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVLLHTVPMMYEKHEDKVDPFAEKAFK  224

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDK  155
            EL K Y VFD KV+SKIP   LK K
Sbjct  225  ELHKHYLVFDEKVVSKIPIASLKAK  249



>ref|XP_004306726.1| PREDICTED: reticulon-like protein B5 [Fragaria vesca subsp. vesca]
Length=257

 Score =   263 bits (673),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            KV RLFGR++PVH VLGGGK ADVFLWRNKKIS GVLGGAT +++LFE++EYHLLT +CH
Sbjct  52   KVFRLFGRERPVHHVLGGGKPADVFLWRNKKISAGVLGGATVVYVLFELVEYHLLTLICH  111

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LI ALAV+FLWSNA +   K+APHIPEV +PEEP LQ AS LR  +N   A+L +IASG
Sbjct  112  ILIGALAVMFLWSNAHTIFHKTAPHIPEVSLPEEPFLQVASELRLQINWAFALLHNIASG  171

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            R+LK FL+VI GLW++SIVGS C+FLTLFYI  VLLHTVPVLYEKYE +VD  AEKA  E
Sbjct  172  RELKKFLIVIAGLWVLSIVGSWCNFLTLFYITFVLLHTVPVLYEKYEHKVDPLAEKATIE  231

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKK  152
            +KKQY VFDAKV++K+    LK+K+
Sbjct  232  MKKQYGVFDAKVVTKVRETVLKNKR  256



>gb|KHN29299.1| Reticulon-like protein B5 [Glycine soja]
Length=250

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            +V RLFGR++PVH V G GK ADV LWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH
Sbjct  45   RVFRLFGRERPVHSVFGAGKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCH  104

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LIL LAVLFLWSNA +FI KS P IPEVH+PEEP  Q ASALR ++N   A+L  I SG
Sbjct  105  ILILLLAVLFLWSNAHTFIHKSPPRIPEVHLPEEPFQQVASALRIEINRGFAILHSIGSG  164

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RDLK FL++I G+WI+SIVG+ C+FLTLFYI  VLLHTVPVLYEKYED++D  AEKA+ E
Sbjct  165  RDLKKFLVIIAGVWILSIVGNWCNFLTLFYITFVLLHTVPVLYEKYEDKIDPLAEKAVIE  224

Query  226  LKKQYAVFDAKVLSKIPRGPLKDK  155
            +KKQY VFDAKVLSKIP GPLK K
Sbjct  225  IKKQYVVFDAKVLSKIPLGPLKAK  248



>gb|KHN40449.1| Reticulon-like protein B5 [Glycine soja]
Length=259

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            KV RLFGR++PVH V G GK ADV LWRNKKIS G+LGGATA+W+LFE+LEYHLLT VCH
Sbjct  54   KVFRLFGRERPVHSVFGAGKPADVLLWRNKKISAGMLGGATAVWVLFELLEYHLLTLVCH  113

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LIL LAVLFLWSNA +FI KS P IPE H+PEEP LQ ASALR +VN   AVL  I SG
Sbjct  114  ILILLLAVLFLWSNAHTFIHKSPPRIPEFHLPEEPFLQVASALRIEVNRGFAVLHSIGSG  173

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RDLK FL+VI  +WI+SIVG+ C+FLTLFYI  +LLHTVPVLYEKY+D++D  AEKA+ E
Sbjct  174  RDLKKFLVVIASVWILSIVGNWCNFLTLFYITFILLHTVPVLYEKYDDKIDPLAEKAVIE  233

Query  226  LKKQYAVFDAKVLSKIPRGPLKDK  155
            +KKQYAVFDAKVLSKIP GPLK K
Sbjct  234  IKKQYAVFDAKVLSKIPLGPLKAK  257



>ref|NP_001240231.1| uncharacterized protein LOC100778096 [Glycine max]
 gb|ACU20901.1| unknown [Glycine max]
Length=259

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            KV RLFGR++PVH V G GK ADV LWRNKKIS G+LGGATA+W+LFE+LEYHLLT VCH
Sbjct  54   KVFRLFGRERPVHSVFGAGKPADVLLWRNKKISAGMLGGATAVWVLFELLEYHLLTLVCH  113

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LIL LAVLFLWSNA +FI KS P IPE H+PEEP LQ ASALR +VN   AVL  I SG
Sbjct  114  ILILLLAVLFLWSNAHTFIHKSPPRIPEFHLPEEPFLQVASALRIEVNRGFAVLHSIGSG  173

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RDLK FL+VI  +WI+SIVG+ C+FLTLFYI  +LLHTVPVLYEKY+D++D  AEKA+ E
Sbjct  174  RDLKKFLVVIASVWILSIVGNWCNFLTLFYITFILLHTVPVLYEKYDDKIDPLAEKAVIE  233

Query  226  LKKQYAVFDAKVLSKIPRGPLKDK  155
            +KKQYAVFDAKVLSKIP GPLK K
Sbjct  234  IKKQYAVFDAKVLSKIPLGPLKAK  257



>dbj|BAH57206.1| AT1G64090 [Arabidopsis thaliana]
Length=240

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 165/206 (80%), Gaps = 4/206 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  K+ RLFGR+QP+HK+ GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT 
Sbjct  26   LKTKIYRLFGREQPLHKLFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTL  85

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  ILALAVLFLWS+AS+FI KS  HIPEVHIPE+ VLQ AS LR ++N    VLRDI
Sbjct  86   FGHISILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDI  145

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKA
Sbjct  146  ASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKA  205

Query  235  MHELKKQYAVFD----AKVLSKIPRG  170
            M E+KKQY  FD    +KV+SKIP+G
Sbjct  206  MREIKKQYVEFDVKVLSKVMSKIPKG  231



>ref|XP_008377768.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 166/209 (79%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +KV RLFGR++PVH V GGGK ADVFLWR+KK S GVL   T IW+ FE+ EYHLLT 
Sbjct  50   LKSKVNRLFGREKPVHHVFGGGKAADVFLWRDKKASAGVLIALTIIWVFFELFEYHLLTL  109

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            V H LIL +A LFLWSNAS+FI KS PHIP+V IPE+ VLQ AS +  ++N    +LR+I
Sbjct  110  VSHLLILGIASLFLWSNASTFINKSPPHIPQVQIPEKLVLQIASVITLEINRAFVILREI  169

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL VI GLW++SI+G   +FLTL YIAVVLL T+PV YEKY+D+VDA AEKA
Sbjct  170  ASGKDLKQFLSVIAGLWVVSILGKWYNFLTLVYIAVVLLFTLPVFYEKYDDQVDAVAEKA  229

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
            + E+KKQYAVFDAKV+SKIPRG LKDKK 
Sbjct  230  LIEIKKQYAVFDAKVMSKIPRGQLKDKKF  258



