BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF040M03

Length=918
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618411.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    359   3e-118   Nicotiana tomentosiformis
ref|XP_009591548.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    357   2e-117   Nicotiana tomentosiformis
ref|XP_004232352.1|  PREDICTED: mannose-6-phosphate isomerase 2         356   4e-117   Solanum lycopersicum
ref|XP_004233489.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    355   8e-117   Solanum lycopersicum
ref|XP_009766829.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    355   9e-117   Nicotiana sylvestris
ref|XP_006357852.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    355   1e-116   Solanum tuberosum [potatoes]
ref|XP_009595066.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    352   8e-116   Nicotiana tomentosiformis
ref|XP_006346906.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    353   9e-116   Solanum tuberosum [potatoes]
ref|XP_009757184.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    352   2e-115   Nicotiana sylvestris
ref|XP_006365538.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    348   3e-114   Solanum tuberosum [potatoes]
ref|XP_011021254.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    348   5e-114   Populus euphratica
ref|XP_009798758.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    346   3e-113   Nicotiana sylvestris
gb|KDP32959.1|  hypothetical protein JCGZ_12990                         347   3e-113   Jatropha curcas
ref|XP_006482242.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    346   6e-113   Citrus sinensis [apfelsine]
ref|XP_002531475.1|  mannose-6-phosphate isomerase, putative            343   6e-113   
gb|KDO59031.1|  hypothetical protein CISIN_1g013464mg                   346   7e-113   Citrus sinensis [apfelsine]
ref|XP_006430767.1|  hypothetical protein CICLE_v10011731mg             345   1e-112   Citrus clementina [clementine]
ref|XP_007033251.1|  Mannose-6-phosphate isomerase, type I              343   4e-112   Theobroma cacao [chocolate]
emb|CBI33642.3|  unnamed protein product                                340   9e-112   Vitis vinifera
ref|XP_002283926.1|  PREDICTED: mannose-6-phosphate isomerase 1         341   3e-111   Vitis vinifera
ref|XP_002305820.1|  DARK INDUCIBLE 9 family protein                    341   5e-111   Populus trichocarpa [western balsam poplar]
ref|XP_011099550.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    340   1e-110   Sesamum indicum [beniseed]
gb|KHG02503.1|  Mannose-6-phosphate isomerase                           338   4e-110   Gossypium arboreum [tree cotton]
ref|XP_006383443.1|  hypothetical protein POPTR_0005s15560g             338   6e-110   
emb|CAN60179.1|  hypothetical protein VITISV_011365                     338   1e-109   Vitis vinifera
gb|EYU44629.1|  hypothetical protein MIMGU_mgv1a0065651mg               331   2e-109   Erythranthe guttata [common monkey flower]
ref|XP_011035071.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    337   3e-109   Populus euphratica
ref|XP_004242042.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    336   3e-109   
gb|KJB48153.1|  hypothetical protein B456_008G055300                    334   1e-108   Gossypium raimondii
emb|CDP02773.1|  unnamed protein product                                331   5e-108   Coffea canephora [robusta coffee]
gb|EYU34411.1|  hypothetical protein MIMGU_mgv1a006972mg                332   1e-107   Erythranthe guttata [common monkey flower]
ref|XP_011097179.1|  PREDICTED: mannose-6-phosphate isomerase 1 i...    330   9e-107   Sesamum indicum [beniseed]
ref|XP_010107822.1|  putative mannose-6-phosphate isomerase             327   8e-106   
ref|XP_010265087.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    325   4e-105   Nelumbo nucifera [Indian lotus]
ref|XP_003552724.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    322   5e-104   Glycine max [soybeans]
gb|AAX31279.1|  phosphomannose isomerase                                322   6e-104   Cyamopsis tetragonoloba [cluster bean]
ref|XP_003532343.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    320   5e-103   Glycine max [soybeans]
gb|KHN17308.1|  Mannose-6-phosphate isomerase                           318   2e-102   Glycine soja [wild soybean]
ref|XP_004489108.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    318   4e-102   Cicer arietinum [garbanzo]
gb|KHG01171.1|  Mannose-6-phosphate isomerase                           315   5e-101   Gossypium arboreum [tree cotton]
ref|XP_008381268.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...    315   6e-101   Malus domestica [apple tree]
gb|ACU18571.1|  unknown                                                 310   6e-101   Glycine max [soybeans]
ref|XP_008381266.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...    315   7e-101   Malus domestica [apple tree]
ref|XP_008244515.1|  PREDICTED: mannose-6-phosphate isomerase 1         315   8e-101   Prunus mume [ume]
ref|XP_003637323.1|  Mannose-6-phosphate isomerase                      311   1e-100   
gb|KJB43061.1|  hypothetical protein B456_007G181800                    314   2e-100   Gossypium raimondii
ref|XP_007215391.1|  hypothetical protein PRUPE_ppa005846mg             314   2e-100   
ref|XP_003541320.1|  PREDICTED: mannose-6-phosphate isomerase 1         313   4e-100   Glycine max [soybeans]
ref|XP_008342936.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    313   4e-100   
ref|XP_009357811.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...    312   7e-100   Pyrus x bretschneideri [bai li]
ref|XP_009357810.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...    312   8e-100   Pyrus x bretschneideri [bai li]
ref|XP_009345680.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    312   8e-100   Pyrus x bretschneideri [bai li]
gb|KEH21549.1|  mannose-6-phosphate isomerase                           311   9e-100   Medicago truncatula
ref|XP_009342661.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    311   1e-99    Pyrus x bretschneideri [bai li]
gb|EPS59833.1|  hypothetical protein M569_14970                         311   2e-99    Genlisea aurea
gb|ACP43318.1|  mannose-6-phosphate isomerase                           302   4e-99    Citrus maxima [buntan]
ref|XP_007139158.1|  hypothetical protein PHAVU_008G006200g             310   4e-99    Phaseolus vulgaris [French bean]
gb|KJB43060.1|  hypothetical protein B456_007G181800                    306   1e-97    Gossypium raimondii
ref|XP_004300283.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    306   2e-97    Fragaria vesca subsp. vesca
ref|XP_010926023.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    305   2e-97    Elaeis guineensis
ref|XP_006391469.1|  hypothetical protein EUTSA_v10018552mg             305   9e-97    Eutrema salsugineum [saltwater cress]
ref|XP_010061893.1|  PREDICTED: mannose-6-phosphate isomerase 1 i...    304   1e-96    Eucalyptus grandis [rose gum]
ref|XP_002884330.1|  hypothetical protein ARALYDRAFT_477494             303   3e-96    
ref|XP_009118359.1|  PREDICTED: mannose-6-phosphate isomerase 1         302   5e-96    Brassica rapa
ref|NP_176878.1|  mannose-6-phosphate isomerase                         302   7e-96    Arabidopsis thaliana [mouse-ear cress]
emb|CDY43229.1|  BnaC05g48220D                                          302   7e-96    Brassica napus [oilseed rape]
ref|XP_009147339.1|  PREDICTED: mannose-6-phosphate isomerase 1         301   9e-96    Brassica rapa
gb|KJB43062.1|  hypothetical protein B456_007G181800                    301   9e-96    Gossypium raimondii
emb|CDY54299.1|  BnaC01g41980D                                          301   1e-95    Brassica napus [oilseed rape]
emb|CDY57541.1|  BnaA05g33470D                                          301   1e-95    Brassica napus [oilseed rape]
ref|XP_010528481.1|  PREDICTED: mannose-6-phosphate isomerase 2         301   1e-95    Tarenaya hassleriana [spider flower]
gb|AEJ89929.1|  mannose-6-phosphate isomerase-like protein              301   1e-95    Brassica rapa subsp. chinensis [bok-choy]
emb|CDY42336.1|  BnaC02g17130D                                          301   2e-95    Brassica napus [oilseed rape]
dbj|BAD44147.1|  phosphomannose isomerase (din9)                        301   3e-95    Arabidopsis thaliana [mouse-ear cress]
emb|CDY12611.1|  BnaA02g12790D                                          300   4e-95    Brassica napus [oilseed rape]
ref|XP_009127517.1|  PREDICTED: mannose-6-phosphate isomerase 2         300   5e-95    Brassica rapa
ref|NP_186906.1|  mannose-6-phosphate isomerase                         300   5e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303122.1|  hypothetical protein CARUB_v100218700mg            295   8e-95    
ref|XP_006408404.1|  hypothetical protein EUTSA_v10020776mg             299   9e-95    Eutrema salsugineum [saltwater cress]
ref|XP_010470599.1|  PREDICTED: mannose-6-phosphate isomerase 2-l...    301   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010463670.1|  PREDICTED: mannose-6-phosphate isomerase 1         299   1e-94    Camelina sativa [gold-of-pleasure]
emb|CDY34738.1|  BnaA01g32870D                                          298   1e-94    Brassica napus [oilseed rape]
ref|XP_010511622.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    299   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010485568.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    298   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_006296709.1|  hypothetical protein CARUB_v10013753mg             298   2e-94    Capsella rubella
ref|XP_010470600.1|  PREDICTED: mannose-6-phosphate isomerase 2-l...    300   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_008807086.1|  PREDICTED: mannose-6-phosphate isomerase 2-l...    298   2e-94    
emb|CDY67541.1|  BnaAnng24620D                                          298   2e-94    Brassica napus [oilseed rape]
ref|XP_010499042.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    298   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010415256.1|  PREDICTED: mannose-6-phosphate isomerase 2         298   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_002887099.1|  predicted protein                                  295   4e-93    Arabidopsis lyrata subsp. lyrata
ref|XP_010916406.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    293   1e-92    Elaeis guineensis
ref|XP_008797801.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-6-ph...    292   4e-92    
ref|XP_008807084.1|  PREDICTED: mannose-6-phosphate isomerase 2-l...    290   2e-91    
ref|XP_004172892.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    288   3e-91    
ref|XP_009383606.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    289   4e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409962.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    289   1e-90    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16432.1|  unknown                                                 288   2e-90    Picea sitchensis
ref|XP_004143675.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    288   2e-90    Cucumis sativus [cucumbers]
dbj|BAJ88474.1|  predicted protein                                      288   2e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004165797.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    288   3e-90    
ref|XP_004145852.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    288   3e-90    Cucumis sativus [cucumbers]
ref|XP_010549921.1|  PREDICTED: mannose-6-phosphate isomerase 1         286   6e-90    Tarenaya hassleriana [spider flower]
ref|XP_008457018.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    286   1e-89    Cucumis melo [Oriental melon]
gb|EEE52368.1|  hypothetical protein OsJ_34433                          283   1e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004979620.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    286   2e-89    Setaria italica
ref|XP_006842317.1|  hypothetical protein AMTR_s00079p00142130          285   2e-89    Amborella trichopoda
gb|EAY72377.1|  hypothetical protein OsI_00230                          280   2e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_002449802.1|  hypothetical protein SORBIDRAFT_05g023560          280   3e-89    
gb|ACG45229.1|  mannose-6-phosphate isomerase                           285   4e-89    Zea mays [maize]
dbj|BAJ97590.1|  predicted protein                                      285   5e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABA94585.1|  mannose-6-phosphate isomerase, class I family pro...    285   8e-89    Oryza sativa Japonica Group [Japonica rice]
gb|EAY81490.1|  hypothetical protein OsI_36663                          285   8e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_004968078.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    284   1e-88    Setaria italica
gb|ABY59214.1|  At1g67070                                               275   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001140535.1|  uncharacterized protein LOC100272600               283   2e-88    Zea mays [maize]
ref|XP_006643701.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    277   2e-88    
ref|XP_010532333.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...    283   2e-88    Tarenaya hassleriana [spider flower]
gb|ABY59220.1|  At1g67070                                               275   3e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006663584.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    279   3e-88    Oryza brachyantha
gb|ABY59218.1|  At1g67070                                               275   4e-88    Arabidopsis thaliana [mouse-ear cress]
gb|ABY59228.1|  At1g67070-like protein                                  274   5e-88    Arabidopsis lyrata subsp. petraea
gb|ABY59226.1|  At1g67070                                               273   1e-87    Arabidopsis thaliana [mouse-ear cress]
gb|ABY59229.1|  At1g67070-like protein                                  273   2e-87    Arabidopsis lyrata subsp. petraea
gb|ABY59219.1|  At1g67070                                               273   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001041907.1|  Os01g0127900                                       279   4e-87    
ref|NP_001063081.2|  Os09g0389000                                       278   6e-87    
ref|XP_003577385.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    279   9e-87    Brachypodium distachyon [annual false brome]
gb|EAZ08978.1|  hypothetical protein OsI_31243                          277   1e-86    Oryza sativa Indica Group [Indian rice]
ref|NP_001147755.1|  LOC100281365                                       277   3e-86    
gb|KDO76962.1|  hypothetical protein CISIN_1g014147mg                   277   3e-86    Citrus sinensis [apfelsine]
ref|XP_006469088.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    276   4e-86    Citrus sinensis [apfelsine]
gb|KDP29436.1|  hypothetical protein JCGZ_18357                         277   5e-86    Jatropha curcas
gb|AFW60447.1|  mannose-6-phosphate isomerase                           276   6e-86    
ref|XP_002526993.1|  mannose-6-phosphate isomerase, putative            276   9e-86    Ricinus communis
ref|XP_011464099.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    273   7e-85    Fragaria vesca subsp. vesca
gb|EMT31567.1|  Mannose-6-phosphate isomerase                           272   1e-84    
ref|XP_008339655.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    272   6e-84    Malus domestica [apple tree]
ref|XP_007222285.1|  hypothetical protein PRUPE_ppa005896mg             270   3e-83    Prunus persica
ref|XP_008389272.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...    269   5e-83    
ref|XP_008243257.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    269   6e-83    Prunus mume [ume]
gb|EMS46597.1|  putative mannose-6-phosphate isomerase                  267   8e-83    Triticum urartu
ref|XP_008367007.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-6-ph...    268   1e-82    
ref|NP_001140476.1|  uncharacterized protein LOC100272536               268   2e-82    Zea mays [maize]
ref|XP_009356970.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...    267   2e-82    Pyrus x bretschneideri [bai li]
ref|XP_009356247.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...    267   3e-82    Pyrus x bretschneideri [bai li]
gb|EMT11818.1|  Mannose-6-phosphate isomerase                           265   3e-82    
emb|CBI26999.3|  unnamed protein product                                262   6e-81    Vitis vinifera
ref|XP_010693191.1|  PREDICTED: mannose-6-phosphate isomerase 1         260   3e-79    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003567941.1|  PREDICTED: mannose-6-phosphate isomerase 1         259   4e-79    Brachypodium distachyon [annual false brome]
ref|NP_001068225.1|  Os11g0600900                                       250   2e-78    
ref|XP_006448445.1|  hypothetical protein CICLE_v10017881mg             253   6e-77    
ref|XP_001775706.1|  predicted protein                                  226   2e-66    
ref|XP_001754844.1|  predicted protein                                  214   4e-62    
ref|XP_002987355.1|  hypothetical protein SELMODRAFT_125724             209   2e-60    
ref|XP_008807087.1|  PREDICTED: mannose-6-phosphate isomerase 2-l...    201   3e-58    
ref|XP_011097180.1|  PREDICTED: mannose-6-phosphate isomerase 1 i...    196   7e-56    
ref|XP_007514601.1|  mannose-6-phosphate isomerase                      197   1e-55    Bathycoccus prasinos
gb|KHN24248.1|  Mannose-6-phosphate isomerase                           186   1e-52    Glycine soja [wild soybean]
ref|XP_008389273.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...    188   1e-52    
ref|XP_009356248.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...    185   1e-51    Pyrus x bretschneideri [bai li]
emb|CDY11497.1|  BnaA09g40630D                                          182   5e-51    Brassica napus [oilseed rape]
emb|CDH53485.1|  mannose-6-phosphate isomerase                          183   2e-50    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002505002.1|  predicted protein                                  182   5e-50    Micromonas commoda
ref|XP_006296710.1|  hypothetical protein CARUB_v10013753mg             180   5e-50    
ref|XP_005844140.1|  hypothetical protein CHLNCDRAFT_139231             182   8e-50    Chlorella variabilis
ref|XP_005645250.1|  mannose-6-phosphate isomerase                      181   3e-49    Coccomyxa subellipsoidea C-169
ref|XP_001416055.1|  predicted protein                                  177   3e-48    Ostreococcus lucimarinus CCE9901
ref|XP_008436962.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    177   3e-48    Cucumis melo [Oriental melon]
gb|KDO27723.1|  phosphomannose isomerase type I                         175   2e-47    Saprolegnia parasitica CBS 223.65
emb|CDS12287.1|  hypothetical protein LRAMOSA04482                      174   4e-47    Lichtheimia ramosa
emb|CEG01212.1|  Phosphomannose isomerase, type I, conserved site       174   5e-47    Ostreococcus tauri
ref|XP_008873487.1|  mannose-6-phosphate isomerase, class I             170   1e-45    Aphanomyces invadans
ref|XP_008608157.1|  phosphomannose isomerase type I                    170   1e-45    Saprolegnia diclina VS20
gb|EPT04877.1|  hypothetical protein FOMPIDRAFT_1027596                 169   7e-45    Fomitopsis pinicola FP-58527 SS1
ref|XP_002954744.1|  hypothetical protein VOLCADRAFT_65163              169   8e-45    Volvox carteri f. nagariensis
gb|ESA05112.1|  hypothetical protein GLOINDRAFT_35949                   168   9e-45    
gb|EIE85057.1|  phosphomannose isomerase type I                         168   1e-44    Rhizopus delemar RA 99-880
ref|XP_003075298.1|  putative mannose-6-phosphate isomerase (ISS)       169   2e-44    
ref|XP_003227566.1|  PREDICTED: mannose-6-phosphate isomerase           165   6e-44    Anolis carolinensis [Carolina anole]
ref|XP_007305503.1|  mannose-6-phosphate isomerase                      165   2e-43    Stereum hirsutum FP-91666 SS1
ref|XP_008932049.1|  PREDICTED: mannose-6-phosphate isomerase iso...    164   3e-43    
gb|KFW76214.1|  Mannose-6-phosphate isomerase                           164   3e-43    Manacus vitellinus
gb|KEP49438.1|  mannose-6-phosphate isomerase                           161   5e-43    Rhizoctonia solani 123E
ref|XP_009829812.1|  mannose-6-phosphate isomerase, class I             162   1e-42    Aphanomyces astaci
gb|EMD36598.1|  hypothetical protein CERSUDRAFT_115637                  162   1e-42    Gelatoporia subvermispora B
emb|CEL59231.1|  mannose-6-phosphate isomerase                          161   4e-42    Rhizoctonia solani AG-1 IB
gb|EUC56226.1|  mannose-6-phosphate isomerase                           160   4e-42    Rhizoctonia solani AG-3 Rhs1AP
gb|KFM80450.1|  Mannose-6-phosphate isomerase                           160   5e-42    Stegodyphus mimosarum
ref|XP_006264069.1|  PREDICTED: mannose-6-phosphate isomerase           160   6e-42    
ref|XP_002896014.1|  mannose-6-phosphate isomerase, putative            159   6e-42    Phytophthora infestans T30-4
ref|XP_009642214.1|  PREDICTED: mannose-6-phosphate isomerase iso...    160   7e-42    Egretta garzetta
ref|XP_005716739.1|  unnamed protein product                            159   9e-42    Chondrus crispus [carageen]
ref|XP_006029163.1|  PREDICTED: mannose-6-phosphate isomerase           160   1e-41    
emb|CEP08577.1|  hypothetical protein                                   157   1e-41    Parasitella parasitica
gb|KFP20073.1|  Mannose-6-phosphate isomerase                           160   1e-41    Egretta garzetta
ref|XP_009672132.1|  PREDICTED: mannose-6-phosphate isomerase           159   1e-41    Struthio camelus australis
emb|CEG82939.1|  Putative Mannose-6-phosphate isomerase                 159   1e-41    Rhizopus microsporus
emb|CAG01059.1|  unnamed protein product                                159   1e-41    Tetraodon nigroviridis
ref|XP_006957699.1|  mannose-6-phosphate isomerase                      159   2e-41    Wallemia mellicola CBS 633.66
gb|KFV80707.1|  Mannose-6-phosphate isomerase                           159   2e-41    Struthio camelus australis
ref|XP_010569926.1|  PREDICTED: mannose-6-phosphate isomerase iso...    158   2e-41    Haliaeetus leucocephalus
emb|CEI89889.1|  Putative Mannose-6-phosphate isomerase                 159   3e-41    Rhizopus microsporus
gb|ETM42356.1|  mannose-6-phosphate isomerase, class I                  158   3e-41    Phytophthora parasitica
gb|ETE58039.1|  Mannose-6-phosphate isomerase                           159   3e-41    Ophiophagus hannah
ref|XP_008908744.1|  mannose-6-phosphate isomerase, class I             158   3e-41    Phytophthora parasitica INRA-310
gb|KDD74657.1|  type I phosphomannose isomerase                         158   3e-41    Helicosporidium sp. ATCC 50920
ref|XP_005145786.1|  PREDICTED: mannose-6-phosphate isomerase           158   4e-41    Melopsittacus undulatus
emb|CEI87990.1|  Putative Mannose-6-phosphate isomerase                 158   4e-41    Rhizopus microsporus
emb|CEG73470.1|  Putative Mannose-6-phosphate isomerase                 158   4e-41    Rhizopus microsporus
ref|XP_003060607.1|  predicted protein                                  159   5e-41    Micromonas pusilla CCMP1545
ref|XP_009544248.1|  hypothetical protein HETIRDRAFT_473320             158   6e-41    Heterobasidion irregulare TC 32-1
gb|KFP85624.1|  Mannose-6-phosphate isomerase                           157   7e-41    Acanthisitta chloris
ref|XP_010569925.1|  PREDICTED: mannose-6-phosphate isomerase iso...    158   7e-41    Haliaeetus leucocephalus
gb|ELU39697.1|  mannose-6-phosphate isomerase                           157   8e-41    Rhizoctonia solani AG-1 IA
ref|XP_009567147.1|  PREDICTED: mannose-6-phosphate isomerase iso...    157   8e-41    Cuculus canorus
ref|XP_005239458.1|  PREDICTED: mannose-6-phosphate isomerase           157   1e-40    Falco peregrinus [peregrine]
ref|XP_638475.1|  mannose-6-phosphate isomerase                         158   1e-40    Dictyostelium discoideum AX4
ref|XP_009909891.1|  PREDICTED: mannose-6-phosphate isomerase iso...    157   1e-40    Picoides pubescens
ref|XP_007435657.1|  PREDICTED: mannose-6-phosphate isomerase           156   1e-40    
gb|KFV63742.1|  Mannose-6-phosphate isomerase                           157   1e-40    Picoides pubescens
gb|KFO82051.1|  Mannose-6-phosphate isomerase                           157   2e-40    Cuculus canorus
gb|AAG10203.1|AF291701_1  mannose-6-phosphate isomerase                 157   2e-40    Cryptococcus neoformans var. neoformans
ref|XP_006126332.1|  PREDICTED: mannose-6-phosphate isomerase iso...    156   3e-40    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006782485.1|  PREDICTED: mannose-6-phosphate isomerase-lik...    155   3e-40    Neolamprologus brichardi [lyretail cichlid]
ref|XP_006126333.1|  PREDICTED: mannose-6-phosphate isomerase iso...    156   4e-40    Pelodiscus sinensis [Chinese softshell turtle]
gb|KIJ18653.1|  mannose-6-phosphate isomerase                           155   4e-40    Paxillus involutus ATCC 200175
ref|XP_004069506.1|  PREDICTED: mannose-6-phosphate isomerase           155   4e-40    Oryzias latipes [Japanese rice fish]
ref|XP_002116196.1|  hypothetical protein TRIADDRAFT_30639              156   4e-40    Trichoplax adhaerens
ref|XP_572705.1|  mannose-6-phosphate isomerase                         156   4e-40    Cryptococcus neoformans var. neoformans JEC21
ref|XP_007363350.1|  mannose-6-phosphate isomerase                      155   5e-40    Dichomitus squalens LYAD-421 SS1
ref|XP_009078147.1|  PREDICTED: mannose-6-phosphate isomerase           155   5e-40    Acanthisitta chloris
ref|XP_003967298.1|  PREDICTED: mannose-6-phosphate isomerase-like      155   5e-40    
ref|XP_007379255.1|  mannos-6-phosphate isomerase                       155   5e-40    Punctularia strigosozonata HHB-11173 SS5
ref|XP_002593357.1|  hypothetical protein BRAFLDRAFT_261743             155   5e-40    Branchiostoma floridae
gb|AFR97043.2|  mannose-6-phosphate isomerase                           155   5e-40    Cryptococcus neoformans var. grubii H99
ref|XP_773772.1|  hypothetical protein CNBH2250                         155   7e-40    Cryptococcus neoformans var. neoformans B-3501A
ref|XP_006782484.1|  PREDICTED: mannose-6-phosphate isomerase-lik...    155   7e-40    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005731511.1|  PREDICTED: mannose-6-phosphate isomerase-like      155   8e-40    Pundamilia nyererei
ref|XP_008289753.1|  PREDICTED: mannose-6-phosphate isomerase           155   8e-40    Stegastes partitus
ref|XP_003455422.1|  PREDICTED: mannose-6-phosphate isomerase-like      155   8e-40    Oreochromis niloticus
ref|XP_001630002.1|  predicted protein                                  154   8e-40    Nematostella vectensis
ref|XP_001950664.1|  PREDICTED: mannose-6-phosphate isomerase iso...    154   8e-40    Acyrthosiphon pisum
ref|XP_002195681.1|  PREDICTED: mannose-6-phosphate isomerase           155   9e-40    Taeniopygia guttata
ref|XP_002675323.1|  mannose phosphate isomerase                        154   9e-40    Naegleria gruberi strain NEG-M
emb|CDQ60375.1|  unnamed protein product                                155   9e-40    Oncorhynchus mykiss
ref|XP_009705978.1|  PREDICTED: mannose-6-phosphate isomerase           152   9e-40    Cariama cristata
ref|XP_001695020.1|  mannose-6-phosphate isomerase                      154   9e-40    Chlamydomonas reinhardtii
ref|XP_009096484.1|  PREDICTED: mannose-6-phosphate isomerase iso...    153   1e-39    
emb|CCI46765.1|  unnamed protein product                                154   1e-39    Albugo candida
ref|XP_008409446.1|  PREDICTED: mannose-6-phosphate isomerase           154   1e-39    Poecilia reticulata
emb|CCA15775.1|  mannose6phosphate isomerase putative                   154   1e-39    Albugo laibachii Nc14
ref|XP_010789443.1|  PREDICTED: mannose-6-phosphate isomerase-like      150   1e-39    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005521434.1|  PREDICTED: mannose-6-phosphate isomerase           154   2e-39    Pseudopodoces humilis [Tibetan ground-jay]
ref|NP_001028282.1|  mannose-6-phosphate isomerase                      154   2e-39    Danio rerio [leopard danio]
emb|CCM01786.1|  predicted protein                                      158   2e-39    Fibroporia radiculosa
ref|XP_010715482.1|  PREDICTED: mannose-6-phosphate isomerase           152   2e-39    Meleagris gallopavo [common turkey]
gb|KIK26872.1|  hypothetical protein PISMIDRAFT_675486                  154   2e-39    Pisolithus microcarpus 441
gb|KJA19592.1|  hypothetical protein HYPSUDRAFT_44152                   154   3e-39    Hypholoma sublateritium FD-334 SS-4
gb|ETN75179.1|  mannose-6-phosphate isomerase, class I                  153   3e-39    Necator americanus
ref|XP_005807503.1|  PREDICTED: mannose-6-phosphate isomerase-like      153   3e-39    Xiphophorus maculatus
ref|XP_010150640.1|  PREDICTED: mannose-6-phosphate isomerase           152   3e-39    Eurypyga helias
ref|XP_007573545.1|  PREDICTED: mannose-6-phosphate isomerase           153   3e-39    Poecilia formosa
ref|XP_010745585.1|  PREDICTED: mannose-6-phosphate isomerase           153   3e-39    Larimichthys crocea [croceine croaker]
ref|XP_001730538.1|  hypothetical protein MGL_2334                      150   3e-39    Malassezia globosa CBS 7966
dbj|GAN06914.1|  phosphomannose isomerase type I                        153   4e-39    Mucor ambiguus
ref|XP_006010547.1|  PREDICTED: mannose-6-phosphate isomerase iso...    153   4e-39    Latimeria chalumnae
ref|XP_007406487.1|  hypothetical protein MELLADRAFT_94588              152   5e-39    Melampsora larici-populina 98AG31
gb|KDE07466.1|  mannose-6-phosphate isomerase                           152   5e-39    Microbotryum lychnidis-dioicae p1A1 Lamole
gb|KHJ41246.1|  mannose-6-phosphate isomerase, class I                  153   5e-39    Trichuris suis
ref|XP_006010546.1|  PREDICTED: mannose-6-phosphate isomerase iso...    152   6e-39    Latimeria chalumnae
gb|KFD51617.1|  hypothetical protein M513_07496                         152   6e-39    Trichuris suis
ref|XP_007315243.1|  hypothetical protein SERLADRAFT_460072             152   6e-39    Serpula lacrymans var. lacrymans S7.9
ref|XP_004564602.1|  PREDICTED: mannose-6-phosphate isomerase-like      152   7e-39    Maylandia zebra
ref|XP_001233064.3|  PREDICTED: mannose-6-phosphate isomerase           152   7e-39    
gb|KDQ65129.1|  hypothetical protein JAAARDRAFT_146519                  152   8e-39    Jaapia argillacea MUCL 33604
emb|CCX13665.1|  Similar to Mannose-6-phosphate isomerase; acc. n...    152   9e-39    Pyronema omphalodes CBS 100304
ref|XP_010221941.1|  PREDICTED: mannose-6-phosphate isomerase           152   1e-38    Tinamus guttatus
ref|XP_010410598.1|  PREDICTED: mannose-6-phosphate isomerase           150   1e-38    
gb|KFM07263.1|  Mannose-6-phosphate isomerase                           150   1e-38    
gb|KGL83459.1|  Mannose-6-phosphate isomerase                           152   1e-38    
gb|KFW05909.1|  Mannose-6-phosphate isomerase                           151   1e-38    
ref|XP_005051635.1|  PREDICTED: mannose-6-phosphate isomerase           152   1e-38    
emb|CCU76370.1|  pmi40 mannose 6 phosphate isomerase                    152   2e-38    
ref|XP_001840654.1|  mannose-6-phosphate isomerase                      151   2e-38    
gb|EPB84028.1|  phosphomannose isomerase type I                         151   2e-38    
ref|XP_010899641.1|  PREDICTED: mannose-6-phosphate isomerase iso...    150   2e-38    
ref|XP_003195790.1|  mannose-6-phosphate isomerase                      151   2e-38    
gb|KGB76902.1|  mannose-6-phosphate isomerase                           151   2e-38    
gb|EPZ35741.1|  Mannose-6-phosphate isomerase, type I domain-cont...    150   2e-38    
gb|KIR62532.1|  mannose-6-phosphate isomerase                           151   2e-38    
gb|KIR47413.1|  mannose-6-phosphate isomerase                           151   2e-38    
ref|XP_009277184.1|  PREDICTED: mannose-6-phosphate isomerase           150   3e-38    
ref|XP_010899640.1|  PREDICTED: mannose-6-phosphate isomerase iso...    150   3e-38    
ref|XP_005311650.1|  PREDICTED: mannose-6-phosphate isomerase           150   3e-38    
ref|XP_007852708.1|  mannose-6-phosphate isomerase                      150   4e-38    
gb|EPQ63511.1|  Mannose-6-phosphate isomerase                           150   5e-38    
ref|XP_005419847.1|  PREDICTED: mannose-6-phosphate isomerase           150   6e-38    
gb|KIY67218.1|  mannose-6-phosphate isomerase                           150   6e-38    
gb|KDR14999.1|  Mannose-6-phosphate isomerase                           149   6e-38    
gb|KIM42639.1|  hypothetical protein M413DRAFT_444327                   150   6e-38    
ref|XP_780304.2|  PREDICTED: mannose-6-phosphate isomerase-like         149   8e-38    
emb|CCU99332.1|  unnamed protein product                                150   8e-38    
ref|XP_009484682.1|  PREDICTED: mannose-6-phosphate isomerase iso...    149   9e-38    
gb|EKD01076.1|  hypothetical protein A1Q2_04574                         149   9e-38    
ref|XP_008640161.1|  PREDICTED: mannose-6-phosphate isomerase iso...    148   1e-37    
gb|KIK47149.1|  hypothetical protein CY34DRAFT_799691                   149   1e-37    
gb|KIR88308.1|  mannose-6-phosphate isomerase                           149   1e-37    
ref|XP_001511999.1|  PREDICTED: mannose-6-phosphate isomerase           149   1e-37    
ref|XP_004344093.1|  mannose6-phosphate isomerase, class I              149   1e-37    
ref|XP_008309845.1|  PREDICTED: mannose-6-phosphate isomerase           149   1e-37    
ref|XP_003979864.1|  PREDICTED: mannose-6-phosphate isomerase-like      144   2e-37    
dbj|GAM28990.1|  hypothetical protein SAMD00019534_121660               149   2e-37    
ref|XP_004364906.1|  mannose-6-phosphate isomerase                      148   2e-37    
ref|XP_003283731.1|  hypothetical protein DICPUDRAFT_26332              148   2e-37    
gb|KJE88373.1|  mannose-6-phosphate isomerase                           148   2e-37    
gb|KHJ89183.1|  phosphomannose isomerase type I                         144   2e-37    
ref|XP_003033541.1|  hypothetical protein SCHCODRAFT_54767              148   2e-37    
gb|EFA76020.1|  mannose-6-phosphate isomerase                           147   3e-37    
gb|KFO65386.1|  Mannose-6-phosphate isomerase                           147   3e-37    
ref|XP_006679522.1|  hypothetical protein BATDEDRAFT_33280              147   3e-37    
ref|XP_007478235.1|  PREDICTED: mannose-6-phosphate isomerase           147   4e-37    
gb|EJT50116.1|  hypothetical protein A1Q1_00583                         148   6e-37    
gb|KDQ14154.1|  hypothetical protein BOTBODRAFT_32941                   146   1e-36    
ref|XP_007397968.1|  hypothetical protein PHACADRAFT_185972             146   1e-36    
ref|XP_003511264.1|  PREDICTED: mannose-6-phosphate isomerase           146   1e-36    
ref|XP_005515521.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-6-ph...    146   1e-36    
ref|XP_003325883.2|  phosphomannose isomerase type I                    146   1e-36    
ref|XP_011160062.1|  PREDICTED: mannose-6-phosphate isomerase iso...    145   2e-36    
gb|KIN99308.1|  hypothetical protein M404DRAFT_1004798                  145   2e-36    
ref|XP_011160040.1|  PREDICTED: mannose-6-phosphate isomerase iso...    145   2e-36    
ref|XP_008932050.1|  PREDICTED: mannose-6-phosphate isomerase iso...    143   2e-36    
ref|XP_007235246.1|  PREDICTED: mannose-6-phosphate isomerase           145   2e-36    
gb|EFZ22736.1|  hypothetical protein SINV_15264                         145   2e-36    
gb|KIM69721.1|  hypothetical protein SCLCIDRAFT_1208231                 145   2e-36    
emb|CDR36108.1|  RHTO0S01e14400g1_1                                     145   2e-36    
ref|XP_007775573.1|  mannose-6-phosphate isomerase                      145   2e-36    
gb|EMS24443.1|  mannose-6-phosphate isomerase                           145   3e-36    
gb|EDK38036.2|  hypothetical protein PGUG_02134                         145   3e-36    
ref|XP_007862634.1|  mannos-6-phosphate isomerase                       145   3e-36    
gb|KEF55290.1|  mannose-6-phosphate isomerase                           145   3e-36    
ref|XP_005069646.1|  PREDICTED: mannose-6-phosphate isomerase           145   3e-36    
ref|XP_001889854.1|  mannos-6-phosphate isomerase                       145   3e-36    
ref|XP_009270272.1|  Mannose-6-phosphate isomerase                      145   4e-36    
gb|KIW63321.1|  mannose-6-phosphate isomerase, class I                  145   4e-36    
gb|KFR02075.1|  Mannose-6-phosphate isomerase                           145   4e-36    
ref|XP_009468015.1|  PREDICTED: mannose-6-phosphate isomerase           144   5e-36    
ref|XP_007906326.1|  PREDICTED: mannose-6-phosphate isomerase iso...    144   5e-36    
ref|XP_001025174.1|  mannose-6-phosphate isomerase, class I famil...    144   5e-36    
ref|XP_008041451.1|  mannos-6-phosphate isomerase                       144   5e-36    
gb|KIX04053.1|  mannose-6-phosphate isomerase, class I                  145   5e-36    
gb|KIX97283.1|  hypothetical protein Z520_06735                         144   6e-36    
ref|XP_005695185.1|  PREDICTED: mannose-6-phosphate isomerase iso...    143   6e-36    
ref|XP_007734742.1|  mannose-6-phosphate isomerase                      144   7e-36    
gb|KFQ62984.1|  Mannose-6-phosphate isomerase                           144   7e-36    
ref|XP_007871886.1|  phosphomannose isomerase type I                    144   8e-36    
gb|KHJ74912.1|  phosphomannose isomerase type I                         139   8e-36    
ref|XP_008497957.1|  PREDICTED: mannose-6-phosphate isomerase           143   8e-36    
gb|KIW26029.1|  mannose-6-phosphate isomerase, class I                  144   8e-36    
gb|KIK97732.1|  hypothetical protein PAXRUDRAFT_135649                  144   8e-36    
ref|XP_011313584.1|  PREDICTED: mannose-6-phosphate isomerase-like      141   9e-36    
ref|XP_002837532.1|  hypothetical protein                               144   9e-36    
ref|XP_001486463.1|  hypothetical protein PGUG_02134                    144   9e-36    
ref|XP_007761687.1|  phosphomannose isomerase type I                    144   1e-35    
gb|KFH65394.1|  phosphomannose isomerase type I                         144   1e-35    
ref|XP_004017895.1|  PREDICTED: mannose-6-phosphate isomerase           144   1e-35    
ref|XP_005695184.1|  PREDICTED: mannose-6-phosphate isomerase iso...    144   1e-35    
ref|XP_008834739.1|  PREDICTED: mannose-6-phosphate isomerase iso...    142   1e-35    
gb|KIP09384.1|  hypothetical protein PHLGIDRAFT_505008                  143   1e-35    
ref|XP_007744674.1|  mannose-6-phosphate isomerase                      144   1e-35    
ref|XP_008834736.1|  PREDICTED: mannose-6-phosphate isomerase iso...    143   1e-35    
ref|NP_001030361.1|  mannose-6-phosphate isomerase                      143   1e-35    
ref|XP_006080716.1|  PREDICTED: mannose-6-phosphate isomerase           143   2e-35    
gb|EYC23560.1|  hypothetical protein Y032_0015g2723                     142   2e-35    
gb|ENN74580.1|  hypothetical protein YQE_08833                          142   2e-35    
gb|EYC23559.1|  hypothetical protein Y032_0015g2723                     139   2e-35    
ref|XP_007906317.1|  PREDICTED: mannose-6-phosphate isomerase iso...    144   2e-35    
ref|XP_009642215.1|  PREDICTED: mannose-6-phosphate isomerase iso...    141   2e-35    
ref|XP_005976000.1|  PREDICTED: mannose-6-phosphate isomerase iso...    143   2e-35    
ref|XP_007537030.1|  PREDICTED: mannose-6-phosphate isomerase iso...    142   2e-35    
ref|XP_004421879.1|  PREDICTED: mannose-6-phosphate isomerase iso...    143   2e-35    
ref|XP_004421880.1|  PREDICTED: mannose-6-phosphate isomerase iso...    142   2e-35    
ref|XP_011335760.1|  PREDICTED: mannose-6-phosphate isomerase iso...    142   3e-35    
ref|XP_008731993.1|  mannose-6-phosphate isomerase, class I             143   3e-35    
ref|XP_011335762.1|  PREDICTED: mannose-6-phosphate isomerase iso...    142   3e-35    
ref|NP_001240850.1|  mannose-6-phosphate isomerase                      142   3e-35    
ref|XP_009484683.1|  PREDICTED: mannose-6-phosphate isomerase iso...    140   3e-35    
ref|XP_007723041.1|  mannose-6-phosphate isomerase                      142   3e-35    
ref|XP_457357.2|  DEHA2B09350p                                          142   3e-35    
ref|XP_005316863.1|  PREDICTED: mannose-6-phosphate isomerase           142   3e-35    
gb|EYC23561.1|  hypothetical protein Y032_0015g2723                     142   4e-35    
ref|XP_008706690.1|  PREDICTED: mannose-6-phosphate isomerase iso...    142   4e-35    
ref|XP_008706689.1|  PREDICTED: mannose-6-phosphate isomerase iso...    142   4e-35    
ref|XP_003173368.1|  mannose-6-phosphate isomerase                      142   4e-35    
ref|XP_011304120.1|  PREDICTED: mannose-6-phosphate isomerase-like      142   4e-35    
ref|XP_003136932.1|  mannose-6-phosphate isomerase                      141   5e-35    
gb|ERL85596.1|  hypothetical protein D910_03015                         141   5e-35    
ref|XP_007065931.1|  PREDICTED: mannose-6-phosphate isomerase           140   5e-35    
ref|XP_005602977.1|  PREDICTED: mannose-6-phosphate isomerase iso...    141   5e-35    
ref|XP_009567148.1|  PREDICTED: mannose-6-phosphate isomerase iso...    139   6e-35    
ref|XP_006461582.1|  hypothetical protein AGABI2DRAFT_222394            142   6e-35    
ref|XP_005393589.1|  PREDICTED: mannose-6-phosphate isomerase iso...    140   6e-35    
ref|XP_009160803.1|  mannose-6-phosphate isomerase                      142   6e-35    
ref|XP_008155278.1|  PREDICTED: mannose-6-phosphate isomerase iso...    141   6e-35    
ref|XP_447802.1|  hypothetical protein                                  141   7e-35    
ref|XP_009909892.1|  PREDICTED: mannose-6-phosphate isomerase iso...    139   7e-35    
ref|XP_003694263.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-6-ph...    141   7e-35    
gb|KDQ26375.1|  hypothetical protein PLEOSDRAFT_176632                  141   7e-35    
ref|XP_007263168.1|  mannos-6-phosphate isomerase                       141   8e-35    
ref|XP_005602976.1|  PREDICTED: mannose-6-phosphate isomerase iso...    141   8e-35    
ref|XP_003463665.1|  PREDICTED: mannose-6-phosphate isomerase           141   8e-35    
gb|KIH68222.1|  mannose-6-phosphate isomerase, class I                  144   9e-35    
ref|XP_003740701.1|  PREDICTED: mannose-6-phosphate isomerase-like      140   9e-35    
ref|XP_005838845.1|  hypothetical protein GUITHDRAFT_41940              139   1e-34    
emb|CDJ82540.1|  Mannose-6-phosphate isomerase domain containing ...    140   1e-34    
ref|XP_003784721.1|  PREDICTED: mannose-6-phosphate isomerase           140   1e-34    
gb|KIM84044.1|  hypothetical protein PILCRDRAFT_424610                  141   1e-34    
ref|XP_003398360.1|  PREDICTED: mannose-6-phosphate isomerase-like      140   1e-34    
ref|XP_002937526.2|  PREDICTED: mannose-6-phosphate isomerase iso...    141   1e-34    
gb|KIW77350.1|  mannose-6-phosphate isomerase, class I                  141   1e-34    
gb|KIW94869.1|  mannose-6-phosphate isomerase, class I                  141   1e-34    
gb|EZF33460.1|  mannose-6-phosphate isomerase                           140   1e-34    
ref|XP_005393588.1|  PREDICTED: mannose-6-phosphate isomerase iso...    140   1e-34    
ref|XP_005905846.1|  PREDICTED: mannose-6-phosphate isomerase           140   1e-34    
emb|CDW55080.1|  mannose 6 phosphate isomerase                          140   1e-34    
ref|XP_010624825.1|  PREDICTED: mannose-6-phosphate isomerase iso...    140   1e-34    
ref|XP_006087951.1|  PREDICTED: mannose-6-phosphate isomerase           140   1e-34    
ref|XP_011117626.1|  hypothetical protein AOL_s00006g15                 141   1e-34    
gb|ELR49029.1|  Mannose-6-phosphate isomerase                           140   1e-34    
ref|XP_001598973.1|  hypothetical protein SS1G_01063                    141   1e-34    
ref|XP_005437554.1|  PREDICTED: mannose-6-phosphate isomerase           140   1e-34    
dbj|GAD95134.1|  mannose-6-phosphate isomerase, class I                 141   1e-34    
gb|EHL00267.1|  putative Mannose-6-phosphate isomerase                  139   2e-34    
gb|EMP30191.1|  Mannose-6-phosphate isomerase                           140   2e-34    
ref|XP_005882824.1|  PREDICTED: mannose-6-phosphate isomerase           140   2e-34    
ref|XP_008586779.1|  PREDICTED: mannose-6-phosphate isomerase           140   2e-34    
ref|XP_623842.1|  PREDICTED: mannose-6-phosphate isomerase-like i...    140   2e-34    
ref|XP_005775908.1|  hypothetical protein EMIHUDRAFT_52642              139   2e-34    
ref|XP_006690173.1|  mannose-6-phosphate isomerase                      140   2e-34    
ref|XP_003704597.1|  PREDICTED: mannose-6-phosphate isomerase-like      140   2e-34    
gb|KGU12950.1|  mannose-6-phosphate isomerase                           140   2e-34    
gb|EGD92428.1|  mannose-6-phosphate isomerase                           140   2e-34    
gb|KHC54026.1|  mannose-6-phosphate isomerase                           140   2e-34    
pdb|1PMI|A  Chain A, Candida Albicans Phosphomannose Isomerase          140   2e-34    
ref|XP_011064085.1|  PREDICTED: mannose-6-phosphate isomerase iso...    140   2e-34    
ref|XP_004180741.1|  hypothetical protein TBLA_0E01650                  140   2e-34    
ref|XP_007197757.1|  PREDICTED: mannose-6-phosphate isomerase iso...    139   2e-34    
gb|KHC58058.1|  mannose-6-phosphate isomerase                           140   2e-34    
ref|XP_010624817.1|  PREDICTED: mannose-6-phosphate isomerase iso...    140   2e-34    
ref|XP_714562.1|  hypothetical protein CaO19.1390                       140   2e-34    
ref|XP_003018751.1|  mannose-6-phosphate isomerase, class I             140   2e-34    
gb|KIK55490.1|  hypothetical protein GYMLUDRAFT_248543                  140   2e-34    
ref|XP_008555945.1|  PREDICTED: mannose-6-phosphate isomerase           140   2e-34    
ref|XP_004872090.1|  PREDICTED: mannose-6-phosphate isomerase iso...    139   2e-34    
gb|EZF33459.1|  mannose-6-phosphate isomerase                           140   2e-34    
gb|EPQ18013.1|  Mannose-6-phosphate isomerase                           140   2e-34    
ref|XP_006628989.1|  PREDICTED: mannose-6-phosphate isomerase-like      139   3e-34    
gb|KGR13934.1|  mannose-6-phosphate isomerase                           140   3e-34    
gb|ESZ98190.1|  mannose-6-phosphate isomerase, class I                  140   3e-34    
gb|ELK37751.1|  Mannose-6-phosphate isomerase                           139   3e-34    
dbj|GAM82182.1|  hypothetical protein ANO11243_001610                   140   3e-34    
ref|XP_006753772.1|  PREDICTED: mannose-6-phosphate isomerase iso...    139   3e-34    
gb|KGT70334.1|  mannose-6-phosphate isomerase                           140   3e-34    
ref|XP_011064084.1|  PREDICTED: mannose-6-phosphate isomerase iso...    139   3e-34    
gb|KGQ95949.1|  mannose-6-phosphate isomerase                           140   3e-34    
ref|XP_714656.1|  hypothetical protein CaO19.8968                       139   3e-34    
ref|XP_005369510.1|  PREDICTED: mannose-6-phosphate isomerase           139   4e-34    
ref|XP_002418846.1|  mannose-6-phosphate isomerase, putative; pho...    139   4e-34    
ref|XP_006822952.1|  PREDICTED: mannose-6-phosphate isomerase-like      139   4e-34    
gb|KGR11799.1|  mannose-6-phosphate isomerase                           139   4e-34    
ref|XP_007197755.1|  PREDICTED: mannose-6-phosphate isomerase iso...    139   4e-34    
gb|KHC72837.1|  mannose-6-phosphate isomerase                           139   4e-34    
gb|KGR00547.1|  mannose-6-phosphate isomerase                           139   4e-34    
ref|XP_004628780.1|  PREDICTED: mannose-6-phosphate isomerase           139   4e-34    
ref|XP_007197756.1|  PREDICTED: mannose-6-phosphate isomerase iso...    139   5e-34    
gb|KIY53400.1|  mannose-6-phosphate isomerase                           139   5e-34    
gb|KHC80739.1|  mannose-6-phosphate isomerase                           139   5e-34    
gb|KHC66042.1|  mannose-6-phosphate isomerase                           139   5e-34    
gb|EGI59455.1|  Mannose-6-phosphate isomerase                           140   5e-34    
ref|XP_004876569.1|  PREDICTED: mannose-6-phosphate isomerase iso...    139   5e-34    
gb|KIV97728.1|  mannose-6-phosphate isomerase, class I                  139   5e-34    
ref|XP_007006022.1|  hypothetical protein TREMEDRAFT_33152              139   6e-34    
ref|XP_009096485.1|  PREDICTED: mannose-6-phosphate isomerase iso...    137   6e-34    
ref|XP_002293857.1|  hypothetical protein THAPSDRAFT_9679               139   6e-34    
gb|KHN73989.1|  putative mannose-6-phosphate isomerase                  142   6e-34    
ref|XP_007118306.1|  PREDICTED: mannose-6-phosphate isomerase iso...    139   6e-34    
ref|XP_001897936.1|  mannose-6-phosphate isomerase, class I famil...    138   6e-34    
ref|XP_007327238.1|  hypothetical protein AGABI1DRAFT_69720             139   6e-34    
gb|KIV83322.1|  mannose-6-phosphate isomerase, class I, variant         138   7e-34    
ref|XP_008086444.1|  RmlC-like cupin                                    139   7e-34    
gb|EGE06621.1|  mannose-6-phosphate isomerase                           138   7e-34    
ref|XP_003010167.1|  mannose-6-phosphate isomerase, class I             139   7e-34    
ref|XP_006888354.1|  PREDICTED: mannose-6-phosphate isomerase iso...    139   7e-34    
gb|EKV06150.1|  Mannose-6-phosphate isomerase                           139   8e-34    
gb|KIO27751.1|  hypothetical protein M407DRAFT_23054                    139   8e-34    
ref|XP_004672897.1|  PREDICTED: mannose-6-phosphate isomerase           138   8e-34    
ref|XP_007118307.1|  PREDICTED: mannose-6-phosphate isomerase iso...    138   8e-34    
gb|KIW14070.1|  mannose-6-phosphate isomerase, class I                  139   8e-34    
gb|KFO37978.1|  Mannose-6-phosphate isomerase                           139   8e-34    
gb|AEE62732.1|  unknown                                                 138   8e-34    