>emb|CDX90792.1| BnaA03g24720D [Brassica napus]
Length=267

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGAT  W+LFE+LEYHLLT +CH 
Sbjct  62   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVLGGATVAWVLFELLEYHLLTLLCHV  121

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ALAVLFLWSNA+ FI KS P IPEVHIPE+P+LQ AS LR ++N   + L +IASGR
Sbjct  122  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGR  181

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK FL  + GLWI+SI+G CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM EL
Sbjct  182  DLKKFLSALFGLWILSILGGCCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAEL  241

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAV DAKVLSKIPRGPLKDKK
Sbjct  242  KKQYAVLDAKVLSKIPRGPLKDKK  265



>ref|NP_176592.1| reticulon-like protein B3 [Arabidopsis thaliana]
 sp|Q9SH59.1|RTNLC_ARATH RecName: Full=Reticulon-like protein B3; Short=AtRTNLB3 [Arabidopsis 
thaliana]
 gb|AAF24576.1|AC007764_18 F22C12.15 [Arabidopsis thaliana]
 gb|AAL36421.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51418.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99051.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34190.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=255

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 165/206 (80%), Gaps = 4/206 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  K+ RLFGR+QP+HK+ GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT 
Sbjct  41   LKTKIYRLFGREQPLHKLFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTL  100

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  ILALAVLFLWS+AS+FI KS  HIPEVHIPE+ VLQ AS LR ++N    VLRDI
Sbjct  101  FGHISILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDI  160

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKA
Sbjct  161  ASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKA  220

Query  235  MHELKKQYAVFD----AKVLSKIPRG  170
            M E+KKQY  FD    +KV+SKIP+G
Sbjct  221  MREIKKQYVEFDVKVLSKVMSKIPKG  246



>ref|XP_002887921.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64180.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 168/212 (79%), Gaps = 4/212 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  K+ RLFGR+QP+HKV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT 
Sbjct  42   LKTKIYRLFGREQPLHKVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTL  101

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  ILALAVLFLWS+A++FI KS PHIPEVHIPEE VL+ AS LR ++N    VLRDI
Sbjct  102  FGHISILALAVLFLWSSATTFIHKSPPHIPEVHIPEEVVLELASGLRIEINRGFTVLRDI  161

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL+VI GLW++S +GS C+FLTL YIA VLL T+PVLYEKYED+VD F EKA
Sbjct  162  ASGRDLKKFLLVIAGLWVLSKLGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKA  221

Query  235  MHELKKQYAVFD----AKVLSKIPRGPLKDKK  152
            M E+KKQY  FD    +KV+SKIP+G    KK
Sbjct  222  MREIKKQYVEFDVKVLSKVMSKIPKGAFYKKK  253



>emb|CDY24806.1| BnaA08g15040D [Brassica napus]
Length=274

 Score =   263 bits (671),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++PVHKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH 
Sbjct  69   VYRLFGREKPVHKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHV  128

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEPVLQ AS LR ++N     LR+IASGR
Sbjct  129  MIVVLAVLFLWSNATMFIHKSPPKIPEVHIPEEPVLQLASGLRIEINRGFYSLREIASGR  188

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK F+  I GLW++SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+
Sbjct  189  DLKKFISAIAGLWVLSILGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEI  248

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAV D KVLSKIP GPLK+KK
Sbjct  249  KKQYAVLDEKVLSKIPLGPLKNKK  272



>ref|XP_009395750.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=253

 Score =   262 bits (669),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 158/209 (76%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVHKVLGGGK ADVFLWRNKK+S    G  TAIW+ FE++EYHL+T 
Sbjct  44   VKAKIYRLFGREKPVHKVLGGGKPADVFLWRNKKVSASTFGAVTAIWVFFELMEYHLITL  103

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCHGLIL+LA++FLW NA++FI KS PH+PEV I E+  L    +LR  +N  L  LRDI
Sbjct  104  VCHGLILSLAIIFLWCNATTFISKSRPHVPEVSISEDLALNVVLSLRYVINRGLVALRDI  163

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL     LW++SI+ +CC FL LFYIA V L+TVPVLYEKYED VDAFAEKA
Sbjct  164  ASGRDLKKFLAAAAALWVLSIIANCCSFLMLFYIAFVALYTVPVLYEKYEDRVDAFAEKA  223

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
              E KK Y V   K LSKIP GPLKDKK 
Sbjct  224  EAEFKKHYVVIHVKYLSKIPMGPLKDKKF  252



>emb|CDY42012.1| BnaC04g00900D [Brassica napus]
Length=251

 Score =   261 bits (668),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +C
Sbjct  45   AKIYRLFGREKPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLC  104

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  ILAL  LFLWSNA +FIKKS P IPE+H+PEEP L  AS+LRN++N    +LR IA 
Sbjct  105  HVSILALGGLFLWSNAHTFIKKSPPQIPEIHVPEEPFLLIASSLRNELNQGFVILRSIAL  164

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FLM++ GLWIIS+VG+ C+FLTL YI  VLLHTVP++YEK+ED+VD FAEKA  
Sbjct  165  GRDLKKFLMIVVGLWIISVVGNWCNFLTLVYICFVLLHTVPMMYEKHEDKVDPFAEKAFK  224

Query  229  ELKKQYAVFDAKVLSKIPRGPLK  161
            EL K Y VFD KV+SKIP   LK
Sbjct  225  ELHKHYLVFDEKVVSKIPIASLK  247



>ref|XP_007139767.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
 gb|ESW11761.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
Length=256

 Score =   262 bits (669),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            KV RLFGR++PVH VLG GK ADV LWRNKKIS GVLGGATA+W+LFE+LEYH LT VCH
Sbjct  51   KVFRLFGRERPVHSVLGAGKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHFLTLVCH  110

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LIL LAVLFLWSNA +FI KS P IP+VH+PEEP+LQ AS LR ++N   AVL  I SG
Sbjct  111  ILILLLAVLFLWSNAHTFIHKSPPRIPDVHLPEEPILQVASVLRIEINRGFAVLHSIGSG  170

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RDLK FLMVI G+WI+SIVG+ C+FLTLFYI  +LLHT PVLYEKYED++D  AEKA+ E
Sbjct  171  RDLKKFLMVIAGVWILSIVGNWCNFLTLFYITFILLHTTPVLYEKYEDKIDPLAEKAVIE  230

Query  226  LKKQYAVFDAKVLSKIPRGPLKDK  155
            +KKQYAVFDAKVLSKIP G LK K
Sbjct  231  IKKQYAVFDAKVLSKIPVGLLKAK  254



>emb|CDM81762.1| unnamed protein product [Triticum aestivum]
Length=253

 Score =   261 bits (668),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 168/206 (82%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT V 
Sbjct  47   AKIYRLFGREKPVHAVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVG  106

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LIL+LA LFL+SN   F+ KS P+IPEV IPE+  +  A +LR+++N     LR+I  
Sbjct  107  HCLILSLATLFLYSNVCIFVHKSPPNIPEVKIPEDMTVNIALSLRHEINRGFFTLREIGH  166