>ref|XP_009618411.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Nicotiana tomentosiformis]
Length=445

 Score =   359 bits (922),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/261 (69%), Positives = 221/261 (85%), Gaps = 1/261 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELKV++QTVPEI EVVG+   +++++L E DG E  KL LR LFT++MS++KDVI++V++
Sbjct  184  ELKVIVQTVPEIIEVVGDTPAKRVLDLNEDDGEEKVKLVLRKLFTEMMSANKDVITEVLA  243

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KLISRLN KN+ R L +KEQLVLRLEKQYP+DVGVLAAFLFN+VKL PGEALYLGANEPH
Sbjct  244  KLISRLNIKNKARRLTDKEQLVLRLEKQYPADVGVLAAFLFNYVKLNPGEALYLGANEPH  303

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GEC+ECMATSDNVVRAGLTPKH DV TLCSMLTY+Q +PEIL+G  LNP+T RYLP
Sbjct  304  AYVYGECVECMATSDNVVRAGLTPKHRDVTTLCSMLTYRQCYPEILQGTKLNPFTMRYLP  363

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PF+EFE+D+CILP+ +  V+P+ PGPSIF+VM GEG MTT S+ E VAEGDVLF+PANTN
Sbjct  364  PFDEFEVDRCILPQQSTVVYPSSPGPSIFVVMGGEGTMTT-SAEETVAEGDVLFAPANTN  422

Query  186  TAVATTLGLSLFRAGIXQYVF  124
              +AT+ GL L+RAG+    F
Sbjct  423  ITIATSSGLHLYRAGVNSRFF  443



>ref|XP_009591548.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Nicotiana tomentosiformis]
Length=419

 Score =   357 bits (915),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/265 (68%), Positives = 222/265 (84%), Gaps = 1/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK+++QTVPEI EVVGNA+ EQ+++L E    E  KL L+ +FT++MS+SKD+I+
Sbjct  156  ISLEELKMIVQTVPEIIEVVGNAHAEQVLDLNEDGEKEKVKLVLQSVFTEIMSASKDMIA  215

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V++KLISRL+ KN+ R L EKEQ+VLRLEKQYP+DVGVLAAFL N+VKLKPGEALYLGA
Sbjct  216  EVIAKLISRLHIKNQARQLTEKEQVVLRLEKQYPADVGVLAAFLLNYVKLKPGEALYLGA  275

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ G+C+E MATSDNVVRAGLTPKH DVKTL SMLTY+QGFPEIL G A+NP+T 
Sbjct  276  NEPHAYIYGDCVEIMATSDNVVRAGLTPKHRDVKTLSSMLTYRQGFPEILNGTAVNPHTM  335

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RY+PPFEEFE+D+CILP+ + A FPA+PGPSIF+VM GEG MTT SS EIV EGDVLF+ 
Sbjct  336  RYIPPFEEFEVDRCILPKQSTAEFPAIPGPSIFMVMEGEGTMTT-SSGEIVCEGDVLFAA  394

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANT+  VAT+ GL L+RAG+    F
Sbjct  395  ANTSITVATSSGLHLYRAGVSSSFF  419



>ref|XP_004232352.1| PREDICTED: mannose-6-phosphate isomerase 2 [Solanum lycopersicum]
Length=434

 Score =   356 bits (914),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 184/265 (69%), Positives = 217/265 (82%), Gaps = 1/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELKV++QTVPEI EVVGNA  E +++L E D  E  KL LR LFT++MS+SKDVI+
Sbjct  169  ISLEELKVIVQTVPEIVEVVGNALAELVLDLSEDDEEEKGKLVLRKLFTEIMSASKDVIT  228

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V++KLISRLN KN+ R L +KEQLVL LEKQYPSDVGVLAAFLFN+VKL PGEALYLGA
Sbjct  229  EVLAKLISRLNIKNKVRVLTDKEQLVLGLEKQYPSDVGVLAAFLFNYVKLNPGEALYLGA  288

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GEC+ECMATSDNVVRAGLTPKH DV+TLCSMLTY+QG PEIL G A+NPYT 
Sbjct  289  NEPHAYVYGECVECMATSDNVVRAGLTPKHRDVRTLCSMLTYRQGNPEILHGTAINPYTV  348

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D CILP  +   FP+ PGPS+F+VM GEG MTT S+  IV EGDVLF+P
Sbjct  349  RYLPPFDEFEVDHCILPPYSTVTFPSAPGPSMFLVMGGEGTMTT-SAEVIVVEGDVLFAP  407

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANTN  +AT+ GL L+RAG+    F
Sbjct  408  ANTNITIATSSGLHLYRAGVNSRFF  432



>ref|XP_004233489.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Solanum lycopersicum]
Length=435

 Score =   355 bits (912),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 175/265 (66%), Positives = 221/265 (83%), Gaps = 1/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK+++QTVPEI E+VG A+ EQ++ L E DG E  K  L+ +FT+LMS++KDV++
Sbjct  170  ISLEELKLIVQTVPEIVELVGTAHTEQVLELNEDDGKEKGKFVLQSVFTELMSANKDVVA  229

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V++KLISRL+ KN+ R L EKEQ+VLRLEKQYP+D+GVLAAFL N+VKL PGEALYLGA
Sbjct  230  EVIAKLISRLHVKNQARELTEKEQVVLRLEKQYPADIGVLAAFLLNYVKLNPGEALYLGA  289

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL G+CIECMATSDNVVRAGLTPKH DVKTLCSMLTY+QGFPEIL+G A+NP+  
Sbjct  290  NEPHAYLYGDCIECMATSDNVVRAGLTPKHRDVKTLCSMLTYRQGFPEILQGTAVNPHVM  349

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RY+PPF+EFE+D+CILP  +   FP++PGPSIF+V+ GEG +T+ SS+EI+ EGDVLF+P
Sbjct  350  RYIPPFDEFEVDRCILPEQSTTEFPSIPGPSIFMVVEGEGTLTS-SSDEIIHEGDVLFAP  408

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANTN  V+T+ GL L+R GI    F
Sbjct  409  ANTNITVSTSSGLQLYRTGINSRFF  433



>ref|XP_009766829.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Nicotiana sylvestris]
Length=440

 Score =   355 bits (912),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 180/261 (69%), Positives = 220/261 (84%), Gaps = 1/261 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELKV++QTVPEI EVVG+A  +++++L E DG E  KL LR LFT++MS++KDVI++V++
Sbjct  181  ELKVIVQTVPEIVEVVGDAPAKRVLDLNEDDGEEKVKLVLRKLFTEMMSANKDVITEVIA  240

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KLISRL+ KN+   L +KEQLVLRLEKQYP+DVGVLAAFLFN+VKL PGEALYLGANEPH
Sbjct  241  KLISRLHIKNKAGQLTDKEQLVLRLEKQYPTDVGVLAAFLFNYVKLNPGEALYLGANEPH  300

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GEC+ECMATSDNVVRAGLTPKH DV TLCSMLTY+Q +PEIL+G  LNP+T RYLP
Sbjct  301  AYVYGECVECMATSDNVVRAGLTPKHRDVTTLCSMLTYRQRYPEILQGTKLNPFTMRYLP  360

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PF+EFE+D+CILP+ +  VFP+  GPSIF+VM GEG MTT S+ E VAEGDVLF+PANTN
Sbjct  361  PFDEFEVDRCILPQQSTVVFPSSSGPSIFVVMGGEGTMTT-SAEETVAEGDVLFAPANTN  419

Query  186  TAVATTLGLSLFRAGIXQYVF  124
              +AT+ GL L+RAG+    F
Sbjct  420  ITIATSSGLHLYRAGVNSRFF  440



>ref|XP_006357852.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Solanum tuberosum]
Length=440

 Score =   355 bits (911),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 183/265 (69%), Positives = 217/265 (82%), Gaps = 1/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELKV++QTVPEI EVVGN   E +++L E D  E  KL LR LFT++MS+SKDVI+
Sbjct  175  ISLEELKVIVQTVPEIVEVVGNVLAELVLDLNEDDEEEKGKLVLRKLFTEIMSASKDVIT  234

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V++KLISRLN KN+ R L  KEQLVL LEKQYP+DVGVLAAFLFN+VKL PGEALYLGA
Sbjct  235  EVLAKLISRLNIKNKVRELTHKEQLVLGLEKQYPADVGVLAAFLFNYVKLNPGEALYLGA  294

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GEC+ECMATSDNVVRAGLTPKH DV+TLCSMLTY+QG PEIL G A+NPYT 
Sbjct  295  NEPHAYVYGECVECMATSDNVVRAGLTPKHRDVRTLCSMLTYRQGNPEILHGTAINPYTM  354

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D+CILP  +   FP+ PGPS+F+VM GEG MTT S+  IVAEGDVLF+P
Sbjct  355  RYLPPFDEFEVDRCILPPYSTVAFPSAPGPSMFVVMGGEGTMTT-SAEVIVAEGDVLFAP  413

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANTN  +AT+ GL L+RAG+    F
Sbjct  414  ANTNITIATSSGLHLYRAGVNSRYF  438



>ref|XP_009595066.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Nicotiana tomentosiformis]
 ref|XP_009595070.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Nicotiana tomentosiformis]
Length=416

 Score =   352 bits (904),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 175/265 (66%), Positives = 216/265 (82%), Gaps = 1/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELKV ++T PEI EV+GNA  EQ++NL E DG E  +L L+  FT +MS  KDVI+
Sbjct  153  VSLEELKVAVKTTPEIVEVIGNAKAEQILNLNEDDGEEEVRLVLQSAFTDIMSVRKDVIA  212

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V++KLISRLN +++ R+L +KEQL+LRLEKQYP+DVGVLAA+L N+VKL PGEALYLG+
Sbjct  213  EVLAKLISRLNIEDQARHLTDKEQLILRLEKQYPADVGVLAAYLLNYVKLNPGEALYLGS  272

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GE +ECMA SDNV+RAGLTPKH DVK LCSMLTY+QGFPEILKG  +NPYT 
Sbjct  273  NEPHAYLYGESVECMANSDNVIRAGLTPKHRDVKILCSMLTYRQGFPEILKGTVVNPYTM  332

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D+CILP+ +  VFP++PGPSIF+VM GEG MTT SS+++V EGDVLF+ 
Sbjct  333  RYLPPFDEFEVDRCILPQQSTTVFPSIPGPSIFLVMGGEGTMTT-SSDKVVTEGDVLFAS  391

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANT   VAT  GL L+RAG+   +F
Sbjct  392  ANTKITVATLSGLHLYRAGVSSRLF  416



>ref|XP_006346906.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Solanum tuberosum]
Length=435

 Score =   353 bits (905),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 177/265 (67%), Positives = 219/265 (83%), Gaps = 1/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK+++QTVPEI E+VG A  EQ++ L E DG E  KL L+ +FT+LMS++KDV++
Sbjct  170  ISLKELKLIVQTVPEIVELVGTARTEQVLELNEDDGKEKGKLVLQSVFTELMSANKDVVA  229

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V++KLISRL+ KN+ R L EKEQ+VLRLEKQYP+D+GVLAAFL N+VKL PGEALYLGA
Sbjct  230  EVIAKLISRLHVKNQARELTEKEQVVLRLEKQYPADIGVLAAFLLNYVKLNPGEALYLGA  289

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL G+CIECMATSDNVVRAGLTPKH DVKTLCSMLTY+QGFPEIL G A+NP+  
Sbjct  290  NEPHAYLYGDCIECMATSDNVVRAGLTPKHRDVKTLCSMLTYRQGFPEILLGTAVNPHVM  349

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RY+PPF+EFE+D+CILP  + A FPA+PGPSIF+V+ GEG +T+ S  EI+ EGDVLF+P
Sbjct  350  RYIPPFDEFEVDRCILPEQSTAEFPAIPGPSIFMVVEGEGTLTS-SLKEIIHEGDVLFAP  408

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANTN  V+T+ GL L+R GI    F
Sbjct  409  ANTNITVSTSSGLQLYRTGINSRFF  433



>ref|XP_009757184.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Nicotiana sylvestris]
Length=421

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/260 (68%), Positives = 220/260 (85%), Gaps = 1/260 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK+++QTVPEI EVVGNA  EQ+++L E    E  KL L+ +FT++MS+SKD+I+
Sbjct  156  ISLEELKLIVQTVPEIIEVVGNACAEQVLDLNEDGEKEKVKLVLQSVFTEIMSASKDMIA  215

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V+++LISRL+ KN+ R L EKEQ+VLRLEKQYP+DVGVLAAFL N+VKLKPGEALYLGA
Sbjct  216  EVIARLISRLHIKNQARQLTEKEQVVLRLEKQYPADVGVLAAFLLNYVKLKPGEALYLGA  275

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ G+C+E MATSDNVVRAGLTPKH DVKTLCSMLTY+QGFPEIL G A+NPYT 
Sbjct  276  NEPHAYIYGDCVEIMATSDNVVRAGLTPKHRDVKTLCSMLTYRQGFPEILNGTAVNPYTM  335

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            R++PPF+EFE+D+CILP  + A FPA+ GPSIF+VM GEG M T SS+EIV EGDVLF+P
Sbjct  336  RFIPPFDEFEVDRCILPEKSTAEFPAILGPSIFLVMEGEGTMNT-SSDEIVCEGDVLFAP  394

Query  198  ANTNTAVATTLGLSLFRAGI  139
            ANT+  VAT+ GL L+RAG+
Sbjct  395  ANTSITVATSSGLHLYRAGV  414



>ref|XP_006365538.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Solanum tuberosum]
Length=418

 Score =   348 bits (894),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 173/265 (65%), Positives = 217/265 (82%), Gaps = 1/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELKV+++T PEI EV+GNA  EQ++NL E DG E  +L L+ +FT +M+  KDV +
Sbjct  151  VSLEELKVIVRTTPEIVEVIGNAKAEQVLNLNEDDGKEEIRLLLQSVFTDIMTVCKDVTA  210

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V++KLISRLN + + R+L +KEQL+L+LEKQYP+DVGVLAA+L N+VKL PGEALYLG+
Sbjct  211  EVLAKLISRLNFEGQARHLTDKEQLILQLEKQYPADVGVLAAYLLNYVKLNPGEALYLGS  270

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GE +ECMA SDNV+RAGLTPK  DVK LCSMLTYKQGFP+ILKG  +NPYT 
Sbjct  271  NEPHAYLYGESVECMANSDNVIRAGLTPKQRDVKILCSMLTYKQGFPDILKGTVVNPYTK  330

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D+CILP+ +  VFP++PGPSIF+V+ GEG MTT SSNE+VAEGDVLF+ 
Sbjct  331  RYLPPFDEFEVDRCILPQDSTTVFPSIPGPSIFLVVEGEGMMTT-SSNEVVAEGDVLFAS  389

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANT+  VAT  GL L+RAG+   +F
Sbjct  390  ANTSITVATLSGLHLYRAGVSSRLF  414



>ref|XP_011021254.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Populus euphratica]
Length=437

 Score =   348 bits (894),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 174/265 (66%), Positives = 212/265 (80%), Gaps = 0/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VL+ VPEI ++VG+A + QL+ + EQD AE  K  LR  FT LMS+SK++ +
Sbjct  170  ISLEELKAVLRDVPEIVDLVGSAEVNQLLQINEQDHAEKVKSVLRSAFTHLMSASKEMTA  229

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V+SKL SRL  ++E R L  KEQLVL+LEKQYP+D+GV++AF  N+VKL PGEALYLGA
Sbjct  230  EVISKLKSRLYTESETRQLTGKEQLVLQLEKQYPADIGVISAFFLNYVKLNPGEALYLGA  289

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GECIECMATSDNVVRAGLTPKHLD++TLCSMLTYKQGFPEILKG  L+PY T
Sbjct  290  NEPHAYLHGECIECMATSDNVVRAGLTPKHLDIQTLCSMLTYKQGFPEILKGFPLSPYIT  349

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D+CILPR A  VFPA+PGPSIF+V+ GEG M T SS ++V EGD LF+P
Sbjct  350  RYLPPFDEFEVDRCILPRGASTVFPAIPGPSIFLVVVGEGTMCTESSKDVVMEGDALFAP  409

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANT  +V+T   L L+RAG+    F
Sbjct  410  ANTEISVSTPSELHLYRAGVNSRFF  434



>ref|XP_009798758.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Nicotiana sylvestris]
Length=417

 Score =   346 bits (887),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 174/265 (66%), Positives = 213/265 (80%), Gaps = 1/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELKV ++T PEI EV+GNA  EQ++NL E DG    +L L+  FT +MS  KDVI 
Sbjct  153  VSLEELKVTVKTTPEIVEVIGNAKAEQILNLNEDDGEVEVRLVLQSAFTDIMSVCKDVIV  212

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V++KLISRLN K++ R+L +KEQL+LRLEKQYP+DVGVLAA+L N+VKL PGEALYLG+
Sbjct  213  EVLAKLISRLNIKDQARHLTDKEQLILRLEKQYPADVGVLAAYLLNYVKLNPGEALYLGS  272

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GE +ECMA SDNV+RAGLTPKH DV+ LCSMLTY+QGFPEILKG  +NPYT 
Sbjct  273  NEPHAYLYGESVECMANSDNVIRAGLTPKHRDVEILCSMLTYRQGFPEILKGTVVNPYTM  332

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D+CILP  +  VFP++PGPSIF+V+ GEG MTT SS+ +VAEGDVLF+ 
Sbjct  333  RYLPPFDEFEVDRCILPPQSTTVFPSIPGPSIFLVVGGEGTMTT-SSDAVVAEGDVLFAS  391

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANT   VAT  GL L+RAG+   +F
Sbjct  392  ANTKITVATLSGLHLYRAGVSSRLF  416



>gb|KDP32959.1| hypothetical protein JCGZ_12990 [Jatropha curcas]
Length=436

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/265 (65%), Positives = 212/265 (80%), Gaps = 0/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELKVVL  VPEI E+VG+A   +++ L EQD  E  K  L+ +FT+LMS+SKD+ +
Sbjct  169  ISLKELKVVLHNVPEIVELVGSADASRVLLLNEQDAKEEVKSILKSIFTQLMSASKDMTT  228

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            KV++KL +RL+ +++ R L +KEQLVL+LEKQYP+DVGV++AF FN+VKL PGEALYLGA
Sbjct  229  KVITKLKTRLHMESQVRQLTDKEQLVLQLEKQYPADVGVISAFFFNYVKLNPGEALYLGA  288

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GECIECMATSDNVVRAGLTPKH D++TLCSMLTYKQG+PEILKG  L+PY T
Sbjct  289  NEPHAYLYGECIECMATSDNVVRAGLTPKHRDIQTLCSMLTYKQGYPEILKGFPLSPYIT  348

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D CILPR A  VFPA+PGPSIF++ AGEG M T  S ++V EGDVLF+P
Sbjct  349  RYLPPFDEFEVDSCILPRGASTVFPAIPGPSIFLIAAGEGRMYTQLSKDVVTEGDVLFAP  408

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANT   + TT  L L+RAG+    F
Sbjct  409  ANTEVTITTTSELCLYRAGVNSRFF  433



>ref|XP_006482242.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Citrus sinensis]
Length=439

 Score =   346 bits (887),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 210/260 (81%), Gaps = 0/260 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VLQ VPEI E+VG+    ++++++ QDG E AK  L+ +FT LM++S ++ +
Sbjct  172  ISLQELKSVLQNVPEIVELVGSEEANRVLHVEMQDGEEKAKFVLQSIFTNLMTASMEMTT  231

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            K  +KL SRL+K+++ R L EKEQLVLRLEKQYP+D+GV+AAF FN+VKL PG+ALYLGA
Sbjct  232  KATTKLKSRLHKESQVRPLTEKEQLVLRLEKQYPADIGVIAAFFFNYVKLNPGQALYLGA  291

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLTPKH DV+TLCSMLTYKQGFPEILKG  L+PY T
Sbjct  292  NEPHAYISGECIECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGFPEILKGFPLSPYIT  351

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D CILP+   +VFPAV GPSIF+V  GEG+M T S N+ VAEGDVLF+P
Sbjct  352  RYLPPFDEFEVDCCILPKGTSSVFPAVSGPSIFLVTDGEGSMLTASHNDAVAEGDVLFAP  411

Query  198  ANTNTAVATTLGLSLFRAGI  139
            ANT   + T+  L L+RAG+
Sbjct  412  ANTEINITTSSKLQLYRAGV  431



>ref|XP_002531475.1| mannose-6-phosphate isomerase, putative [Ricinus communis]
 gb|EEF30899.1| mannose-6-phosphate isomerase, putative [Ricinus communis]
Length=374

 Score =   343 bits (881),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 171/265 (65%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -1

Query  912  FGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskv  733
            F ELK VLQ +PEI E+VG A  +Q++++ EQDG E  K  +R +FT+LMS+SK++I++V
Sbjct  109  FKELKAVLQNIPEIVELVGTADAKQVLHVNEQDGEEKVKSVVRSIFTQLMSASKEMITEV  168

Query  732  vskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
            +SKL  RL+ +++ R L +KEQL+L+LEKQYP+D+GV++AF FN+VKL PGEALYLGANE
Sbjct  169  ISKLKIRLHMESQVRQLTDKEQLILQLEKQYPADIGVISAFFFNYVKLNPGEALYLGANE  228

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRY  373
            PHAYL GECIECMATSDNVVRAGLTPKH DV+TLCSMLTYKQGFPEILKG  L+PY  RY
Sbjct  229  PHAYLYGECIECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGFPEILKGFPLSPYIRRY  288

Query  372  LPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPAN  193
            LPPF+EFE+D CIL +    VFPAVPGPSIF+V AG+G M T  S E+V EGDVLF+PAN
Sbjct  289  LPPFDEFEVDSCILSKGESTVFPAVPGPSIFVVTAGKGMMHTGLSKEVVGEGDVLFAPAN  348

Query  192  TNTAVATTLGLSLFRAGIXQYVFCR  118
                V T+  L L+RAG+    F R
Sbjct  349  IEINVTTSSELRLYRAGVNSRFFQR  373



>gb|KDO59031.1| hypothetical protein CISIN_1g013464mg [Citrus sinensis]
Length=442

 Score =   346 bits (887),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 210/260 (81%), Gaps = 0/260 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VLQ VPEI E+VG+    ++++++ QDG E AK  L+ +FT LM++S ++ +
Sbjct  175  ISLQELKSVLQNVPEIVELVGSEEANRVLHVEMQDGEEKAKFVLQSIFTNLMTASMEMTT  234

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            K  +KL SRL+K+++ R L EKEQLVLRLEKQYP+D+GV+AAF FN+VKL PG+ALYLGA
Sbjct  235  KATTKLKSRLHKESQVRPLTEKEQLVLRLEKQYPADIGVIAAFFFNYVKLNPGQALYLGA  294

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLTPKH DV+TLCSMLTYKQGFPEILKG  L+PY T
Sbjct  295  NEPHAYISGECIECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGFPEILKGFPLSPYIT  354

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D CILP+   +VFPAV GPSIF+V  GEG+M T S N+ VAEGDVLF+P
Sbjct  355  RYLPPFDEFEVDCCILPKGTSSVFPAVSGPSIFLVTDGEGSMLTASHNDAVAEGDVLFAP  414

Query  198  ANTNTAVATTLGLSLFRAGI  139
            ANT   + T+  L L+RAG+
Sbjct  415  ANTEINITTSSKLQLYRAGV  434



>ref|XP_006430767.1| hypothetical protein CICLE_v10011731mg [Citrus clementina]
 gb|ESR44007.1| hypothetical protein CICLE_v10011731mg [Citrus clementina]
Length=442

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/260 (65%), Positives = 211/260 (81%), Gaps = 0/260 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VLQ VPEI E+VG+    ++++++ QDG E AK  L+ +FT LM++S ++ +
Sbjct  175  ISLQELKSVLQNVPEIVELVGSEEANRVLHVEMQDGEEKAKFVLQSIFTNLMTASMEMTT  234

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            K  +KL SRL+K+++ R L EKEQLVLRLEKQYP+D+GV+AAF FN+VKL PG+ALYLGA
Sbjct  235  KATTKLKSRLHKESQVRPLTEKEQLVLRLEKQYPADIGVIAAFFFNYVKLNPGQALYLGA  294

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLTPKH DV+TLCSMLTYKQGFPEILKG  L+PY T
Sbjct  295  NEPHAYISGECIECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGFPEILKGFPLSPYIT  354

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D CILP+   +VFPAV GPSIF+V  GEG+M T S N+ VA+GDVLF+P
Sbjct  355  RYLPPFDEFEVDCCILPKGTSSVFPAVSGPSIFLVSDGEGSMLTASHNDAVAKGDVLFAP  414

Query  198  ANTNTAVATTLGLSLFRAGI  139
            ANT  ++ T+  L L+RAG+
Sbjct  415  ANTEISITTSSKLQLYRAGV  434



>ref|XP_007033251.1| Mannose-6-phosphate isomerase, type I [Theobroma cacao]
 gb|EOY04177.1| Mannose-6-phosphate isomerase, type I [Theobroma cacao]
Length=424

 Score =   343 bits (880),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/260 (65%), Positives = 208/260 (80%), Gaps = 0/260 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VL+ VPEI E+VG A   Q++ + E+DGAE  K  LR +FT+LMS+SK++ +
Sbjct  157  ITLEELKGVLEDVPEIVELVGTASANQVLYIDEKDGAEKVKSALRSVFTQLMSASKEMTT  216

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            K +SKL SRL+ K++ R L EKEQLVL LEKQYP D+GV++AF FN+VKL PGEALYLGA
Sbjct  217  KAISKLKSRLHMKSQLRCLTEKEQLVLHLEKQYPGDIGVISAFFFNYVKLNPGEALYLGA  276

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GECIECMATSDNVVRAGLTPKH D++TLCSMLTYKQG+PEILKG  L+PY T
Sbjct  277  NEPHAYLSGECIECMATSDNVVRAGLTPKHRDIQTLCSMLTYKQGYPEILKGFPLSPYIT  336

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D+CILP+ A  VFPA+PGPSIF+   GEG + T S N+IV EGDVLF+P
Sbjct  337  RYLPPFDEFEVDRCILPKGASTVFPAIPGPSIFLAFVGEGTLHTGSWNDIVTEGDVLFAP  396

Query  198  ANTNTAVATTLGLSLFRAGI  139
            ANT   ++T   L L+R G+
Sbjct  397  ANTEITISTASELQLYRGGV  416



>emb|CBI33642.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   340 bits (872),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V  GELK+VL+ VPEI EVVG+A   Q++++ E+DG E  K  L+ +FT+LMS++K+++S
Sbjct  101  VSLGELKIVLKDVPEIVEVVGSADANQVLDVSEEDGKEKVKSVLQSIFTQLMSANKEMVS  160

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            K+++KL  RL  +++ R L +KEQLVLRLEKQYP DVGV++AF FN+VKL PGEALYLGA
Sbjct  161  KIITKLKIRLQMESQVRQLTDKEQLVLRLEKQYPGDVGVISAFFFNYVKLNPGEALYLGA  220

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GECIECMATSDNVVRAGLTPKH DV+TLCSMLTYKQGFPEIL+G  LNPYT 
Sbjct  221  NEPHAYLYGECIECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGFPEILQGVPLNPYTR  280

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LP+ A A+FPAV GPSIF+V  GEG     +  E V EGDVLF+P
Sbjct  281  RYLPPFDEFEVDCCSLPKGASAMFPAVEGPSIFVVTVGEGTAHVGACEEQVGEGDVLFAP  340

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            A+T  +  T+  L+L+RAG+   +F
Sbjct  341  ADTEISFGTSTQLNLYRAGVNSRLF  365



>ref|XP_002283926.1| PREDICTED: mannose-6-phosphate isomerase 1 [Vitis vinifera]
Length=420

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V  GELK+VL+ VPEI EVVG+A   Q++++ E+DG E  K  L+ +FT+LMS++K+++S
Sbjct  156  VSLGELKIVLKDVPEIVEVVGSADANQVLDVSEEDGKEKVKSVLQSIFTQLMSANKEMVS  215

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            K+++KL  RL  +++ R L +KEQLVLRLEKQYP DVGV++AF FN+VKL PGEALYLGA
Sbjct  216  KIITKLKIRLQMESQVRQLTDKEQLVLRLEKQYPGDVGVISAFFFNYVKLNPGEALYLGA  275

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GECIECMATSDNVVRAGLTPKH DV+TLCSMLTYKQGFPEIL+G  LNPYT 
Sbjct  276  NEPHAYLYGECIECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGFPEILQGVPLNPYTR  335

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LP+ A A+FPAV GPSIF+V  GEG     +  E V EGDVLF+P
Sbjct  336  RYLPPFDEFEVDCCSLPKGASAMFPAVEGPSIFVVTVGEGTAHVGACEEQVGEGDVLFAP  395

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            A+T  +  T+  L+L+RAG+   +F
Sbjct  396  ADTEISFGTSTQLNLYRAGVNSRLF  420



>ref|XP_002305820.1| DARK INDUCIBLE 9 family protein [Populus trichocarpa]
 gb|EEE86331.1| DARK INDUCIBLE 9 family protein [Populus trichocarpa]
Length=440

 Score =   341 bits (874),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 170/265 (64%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +  GELK VL+ VPEI EVVG+A   Q++ + EQD  E  K  LR  FT+LMS+S+++ +
Sbjct  171  ISIGELKGVLRDVPEIVEVVGSAEANQVLQIHEQDHEEKVKSVLRSAFTQLMSASQEITA  230

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            + +SKL SRL  +++ R L  KEQLVL+LEKQYP+D+GV++AF  N+VKL  GEALYLGA
Sbjct  231  EAISKLKSRLYMESKIRQLTGKEQLVLQLEKQYPADIGVISAFFLNYVKLNSGEALYLGA  290

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GECIECMATSDNVVRAGLTPK  D++TLCSMLTYKQGFPEILKG  L+PY T
Sbjct  291  NEPHAYLYGECIECMATSDNVVRAGLTPKLRDIQTLCSMLTYKQGFPEILKGFPLSPYIT  350

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D+CILPR A  VFPA+PGPSIF+VM G+GAM T SS ++V EGDVLF+P
Sbjct  351  RYLPPFDEFEVDRCILPRGASTVFPAIPGPSIFLVMVGDGAMCTGSSKDVVMEGDVLFAP  410

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            AN+  +V+T   L L+RAG+    F
Sbjct  411  ANSEISVSTASELHLYRAGVNSRFF  435



>ref|XP_011099550.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Sesamum indicum]
Length=452

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 177/265 (67%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK V+ +VPEI EVVG++  EQ++++ E+DGA   K  L+ LFTKLMS SK VIS
Sbjct  176  VGLEELKTVVHSVPEIIEVVGSSCAEQVLHISEEDGATKLKEVLQSLFTKLMSVSKAVIS  235

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V+SKLISRLN K E R L +KE+LVLRLEKQYP DVGVLAAFLFN+VKL PGEALYLGA
Sbjct  236  EVISKLISRLNLKREVRELTDKEELVLRLEKQYPRDVGVLAAFLFNYVKLNPGEALYLGA  295

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GEC+ECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQGFPEIL G   NPYT 
Sbjct  296  NEPHAYIHGECVECMATSDNVVRAGLTPKNRDVQTLCSMLTYKQGFPEILPGVPSNPYTV  355

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            +YLPPF+EFE+++C LP+    VFPAVPGPS+F+VM GEG M T  S  ++AEGDVLF+P
Sbjct  356  KYLPPFDEFEVERCNLPQETSTVFPAVPGPSLFVVMTGEGKMRTAFSEMLIAEGDVLFAP  415

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANT  A  T  G+ ++RAG+    F
Sbjct  416  ANTQIATETISGMDIYRAGVNSRFF  440



>gb|KHG02503.1| Mannose-6-phosphate isomerase [Gossypium arboreum]
Length=425

 Score =   338 bits (867),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 167/261 (64%), Positives = 208/261 (80%), Gaps = 0/261 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL  +PEI E+VGNA  +Q++++ +QDGAE  K  LR +FT+LMS+SK++ +K ++
Sbjct  161  ELKGVLVDIPEIVELVGNASAKQVLDISKQDGAEKVKYALRSVFTQLMSASKEMATKSIA  220

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL SRL+ +++ R L EKEQLVL LEKQYP D+GV++AF FN+VKL PGEALYLGANEPH
Sbjct  221  KLKSRLHVESQLRCLTEKEQLVLHLEKQYPGDIGVISAFFFNYVKLNPGEALYLGANEPH  280

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPKH D++TLCSMLTYKQG+P+ILKG  L+PY TRYLP
Sbjct  281  AYLSGECIECMATSDNVVRAGLTPKHRDIQTLCSMLTYKQGYPDILKGFPLSPYITRYLP  340

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D CILP+ A  VFPA+PGPSIF+V  G+G     S  +IV EGDVLF+P+NT 
Sbjct  341  PFEEFEVDCCILPKGASTVFPAIPGPSIFLVFLGKGTFRIGSREDIVTEGDVLFAPSNTE  400

Query  186  TAVATTLGLSLFRAGIXQYVF  124
              + T+  L L+RAG+    F
Sbjct  401  ITITTSSELQLYRAGVNSRFF  421



>ref|XP_006383443.1| hypothetical protein POPTR_0005s15560g [Populus trichocarpa]
 gb|ERP61240.1| hypothetical protein POPTR_0005s15560g [Populus trichocarpa]
Length=434

 Score =   338 bits (866),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 171/265 (65%), Positives = 209/265 (79%), Gaps = 3/265 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VL+ VPEI E+VG+A + QL+ + EQD  +  K  LR  FT LMS+SK++ +
Sbjct  170  ISLEELKAVLRDVPEIVELVGSAEVNQLLQINEQDHEKKVKSVLRSAFTHLMSASKEMTA  229

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
             V+SKL SRL  ++E   L  KEQLVL+LEKQYP+D+GV++AF  N+VKL PGEALYLGA
Sbjct  230  DVISKLKSRLYTESE---LTGKEQLVLQLEKQYPADIGVISAFFLNYVKLNPGEALYLGA  286

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GEC+ECMATSDNVVRAGLTPKHLD++TLCSMLTYKQGFPEILKG  L+PY T
Sbjct  287  NEPHAYLHGECVECMATSDNVVRAGLTPKHLDIQTLCSMLTYKQGFPEILKGFPLSPYIT  346

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D+CILPR A  VFPA+PGPSIF+V+ GEG M T SS ++V EGD LF+P
Sbjct  347  RYLPPFDEFEVDRCILPRGASTVFPAIPGPSIFLVVVGEGTMCTESSKDVVMEGDALFAP  406

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANT  +V+T   L L+RAG+    F
Sbjct  407  ANTEISVSTPSELHLYRAGVNSRFF  431



>emb|CAN60179.1| hypothetical protein VITISV_011365 [Vitis vinifera]
Length=455

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/265 (63%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK+VL+ VPEI EVVG+A   Q++++ E+DG E  K  L+ +FT+LMS++K+++S
Sbjct  191  VSLXELKIVLKDVPEIVEVVGSADANQVLDVSEEDGKEKVKSVLQSIFTQLMSANKEMVS  250

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            K+++KL  RL  +++ R L +KEQLVLRLEKQYP DVGV++AF FN+VKL PGEALYLGA
Sbjct  251  KIITKLKIRLQMESQMRQLTDKEQLVLRLEKQYPGDVGVISAFFFNYVKLNPGEALYLGA  310

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GECIECMATSDNVVRAGLTPKH DV+TLCSMLTYKQGFPEIL+G  LNPYT 
Sbjct  311  NEPHAYLYGECIECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGFPEILQGVPLNPYTR  370

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LP+ A A+FPAV GPSIF+V  GEG     +  E V EGDVLF+P
Sbjct  371  RYLPPFDEFEVDCCSLPKGASAMFPAVEGPSIFVVTVGEGTAHVGACEEQVGEGDVLFAP  430

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            A+T  +  T+  L+L+RAG+   +F
Sbjct  431  ADTEISFGTSTQLNLYRAGVNSRLF  455



>gb|EYU44629.1| hypothetical protein MIMGU_mgv1a0065651mg, partial [Erythranthe 
guttata]
Length=268

 Score =   331 bits (848),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/256 (64%), Positives = 203/256 (79%), Gaps = 2/256 (1%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V+Q+VPEI E+VG++  +Q++ + E DG +  K   + LFT L+S S  VIS+++ 
Sbjct  1    ELKSVIQSVPEIVEIVGSSRADQVLQITENDGEKKLKEVFKSLFTDLISVSNSVISEIIP  60