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FL+VI GLW++S++GSCC+FLTL YI  V+L+TVPVLYEKY+D+VDAF EKAM 
Sbjct  167  GRDLKKFLIVIGGLWVLSVLGSCCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMI  226

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            ELKK YA+F+ KVLSKIP+G LK+KK
Sbjct  227  ELKKYYAIFEEKVLSKIPKGALKNKK  252



>emb|CDY41666.1| BnaC03g62180D [Brassica napus]
Length=276

 Score =   262 bits (670),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            V RLFGR++PVHKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH 
Sbjct  71   VYRLFGREKPVHKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHV  130

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
            +I+ LAVLFLWSN + FI KS P IP+VHIPEEPVLQ AS LR ++N   + LR+IASGR
Sbjct  131  MIVVLAVLFLWSNVTRFIHKSPPKIPQVHIPEEPVLQLASGLRIEINRGFSSLREIASGR  190

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK F+  I GLW++SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+
Sbjct  191  DLKKFISAIAGLWVLSILGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEI  250

Query  223  KKQYAVFDAKVLSKIPRGPLKDKK  152
            KKQYAV D KVLSKIP GPLK+KK
Sbjct  251  KKQYAVLDEKVLSKIPLGPLKNKK  274



>ref|XP_002880222.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56481.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   261 bits (668),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 166/207 (80%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ 
Sbjct  45   VKAKIYRLFGREKPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            +CH  ILAL  LFLWSN  +FI K++P IPE+H+PEE  L  AS+LRN++N    +LR I
Sbjct  105  LCHISILALGGLFLWSNVHTFINKASPQIPEIHVPEEAFLVIASSLRNELNQAFVILRSI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A GRDLK FLMV+ GLWIIS+VG+ C+FLTL Y   V+LHTVP+LYEK+ED+VD  AEKA
Sbjct  165  ALGRDLKKFLMVVVGLWIISVVGNWCNFLTLVYFCFVILHTVPMLYEKHEDKVDPLAEKA  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDK  155
            + EL+KQY VFD KVLSKIP   LK K
Sbjct  225  LKELQKQYVVFDEKVLSKIPIASLKAK  251



>emb|CDY52012.1| BnaC06g42920D [Brassica napus]
Length=254

 Score =   261 bits (667),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 164/207 (79%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ 
Sbjct  46   LKAKIYRLFGREKPVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSL  105

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI +LA +FLWSNA +F+KKS P IPEVH+ EE  L  ASALRN++N    +LR I
Sbjct  106  VCHILIFSLAAMFLWSNAHAFMKKSPPKIPEVHVKEEHFLLIASALRNELNQAFVILRSI  165

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A GRDLK FLMV+ GLWIIS+VG+  +FLTL YI  V+LHTVP+LYEK+ED+VD  AEK 
Sbjct  166  ALGRDLKKFLMVVVGLWIISVVGNWFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKT  225

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDK  155
            + ELKK Y VFD KVLSKIP   LK K
Sbjct  226  LKELKKHYMVFDEKVLSKIPLASLKAK  252



>ref|XP_008367699.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   261 bits (667),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 167/209 (80%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +KV RLFGR++PVH V GGGK AD+FLWR KK+S GVL   T IW+ FE+LEYHLLT 
Sbjct  50   LKSKVNRLFGREKPVHHVFGGGKAADIFLWRGKKVSAGVLIALTIIWVFFELLEYHLLTL  109

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            V H LI+ + +LFLWSNAS+FI KS PHIP+V IPE+PVLQ ASA+ +++N    ++R+I
Sbjct  110  VSHLLIIGIVMLFLWSNASTFINKSPPHIPQVQIPEKPVLQIASAITSEINRAFVIVREI  169

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL  I GLW++SI+G   +FLTL YIAVVLL T+PV YEKY+D+VDA AEKA
Sbjct  170  ASGKDLKQFLSAIAGLWVVSILGKYYNFLTLVYIAVVLLFTLPVFYEKYDDQVDAVAEKA  229

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
            + E+KKQYAVFDAKVLSKIPRG  K KK 
Sbjct  230  LTEMKKQYAVFDAKVLSKIPRGQTKAKKF  258



>ref|XP_009334492.1| PREDICTED: reticulon-like protein B2 [Pyrus x bretschneideri]
Length=258

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 166/209 (79%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + +KV RLFGR++PVH V GGGK ADVFLWR+KK S GVL   T IW+ FE+ EYHLLT 
Sbjct  50   LKSKVNRLFGREKPVHHVFGGGKAADVFLWRDKKASAGVLIALTIIWVFFELFEYHLLTL  109

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            V H LIL +A LFLWSNAS+FI KS PHIP+V IPE+PVLQ AS +  ++N    +LR+I
Sbjct  110  VSHLLILGIASLFLWSNASTFINKSPPHIPQVQIPEKPVLQIASVITMEINRAFVILREI  169

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL VI GLW++SI+G   +FLTL YI VVLL T+PV YEKY+D+VDA AEKA
Sbjct  170  ASGKDLKQFLSVIAGLWVVSILGKWYNFLTLVYIVVVLLFTLPVFYEKYDDQVDAVAEKA  229

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
            + E+KKQYAVFDAKV+SKIPRG LKDKK 
Sbjct  230  LIEIKKQYAVFDAKVMSKIPRGQLKDKKF  258



>ref|XP_010671578.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=286

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 168/207 (81%), Gaps = 0/207 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            K+ RLFGRQ+PVHKVLGGGK ADV LWRNKKIS   LG AT IW LFE+LEYHLLT +CH
Sbjct  80   KIYRLFGRQKPVHKVLGGGKPADVLLWRNKKISASALGVATVIWFLFELLEYHLLTLLCH  139

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LI  LAVLFLWSNAS+FI K+ P IP+VHIP+  +L+F S LR ++N  L+VLRDIASG
Sbjct  140  ILIFTLAVLFLWSNASAFIHKAPPRIPDVHIPDNALLEFISVLRFEINRALSVLRDIASG  199

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            ++LK F  VI GLW++S+VGS  +FLTL Y+  VLLHTVPVLYEKYED VDAFAEKA  E
Sbjct  200  KELKKFFGVIAGLWVVSVVGSWFNFLTLVYLLFVLLHTVPVLYEKYEDHVDAFAEKAAIE  259

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKKLA  146
            LKKQYAV D K LSKIPRGPLKDKK A
Sbjct  260  LKKQYAVADEKFLSKIPRGPLKDKKSA  286



>ref|XP_007040378.1| Reticulan like protein B3, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOY24879.1| Reticulan like protein B3, putative isoform 3, partial [Theobroma 
cacao]
Length=277

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + + V RLFGR++PVH+VLGGGK AD+FLWRNKKIS G LG AT IW+LFE+LEY+LLT 
Sbjct  43   IKSNVFRLFGREKPVHQVLGGGKPADIFLWRNKKISAGALGVATVIWVLFELLEYYLLTL  102

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALA+LFLWSNA++FI KS P IPEV IP+EPVL+FA ALR ++N   AVLRDI
Sbjct  103  VCHLLILALAILFLWSNATTFINKSPPRIPEVQIPKEPVLEFAQALRFEINRAFAVLRDI  162

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++SIVGS C+FLTLFYI  VLLH+VPVLYEKYED+VD+F+EKA
Sbjct  163  ASGRDLKKFLSVIAGLWVLSIVGSWCNFLTLFYIVFVLLHSVPVLYEKYEDKVDSFSEKA  222

Query  235  MHELKKQYAVFDAKVLSKIPRGPLK  161
            MHE+KKQYAVFDAKVLSKIPRGPL 
Sbjct  223  MHEIKKQYAVFDAKVLSKIPRGPLN  247



>ref|XP_002301382.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
 gb|EEE80655.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
Length=251

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 171/209 (82%), Gaps = 0/209 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVH VLGGGK ADVFLWRNKK+S GVLG  TA+W+LFE++EYHLLT 
Sbjct  43   VKAKIWRLFGREKPVHHVLGGGKPADVFLWRNKKVSAGVLGFVTAMWVLFELIEYHLLTL  102

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILA A+LFLWSNA + I KS P IPEVH+PE+ VLQ ASAL  ++N   A LR +
Sbjct  103  VCHILILAAALLFLWSNACTLINKSPPRIPEVHLPEKLVLQVASALCVEINSAFAGLRSV  162

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A+G+D K FLM+I GLW++SIVGS C FLTLFYI  VLLHTVPVLYEKYED+VD  AEKA
Sbjct  163  AAGKDFKKFLMIIAGLWVLSIVGSSCHFLTLFYICFVLLHTVPVLYEKYEDKVDPLAEKA  222

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  149
            M E+KKQYAVFDAKVLSKIP   LK K++
Sbjct  223  MVEIKKQYAVFDAKVLSKIPVASLKAKRV  251



>ref|XP_009104316.1| PREDICTED: reticulon-like protein B6 [Brassica rapa]
 emb|CDY53913.1| BnaA07g38210D [Brassica napus]
Length=254

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 162/207 (78%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ 
Sbjct  46   LKAKIYRLFGREKPVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSL  105

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI +LA +FLWSNA +F+KKS P IPE+ + EE  L  ASALRN++N    +LR I
Sbjct  106  VCHILIFSLAAMFLWSNAHAFMKKSPPKIPEIQVKEEHFLLIASALRNELNQAFVILRSI  165

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A GRDLK FLMV+ GLWIIS+VG+  +FLTL YI  V+LHTVP+LYEK+ED+VD  AEK 
Sbjct  166  ALGRDLKKFLMVVVGLWIISVVGNWFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKT  225

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDK  155
            + ELKK Y VFD KVLSKIP   LK K
Sbjct  226  LKELKKHYMVFDEKVLSKIPLASLKAK  252



>ref|NP_001239653.1| uncharacterized protein LOC100793862 [Glycine max]
 gb|ACU21118.1| unknown [Glycine max]
Length=257

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            +V RLFGR++PVH V G GK ADV LWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH
Sbjct  52   RVFRLFGRERPVHSVFGAGKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCH  111

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LIL LAVLFLWSNA +FI KS P IPEVH+PEEP  Q ASALR ++N   A+L  I SG
Sbjct  112  ILILLLAVLFLWSNAHTFIHKSPPRIPEVHLPEEPFQQVASALRIEINRGFAILHSIGSG  171

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RDLK FL++I G+WI+SIVG+ C+FLTLFYI  VL HTVPVLYEKYED++D  AEKA+ E
Sbjct  172  RDLKKFLVIIAGVWILSIVGNWCNFLTLFYITFVLSHTVPVLYEKYEDKIDPLAEKAVIE  231

Query  226  LKKQYAVFDAKVLSKIPRGPLKDK  155
            +KKQY VFDAKVLSKIP GPLK K
Sbjct  232  IKKQYVVFDAKVLSKIPLGPLKAK  255



>ref|XP_006302727.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
 gb|EOA35625.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
Length=253

 Score =   259 bits (663),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 164/206 (80%), Gaps = 4/206 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  K+ RLFGR+QPVHK+ GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT 
Sbjct  40   LKTKIYRLFGREQPVHKIFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTL  99

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  IL LAVLFLWS+A++FI K+ PHIPEVHIPEE VLQ AS LR ++N     LRDI
Sbjct  100  FGHISILTLAVLFLWSSATTFIHKTPPHIPEVHIPEEVVLQLASGLRIEINRGFTALRDI  159

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKA
Sbjct  160  ASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKA  219

Query  235  MHELKKQYAVFD----AKVLSKIPRG  170
            M E+KKQY  FD    +KV+SKIP+G
Sbjct  220  MREIKKQYVEFDVKVLSKVMSKIPKG  245



>ref|XP_007040377.1| Reticulan like protein B3, putative isoform 2 [Theobroma cacao]
 gb|EOY24878.1| Reticulan like protein B3, putative isoform 2 [Theobroma cacao]
Length=291

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + + V RLFGR++PVH+VLGGGK AD+FLWRNKKIS G LG AT IW+LFE+LEY+LLT 
Sbjct  43   IKSNVFRLFGREKPVHQVLGGGKPADIFLWRNKKISAGALGVATVIWVLFELLEYYLLTL  102

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILALA+LFLWSNA++FI KS P IPEV IP+EPVL+FA ALR ++N   AVLRDI
Sbjct  103  VCHLLILALAILFLWSNATTFINKSPPRIPEVQIPKEPVLEFAQALRFEINRAFAVLRDI  162

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASGRDLK FL VI GLW++SIVGS C+FLTLFYI  VLLH+VPVLYEKYED+VD+F+EKA
Sbjct  163  ASGRDLKKFLSVIAGLWVLSIVGSWCNFLTLFYIVFVLLHSVPVLYEKYEDKVDSFSEKA  222

Query  235  MHELKKQYAVFDAKVLSKIPRGPLK  161
            MHE+KKQYAVFDAKVLSKIPRGPL 
Sbjct  223  MHEIKKQYAVFDAKVLSKIPRGPLN  247



>emb|CDY34396.1| BnaA09g11380D [Brassica napus]
Length=251

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 167/212 (79%), Gaps = 4/212 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  K+ RLFGR++PVHKV GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT 
Sbjct  39   IKTKIFRLFGREKPVHKVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTL  98

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  ILALAVLFLWS+A++FI K+ PHIPEVHIPEE VLQ AS LR ++N    +LR+I
Sbjct  99   FGHVSILALAVLFLWSSATTFIHKTPPHIPEVHIPEEVVLQLASGLRIEINRGFTILRNI  158