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KLI RLN K E+  L EKE+LVLRLE+QYP D+GV+AAFLFN+VKL PGEALYLGANEPH
Sbjct  61   KLIRRLNSKREK--LTEKEELVLRLERQYPGDIGVIAAFLFNYVKLNPGEALYLGANEPH  118

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GECIECMATSDNVVRAGLTPKH DV+TLCSMLTYKQGFPEIL G   NPYT +Y+P
Sbjct  119  AYIHGECIECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGFPEILNGVPSNPYTVKYIP  178

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PF+EFE+D+C LP  A  +FPAV GPS+F+V +GEG M   SS E+V EGDVLF+PAN+ 
Sbjct  179  PFDEFEVDRCNLPEEASTIFPAVNGPSVFVVTSGEGTMGVASSKELVREGDVLFAPANSE  238

Query  186  TAVATTLGLSLFRAGI  139
              V T  GL+L+RAG+
Sbjct  239  ITVETISGLNLYRAGV  254



>ref|XP_011035071.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Populus euphratica]
Length=440

 Score =   337 bits (863),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/265 (63%), Positives = 208/265 (78%), Gaps = 0/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +  GELK VL+ VPE+ E+VG+A   +++ + EQD  E  K  LR  FT+LMS+S+++ +
Sbjct  171  ISIGELKGVLRDVPEVVELVGSAEANRVLQIHEQDHEEKVKSVLRSAFTQLMSASQEITA  230

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            + +SKL SRL  +++ R L  KEQLVL+LEKQYP+D+GV++AF  N+VKL  GEALYLGA
Sbjct  231  EAISKLKSRLYMESKTRQLTGKEQLVLQLEKQYPADIGVISAFFLNYVKLNSGEALYLGA  290

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GECIECMATSDNVVRAGLTPK  D++TLCSMLTYKQGFPEILKG  L+PYTT
Sbjct  291  NEPHAYLYGECIECMATSDNVVRAGLTPKLRDIQTLCSMLTYKQGFPEILKGFPLSPYTT  350

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D+CILPR A  VFPA+PGPSIF+VM GEGAM   SS + V EGDVLF+P
Sbjct  351  RYLPPFDEFEVDRCILPRGASTVFPAIPGPSIFLVMVGEGAMCAGSSKDEVMEGDVLFAP  410

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            AN+   V+T   L L+RAG+    F
Sbjct  411  ANSEITVSTASELHLYRAGVNSRFF  435



>ref|XP_004242042.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Solanum lycopersicum]
Length=418

 Score =   336 bits (861),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 214/265 (81%), Gaps = 1/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELKV+++T PEI EVVGN+  EQ++ L + +G E  +L L+ +FT +M+  KDV +
Sbjct  151  VSLEELKVIVRTTPEIVEVVGNSKAEQVLILNDDEGKEEIRLLLQSVFTDIMTVCKDVTA  210

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V++KLISRLN + + R+L EKEQL+L+LEKQYP+DVGVLAA+L N+VKL PGEALYLG+
Sbjct  211  EVLAKLISRLNFEGQARHLTEKEQLILQLEKQYPADVGVLAAYLLNYVKLNPGEALYLGS  270

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GE +ECMA SDNV+RAGLTPK  DVK LCSMLTYKQGFP+ILKG  +NPYT 
Sbjct  271  NEPHAYLYGESVECMANSDNVIRAGLTPKQRDVKILCSMLTYKQGFPDILKGTVVNPYTK  330

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D+CILP+ +  VF ++PGPSIF+V+ GEG MTT SSN++VAEGDVLF+ 
Sbjct  331  RYLPPFDEFEVDRCILPQNSTTVFASIPGPSIFLVVEGEGTMTT-SSNKVVAEGDVLFAS  389

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANT+  VAT  GL L RAG+   +F
Sbjct  390  ANTSITVATMSGLHLCRAGVSSRLF  414



>gb|KJB48153.1| hypothetical protein B456_008G055300 [Gossypium raimondii]
Length=424

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/261 (64%), Positives = 208/261 (80%), Gaps = 1/261 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL  +PEI E+VGNA  +Q++++ +QDGAE  K  LR +FT+LMS+SK++ +K ++
Sbjct  161  ELKGVLD-IPEIVELVGNASAKQVLDIDKQDGAEKVKYALRSVFTQLMSASKEMATKSIA  219

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL SRL+ +++ R L EKEQLVL LEKQYP D+GV++AF FN+VKL PGEALYLGANEPH
Sbjct  220  KLKSRLHVESQLRCLTEKEQLVLHLEKQYPGDIGVISAFFFNYVKLNPGEALYLGANEPH  279

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPKH D++TLCSMLTYKQG+P+ILKG  L+PY TRYLP
Sbjct  280  AYLSGECIECMATSDNVVRAGLTPKHRDIQTLCSMLTYKQGYPDILKGFPLSPYITRYLP  339

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D CILP+ A  VFPA+PGPSIF+V  G+G     S  +IV EGDVLF+P+NT 
Sbjct  340  PFEEFEVDCCILPKGASTVFPAIPGPSIFLVFLGKGTFHIGSREDIVTEGDVLFAPSNTE  399

Query  186  TAVATTLGLSLFRAGIXQYVF  124
              + T+  L L+RAG+    F
Sbjct  400  ITITTSSELQLYRAGVNSRFF  420



>emb|CDP02773.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   331 bits (848),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 167/265 (63%), Positives = 215/265 (81%), Gaps = 2/265 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK V+  VPEI EVVG  Y+++L+ + E+D  + AK  L+L+FT+LM++SKDVI+
Sbjct  110  ISLEELKSVVHNVPEIVEVVGTKYVDELLCVHEED-VKKAKEVLQLIFTQLMAASKDVIA  168

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            + +S+LISRL+ KNE R L +KE LVLRLEKQYP+D+G+LAAFL N++KLKPG+ALYLGA
Sbjct  169  QALSRLISRLSIKNEARELTDKEHLVLRLEKQYPADIGLLAAFLLNYIKLKPGQALYLGA  228

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            +EPHAY+ GECIECMATSDNVVRAGLTPK  DV+TLCSMLTYKQG PEIL G ALN Y  
Sbjct  229  DEPHAYIYGECIECMATSDNVVRAGLTPKSRDVQTLCSMLTYKQGLPEILDGVALNAYVH  288

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            R+ PPF+EFE+D+CILP+ +  VFP+VPGP+I++V+ G+G +++ +S E+V EGDVLFSP
Sbjct  289  RFPPPFDEFEVDRCILPQGSSVVFPSVPGPAIYLVIGGQGTISS-TSEELVGEGDVLFSP  347

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANT   V TT GLSL+RAG+    F
Sbjct  348  ANTEITVTTTSGLSLYRAGVNSKFF  372



>gb|EYU34411.1| hypothetical protein MIMGU_mgv1a006972mg [Erythranthe guttata]
Length=424

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/256 (66%), Positives = 208/256 (81%), Gaps = 0/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E K VL+ VPEI EVVG +Y +Q++++ +++G    K  LR LFTKLMS+SK VI++VV 
Sbjct  160  EFKNVLRHVPEIVEVVGTSYADQILHISDKEGEMKLKEVLRSLFTKLMSASKAVITEVVV  219

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KLI+RLN K+E R L EKE+LVL LEKQYP DVGV+A+FL N+VKLK GEALY+GANEPH
Sbjct  220  KLITRLNIKHEARQLTEKEELVLMLEKQYPGDVGVIASFLLNYVKLKSGEALYIGANEPH  279

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GEC+ECMATSDNVVRAGLTPK LDV+TLCSMLTYKQGFPEIL+G   NPYT +YLP
Sbjct  280  AYIHGECVECMATSDNVVRAGLTPKTLDVQTLCSMLTYKQGFPEILRGIPSNPYTVKYLP  339

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PF+EFE+D+CILP+    VFPAV GPS+F+V++GEG M    + E+V EGDVLF PA+T 
Sbjct  340  PFDEFEVDRCILPQETSTVFPAVNGPSVFVVVSGEGEMGPAFTEELVGEGDVLFIPADTE  399

Query  186  TAVATTLGLSLFRAGI  139
              V T+ GL+L+RAGI
Sbjct  400  ITVKTSSGLNLYRAGI  415



>ref|XP_011097179.1| PREDICTED: mannose-6-phosphate isomerase 1 isoform X1 [Sesamum 
indicum]
Length=439

 Score =   330 bits (846),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 170/265 (64%), Positives = 203/265 (77%), Gaps = 0/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   E K V++ VPEI EVVG A   Q +N+ E DG +  K  L  LFTKLMS+SK +IS
Sbjct  174  VGLEEFKSVVRNVPEIIEVVGTASAHQALNISEDDGEKKLKEVLHSLFTKLMSTSKAIIS  233

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
             VV KLISRLN   + R L +KE+LVLRLEKQ+P DVGV+AAFL N+VKL  GEALY+ A
Sbjct  234  DVVLKLISRLNITRKVRQLTDKEELVLRLEKQFPGDVGVIAAFLLNYVKLSAGEALYVAA  293

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GEC+ECMATSDNVVRAGLTPK LDV+TLCSMLTYKQGFPEIL G   NPYT 
Sbjct  294  NEPHAYIHGECVECMATSDNVVRAGLTPKTLDVQTLCSMLTYKQGFPEILHGVPSNPYTV  353

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            +Y+PPF+EFE+D+CILP+    +FPAVPGPS+F+V+AGE  M  P S E+V EGDV+F+P
Sbjct  354  KYMPPFDEFEVDRCILPQEKSTIFPAVPGPSVFVVIAGEAVMRLPFSEELVTEGDVIFTP  413

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            ANT   V TT GL+L+RAG+    F
Sbjct  414  ANTEITVETTSGLNLYRAGVNSKFF  438



>ref|XP_010107822.1| putative mannose-6-phosphate isomerase [Morus notabilis]
 gb|EXC17063.1| putative mannose-6-phosphate isomerase [Morus notabilis]
Length=435

 Score =   327 bits (839),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 198/265 (75%), Gaps = 0/265 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VL  VPEI E+VG+    QL+NL +QD  E  K+ LR +FTKLMS+SK++I 
Sbjct  168  ISLQELKSVLHDVPEIVELVGSTDANQLLNLSDQDAEEKVKIVLRSIFTKLMSASKEMII  227

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +  SKL  RL+ +++ R L +KE+LVL LEKQYP+DVGV++AF FN+VKL PGEALYLG 
Sbjct  228  EATSKLKDRLHFESQVRQLTDKERLVLELEKQYPADVGVISAFFFNYVKLNPGEALYLGP  287

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GECIECMATSDNVVRAGLTPKH DV TLCSMLTYKQG+PEIL+G  LNPY  
Sbjct  288  NEPHAYLFGECIECMATSDNVVRAGLTPKHRDVNTLCSMLTYKQGYPEILQGVPLNPYVR  347

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LPR     FPAVPGPSI +V  GEG M T    +++AEGDVLF P
Sbjct  348  RYLPPFDEFEVDSCNLPRLESVAFPAVPGPSISMVTRGEGIMHTSFLEDVIAEGDVLFIP  407

Query  198  ANTNTAVATTLGLSLFRAGIXQYVF  124
            A+T  ++ +   L L+R G+    F
Sbjct  408  ADTEFSITSASDLQLYRTGVNSKFF  432



>ref|XP_010265087.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Nelumbo nucifera]
Length=431

 Score =   325 bits (834),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 166/266 (62%), Positives = 204/266 (77%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL +VPEI E+VG+    ++++  +QDG E  K  L+ +FT+LMS+S+D IS
Sbjct  164  VSLEELKNVLLSVPEIIELVGSKSAGEILHANKQDGEEKIKAMLQSIFTQLMSTSEDEIS  223

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
              VSKL +RLN +N+ R L EKEQL+LRLEKQYP D+GV++AF  N+VKL PGEALYLGA
Sbjct  224  GAVSKLKTRLNMENKMRQLTEKEQLILRLEKQYPGDIGVISAFFLNYVKLNPGEALYLGA  283

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLTPK+ DV TLCSMLTY+QGFPEIL+G  LNPYTT
Sbjct  284  NEPHAYIFGECIECMATSDNVVRAGLTPKYRDVHTLCSMLTYRQGFPEILQGVPLNPYTT  343

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSN-EIVAEGDVLFS  202
            RYLPPFEEFE+D+C+LP+ A   FPAVPGPS+F+V  G G + T SS+ + + EG VLF 
Sbjct  344  RYLPPFEEFEVDRCVLPKGASVKFPAVPGPSLFVVTTGRGTIQTESSSADAIVEGCVLFV  403

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
            PA+T   V    GL L+RAG+    F
Sbjct  404  PADTELGVTAMDGLQLYRAGVNSKFF  429



>ref|XP_003552724.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Glycine max]
Length=421

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 165/266 (62%), Positives = 199/266 (75%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VL TVPEI E+VG      ++   +QDG E  K  L+ +FT LMS+SKD ++
Sbjct  153  ITLKELKGVLHTVPEIVELVGATNTNLVLQTNDQDGEEKVKPVLQAVFTDLMSASKDRVT  212

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
              V++L SRL K++E R L +KEQLVLRLEKQYP+DVGV+AAF  NHVKL PGEAL+LGA
Sbjct  213  DAVNRLKSRLLKESEVRQLTDKEQLVLRLEKQYPADVGVIAAFFLNHVKLNPGEALFLGA  272

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GEC+ECMATSDNVVRAGLTPKH DV+TLCSMLTYKQG PEIL+G ++NPY  
Sbjct  273  NEPHAYLSGECVECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGSPEILRGVSVNPYVN  332

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTP-SSNEIVAEGDVLFS  202
            +Y PPFEEFEID+CILP+    VFPAVPGPSIF+V  GEG M T      +V EGDVLF+
Sbjct  333  KYTPPFEEFEIDRCILPQGETVVFPAVPGPSIFLVTVGEGTMNTGLPKGHVVTEGDVLFA  392

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
             ANT  +V +   L+L+R G+    F
Sbjct  393  AANTEISVTSASELNLYRTGVNSKFF  418



>gb|AAX31279.1| phosphomannose isomerase [Cyamopsis tetragonoloba]
Length=428

 Score =   322 bits (826),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/263 (62%), Positives = 200/263 (76%), Gaps = 2/263 (1%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL TVPE+ E+VG A    ++  ++QDG E  K  L+ +FT LMS+SK+ ++  V+
Sbjct  163  ELKAVLHTVPEVVELVGAANANLILQTRDQDGEEKVKPVLQTVFTHLMSASKEKVTDAVN  222

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            +L SRL+K++E R L +KEQLVLRLEKQYP+DVGV+AAF  N VKL PGEAL+LGANEPH
Sbjct  223  RLKSRLHKESEVRQLTDKEQLVLRLEKQYPADVGVIAAFFLNLVKLSPGEALFLGANEPH  282

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGL+PKH DV+TLCSMLTYKQG PEIL G  LNPY  +Y P
Sbjct  283  AYLHGECIECMATSDNVVRAGLSPKHRDVQTLCSMLTYKQGSPEILPGVPLNPYVKKYTP  342

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTT--PSSNEIVAEGDVLFSPAN  193
            PF+EFEID+CILP+    VFPAVPGPSIF+V  GEG M T  PS  ++V+EGDVLF+ A 
Sbjct  343  PFKEFEIDRCILPQGKTVVFPAVPGPSIFLVTVGEGVMNTGSPSKEQVVSEGDVLFAAAY  402

Query  192  TNTAVATTLGLSLFRAGIXQYVF  124
            T  +V +   L L+R G+    F
Sbjct  403  TEISVTSASELHLYRTGVNSRFF  425



>ref|XP_003532343.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Glycine max]
 gb|KHN24932.1| Mannose-6-phosphate isomerase [Glycine soja]
Length=421

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 164/266 (62%), Positives = 196/266 (74%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VL TVPEI E+VG      ++   +QDG E  K  L+ +FT LMS+ KD ++
Sbjct  153  ITLKELKGVLHTVPEIVELVGATNTNLVLQTNDQDGEEKVKPVLQAVFTDLMSACKDRVT  212

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
              V++L SRL K++E R L +KEQLVL+LEKQYP+DVGV+AAF  NHVKL PGEAL+LGA
Sbjct  213  DAVNRLKSRLLKESEVRQLTDKEQLVLQLEKQYPADVGVIAAFFLNHVKLNPGEALFLGA  272

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GEC+ECMATSDNVVRAGLTPKH DV+TLCSMLTYKQG PEIL G ++NPY  
Sbjct  273  NEPHAYLSGECVECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGSPEILHGVSVNPYVN  332

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS-SNEIVAEGDVLFS  202
            +Y PPFEEFEID+CILP+    VFPAVPGPSIF+V  GEG M T S    +V EGDVLF+
Sbjct  333  KYTPPFEEFEIDRCILPQGETVVFPAVPGPSIFLVTVGEGTMNTGSPKGHVVTEGDVLFA  392

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
             ANT   V +   L L+R G+    F
Sbjct  393  AANTEIRVTSASELHLYRTGVNSKFF  418



>gb|KHN17308.1| Mannose-6-phosphate isomerase [Glycine soja]
Length=421

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 164/266 (62%), Positives = 198/266 (74%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VL TVPEI E+VG      ++   +QDG E  K  L+ +FT LMS+SKD ++
Sbjct  153  ITLKELKGVLHTVPEIVELVGATNTNLVLQTNDQDGEEKVKPVLQAVFTDLMSASKDRVT  212

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
              V++L S L KK+E R L +KEQLVL+LEKQYP+DVGV+AAF  NHVKL PGEAL+LGA
Sbjct  213  DAVNRLKSCLLKKSEVRQLTDKEQLVLQLEKQYPADVGVIAAFFLNHVKLNPGEALFLGA  272

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GEC+ECMATSDNVVRAGLTPKH DV+TLCSMLTYKQG PEIL+G ++NPY  
Sbjct  273  NEPHAYLSGECVECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGSPEILRGVSVNPYVN  332

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTP-SSNEIVAEGDVLFS  202
            +Y PPFEEFEID+CILP+    VFPAVPGPSIF+V  GEG M T      +V EGDVLF+
Sbjct  333  KYTPPFEEFEIDRCILPQGETVVFPAVPGPSIFLVTVGEGTMNTGLPKGHVVTEGDVLFA  392

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
             ANT  +V +   L+L+R G+    F
Sbjct  393  AANTEISVTSASELNLYRTGVNSKFF  418



>ref|XP_004489108.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Cicer arietinum]
Length=430

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/266 (60%), Positives = 201/266 (76%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VL TVPE+ E+VG A    ++   + +G    K  L+ +FT LMS+SK++++
Sbjct  162  ITLKELKAVLHTVPEVVELVGAANANLILQTSDLNGEVKVKPVLQAVFTHLMSASKEIVT  221

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
              V++L +RL++++E R L EKEQLVL+LE QYPSD+GV+AAF  NHVKL PGEAL+LGA
Sbjct  222  DAVNRLKNRLHRESEVRQLTEKEQLVLQLENQYPSDIGVIAAFFLNHVKLSPGEALFLGA  281

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GEC+ECMATSDNVVRAGLTPKH DV TLCSMLTYKQGFPEIL+G ++NPY  
Sbjct  282  NEPHAYLSGECVECMATSDNVVRAGLTPKHRDVPTLCSMLTYKQGFPEILRGVSMNPYVN  341

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSN-EIVAEGDVLFS  202
            +Y+PPFEEFEID+CILP+  + VFPAVPGPSIF+V AGEG M+T S     + EGDVLF+
Sbjct  342  KYIPPFEEFEIDRCILPKGERIVFPAVPGPSIFLVTAGEGVMSTGSPKVYAITEGDVLFA  401

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
             A T  +V +   L L+R GI    F
Sbjct  402  AAYTEISVVSESELHLYRTGINSNFF  427



>gb|KHG01171.1| Mannose-6-phosphate isomerase [Gossypium arboreum]
Length=432

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 167/268 (62%), Positives = 208/268 (78%), Gaps = 3/268 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDG--AENAKLTLRLLFTKLMssskdv  745
            +   ELK VL+ VPEI E+VG A  +Q++ + E+ G  A+ AK  LR +FT+LMS+SK++
Sbjct  162  ITLQELKEVLEDVPEIVELVGTASAKQVMEIDERGGDTADKAKTALRSVFTQLMSASKEM  221

Query  744  iskvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYL  565
             +K +SKL SRL  +++ R+L EKE+LVL+LEKQYP D+GVL+AF FN+VKLKPGEALYL
Sbjct  222  TTKAISKLKSRLLLQSQLRSLTEKEELVLQLEKQYPGDIGVLSAFFFNYVKLKPGEALYL  281

Query  564  GANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPY  385
             ANEPHAYL G+C+ECMATSDNVVRAGLTPKH D++TLCSMLTY QG+PEIL G AL+PY
Sbjct  282  AANEPHAYLSGDCVECMATSDNVVRAGLTPKHRDIQTLCSMLTYNQGYPEILSGLALSPY  341

Query  384  TTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLF  205
             TRYLPPF+EFE+D+CILP+ +  VFPA+PGPSIF+   GEG M T     IV EGDV+F
Sbjct  342  ITRYLPPFDEFEVDRCILPKGSSVVFPAIPGPSIFLAFVGEGKMKTGCWEGIVTEGDVVF  401

Query  204  SPANTNTAV-ATTLGLSLFRAGIXQYVF  124
             PANT   + ATT  L L+RAGI    F
Sbjct  402  EPANTELVITATTSELQLYRAGINSRFF  429



>ref|XP_008381268.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X2 [Malus 
domestica]
Length=436

 Score =   315 bits (807),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 201/266 (76%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELKVVL  VPEI E+VG+   +++  + + D  E  K  LR LFT LM +SK++I+
Sbjct  168  INLKELKVVLDNVPEIEELVGSEEAKKVSGITDLDEEEKVKSALRSLFTHLMLASKEMIT  227

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
             V++K+  RL+ +++ R L EKEQLVL+L KQYP+DVGV++AF  NHVKL PGEALY+GA
Sbjct  228  TVITKMKDRLHAESQARLLTEKEQLVLQLVKQYPTDVGVISAFFLNHVKLNPGEALYIGA  287