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A GRDLK FLMV+ GLW++S VGS C+FLTL YIA VLL TVPV YEKYED+VD F EKA
Sbjct  159  ALGRDLKKFLMVVAGLWVLSKVGSSCNFLTLIYIATVLLFTVPVFYEKYEDKVDHFGEKA  218

Query  235  MHELKKQYAVFD----AKVLSKIPRGPLKDKK  152
            M E+KKQYAV D    +KV+SKIPRG    KK
Sbjct  219  MKEIKKQYAVLDEKVLSKVMSKIPRGAFNKKK  250



>ref|XP_009349323.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   259 bits (662),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 166/208 (80%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AKV R+FGR++PVH VLGGGK ADVFLWRNKK+S GVLGGAT +W+LFE+L+YHLLT 
Sbjct  52   VKAKVFRIFGREKPVHHVLGGGKSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTL  111

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            V H LI  LA+LFLWSNA +FI K+ P IPEV +PEEP LQ AS LR  +N   A+L  I
Sbjct  112  VAHILIATLAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASELRVVINCSFALLHSI  171

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL VI GLW++S+VG  C+FLTLFYI+ VLLHTVP +YEKYED++D  AEK 
Sbjct  172  ASGKDLKKFLAVIAGLWVLSVVGKWCNFLTLFYISFVLLHTVPFIYEKYEDKIDPLAEKV  231

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
              E KKQY VFDAKVLSKIP G LK+K+
Sbjct  232  TIEFKKQYDVFDAKVLSKIPCG-LKNKR  258



>ref|XP_010447719.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   259 bits (661),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 170/208 (82%), Gaps = 4/208 (2%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            + RLFGR++PVHKVLGGGK AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH 
Sbjct  49   IYRLFGREKPVHKVLGGGKPADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHF  108

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
             + ALA LFLWSNA +FI KS PHIPEVHIPE+PVLQ  S LR ++N    VLR+IASGR
Sbjct  109  AMAALAALFLWSNACTFIHKSTPHIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGR  168

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK F++VI GLW++SI+GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+
Sbjct  169  DLKKFILVIAGLWVLSIIGSCCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEI  228

Query  223  KKQYAVFD----AKVLSKIPRGPLKDKK  152
            KKQYAV D    +KVLSKIPRG L  KK
Sbjct  229  KKQYAVLDEKVFSKVLSKIPRGALNKKK  256



>gb|KFK40472.1| hypothetical protein AALP_AA2G000200 [Arabis alpina]
Length=254

 Score =   259 bits (661),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 168/213 (79%), Gaps = 4/213 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  K+ RLFGR++PVHKV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT 
Sbjct  42   LKTKIYRLFGREKPVHKVFGGGKPADIFLWRNKKVSGGVLGAATISWILFELLEYNLLTL  101

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  ILALAVLFLWS+A++FI K+ PHIPE+HIPE+ VL+ AS LR ++N    VLR I
Sbjct  102  FGHVSILALAVLFLWSSATTFIHKTPPHIPEIHIPEKIVLELASGLRIEINRGFTVLRHI  161

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A GRDLK FLMV+ GLW++SI+GS C FLTL YIA V+L TVPVLYEKYED+VD F EKA
Sbjct  162  ALGRDLKKFLMVVAGLWVLSILGSSCTFLTLVYIATVILFTVPVLYEKYEDKVDDFGEKA  221

Query  235  MHELKKQYAVFD----AKVLSKIPRGPLKDKKL  149
            M E+KKQYAV D    +KV+SKIP G L  KKL
Sbjct  222  MKEIKKQYAVLDEKVLSKVMSKIPIGALMKKKL  254



>emb|CDY38194.1| BnaA09g11950D [Brassica napus]
Length=250

 Score =   258 bits (660),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 166/211 (79%), Gaps = 4/211 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  K+ RLFGR++PVHKV GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT 
Sbjct  39   IKTKIFRLFGREKPVHKVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTL  98

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  ILALAVLFLWS+A++FI K  PHIPEVHIPEE VLQ AS LR ++N    +LR+I
Sbjct  99   FGHVSILALAVLFLWSSATTFIHKKPPHIPEVHIPEEVVLQLASGLRIEINRGFTILRNI  158

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A GRDLK FLMV+ GLW++S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKA
Sbjct  159  ALGRDLKKFLMVVAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDHFGEKA  218

Query  235  MHELKKQYAVFD----AKVLSKIPRGPLKDK  155
            M E+KKQYAV D    +KV+SKIPRG    K
Sbjct  219  MKEIKKQYAVLDEKVLSKVMSKIPRGAFNKK  249



>gb|AFK42059.1| unknown [Lotus japonicus]
Length=258

 Score =   258 bits (660),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 165/208 (79%), Gaps = 4/208 (2%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            K+ RLFGR++P+H VLGGGK ADV LW+NKK+S G LG ATA+W+ FE+LEYHLLT VCH
Sbjct  49   KIFRLFGREKPLHSVLGGGKPADVLLWKNKKVSAGALGVATAVWLFFELLEYHLLTLVCH  108

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LIL++ +LFLWSNA + + K+ P IP  H+PEEP L+ ASALR ++NH  A LRDI +G
Sbjct  109  ILILSITLLFLWSNAHTLLHKAPPRIPVFHLPEEPFLEIASALRIEINHGFAALRDIGTG  168

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            +D+K FL+ I GLWI+SIVGS C+FLTLFYI  VLL T+P LY+KYED++D  AEKA HE
Sbjct  169  KDVKKFLIAIVGLWILSIVGSWCNFLTLFYINFVLLLTIPFLYDKYEDKIDPLAEKAAHE  228

Query  226  LKKQYAVFDA----KVLSKIPRGPLKDK  155
            +KKQY VFDA    KVLSKIP+G LK K
Sbjct  229  IKKQYVVFDAKVLSKVLSKIPKGLLKGK  256



>ref|NP_566065.1| reticulon-like protein B5 [Arabidopsis thaliana]
 sp|O82352.1|RTNLE_ARATH RecName: Full=Reticulon-like protein B5; Short=AtRTNLB5 [Arabidopsis 
thaliana]
 gb|AAC62889.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96651.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AAL69534.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AEC10651.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=255

 Score =   258 bits (660),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ R+FGR++PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +C
Sbjct  47   AKIYRMFGREKPVHKVLGGGKPADVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLC  106

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H  ILAL  LFLWSNA + I K++P IPE+H+PEE  L  AS+LRN++N    +LR IA 
Sbjct  107  HISILALGGLFLWSNAHTLINKTSPQIPEIHVPEEAFLVVASSLRNELNQAFVILRSIAL  166

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            GRDLK FLMV+ GLWIIS+VG+  +FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM 
Sbjct  167  GRDLKKFLMVVVGLWIISVVGNWFNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMK  226

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDK  155
            EL+KQY VFD KVLSKIP   LK K
Sbjct  227  ELQKQYVVFDEKVLSKIPIASLKAK  251



>ref|XP_006284372.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
 gb|EOA17270.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
Length=257

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 170/208 (82%), Gaps = 4/208 (2%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            + RLFGR++PVHKVLGGGK AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH 
Sbjct  49   IYRLFGREKPVHKVLGGGKPADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHF  108

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
             + ALA LFLWSNA +FI K+ PHIPEVHIPE+PVLQ  S LR ++N    VLR+IASGR
Sbjct  109  AMAALAALFLWSNACTFIHKATPHIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGR  168

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK F++VI GLWI+SI+GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+
Sbjct  169  DLKKFILVIAGLWILSILGSCCNFLTLFYIATVLLFTIPVIYEKYEDKVDAFGEKAMKEI  228

Query  223  KKQYAVFD----AKVLSKIPRGPLKDKK  152
            KKQYAV D    +KVLSKIPRG L  KK
Sbjct  229  KKQYAVLDEKVLSKVLSKIPRGALNKKK  256



>ref|XP_007209494.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
 gb|EMJ10693.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
Length=257

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 165/208 (79%), Gaps = 0/208 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK   LFGR++PVH V GGGK ADVFLWR+KK S  VL   T IW+ FE+L YHLLT 
Sbjct  49   LKAKAYSLFGREKPVHNVFGGGKAADVFLWRDKKGSASVLIAITIIWVFFELLGYHLLTL  108

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            + H LIL LA+LFLWSNAS+FI KS P IP+V IPE+PVLQ ASA+  ++N    +LR+I
Sbjct  109  MAHCLILVLAMLFLWSNASTFINKSPPRIPQVKIPEKPVLQIASAITIEINRAFVILREI  168

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            ASG+DLK FL VI GLW++SI+G   +FLTL YI VVLL T+PV YEKY+D+VDAFAEKA
Sbjct  169  ASGKDLKQFLSVIAGLWVLSILGKWYNFLTLVYIVVVLLFTLPVFYEKYDDQVDAFAEKA  228

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDKK  152
            M E+KKQYAVFDAKVLSK+P+G +KDKK
Sbjct  229  MIEIKKQYAVFDAKVLSKVPKGQMKDKK  256



>ref|XP_009112901.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=251

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 165/212 (78%), Gaps = 4/212 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  K+ RLFGR++PVHKV GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT 
Sbjct  39   IKTKIFRLFGREKPVHKVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTL  98

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  ILALAVLFLWS+A++FI K  PHIPEVHIPEE  LQ AS LR ++N    +LR+I
Sbjct  99   FGHVSILALAVLFLWSSATTFIHKKPPHIPEVHIPEEVALQLASGLRIEINRGFTILRNI  158

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A GR+LK FLMV+ GLW++S VGS C+FLTL YIA VLL TVPV YEKYED+VD F EKA
Sbjct  159  ALGRELKKFLMVVAGLWVLSKVGSSCNFLTLIYIATVLLFTVPVFYEKYEDKVDHFGEKA  218

Query  235  MHELKKQYAVFD----AKVLSKIPRGPLKDKK  152
            M E+KKQYAV D    +KV+SKIPRG    KK
Sbjct  219  MKEIKKQYAVLDEKVLSKVMSKIPRGAFNKKK  250



>gb|ACG32549.1| seed maturation protein [Zea mays]
Length=254

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ R+FGR++PVH VLGGGK AD+FLWRNK+IS GVL GATA W+LFEV++YHLLT +C
Sbjct  47   AKIYRIFGREKPVHSVLGGGKPADLFLWRNKRISGGVLAGATAFWLLFEVMDYHLLTLLC  106

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LIL LA+LFLWSNA++FI KS P+IPEV IP++  + FA +LR ++N   A LR+I  
Sbjct  107  HCLILTLAILFLWSNATTFINKSPPNIPEVKIPDDLAVNFARSLRYEINRGFATLREIGQ  166

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            G DLK FL+VI GLWI+S++GSCC+FLTL YI  ++L+TVPVLYEK+ED+VDAF EKAM 
Sbjct  167  GHDLKKFLIVIAGLWILSVLGSCCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKAMV  226

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            ELKK YA+FD K LSKIP+GPLKDKK
Sbjct  227  ELKKYYAIFDEKCLSKIPKGPLKDKK  252



>ref|XP_002441411.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
 gb|EES19841.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
Length=255

 Score =   257 bits (657),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ RLFGR++PVH VLGGGK AD+FLWRNK+IS GVL GATAIW+LFEV++YHLLT +C
Sbjct  48   AKIYRLFGREKPVHSVLGGGKPADLFLWRNKRISGGVLAGATAIWLLFEVMDYHLLTLLC  107

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LIL LA+LFLWSNA++FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  
Sbjct  108  HCLILTLAILFLWSNATTFINKSPPNIPEVKIPEDLAVNVARSLRYEINRGFATLREIGQ  167

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            G DLK FL+VI GLWI+S++GSCC+FLTL YI  ++L+TVPVLYEK+ED+VDAF EKAM 
Sbjct  168  GHDLKKFLIVIAGLWILSVLGSCCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKAMV  227

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            ELKK YA+FD K LSKIP+GPLKDKK
Sbjct  228  ELKKYYAIFDEKCLSKIPKGPLKDKK  253



>ref|XP_006402470.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
 gb|ESQ43923.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
Length=253

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 163/207 (79%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ 
Sbjct  45   LKAKIYRLFGREKPVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSL  104

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI ALAVLFL SNA +F+KKS P IPE+HI EE  L  ASALRN++N    +LR I
Sbjct  105  VCHILIFALAVLFLLSNAHAFMKKSPPKIPEIHIKEEHFLLIASALRNELNQAFVILRSI  164

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A GRDLK FLMV+ GLWIIS+VG+  +FLTL YI  V+LHTVP+LYEK+ED+VD  AEK 
Sbjct  165  ALGRDLKKFLMVVFGLWIISVVGNWFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKT  224

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDK  155
            + ELKK Y VFD KVLSKIP   LK K
Sbjct  225  LKELKKHYMVFDEKVLSKIPVASLKAK  251



>ref|XP_010436110.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   256 bits (654),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 169/208 (81%), Gaps = 4/208 (2%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            + RLFGR++PVHKVLGGGK AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH 
Sbjct  49   IYRLFGREKPVHKVLGGGKPADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHF  108

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
             + ALA LFLWSNA +FI K+ PH+PEVHIPE+PVLQ  S LR ++N    VLR+IASGR
Sbjct  109  AMAALAALFLWSNACTFIHKATPHLPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGR  168

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK F++VI GLW +SI+GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+
Sbjct  169  DLKKFILVIAGLWALSIIGSCCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEI  228

Query  223  KKQYAVFD----AKVLSKIPRGPLKDKK  152
            KKQYAV D    +KVLSKIPRG L  KK
Sbjct  229  KKQYAVLDEKVLSKVLSKIPRGALNKKK  256