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GEC+ECMATSDNVVRAGLTPKH+DV+TLCSML+YKQG+P+IL+G A+ PY T
Sbjct  288  NEPHAYIFGECVECMATSDNVVRAGLTPKHMDVQTLCSMLSYKQGYPDILQGVAIGPYVT  347

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS-SNEIVAEGDVLFS  202
            RYLPPF+EFE+D+C LP+   A FPAVPGPSIF+V  GEG M   +   +++ EGDVLF+
Sbjct  348  RYLPPFDEFEVDRCQLPQGESAEFPAVPGPSIFVVTFGEGIMYASNVQGDVITEGDVLFA  407

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
            PANT   +     L ++RAG+    F
Sbjct  408  PANTRIRITGASELQIYRAGVSSMFF  433



>gb|ACU18571.1| unknown [Glycine max]
Length=282

 Score =   310 bits (793),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 162/266 (61%), Positives = 195/266 (73%), Gaps = 2/266 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL TVPE+ E+V    +  ++ + ++DG E  K  L+ LFT +MS+ K+ ++
Sbjct  15   VTLKELKAVL-TVPEVVELVVAENVNSVLQITDEDGEEKVKPILKSLFTDIMSAGKERVA  73

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
              V +L SRL+K+++ R L EKEQLVLRLEKQYPSDVGV+AAF  NHVKL PGEAL+LGA
Sbjct  74   GAVDRLRSRLHKESQVRQLTEKEQLVLRLEKQYPSDVGVIAAFFLNHVKLAPGEALFLGA  133

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLTPKH DV+TLCS LTYKQG PEIL+G  +N Y  
Sbjct  134  NEPHAYICGECIECMATSDNVVRAGLTPKHRDVQTLCSTLTYKQGSPEILRGVPINQYVN  193

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS-SNEIVAEGDVLFS  202
            +Y+PPFEEFEID CILP+  K VFPAVPGPSIF+V  GEG MTT S     + EG VLF 
Sbjct  194  KYIPPFEEFEIDCCILPQGEKVVFPAVPGPSIFLVTVGEGMMTTESLKGYPITEGHVLFV  253

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
             ANT   V++   L LFR G+    F
Sbjct  254  AANTEITVSSAPQLHLFRTGVNSRFF  279



>ref|XP_008381266.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X1 [Malus 
domestica]
Length=442

 Score =   315 bits (807),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 201/266 (76%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELKVVL  VPEI E+VG+   +++  + + D  E  K  LR LFT LM +SK++I+
Sbjct  174  INLKELKVVLDNVPEIEELVGSEEAKKVSGITDLDEEEKVKSALRSLFTHLMLASKEMIT  233

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
             V++K+  RL+ +++ R L EKEQLVL+L KQYP+DVGV++AF  NHVKL PGEALY+GA
Sbjct  234  TVITKMKDRLHAESQARLLTEKEQLVLQLVKQYPTDVGVISAFFLNHVKLNPGEALYIGA  293

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GEC+ECMATSDNVVRAGLTPKH+DV+TLCSML+YKQG+P+IL+G A+ PY T
Sbjct  294  NEPHAYIFGECVECMATSDNVVRAGLTPKHMDVQTLCSMLSYKQGYPDILQGVAIGPYVT  353

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS-SNEIVAEGDVLFS  202
            RYLPPF+EFE+D+C LP+   A FPAVPGPSIF+V  GEG M   +   +++ EGDVLF+
Sbjct  354  RYLPPFDEFEVDRCQLPQGESAEFPAVPGPSIFVVTFGEGIMYASNVQGDVITEGDVLFA  413

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
            PANT   +     L ++RAG+    F
Sbjct  414  PANTRIRITGASELQIYRAGVSSMFF  439



>ref|XP_008244515.1| PREDICTED: mannose-6-phosphate isomerase 1 [Prunus mume]
Length=440

 Score =   315 bits (806),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 201/266 (76%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELKVVL  VPEI E+VG+    ++ ++ ++D        LR +FT LMS+SK++I+
Sbjct  172  ISLEELKVVLDNVPEIEELVGSEDANKVFDITDRDDENKVTSVLRSIFTHLMSASKEMIT  231

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
             +++K+ +RL  +++ R L EKEQLVL+LE+QYP+DVGV++AF  NHV LKPGEALY+GA
Sbjct  232  TIITKMKNRLRIESQGRLLTEKEQLVLQLERQYPADVGVISAFFLNHVNLKPGEALYIGA  291

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLTPKH+DV TLCSMLTYKQG+P+IL+G AL PY T
Sbjct  292  NEPHAYIFGECIECMATSDNVVRAGLTPKHMDVNTLCSMLTYKQGYPKILQGVALGPYVT  351

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS-SNEIVAEGDVLFS  202
            RYLPPF+EFE+D C LP+   A FPAVPGPSIF+V  GEG +       +I+ EGDVLF+
Sbjct  352  RYLPPFDEFEVDCCQLPQGESAEFPAVPGPSIFVVTFGEGIIYASDLKGDIITEGDVLFA  411

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
            PANT  ++ +   L ++RAG+    F
Sbjct  412  PANTQISITSASQLQIYRAGVNSMFF  437



>ref|XP_003637323.1| Mannose-6-phosphate isomerase, partial [Medicago truncatula]
Length=350

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 203/267 (76%), Gaps = 4/267 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK V+ TVPE+  +VG +    ++   +Q+  E  K  L+ +FT LMS+SK++++
Sbjct  83   ITLKELKAVIHTVPEVVNLVGASNANLVLETSDQN-EEKVKPVLQAVFTHLMSASKEIVT  141

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
              V++LI+RL++++E R+L EKE LVLRLE QYPSD+GV+AAF  NHVKL PGEAL+LGA
Sbjct  142  DAVNRLINRLHEESEMRHLTEKELLVLRLENQYPSDIGVIAAFFLNHVKLNPGEALFLGA  201

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GECIECMATSDNVVRAGLTPK +DV TLCSMLTYKQGFPEIL+G ++NPY  
Sbjct  202  NEPHAYLSGECIECMATSDNVVRAGLTPKFIDVPTLCSMLTYKQGFPEILRGVSMNPYVN  261

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTT--PSSNEIVAEGDVLF  205
            +Y+PPFEEFEID+CILP+    VFPAVPGPSIF+V AGEG+M T  P   EI  EGD LF
Sbjct  262  KYIPPFEEFEIDRCILPKGQTVVFPAVPGPSIFLVTAGEGSMNTGSPKVYEI-TEGDALF  320

Query  204  SPANTNTAVATTLGLSLFRAGIXQYVF  124
            +PA T  +VA+   L L+R GI    F
Sbjct  321  APAYTEISVASESELHLYRTGINSKFF  347



>gb|KJB43061.1| hypothetical protein B456_007G181800 [Gossypium raimondii]
Length=435

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 166/268 (62%), Positives = 208/268 (78%), Gaps = 3/268 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDG--AENAKLTLRLLFTKLMssskdv  745
            +   ELK VL+ VPEI E+VG A  +Q++++ E+ G  A+ AK  LR +FT+LMS+SK++
Sbjct  165  ITLQELKEVLEDVPEIVELVGTASAKQVMDIDERGGDTADKAKTALRSVFTQLMSASKEM  224

Query  744  iskvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYL  565
             +K +SKL SRL  +++ R+L EKE+LVL+LEKQYP D+GVL+AF FN+VKLKPGEALYL
Sbjct  225  TTKAISKLKSRLLLQSQLRSLTEKEELVLQLEKQYPGDIGVLSAFFFNYVKLKPGEALYL  284

Query  564  GANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPY  385
             ANEPHAYL G+C+ECMATSDNVVRAGLTPKH D++TLCSMLTY QG+PEIL G AL+PY
Sbjct  285  AANEPHAYLSGDCVECMATSDNVVRAGLTPKHRDIQTLCSMLTYNQGYPEILSGLALSPY  344

Query  384  TTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLF  205
             TRYLPPF+EFE+D+C+LP+ +  VFPAVPGPSIF+   GEG M T     IV EGDV+F
Sbjct  345  ITRYLPPFDEFEVDRCVLPKGSSVVFPAVPGPSIFLAFVGEGTMKTGCWEGIVTEGDVVF  404

Query  204  SPANTNTAV-ATTLGLSLFRAGIXQYVF  124
             PANT   + A T  L L+RAGI    F
Sbjct  405  EPANTELVITAATSELQLYRAGINSRFF  432



>ref|XP_007215391.1| hypothetical protein PRUPE_ppa005846mg [Prunus persica]
 gb|EMJ16590.1| hypothetical protein PRUPE_ppa005846mg [Prunus persica]
 gb|AGH25529.1| phosphomannose isomerase [Prunus persica]
Length=440

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/262 (58%), Positives = 202/262 (77%), Gaps = 1/262 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELKVVL  VPEI E+VG+    ++ ++ ++D        LR +FT LMS+SK++I+ +++
Sbjct  176  ELKVVLDNVPEIEELVGSEDANKVFDITDRDDENKVTSVLRSIFTHLMSASKEMITTIIT  235

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            K+ +RL+ +++ R L EKEQLVL+LE+QYP+DVGV++AF  NHV LKPGEALY+GANEPH
Sbjct  236  KMKNRLHIESQGRLLTEKEQLVLQLERQYPADVGVISAFFLNHVNLKPGEALYIGANEPH  295

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GECIECMATSDNVVRAGLTPKH+DV TLCSMLTYKQG+P+IL+G AL PY TRYLP
Sbjct  296  AYIFGECIECMATSDNVVRAGLTPKHMDVNTLCSMLTYKQGYPKILQGVALGPYVTRYLP  355

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS-SNEIVAEGDVLFSPANT  190
            PF+EFE+D C LP+   A FPAVPGPSIF+V  GEG + +     +++ EGDVLF+PANT
Sbjct  356  PFDEFEVDCCQLPQGESAEFPAVPGPSIFVVTFGEGIIYSIDLKGDVITEGDVLFAPANT  415

Query  189  NTAVATTLGLSLFRAGIXQYVF  124
              ++ +   L ++RAG+    F
Sbjct  416  QISITSASQLQIYRAGVNSMFF  437



>ref|XP_003541320.1| PREDICTED: mannose-6-phosphate isomerase 1 [Glycine max]
 gb|KHN47669.1| Mannose-6-phosphate isomerase [Glycine soja]
Length=437

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/266 (61%), Positives = 196/266 (74%), Gaps = 2/266 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL TVPE+ E+V    +  ++ + ++DG E  K  L+ LFT +MS+ K+ ++
Sbjct  170  VTLKELKAVL-TVPEVVELVVAENVNSVLQITDEDGEEKVKPILKSLFTDIMSAGKERVA  228

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
              V +L SRL+K+++ R L EKEQLVLRLEKQYPSDVGV+AAF  NHVKL PGEAL+LGA
Sbjct  229  GAVDRLRSRLHKESQVRQLTEKEQLVLRLEKQYPSDVGVIAAFFLNHVKLAPGEALFLGA  288

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLTPKH DV+TLCSMLTYKQG PEIL+G  +N Y  
Sbjct  289  NEPHAYICGECIECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGSPEILRGVPINQYVN  348

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEI-VAEGDVLFS  202
            +Y+PPFEEFEID CILP+  K VFPAVPGPSIF+V  GEG MTT S     + EG VLF 
Sbjct  349  KYIPPFEEFEIDCCILPQGEKVVFPAVPGPSIFLVTVGEGMMTTESPKGYPITEGHVLFV  408

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
             ANT   V++   L LFR G+    F
Sbjct  409  AANTEITVSSAPQLHLFRTGVNSRFF  434



>ref|XP_008342936.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Malus domestica]
Length=441

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 151/262 (58%), Positives = 199/262 (76%), Gaps = 1/262 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELKVVL  VPEI E++G+   +++  + +QD  E     LR +FT LM +SK++I+ V++
Sbjct  178  ELKVVLANVPEIEELIGSEEAKKVSGITDQDKEEKVTSALRSVFTHLMLASKEMITTVIT  237

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            K+  RL+ +++ R L EKEQLVL+L KQYP+DVGV++AF  NHVKL PGEALY+GANEPH
Sbjct  238  KMKDRLHIESQARRLTEKEQLVLQLVKQYPTDVGVISAFFMNHVKLNPGEALYIGANEPH  297

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GEC+ECMATSDNVVRAGLTPKH+DV+TLCSMLTYKQG+P+IL+G A+ PY TRYLP
Sbjct  298  AYIFGECVECMATSDNVVRAGLTPKHMDVQTLCSMLTYKQGYPDILQGVAVGPYVTRYLP  357

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAM-TTPSSNEIVAEGDVLFSPANT  190
            PF+EFE+D+C LP+   A FPA PGPSIF+V  GEG +  +    +++ EGDVLF+PANT
Sbjct  358  PFDEFEVDRCQLPQGESAEFPAAPGPSIFVVTFGEGIIYASDVQGDVITEGDVLFAPANT  417

Query  189  NTAVATTLGLSLFRAGIXQYVF  124
               +     L ++RAG+    F
Sbjct  418  RIRITGASELQIYRAGVSSLFF  439



>ref|XP_009357811.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=436

 Score =   312 bits (800),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 200/266 (75%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELKVVL  VPEI E+VG+   +++  + + D  E  K  LR LFT LM +SK++I+
Sbjct  168  INLKELKVVLDNVPEIEELVGSEEAKKVSGITDLDEEEKVKSALRSLFTHLMLASKEMIT  227

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
             V++K+  RL+ +++ R L EKEQLVL+L KQYP+DVGV++AF  NHVKL PGEALY+GA
Sbjct  228  TVITKMKDRLHVESQARLLTEKEQLVLQLVKQYPTDVGVISAFFLNHVKLNPGEALYIGA  287

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GEC+ECMATSDNVVRAGLTPKH+DV+TLCSML+YKQG+P+IL+G A+ PY T
Sbjct  288  NEPHAYIFGECVECMATSDNVVRAGLTPKHMDVQTLCSMLSYKQGYPDILQGVAIGPYVT  347

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS-SNEIVAEGDVLFS  202
            RYLPPF+EFE+D+C LP+   A FPAVPGPSIF+V  GEG M   +   +++ EGDVLF+
Sbjct  348  RYLPPFDEFEVDRCQLPQGESAEFPAVPGPSIFVVTFGEGIMYASNVQGDVITEGDVLFA  407

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
            PAN    +     L ++RAG+    F
Sbjct  408  PANIRIRITGASELQIYRAGVSSMFF  433



>ref|XP_009357810.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=442

 Score =   312 bits (800),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 200/266 (75%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELKVVL  VPEI E+VG+   +++  + + D  E  K  LR LFT LM +SK++I+
Sbjct  174  INLKELKVVLDNVPEIEELVGSEEAKKVSGITDLDEEEKVKSALRSLFTHLMLASKEMIT  233

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
             V++K+  RL+ +++ R L EKEQLVL+L KQYP+DVGV++AF  NHVKL PGEALY+GA
Sbjct  234  TVITKMKDRLHVESQARLLTEKEQLVLQLVKQYPTDVGVISAFFLNHVKLNPGEALYIGA  293

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GEC+ECMATSDNVVRAGLTPKH+DV+TLCSML+YKQG+P+IL+G A+ PY T
Sbjct  294  NEPHAYIFGECVECMATSDNVVRAGLTPKHMDVQTLCSMLSYKQGYPDILQGVAIGPYVT  353

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS-SNEIVAEGDVLFS  202
            RYLPPF+EFE+D+C LP+   A FPAVPGPSIF+V  GEG M   +   +++ EGDVLF+
Sbjct  354  RYLPPFDEFEVDRCQLPQGESAEFPAVPGPSIFVVTFGEGIMYASNVQGDVITEGDVLFA  413

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
            PAN    +     L ++RAG+    F
Sbjct  414  PANIRIRITGASELQIYRAGVSSMFF  439



>ref|XP_009345680.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Pyrus x bretschneideri]
Length=441

 Score =   312 bits (800),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 199/266 (75%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELKVVL  VPEI E++G+   +++  + +QD  E     LR +FT LM +SK+ I+
Sbjct  174  ITLQELKVVLANVPEIEELIGSEEAKKVSGITDQDEEEKVTSALRSVFTHLMLASKERIT  233

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
             V++K+  RL+ +++ R L EKEQLVL+L KQYP+DVGV++AF  NHVKL PGEA+Y+GA
Sbjct  234  TVITKMKDRLHIESQARRLTEKEQLVLQLVKQYPTDVGVISAFFMNHVKLNPGEAMYIGA  293

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GEC+ECMATSDNVVRAGLTPKH+DV+TLCSMLTYKQG+P+IL+G A+ PY T
Sbjct  294  NEPHAYIFGECVECMATSDNVVRAGLTPKHMDVQTLCSMLTYKQGYPDILQGVAVGPYVT  353

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAM-TTPSSNEIVAEGDVLFS  202
            RYLPPF+EFE+D+C LP+   A FPA PGPSIF+V  GEG +  +    +++ EGDVLF+
Sbjct  354  RYLPPFDEFEVDRCQLPQGESAEFPAAPGPSIFVVTFGEGIIYASDVQGDVITEGDVLFA  413

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
            PANT   +     L ++RAG+    F
Sbjct  414  PANTRIRITGASELQIYRAGVSSMFF  439



>gb|KEH21549.1| mannose-6-phosphate isomerase [Medicago truncatula]
Length=424

 Score =   311 bits (798),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 203/267 (76%), Gaps = 4/267 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK V+ TVPE+  +VG +    ++   +Q+  E  K  L+ +FT LMS+SK++++
Sbjct  157  ITLKELKAVIHTVPEVVNLVGASNANLVLETSDQN-EEKVKPVLQAVFTHLMSASKEIVT  215

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
              V++LI+RL++++E R+L EKE LVLRLE QYPSD+GV+AAF  NHVKL PGEAL+LGA
Sbjct  216  DAVNRLINRLHEESEMRHLTEKELLVLRLENQYPSDIGVIAAFFLNHVKLNPGEALFLGA  275

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GECIECMATSDNVVRAGLTPK +DV TLCSMLTYKQGFPEIL+G ++NPY  
Sbjct  276  NEPHAYLSGECIECMATSDNVVRAGLTPKFIDVPTLCSMLTYKQGFPEILRGVSMNPYVN  335

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTT--PSSNEIVAEGDVLF  205
            +Y+PPFEEFEID+CILP+    VFPAVPGPSIF+V AGEG+M T  P   EI  EGD LF
Sbjct  336  KYIPPFEEFEIDRCILPKGQTVVFPAVPGPSIFLVTAGEGSMNTGSPKVYEIT-EGDALF  394

Query  204  SPANTNTAVATTLGLSLFRAGIXQYVF  124
            +PA T  +VA+   L L+R GI    F
Sbjct  395  APAYTEISVASESELHLYRTGINSKFF  421



>ref|XP_009342661.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Pyrus x bretschneideri]
Length=441

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 199/266 (75%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELKVVL  VPEI E++G+   +++  + +QD  E     LR +FT LM +SK+ I+
Sbjct  174  ITLQELKVVLANVPEIEELIGSEEAKKVSGITDQDEEEKVTSALRSVFTHLMLASKERIT  233

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
             V++K+  RL+ +++ R L EKEQLVL+L KQYP+DVGV++AF  NHVKL PGEA+Y+GA
Sbjct  234  TVITKMKDRLHIESQARRLTEKEQLVLQLVKQYPTDVGVISAFFMNHVKLNPGEAMYIGA  293

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GEC+ECMATSDNVVRAGLTPKH+DV+TLCSMLTYKQG+P+IL+G A+ PY T
Sbjct  294  NEPHAYIFGECVECMATSDNVVRAGLTPKHMDVQTLCSMLTYKQGYPDILQGVAVGPYVT  353

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAM-TTPSSNEIVAEGDVLFS  202
            RYLPPF+EFE+D+C LP+   A FPA PGPSIF+V  GEG +  +    +++ EGDVLF+
Sbjct  354  RYLPPFDEFEVDRCQLPQGESAEFPATPGPSIFVVTFGEGIIYASDVQGDVITEGDVLFA  413

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
            PANT   +     L ++RAG+    F
Sbjct  414  PANTRIRITGASELQIYRAGVSSMFF  439



>gb|EPS59833.1| hypothetical protein M569_14970 [Genlisea aurea]
Length=426

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/262 (60%), Positives = 191/262 (73%), Gaps = 2/262 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK V+ +VPEI+E++GN+  +Q++ L+ +D     K  L+ LFT+LMS+ K  I 
Sbjct  157  VDLQELKAVVLSVPEISEIIGNSLADQVLQLRREDEENKLKNILKSLFTELMSADKAKIF  216

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            + +  L +RL  K E   L EKE+LVLRLEKQYP DVGVLA FLFNHVKL+PGEALYLGA
Sbjct  217  QAIQALTARLQSKREVEGLTEKEELVLRLEKQYPGDVGVLAGFLFNHVKLRPGEALYLGA  276

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GEC+ECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQG PEIL+G A N YTT
Sbjct  277  NEPHAYVHGECVECMATSDNVVRAGLTPKYRDVETLCSMLTYKQGRPEILRGLAWNEYTT  336

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            +Y PPF+EFE+D+C +P     VFPAV GPS+F+V  GEG M T      V EGD LF+ 
Sbjct  337  KYAPPFDEFEVDRCSIPGEKTTVFPAVSGPSVFVVTGGEGRMRTAWCEVCVGEGDALFAA  396

Query  198  ANTNTAVATTL--GLSLFRAGI  139
            A+    V  T   GL ++RAGI
Sbjct  397  AHVEITVEATTNSGLEMYRAGI  418



>gb|ACP43318.1| mannose-6-phosphate isomerase [Citrus maxima]
Length=213

 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  714  RLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLL  535
            RL+K+++ R L EKEQLVLRLEKQYP+D+GV+AAF FN+VKL PG+ALYLGANEPHAY+ 
Sbjct  14   RLHKESQVRPLTEKEQLVLRLEKQYPADIGVIAAFFFNYVKLNPGQALYLGANEPHAYIS  73