>ref|XP_010441324.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   256 bits (653),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 168/208 (81%), Gaps = 4/208 (2%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            + RLFGR++PVHKVLGGGK AD+FLWRNKK+S GV G  TA W+LFE++EY  LT +CH 
Sbjct  49   IYRLFGREKPVHKVLGGGKPADIFLWRNKKVSGGVFGAITASWVLFELIEYRFLTFLCHF  108

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
             + ALA LFLWSNA +FI KS P IPEVHIPE+PVLQ  S LR ++N    VLR+IASGR
Sbjct  109  AMAALAALFLWSNACTFIHKSTPRIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGR  168

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            DLK F++VI GLW++SI+GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+
Sbjct  169  DLKKFILVIAGLWVLSIIGSCCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEI  228

Query  223  KKQYAVFD----AKVLSKIPRGPLKDKK  152
            KKQYAV D    +KVLSKIPRG L  KK
Sbjct  229  KKQYAVLDDKVFSKVLSKIPRGALNKKK  256



>ref|XP_011037168.1| PREDICTED: reticulon-like protein B5 [Populus euphratica]
Length=252

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            K+ RLFGR++PVH+VLGGGK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH
Sbjct  47   KIWRLFGREKPVHRVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCH  106

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LIL+LA+LFLWSNA +FI KS P IP+VH+PEEPVLQ ASAL  ++N     LR IA+G
Sbjct  107  ILILSLALLFLWSNAHAFIYKSPPRIPQVHLPEEPVLQVASALCVEINGAYVFLRSIAAG  166

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            +DLK FL+VI GLW++SIVGS C FLTLFYI  VLLHTVPVLYEK+ED++D  AEKAM E
Sbjct  167  KDLKKFLIVIAGLWVMSIVGSWCHFLTLFYICFVLLHTVPVLYEKFEDKIDPLAEKAMIE  226

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKKL  149
            +K+QYAVFDAKVLSKIP   LK KK+
Sbjct  227  IKRQYAVFDAKVLSKIPVAALKAKKV  252



>ref|XP_004308034.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=275

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 160/202 (79%), Gaps = 0/202 (0%)
 Frame = -3

Query  757  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  578
            R+FGR++PVHKVLGGGK ADV LWR+KK S  VLG AT +WI FE LEYHL+T  CH +I
Sbjct  72   RIFGREKPVHKVLGGGKPADVLLWRDKKESASVLGAATVLWIFFECLEYHLITLFCHIMI  131

Query  577  LALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDL  398
            L LAV FLWSN SSFI K+ P IP+V IPE+ VL  ASALR ++N    VLR+IASGRDL
Sbjct  132  LFLAVFFLWSNGSSFINKAPPEIPKVQIPEKCVLDIASALRIELNKGFHVLREIASGRDL  191

Query  397  KMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKK  218
            K FL VI  LWI+S++G C  FLTLFY+  VLLH+ P++YEK+ED++DA AEKA  E KK
Sbjct  192  KTFLGVIAVLWIVSVIGKCFSFLTLFYLTFVLLHSAPLIYEKHEDQIDAVAEKAWIEFKK  251

Query  217  QYAVFDAKVLSKIPRGPLKDKK  152
            QYAVF+ KVLSKIP+GP+K+KK
Sbjct  252  QYAVFNEKVLSKIPKGPVKEKK  273



>ref|XP_007135152.1| hypothetical protein PHAVU_010G105400g [Phaseolus vulgaris]
 gb|ESW07146.1| hypothetical protein PHAVU_010G105400g [Phaseolus vulgaris]
Length=255

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 166/207 (80%), Gaps = 0/207 (0%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            KV RLFGR++PVH VLGGGK ADV LWRNKKIS  VL  ATA+WI FE+LEYHLLT V H
Sbjct  49   KVFRLFGREKPVHSVLGGGKPADVLLWRNKKISASVLSVATAVWIFFELLEYHLLTLVGH  108

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
             LIL LAVLFLWSNA +FI K+ P IP VH+PEEP LQFASAL  ++N   A L  I SG
Sbjct  109  ILILLLAVLFLWSNAHTFIHKAPPRIPVVHLPEEPFLQFASALTIEINRGFAALHAIGSG  168

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            RDLK FL+VI G WI+SIVGS  +F+TLFYI  VLLHTVPVLY+KYED++D  AEKA+ E
Sbjct  169  RDLKTFLVVIVGTWILSIVGSWVNFMTLFYIVFVLLHTVPVLYDKYEDKIDPLAEKALIE  228

Query  226  LKKQYAVFDAKVLSKIPRGPLKDKKLA  146
             KKQYAVFD KVLSKIP+GPLK KKLA
Sbjct  229  FKKQYAVFDEKVLSKIPKGPLKYKKLA  255



>gb|KFK33000.1| hypothetical protein AALP_AA6G316900 [Arabis alpina]
Length=258

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 170/207 (82%), Gaps = 4/207 (2%)
 Frame = -3

Query  763  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  584
            + RLFGR++PVHKVLGGGK AD+FLWRNKK+S GV G  TA WI+FE++EYH LT +CH 
Sbjct  50   IYRLFGREKPVHKVLGGGKPADIFLWRNKKVSGGVFGAVTACWIVFELIEYHFLTFLCHF  109

Query  583  LILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGR  404
             ILALA LFLWSNA +FI K++PHIPEVHIPE+PVLQ AS LR + N  L VLR+IASG+
Sbjct  110  AILALAALFLWSNACTFIHKASPHIPEVHIPEDPVLQLASGLRIETNRALTVLRNIASGK  169

Query  403  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  224
            D+K F++VI GLWI+SI+GSCC+FLTLFY A VLL T+PV+YEKYED++DA+ EKAM E+
Sbjct  170  DIKKFILVIAGLWILSIIGSCCNFLTLFYTATVLLFTIPVIYEKYEDKIDAYGEKAMKEI  229

Query  223  KKQYAVFDAKVL----SKIPRGPLKDK  155
            KKQYAV D KVL    SKIPRG L  K
Sbjct  230  KKQYAVLDEKVLSKIMSKIPRGSLNKK  256



>emb|CDY08353.1| BnaC09g12430D [Brassica napus]
Length=250

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 162/211 (77%), Gaps = 4/211 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  K+ RLFGR++PVHKV GGGK AD+FLWRNKK+S GVLG AT  WILFE+ +Y+LLT 
Sbjct  39   IKTKIYRLFGREKPVHKVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELFQYNLLTL  98

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  ILALAVLFLWS+AS+FI K  P IPEVHIPEE VLQ AS LR ++N    +LR I
Sbjct  99   FGHISILALAVLFLWSSASTFIHKKPPRIPEVHIPEEVVLQLASGLRIEINRGFTLLRHI  158