Query  534  GECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEE  355
            GECIECMATSDNVVRAGLTPKH DV+TLCSMLTYKQGFPEILKG  L+PY TRYLPPF+E
Sbjct  74   GECIECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGFPEILKGFPLSPYITRYLPPFDE  133

Query  354  FEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTNTAVA  175
            FE+D CILP+   +VFPAV GPSIF+V  GEG+M T S N+ VA+GDVLF+PANT  ++ 
Sbjct  134  FEVDCCILPKGTSSVFPAVSGPSIFLVTDGEGSMLTASHNDAVAKGDVLFAPANTEISIT  193

Query  174  TTLGLSLFRAGI  139
            T+  L L+RAG+
Sbjct  194  TSSKLQLYRAGV  205



>ref|XP_007139158.1| hypothetical protein PHAVU_008G006200g [Phaseolus vulgaris]
 gb|ESW11152.1| hypothetical protein PHAVU_008G006200g [Phaseolus vulgaris]
Length=418

 Score =   310 bits (793),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 159/266 (60%), Positives = 194/266 (73%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VL ++PEI E++G      ++   + DG E  K  L+ +FT LMS+SK+ ++
Sbjct  150  ITLKELKGVLHSIPEIVELIGATNTNLVLQTNDHDGEEKVKSVLKAVFTDLMSASKERVT  209

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
              V++L +RL K+NE R L +KEQLVLRLE QYPSDVGV+AAF  N VKL PGEAL+LGA
Sbjct  210  DAVNRLKTRLLKENEVRQLTDKEQLVLRLEGQYPSDVGVIAAFFLNLVKLNPGEALFLGA  269

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GEC+ECMATSDNVVRAGLTPK  DV+TLCSMLTYKQG PEIL G +LNPY  
Sbjct  270  NEPHAYLSGECVECMATSDNVVRAGLTPKLRDVQTLCSMLTYKQGSPEILHGVSLNPYVN  329

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS-SNEIVAEGDVLFS  202
            +Y PPFEEFEID+CILP+    VFPAVPGPSIF+V  GEG M T S    +V EG+VLF+
Sbjct  330  KYTPPFEEFEIDRCILPQGETVVFPAVPGPSIFLVTVGEGNMNTGSPEGHVVTEGNVLFA  389

Query  201  PANTNTAVATTLGLSLFRAGIXQYVF  124
             ANT  +V +   L L+R  +   VF
Sbjct  390  AANTEISVTSASELHLYRTAVNSKVF  415



>gb|KJB43060.1| hypothetical protein B456_007G181800 [Gossypium raimondii]
Length=443

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 166/276 (60%), Positives = 208/276 (75%), Gaps = 11/276 (4%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDG--AENAKLTLRLLFTKLMssskdv  745
            +   ELK VL+ VPEI E+VG A  +Q++++ E+ G  A+ AK  LR +FT+LMS+SK++
Sbjct  165  ITLQELKEVLEDVPEIVELVGTASAKQVMDIDERGGDTADKAKTALRSVFTQLMSASKEM  224

Query  744  iskvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYL  565
             +K +SKL SRL  +++ R+L EKE+LVL+LEKQYP D+GVL+AF FN+VKLKPGEALYL
Sbjct  225  TTKAISKLKSRLLLQSQLRSLTEKEELVLQLEKQYPGDIGVLSAFFFNYVKLKPGEALYL  284

Query  564  GANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYK--------QGFPEIL  409
             ANEPHAYL G+C+ECMATSDNVVRAGLTPKH D++TLCSMLTY         QG+PEIL
Sbjct  285  AANEPHAYLSGDCVECMATSDNVVRAGLTPKHRDIQTLCSMLTYNQNIISFMLQGYPEIL  344

Query  408  KGNALNPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEI  229
             G AL+PY TRYLPPF+EFE+D+C+LP+ +  VFPAVPGPSIF+   GEG M T     I
Sbjct  345  SGLALSPYITRYLPPFDEFEVDRCVLPKGSSVVFPAVPGPSIFLAFVGEGTMKTGCWEGI  404

Query  228  VAEGDVLFSPANTNTAV-ATTLGLSLFRAGIXQYVF  124
            V EGDV+F PANT   + A T  L L+RAGI    F
Sbjct  405  VTEGDVVFEPANTELVITAATSELQLYRAGINSRFF  440



>ref|XP_004300283.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Fragaria vesca 
subsp. vesca]
Length=434

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/267 (58%), Positives = 197/267 (74%), Gaps = 2/267 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL  VPEI +VVG+    Q+ +   +DG +  K  LRL+FT+LMS++K++++
Sbjct  165  VTLEELKGVLDNVPEIVQVVGSEVANQVFDTTNEDGEDKVKSVLRLIFTQLMSATKEIVT  224

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
               +KL +RL+ +N+ R L EKEQLVL LE+QY  DVGV++AF  N+VKL PGEALYLGA
Sbjct  225  TATTKLKNRLHMENQVRQLTEKEQLVLELERQYHDDVGVISAFFLNYVKLSPGEALYLGA  284

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ G+C+ECMATSDNVVRAGLTPKH DVKTLCSMLTYKQG PEILKG ALN Y T
Sbjct  285  NEPHAYMFGDCVECMATSDNVVRAGLTPKHRDVKTLCSMLTYKQGCPEILKGVALNSYVT  344

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAM-TTPSSNEI-VAEGDVLF  205
            RYLPPF+EFE+D+C LP+     FPAV GPSIF+V  GEG + T+  + +I + +G+VLF
Sbjct  345  RYLPPFDEFEVDRCHLPQGESVEFPAVQGPSIFVVTFGEGIIYTSDFTGDINITQGEVLF  404

Query  204  SPANTNTAVATTLGLSLFRAGIXQYVF  124
             PA T   + +   L ++RAG+    F
Sbjct  405  VPAGTEIGITSASELHIYRAGVNSMFF  431



>ref|XP_010926023.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Elaeis guineensis]
Length=426

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 159/264 (60%), Positives = 202/264 (77%), Gaps = 4/264 (2%)
 Frame = -1

Query  903  LKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvsk  724
            LK VL  VPEI E+VG+    +++N+KEQDG    K  LR +FTK++S+SK+ +S+++SK
Sbjct  163  LKDVLAGVPEIVELVGDEDASKVLNIKEQDGYMEVKSILRSIFTKVISASKEAVSELLSK  222

Query  723  liSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHA  544
            L  RLN++++ R L EKEQLVL LEKQYP+DVGV++ F FN+VKL PGEALY+GANEPHA
Sbjct  223  LKCRLNEEHKIRMLTEKEQLVLLLEKQYPADVGVISVFFFNYVKLSPGEALYIGANEPHA  282

Query  543  YLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPP  364
            Y+ G+CIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQGFPEIL+G  LN Y +RY PP
Sbjct  283  YISGDCIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQGFPEILRGTPLNHYISRYTPP  342

Query  363  FEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSS--NEIVAEGDVLFSPANT  190
            F+EFE+D C+LP     VFPA+PGPSIF+V+ GEG M   S+   E+VAEG V F PA++
Sbjct  343  FDEFEVDHCLLPPQESVVFPAIPGPSIFVVVDGEGRMRMGSAIDEEMVAEGHVYFVPAHS  402

Query  189  NTAV--ATTLGLSLFRAGIXQYVF  124
              A+  A    L L+RAG+   V 
Sbjct  403  EIALTAAPAGPLQLYRAGVNSRVL  426



>ref|XP_006391469.1| hypothetical protein EUTSA_v10018552mg [Eutrema salsugineum]
 gb|ESQ28755.1| hypothetical protein EUTSA_v10018552mg [Eutrema salsugineum]
Length=445

 Score =   305 bits (780),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 192/267 (72%), Gaps = 2/267 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENA-KLTLRLLFTKLMssskdvi  742
            V   ELK  +  VPEI E+VG+   +Q+  + E DG E + K  +RL+FT+LMS++ +  
Sbjct  176  VSLNELKEAIANVPEITELVGSKAADQIFKVNEHDGDETSVKSVVRLIFTQLMSANINDT  235

Query  741  skvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             +V+S++  RL  +   R L EKE+LVL LEKQYP DVGV++AF FNHVKL PGEALYL 
Sbjct  236  KQVISQMKIRLISETNHRELSEKEKLVLELEKQYPGDVGVISAFFFNHVKLNPGEALYLD  295

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYT  382
            ANEPHAY+ G+C+ECMA SDNVVRAGLTPKH DV+TLCSMLTYK G+PEILKG  L PY 
Sbjct  296  ANEPHAYISGDCVECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYI  355

Query  381  TRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFS  202
            TRYLPPF+EFE+D C LPR    VFPA+PGPS+++V+ G+G + T SS  +V  GDVLF 
Sbjct  356  TRYLPPFDEFEVDHCDLPREKSTVFPAIPGPSVYLVIEGKGTLKTGSSQLLVKRGDVLFV  415

Query  201  PANTNTAV-ATTLGLSLFRAGIXQYVF  124
            PA+    V   +  + L+RAG+    F
Sbjct  416  PAHNEIHVTGESDVMKLYRAGVSSRFF  442



>ref|XP_010061893.1| PREDICTED: mannose-6-phosphate isomerase 1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW68932.1| hypothetical protein EUGRSUZ_F02498 [Eucalyptus grandis]
Length=439

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/261 (61%), Positives = 200/261 (77%), Gaps = 2/261 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VL  VPEIAE+VG+  +E+ I L EQ+  E AK  L+ +FTKLMS+S D+++
Sbjct  162  ISMEELKQVLCDVPEIAELVGSTDVEKFIKLGEQE-VEKAKCLLQSIFTKLMSASADIVA  220

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
              VS++ SRL  +++ R L +KEQLVLRLEKQYP+DVGV++AF  N+V+L PGEALYLGA
Sbjct  221  LAVSQIKSRLELESQVRPLTDKEQLVLRLEKQYPADVGVISAFFLNYVRLNPGEALYLGA  280

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLTPK  D++TLCSMLTYKQGFP+ILKG  L  Y T
Sbjct  281  NEPHAYVSGECIECMATSDNVVRAGLTPKTKDIQTLCSMLTYKQGFPDILKGVPLKTYIT  340

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS-SNEIVAEGDVLFS  202
            RY+PPF+EFE+D+C+LP+ + AVF AV GPSIF+V  GEG +   S   ++VAEG VLF 
Sbjct  341  RYIPPFDEFEVDRCVLPKGSSAVFSAVLGPSIFLVTDGEGTINVGSVKQDVVAEGYVLFV  400

Query  201  PANTNTAVATTLGLSLFRAGI  139
            PAN    V +   L ++RAG+
Sbjct  401  PANVEIHVTSVTELHVYRAGV  421



>ref|XP_002884330.1| hypothetical protein ARALYDRAFT_477494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60589.1| hypothetical protein ARALYDRAFT_477494 [Arabidopsis lyrata subsp. 
lyrata]
Length=432

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/256 (59%), Positives = 196/256 (77%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V+Q +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   K+VS
Sbjct  170  ELKSVIQAIPEIEELVGSEEANQVFCISEHD-EEKVKSVVRTIFTLLMSADPDTTKKIVS  228

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+  +++R L +KE+LVL+LEKQYP+D+GV++AF FN+VKL PGEALYLGANEPH
Sbjct  229  KLKRRLHMDSQERQLTDKERLVLKLEKQYPNDIGVISAFFFNYVKLNPGEALYLGANEPH  288

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GEC+E MATSDNVVRAGLT K LD++TLCSML+YK G+PEILKG+ + PY TRYLP
Sbjct  289  AYLFGECLEVMATSDNVVRAGLTSKPLDIQTLCSMLSYKLGYPEILKGSRIRPYITRYLP  348

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D C LP AA  VFP+VPGPS+ +V+ GEG M+T +S + ++ GDVLF PA+T 
Sbjct  349  PFEEFEVDLCDLPSAASTVFPSVPGPSLLLVLQGEGRMSTEASADGISMGDVLFVPADTE  408

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAGI
Sbjct  409  IHLRSSSDLKLYRAGI  424



>ref|XP_009118359.1| PREDICTED: mannose-6-phosphate isomerase 1 [Brassica rapa]
Length=432

 Score =   302 bits (773),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 195/256 (76%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   ++V 
Sbjct  170  ELKSVIRAIPEIEELVGSEETNQVFCISEHD-EEKVKSAVRTIFTLLMSAGPDTTKQIVF  228

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R+L EKE+LVL+LEKQYP+D+GV++AF FN++KL PGEALYLGANEPH
Sbjct  229  KLKRRLHMESQERHLTEKERLVLKLEKQYPNDIGVISAFFFNYIKLNPGEALYLGANEPH  288

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIE MATSDNVVRAGLT K LD+++LCSMLTYK GFPEILKG  + PY TRYLP
Sbjct  289  AYLFGECIEVMATSDNVVRAGLTSKPLDIQSLCSMLTYKLGFPEILKGTRIRPYITRYLP  348

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D C LP  A  VFP+VPGPS+ +V+ GEG M+T +S + V+ GDVLF PA+T 
Sbjct  349  PFEEFEVDICDLPSGASTVFPSVPGPSLLLVIHGEGRMSTDASADEVSVGDVLFVPADTE  408

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAG+
Sbjct  409  IQLKSSSDLKLYRAGV  424



>ref|NP_176878.1| mannose-6-phosphate isomerase [Arabidopsis thaliana]
 sp|Q9FZH5.1|MPI2_ARATH RecName: Full=Mannose-6-phosphate isomerase 2; AltName: Full=Phosphohexomutase 
2; AltName: Full=Phosphomannose isomerase 
2; Short=PMI2; AltName: Full=Protein DARK INDUCIBLE 9 [Arabidopsis 
thaliana]
 gb|AAF98217.1|AC007152_13 Putative mannose-6-phosphate isomerase [Arabidopsis thaliana]
 dbj|BAD44244.1| phosphomannose isomerase (din9) [Arabidopsis thaliana]
 gb|ABG25084.1| At1g67070 [Arabidopsis thaliana]
 gb|AEE34592.1| mannose-6-phosphate isomerase [Arabidopsis thaliana]
Length=441

 Score =   302 bits (773),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 152/266 (57%), Positives = 193/266 (73%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK V+  VPEI E+VG+   +Q+ N+ E D  E  K  +RL+FT+LMS+S +   
Sbjct  173  VTLKELKEVITNVPEITELVGSKAADQIFNVHEHDEDERIKSVVRLIFTQLMSASNNETK  232

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +VVS++ +RL  + + R L EKE+LVL LEKQY  D+GV++AF FN+VKL PGEALYL A
Sbjct  233  QVVSRMKNRLLLETKHRELSEKEKLVLELEKQYTGDIGVISAFFFNYVKLNPGEALYLDA  292

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ G+C+ECMA SDNVVRAGLTPKH DV+TLCSMLTYK G+PEILKG  L PY T
Sbjct  293  NEPHAYISGDCVECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYVT  352

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LPR    VFPAVPGPS+++V+ G+G + T SS  +V  GDVLF P
Sbjct  353  RYLPPFDEFEVDHCDLPRGKSTVFPAVPGPSVYLVIEGKGQLRTGSSKVLVNRGDVLFVP  412

Query  198  ANTNTAV-ATTLGLSLFRAGIXQYVF  124
            A+    V   +  + L+RAG+    F
Sbjct  413  ADIEIHVTGESDVMKLYRAGVSSRFF  438



>emb|CDY43229.1| BnaC05g48220D [Brassica napus]
Length=436

 Score =   302 bits (773),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 196/256 (77%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   ++VS
Sbjct  174  ELKSVIRAIPEIEELVGSEEANQVFCISEHD-EEKVKSAVRTIFTLLMSAGPDTTKQIVS  232

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R+L +KE+LVL+LEKQYP D+GV++AF FN+VKL PGEALYLGANEPH
Sbjct  233  KLKHRLHMESQERHLTDKERLVLKLEKQYPDDIGVISAFFFNYVKLNPGEALYLGANEPH  292

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIE MATSDNVVRAGLT K LD++TLCSML+YK GFPEILKG+ + PY TRYLP
Sbjct  293  AYLFGECIEVMATSDNVVRAGLTSKPLDIQTLCSMLSYKLGFPEILKGSRIRPYITRYLP  352

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D C LP  A  VFP+VPGPS+ +V+ GEG M+T +S + ++ GDVLF PA+T 
Sbjct  353  PFEEFEVDLCDLPCGASTVFPSVPGPSLLLVLQGEGRMSTDASADEISMGDVLFVPADTE  412

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAGI
Sbjct  413  IHLKSSSDLKLYRAGI  428



>ref|XP_009147339.1| PREDICTED: mannose-6-phosphate isomerase 1 [Brassica rapa]
Length=433

 Score =   301 bits (772),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 196/256 (77%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   ++VS
Sbjct  171  ELKSVIRAIPEIEELVGSEEANQVFCISEHD-EEKVKSAVRTIFTLLMSAGPDTTKQIVS  229

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R+L +KE+LVL+LEKQYP D+GV++AF FN+VKL PGEALYLGANEPH
Sbjct  230  KLKHRLHMESQERHLTDKERLVLKLEKQYPDDIGVISAFFFNYVKLNPGEALYLGANEPH  289

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIE MATSDNVVRAGLT K LD++TLCSML+YK GFPEILKG+ + PY TRYLP
Sbjct  290  AYLFGECIEVMATSDNVVRAGLTSKPLDIQTLCSMLSYKLGFPEILKGSRIRPYITRYLP  349

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D C LP  A  VFP+VPGPS+ +V+ GEG M+T +S + ++ GDVLF PA+T 
Sbjct  350  PFEEFEVDLCDLPCGASTVFPSVPGPSLLLVLQGEGRMSTDASADEISMGDVLFVPADTE  409

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAGI
Sbjct  410  IHLKSSSDLKLYRAGI  425



>gb|KJB43062.1| hypothetical protein B456_007G181800 [Gossypium raimondii]
Length=422

 Score =   301 bits (771),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 159/268 (59%), Positives = 196/268 (73%), Gaps = 16/268 (6%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDG--AENAKLTLRLLFTKLMssskdv  745
            +   ELK VL+ VPEI E+VG A  +Q++++ E+ G  A+ AK  LR +FT+LMS+SK++
Sbjct  165  ITLQELKEVLEDVPEIVELVGTASAKQVMDIDERGGDTADKAKTALRSVFTQLMSASKEM  224

Query  744  iskvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYL  565
             +K +SKL SRL              L  +LEKQYP D+GVL+AF FN+VKLKPGEALYL
Sbjct  225  TTKAISKLKSRL-------------LLQSQLEKQYPGDIGVLSAFFFNYVKLKPGEALYL  271

Query  564  GANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPY  385
             ANEPHAYL G+C+ECMATSDNVVRAGLTPKH D++TLCSMLTY QG+PEIL G AL+PY
Sbjct  272  AANEPHAYLSGDCVECMATSDNVVRAGLTPKHRDIQTLCSMLTYNQGYPEILSGLALSPY  331

Query  384  TTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLF  205
             TRYLPPF+EFE+D+C+LP+ +  VFPAVPGPSIF+   GEG M T     IV EGDV+F
Sbjct  332  ITRYLPPFDEFEVDRCVLPKGSSVVFPAVPGPSIFLAFVGEGTMKTGCWEGIVTEGDVVF  391

Query  204  SPANTNTAV-ATTLGLSLFRAGIXQYVF  124
             PANT   + A T  L L+RAGI    F
Sbjct  392  EPANTELVITAATSELQLYRAGINSRFF  419



>emb|CDY54299.1| BnaC01g41980D [Brassica napus]
Length=428

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 196/256 (77%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   ++VS
Sbjct  166  ELKSVIRAIPEIEELVGSEEANQVFCISEHD-EEKVKSAVRTIFTLLMSAGPDTTKQIVS  224

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R+L +KE+LVL+LEKQYP D+GV++AF FN+VKL PGEALYLGANEPH
Sbjct  225  KLKHRLHMESQERHLTDKERLVLKLEKQYPDDIGVISAFFFNYVKLNPGEALYLGANEPH  284

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIE MATSDNVVRAGLT K LD++TLCSML+YK GFPEILKG+ + PY TRYLP
Sbjct  285  AYLFGECIEVMATSDNVVRAGLTSKPLDIQTLCSMLSYKLGFPEILKGSRIRPYITRYLP  344

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D C LP  A  VFP+VPGPS+ +V+ GEG M+T +S + ++ GDVLF PA+T 
Sbjct  345  PFEEFEVDLCDLPCGASTVFPSVPGPSLLLVLQGEGRMSTDASADEISMGDVLFVPADTE  404

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAG+
Sbjct  405  IQLKSSSDLKLYRAGV  420



>emb|CDY57541.1| BnaA05g33470D [Brassica napus]
Length=433

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 196/256 (77%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   ++VS
Sbjct  171  ELKSVIRAIPEIEELVGSEEANQVFCISEHD-EEKVKSAVRTIFTLLMSAGPDTTKQIVS  229

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R+L +KE+LVL+LEKQYP D+GV++AF FN+VKL PGEALYLGANEPH
Sbjct  230  KLKHRLHMESQERHLTDKERLVLKLEKQYPDDIGVISAFFFNYVKLNPGEALYLGANEPH  289

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIE MATSDNVVRAGLT K LD++TLCSML+YK GFPEILKG+ + PY TRYLP
Sbjct  290  AYLFGECIEVMATSDNVVRAGLTSKPLDIQTLCSMLSYKLGFPEILKGSRIRPYITRYLP  349

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D C LP  A  VFP+VPGPS+ +V+ GEG M+T +S + ++ GDVLF PA+T 
Sbjct  350  PFEEFEVDLCDLPCGASTVFPSVPGPSLLLVLQGEGRMSTDASADEISMGDVLFVPADTE  409

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAGI
Sbjct  410  IHLESSSDLKLYRAGI  425



>ref|XP_010528481.1| PREDICTED: mannose-6-phosphate isomerase 2 [Tarenaya hassleriana]
Length=439

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 195/273 (71%), Gaps = 2/273 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL++VPEI E+VGN   ++++ + E DG E AK  +RL+FT+LMS+  D   
Sbjct  165  VSLQELKEVLESVPEITELVGNQVADKILQVDEGDGDERAKPLVRLIFTQLMSAGSDATK  224