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A GRDLK FLMVI GLW++S VGS C+FLTL Y A VLL TVPVLYEKYED+VD F EKA
Sbjct  159  ALGRDLKKFLMVIAGLWVLSKVGSSCNFLTLVYSATVLLFTVPVLYEKYEDKVDDFGEKA  218

Query  235  MHELKKQYAVFDAKVL----SKIPRGPLKDK  155
            M E+KKQYAV D KVL    SKIP+G  K K
Sbjct  219  MKEIKKQYAVLDEKVLSKVISKIPKGAFKKK  249



>ref|XP_009112802.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=250

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 164/211 (78%), Gaps = 4/211 (2%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            +  K+ RLFGR++PVHKV GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT 
Sbjct  39   IKTKIFRLFGREKPVHKVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTL  98

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
              H  ILALAVLF W +A++FI K  PHIPEVHIPEE VLQ AS LR ++N    +LR+I
Sbjct  99   FGHVSILALAVLFSWPSATTFIHKKPPHIPEVHIPEEVVLQLASGLRIEINRGFTILRNI  158

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A GRDLK FLMV+ GLW++S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKA
Sbjct  159  ALGRDLKKFLMVVAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDHFGEKA  218

Query  235  MHELKKQYAVFD----AKVLSKIPRGPLKDK  155
            M E+KKQYAV D    +KV+SKIPRG    K
Sbjct  219  MKEIKKQYAVLDEKVLSKVMSKIPRGAFNKK  249



>gb|AFK34557.1| unknown [Medicago truncatula]
 gb|KEH18780.1| seed maturation protein [Medicago truncatula]
Length=267

 Score =   254 bits (649),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 165/208 (79%), Gaps = 4/208 (2%)
 Frame = -3

Query  766  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  587
            KV RLFGR++PVH VLGGGK ADVFLW+NKK+S G L  ATAIW+ FE+LEYH LT +CH
Sbjct  58   KVFRLFGREKPVHSVLGGGKPADVFLWKNKKLSAGTLATATAIWVFFELLEYHFLTLICH  117

Query  586  GLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASG  407
              IL LA+LFLWSNA +F+ K+ PHIP VH+PEEP LQ ASALR ++N   + LRDI +G
Sbjct  118  ISILVLALLFLWSNAHTFVHKTPPHIPIVHLPEEPFLQIASALRIEINRGFSALRDIGTG  177

Query  406  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  227
            +D+K FL+VI GLWI+SIVGS  +FLTLFYI  VLL TVP +Y+KYED++D  AEKA  E
Sbjct  178  KDVKKFLIVIFGLWILSIVGSWSNFLTLFYITFVLLFTVPFVYDKYEDKIDPLAEKAFIE  237

Query  226  LKKQYAVFD----AKVLSKIPRGPLKDK  155
            +KKQYAVFD    +KVLSKIP+G LK K
Sbjct  238  IKKQYAVFDEKVLSKVLSKIPKGVLKGK  265



>ref|NP_001130268.1| uncharacterized protein LOC100191362 [Zea mays]
 gb|ACF78438.1| unknown [Zea mays]
 gb|ACG39160.1| seed maturation protein [Zea mays]
 gb|ACL53798.1| unknown [Zea mays]
 gb|AFW78797.1| seed maturation protein [Zea mays]
Length=254

 Score =   254 bits (648),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -3

Query  769  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  590
            AK+ R+FGR++PVH VLGGGK AD+FLWRNK+IS GVL GATA W+LFEV++YHLLT +C
Sbjct  47   AKIYRIFGREKPVHSVLGGGKPADLFLWRNKRISGGVLAGATAFWLLFEVMDYHLLTLLC  106

Query  589  HGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIAS  410
            H LIL LA+LFLWSNA++FI KS P+IPEV IP++  +  A +LR ++N   A LR+I  
Sbjct  107  HCLILTLAILFLWSNATTFINKSPPNIPEVKIPDDLAVNVARSLRYEINRGFATLREIGQ  166

Query  409  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  230
            G DLK FL+VI GLWI+S++GSCC+FLTL YI  ++L+TVPVLYEK+ED+VDAF EKAM 
Sbjct  167  GHDLKKFLIVIAGLWILSVLGSCCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKAMV  226

Query  229  ELKKQYAVFDAKVLSKIPRGPLKDKK  152
            ELK+ YA+FD K LSKIP+GPLKDKK
Sbjct  227  ELKRYYAIFDEKCLSKIPKGPLKDKK  252



>ref|XP_006291739.1| hypothetical protein CARUB_v10017909mg [Capsella rubella]
 gb|EOA24637.1| hypothetical protein CARUB_v10017909mg [Capsella rubella]
Length=249

 Score =   253 bits (646),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 162/207 (78%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ 
Sbjct  41   LKAKIYRLFGREKPVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSL  100

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LI ALAVLFL SNA +F+ K+ P IPE+HI EE  +  ASALRN++N    +LR I
Sbjct  101  VCHILIFALAVLFLLSNAHAFMNKTPPKIPEIHIKEEHFILIASALRNELNQAFVILRSI  160

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A GRDLK FLMV+ GLW+IS+VG+  +FLTL YI  V+LHTVP+LYEK+ED+VD  AEK 
Sbjct  161  ALGRDLKKFLMVVVGLWVISVVGNWFNFLTLLYICFVVLHTVPMLYEKHEDKVDPVAEKT  220

Query  235  MHELKKQYAVFDAKVLSKIPRGPLKDK  155
            + ELKK Y VFD KVLSK+P   LK K
Sbjct  221  LKELKKHYMVFDEKVLSKLPVASLKAK  247



>ref|XP_011023265.1| PREDICTED: reticulon-like protein B5 [Populus euphratica]
 ref|XP_011023266.1| PREDICTED: reticulon-like protein B5 [Populus euphratica]
Length=252

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = -3

Query  775  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  596
            + AK+ RLFGR++PVH VLGGGK ADVFLWRNKK+S GVLG  TA+W+LFE++EYHLLT 
Sbjct  43   VKAKIWRLFGREKPVHHVLGGGKPADVFLWRNKKVSAGVLGFVTAMWVLFELIEYHLLTL  102

Query  595  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  416
            VCH LILA A+LFLWSNA + I KS P IPE+H+PE+ VLQ ASAL  ++N   A LR +
Sbjct  103  VCHILILAAALLFLWSNACTLINKSPPRIPEIHLPEKLVLQVASALCVEINSAFAGLRSV  162

Query  415  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  236
            A+G+D K  LM+I GLW++SIVGS C FLTLFYI  VLLHTVPVLYEKYED+VD  AEKA
Sbjct  163  AAGKDFKKLLMIIAGLWVLSIVGSSCHFLTLFYICFVLLHTVPVLYEKYEDKVDPLAEKA  222

Query  235  MHELKKQYAVFDAKVLSKIP  176
            M ++KKQYAVFDAKVLSKIP
Sbjct  223  MVQIKKQYAVFDAKVLSKIP  242



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1726355462650