Query  738  kvvskliSRLNKKNEQRNL-CEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
              VSKL +RL  K     L  EK+ L +RL +QYP D+GV+++   N+VKLKPGEALYLG
Sbjct  225  DAVSKLTNRLRSKGTDGELLSEKDGLAVRLGRQYPGDIGVMSSLFLNYVKLKPGEALYLG  284

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYT  382
            ANEPHAY+ GECIECMA+SDNVVRAGLTPK  DV+TLCSMLTY  G+PEILKG  L+PY 
Sbjct  285  ANEPHAYISGECIECMASSDNVVRAGLTPKFRDVRTLCSMLTYNLGYPEILKGFPLSPYI  344

Query  381  TRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFS  202
            TRYLPPF+EFE+D+C LP     VFPAVPGPS+F+V+ G+G + T SS   V  GDVLF+
Sbjct  345  TRYLPPFDEFEVDRCDLPSGESTVFPAVPGPSVFLVIEGKGKLQTGSSQFPVNRGDVLFA  404

Query  201  PANTNTAV-ATTLGLSLFRAGIXQYVFCRKITE  106
            P++T   V      + L+RAGI    F RKI E
Sbjct  405  PSHTEIQVTGDNNEVKLYRAGISSRFFQRKIDE  437



>gb|AEJ89929.1| mannose-6-phosphate isomerase-like protein [Brassica rapa subsp. 
chinensis]
Length=444

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 192/266 (72%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK V+  VPEI E+VG+   +Q+  + E+DG E+ K  +RL+FT+LMS++ +   
Sbjct  176  VSLKELKEVIANVPEIPELVGSKAADQIFTVNEKDGEESVKSVVRLIFTQLMSATNNETK  235

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V+S++  RL  +   R L EKE+LVL LEKQYP DVGV++AF FN+VKL PGEALYL A
Sbjct  236  RVISEMKMRLITETNHRELSEKEKLVLELEKQYPGDVGVISAFFFNYVKLNPGEALYLDA  295

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            +EPHAY+ G+C+ECMA SDNVVRAGLTPKH DV+TLCSMLTYK G+PEILKG  L PY T
Sbjct  296  DEPHAYISGDCVECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYIT  355

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LP     +FPA+PGPS+++V+ G G + T SS  +V  GDVLF P
Sbjct  356  RYLPPFDEFEVDHCDLPTGKSTIFPAIPGPSVYLVIEGTGKLQTGSSQLLVNRGDVLFVP  415

Query  198  ANTNTAV-ATTLGLSLFRAGIXQYVF  124
            A+    V   +  + L+RAG+    F
Sbjct  416  AHNEIQVTGESDVIKLYRAGVSSRFF  441



>emb|CDY42336.1| BnaC02g17130D [Brassica napus]
Length=444

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 192/266 (72%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK V+  VPEI E+VG+   +Q+  + E+DG E+ K  +RL+FT+LMS+S +   
Sbjct  176  VSLKELKEVIANVPEITELVGSKAADQIFTVNEKDGDESIKSVVRLIFTQLMSASNNETK  235

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V+S++  RL  +   R L EKE+L+L LEKQYP DVGV++AF FN+VKL PGEALYL A
Sbjct  236  RVISEMKMRLITETNHRELSEKEKLILELEKQYPGDVGVISAFFFNYVKLNPGEALYLDA  295

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            +EPHAY+ G+C+ECMA SDNVVRAGLTPKH DV+TLCSMLTYK G+PEILKG  L PY T
Sbjct  296  DEPHAYISGDCVECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYIT  355

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LP     +FPA+PGPS+++V+ G G + T SS  +V  GDVLF P
Sbjct  356  RYLPPFDEFEVDHCDLPTGKSTIFPAIPGPSVYLVIEGTGKLQTGSSQLLVNRGDVLFVP  415

Query  198  ANTNTAV-ATTLGLSLFRAGIXQYVF  124
            A+    V   +  + L+RAG+    F
Sbjct  416  AHNEIQVTGESDVIKLYRAGVSSRFF  441



>dbj|BAD44147.1| phosphomannose isomerase (din9) [Arabidopsis thaliana]
Length=441

 Score =   301 bits (770),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/266 (57%), Positives = 192/266 (72%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK V+  VPEI E+VG+   +Q+ N+ E D  E  K  +RL+FT+LMS+S +   
Sbjct  173  VTLKELKEVITNVPEITELVGSKAADQIFNVHEHDEDERIKSVVRLIFTQLMSASNNETK  232

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +VVS++ +RL  + + R L EKE+LVL LEKQY  D+GV++AF FN+VKL PGEA YL A
Sbjct  233  QVVSRMKNRLLLETKHRELSEKEKLVLELEKQYTGDIGVISAFFFNYVKLNPGEAWYLDA  292

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ G+C+ECMA SDNVVRAGLTPKH DV+TLCSMLTYK G+PEILKG  L PY T
Sbjct  293  NEPHAYISGDCVECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYVT  352

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LPR    VFPAVPGPS+++V+ G+G + T SS  +V  GDVLF P
Sbjct  353  RYLPPFDEFEVDHCDLPRGKSTVFPAVPGPSVYLVIEGKGQLRTGSSKVLVNRGDVLFVP  412

Query  198  ANTNTAV-ATTLGLSLFRAGIXQYVF  124
            A+    V   +  + L+RAG+    F
Sbjct  413  ADIEIHVTGESDVMKLYRAGVSSRFF  438



>emb|CDY12611.1| BnaA02g12790D [Brassica napus]
Length=444

 Score =   300 bits (768),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 192/266 (72%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK V+  VPEI E+VG+   +Q+  + E+DG E+ K  +RL+FT+LMS++ +   
Sbjct  176  VSLKELKEVIANVPEIPELVGSKAADQIFTVNEKDGEESVKSVVRLIFTQLMSATNNETK  235

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V+S++  RL  +   R L EKE+LVL LEKQYP DVGV++AF FN+VKL PGEALYL A
Sbjct  236  RVISEMKMRLITETNHRELSEKEKLVLELEKQYPGDVGVISAFFFNYVKLNPGEALYLDA  295

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            ++PHAY+ G+C+ECMA SDNVVRAGLTPKH DV+TLCSMLTYK G+PEILKG  L PY T
Sbjct  296  DQPHAYISGDCVECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYIT  355

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LP     +FPA+PGPS+++V+ G G + T SS  +V  GDVLF P
Sbjct  356  RYLPPFDEFEVDHCDLPTGKSTIFPAIPGPSVYLVIEGTGKLQTGSSQLLVNRGDVLFVP  415

Query  198  ANTNTAV-ATTLGLSLFRAGIXQYVF  124
            A+    V   +  + L+RAG+    F
Sbjct  416  AHNEIQVTGESDVIKLYRAGVSSRFF  441



>ref|XP_009127517.1| PREDICTED: mannose-6-phosphate isomerase 2 [Brassica rapa]
Length=444

 Score =   300 bits (768),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 192/266 (72%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK V+  VPEI E+VG+   +Q+  + E+DG E+ K  +RL+FT+LMS++ +   
Sbjct  176  VSLKELKEVIANVPEIPELVGSKAADQIFTVNEKDGEESVKSVVRLIFTQLMSATNNETK  235

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V+S++  RL  +   R L EKE+LVL LEKQYP DVGV++AF FN+VKL PGEALYL A
Sbjct  236  RVISEMKMRLITETNHRELSEKEKLVLELEKQYPGDVGVISAFFFNYVKLNPGEALYLDA  295

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            ++PHAY+ G+C+ECMA SDNVVRAGLTPKH DV+TLCSMLTYK G+PEILKG  L PY T
Sbjct  296  DQPHAYISGDCVECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYIT  355

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LP     +FPA+PGPS+++V+ G G + T SS  +V  GDVLF P
Sbjct  356  RYLPPFDEFEVDHCDLPTGKSTIFPAIPGPSVYLVIEGTGKLQTGSSQLLVNRGDVLFVP  415

Query  198  ANTNTAV-ATTLGLSLFRAGIXQYVF  124
            A+    V   +  + L+RAG+    F
Sbjct  416  AHNEIQVTGESDVIKLYRAGVSSRFF  441



>ref|NP_186906.1| mannose-6-phosphate isomerase [Arabidopsis thaliana]
 sp|Q9M884.1|MPI1_ARATH RecName: Full=Mannose-6-phosphate isomerase 1; AltName: Full=Phosphohexomutase 
1; AltName: Full=Phosphomannose isomerase 
1; Short=PMI1; AltName: Full=Protein MATERNAL EFFECT EMBRYO 
ARREST 31 [Arabidopsis thaliana]
 gb|AAF32464.1| putative mannose-6-phosphate isomerase [Arabidopsis thaliana]
 gb|AAL49850.1| putative mannose-6-phosphate isomerase [Arabidopsis thaliana]
 gb|AAM20214.1| putative mannose-6-phosphate isomerase [Arabidopsis thaliana]
 gb|AEE73831.1| mannose-6-phosphate isomerase [Arabidopsis thaliana]
Length=432

 Score =   300 bits (767),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 195/256 (76%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   K+VS
Sbjct  170  ELKSVIRAIPEIEELVGSEEANQVFCITEHD-EEKVKSVVRTIFTLLMSADADTTKKIVS  228

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R L +KE+LVL+LEKQYP+D+GV++AF FN+VKL PGEALYLGANEPH
Sbjct  229  KLKRRLHMESQERQLTDKERLVLKLEKQYPNDIGVISAFFFNYVKLNPGEALYLGANEPH  288

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GEC+E MATSDNVVRAGLT K LD++TLCSML+YK G+PEILKG  + PY TRYLP
Sbjct  289  AYLFGECLEVMATSDNVVRAGLTSKPLDIQTLCSMLSYKLGYPEILKGTRIRPYITRYLP  348

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D C LP  A  VFP+VPGPS+ +V+ GEG M+T +S + ++ GDVLF PA+T 
Sbjct  349  PFEEFEVDLCDLPSGASTVFPSVPGPSLLLVLQGEGRMSTEASADGISMGDVLFVPADTE  408

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAGI
Sbjct  409  IHLRSSSDLKLYRAGI  424



>ref|XP_006303122.1| hypothetical protein CARUB_v100218700mg, partial [Capsella rubella]
 gb|EOA36020.1| hypothetical protein CARUB_v100218700mg, partial [Capsella rubella]
Length=321

 Score =   295 bits (756),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 187/266 (70%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK V+  VPEI E+VG+    Q+  + E D  E  K  +RL+FT+LMS+      
Sbjct  53   VSLKELKEVIANVPEITELVGSKAAGQIFKVHEHDDEERIKSVVRLIFTQLMSAKSSKTK  112

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V+S++  RL  + + R L +KE+LVL LEKQY  D+GV++AF FN+VKL PGEALYL A
Sbjct  113  QVISRMKIRLISETKHRELSDKEKLVLELEKQYTGDIGVISAFFFNYVKLNPGEALYLDA  172

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ G+CIECMA SDNVVRAGLTPKH DV+TLCSMLTYK G+PEILKG  L PY T
Sbjct  173  NEPHAYISGDCIECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYVT  232

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LP     V PAVPGPS+++V+ GEG + T S+  +V +GDVLF P
Sbjct  233  RYLPPFDEFEVDHCELPLGRSTVLPAVPGPSVYLVIEGEGKLQTGSTQLLVNQGDVLFVP  292

Query  198  ANTNTAV-ATTLGLSLFRAGIXQYVF  124
            A+    +   +  + L+RAG+    F
Sbjct  293  AHNEIHITGESDVMKLYRAGVSSRFF  318



>ref|XP_006408404.1| hypothetical protein EUTSA_v10020776mg [Eutrema salsugineum]
 gb|ESQ49857.1| hypothetical protein EUTSA_v10020776mg [Eutrema salsugineum]
Length=432

 Score =   299 bits (765),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 195/256 (76%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   ++V 
Sbjct  170  ELKSVIRAIPEIEELVGSEEANQVFCISEHD-EEKVKSAVRTIFTLLMSAGPDTTKQIVF  228

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R+L +KE+LVL+LEKQYP D+GV++AF FN+VKL PGEALYLGANEPH
Sbjct  229  KLKRRLHMESQERHLTDKERLVLKLEKQYPDDIGVISAFFFNYVKLNPGEALYLGANEPH  288

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIE MATSDNVVRAGLT K LD++TLCSML+YK GFPEILKG+ + PY TRYLP
Sbjct  289  AYLFGECIEVMATSDNVVRAGLTSKPLDIQTLCSMLSYKLGFPEILKGSRIRPYITRYLP  348

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D C LP  A  VFP+VPGPS+ +V+ GEG ++T +S + ++ GDVLF PA+T 
Sbjct  349  PFEEFEVDLCDLPCGASTVFPSVPGPSLLLVLLGEGRVSTDASADEISMGDVLFVPADTE  408

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAG+
Sbjct  409  IQLKSSFDLKLYRAGV  424



>ref|XP_010470599.1| PREDICTED: mannose-6-phosphate isomerase 2-like isoform X1 [Camelina 
sativa]
Length=498

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 190/266 (71%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK V+  VPEI E+VG+    Q+  + E D     KL +RL+FT+LMS+S     
Sbjct  230  VSLKELKEVITNVPEITELVGSKATGQIFKVNEHDEDVKVKLVVRLIFTQLMSASSSETK  289

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +VVS++  RL  + + R L +KE+LVL LE+QY  D+GV++AF FN+VKL PGEALYL A
Sbjct  290  QVVSRMKIRLISETKHRELSDKEKLVLELEEQYKGDIGVISAFFFNYVKLNPGEALYLDA  349

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ G+C+ECMA SDNVVRAGLTPKH DV+TLCSMLTYK G+PEILKG  L PY T
Sbjct  350  NEPHAYISGDCVECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYVT  409

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LPR    VFPAVPGPS+++V+ GEG + T S+  +V++GDVLF P
Sbjct  410  RYLPPFDEFEVDHCDLPRGKSTVFPAVPGPSVYLVIEGEGKLQTGSTQLLVSQGDVLFVP  469

Query  198  ANTNTAVATTLGL-SLFRAGIXQYVF  124
            A+    V     L  L+RAG+    F
Sbjct  470  AHNEIHVTGESDLMKLYRAGVSSRFF  495



>ref|XP_010463670.1| PREDICTED: mannose-6-phosphate isomerase 1 [Camelina sativa]
Length=432

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 195/256 (76%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   K+V 
Sbjct  170  ELKSVIRAIPEIEELVGSEEANQVFCISEHD-EEKVKSVVRTIFTLLMSADPDTTKKIVF  228

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R L +KE+LVL+LEKQYP+D+GV++AF FN+VKL PGEALYLGANEPH
Sbjct  229  KLKRRLHMESQERQLTDKERLVLKLEKQYPNDIGVISAFFFNYVKLNPGEALYLGANEPH  288

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIE MATSDNVVRAGLT K LD+++LCSML+YK G+PEILKG+ + PY TRYLP
Sbjct  289  AYLFGECIEVMATSDNVVRAGLTSKPLDIQSLCSMLSYKLGYPEILKGSRIRPYITRYLP  348

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D C LP  A  VFP+VPGPS+ +V+ GEG M+T +S + ++ GDVLF PA+T 
Sbjct  349  PFEEFEVDLCDLPSGASTVFPSVPGPSLLLVLQGEGRMSTEASADGISMGDVLFVPADTE  408

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAG+
Sbjct  409  IHLRSSSDLKLYRAGV  424



>emb|CDY34738.1| BnaA01g32870D [Brassica napus]
Length=432

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 194/256 (76%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   ++V 
Sbjct  170  ELKSVIRAIPEIEELVGSEETNQVFCISEHD-EEKVKSAVRTIFTLLMSAGPDTTKQIVF  228

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R+L EKE+LVL+LEKQYP+D+GV++AF FN++KL PGEALYLGANEPH
Sbjct  229  KLKRRLHMESQERHLTEKERLVLKLEKQYPNDIGVISAFFFNYIKLNPGEALYLGANEPH  288

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIE MATSDNVVRAGLT K LD+++LCSMLTYK GFPEILKG  + PY TRYLP
Sbjct  289  AYLFGECIEVMATSDNVVRAGLTSKPLDIQSLCSMLTYKLGFPEILKGTRIRPYITRYLP  348

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D C LP  A  VF +VPGPS+ +V+ GEG M+T +S + V+ GDVLF PA+T 
Sbjct  349  PFEEFEVDVCDLPSGASTVFLSVPGPSLLLVIHGEGRMSTDASADEVSVGDVLFVPADTE  408

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAG+
Sbjct  409  IQLKSSSDLKLYRAGV  424



>ref|XP_010511622.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Camelina sativa]
Length=445

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 190/266 (71%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK V+  VPEI E+VG+    Q+  + E D     K  +RL+FT+LMS+S     
Sbjct  177  VSLKELKEVITNVPEITELVGSKAAGQIFKVNENDDDVRIKSVVRLIFTQLMSASSSETK  236

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +VVS++  RL  + + R L +KE+LVL LEKQY  D+GV++AF FN+VKL PGEALYL A
Sbjct  237  QVVSRMKIRLISETKHRELSDKEKLVLELEKQYTGDIGVISAFFFNYVKLNPGEALYLDA  296

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ G+C+ECMA SDNVVRAGLTPKH DV+TLCSMLTYK G+PEILKG  L PY T
Sbjct  297  NEPHAYISGDCVECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYVT  356

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LPR    VFPAVPGPS+++V+ GEG + T S+  +V++GDVLF P
Sbjct  357  RYLPPFDEFEVDHCDLPRGKSTVFPAVPGPSVYLVIEGEGKLQTGSTQLLVSQGDVLFVP  416

Query  198  ANTNTAV-ATTLGLSLFRAGIXQYVF  124
            A+    V   +  + L+RAG+    F
Sbjct  417  AHNEIHVTGESDVMKLYRAGVSSRFF  442



>ref|XP_010485568.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Camelina sativa]
Length=432

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 195/256 (76%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   K+V 
Sbjct  170  ELKSVIRAIPEIEELVGSEEANQVFCISEHD-EEKVKSVVRTIFTLLMSADPDTTKKIVF  228

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R L +KE+LVL+LEKQYP+D+GV++AF FN+VKL PGEALYLGANEPH
Sbjct  229  KLKRRLHLESQERQLTDKERLVLKLEKQYPNDIGVISAFFFNYVKLNPGEALYLGANEPH  288

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIE MATSDNVVRAGLT K LD+++LCSML+YK G+PEILKG+ + PY TRYLP
Sbjct  289  AYLFGECIEVMATSDNVVRAGLTSKPLDIQSLCSMLSYKLGYPEILKGSRIRPYITRYLP  348

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D C LP  A  VFP+VPGPS+ +V+ GEG M+T +S + ++ GDVLF PA+T 
Sbjct  349  PFEEFEVDLCDLPSGASTVFPSVPGPSLLLVLQGEGRMSTEASADGISMGDVLFVPADTE  408

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAG+
Sbjct  409  IHLRSSSDLKLYRAGV  424



>ref|XP_006296709.1| hypothetical protein CARUB_v10013753mg [Capsella rubella]
 gb|EOA29607.1| hypothetical protein CARUB_v10013753mg [Capsella rubella]
Length=432

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 194/256 (76%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   K+V 
Sbjct  170  ELKSVIRAIPEIEELVGSEEANQVFCISEHD-EEKLKSVVRTIFTLLMSADPDTTKKIVF  228

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R L +KE+LVL+LEKQYP+D+GV++ F FN+VKL PGEALYLGANEPH
Sbjct  229  KLKRRLHMESQERQLTDKERLVLKLEKQYPNDIGVISTFFFNYVKLNPGEALYLGANEPH  288

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIE MATSDNVVRAGLT K LD+++LCSMLTYK G+PEILKG+ + PY TRYLP
Sbjct  289  AYLFGECIEVMATSDNVVRAGLTSKPLDIQSLCSMLTYKLGYPEILKGSRIRPYITRYLP  348

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D C LP  A  VFP+VPGPS+ +V+ GEG M+T +S + ++ GDVLF PA+T 
Sbjct  349  PFEEFEVDLCDLPSGASTVFPSVPGPSLLLVLQGEGRMSTEASADGISMGDVLFVPADTE  408

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAG+
Sbjct  409  IHLRSSTDLKLYRAGV  424



>ref|XP_010470600.1| PREDICTED: mannose-6-phosphate isomerase 2-like isoform X2 [Camelina 
sativa]
Length=500

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/268 (56%), Positives = 191/268 (71%), Gaps = 3/268 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK V+  VPEI E+VG+    Q+  + E D     KL +RL+FT+LMS+S     
Sbjct  230  VSLKELKEVITNVPEITELVGSKATGQIFKVNEHDEDVKVKLVVRLIFTQLMSASSSETK  289

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +VVS++  RL  + + R L +KE+LVL LE+QY  D+GV++AF FN+VKL PGEALYL A
Sbjct  290  QVVSRMKIRLISETKHRELSDKEKLVLELEEQYKGDIGVISAFFFNYVKLNPGEALYLDA  349

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ G+C+ECMA SDNVVRAGLTPKH DV+TLCSMLTYK G+PEILKG  L PY T
Sbjct  350  NEPHAYISGDCVECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYVT  409

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LPR    VFPAVPGPS+++V+ GEG + T S+  +V++GDVLF P
Sbjct  410  RYLPPFDEFEVDHCDLPRGKSTVFPAVPGPSVYLVIEGEGKLQTGSTQLLVSQGDVLFVP  469

Query  198  ANTNTAVATTLG---LSLFRAGIXQYVF  124
            A+    +  T     + L+RAG+    F
Sbjct  470  AHNEIHIHVTGESDLMKLYRAGVSSRFF  497



>ref|XP_008807086.1| PREDICTED: mannose-6-phosphate isomerase 2-like isoform X2 [Phoenix 
dactylifera]
Length=426

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 202/269 (75%), Gaps = 4/269 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL  VPEI E+VG+    +++N+KEQDG    K  LR +FTK++S+SK+ +S
Sbjct  158  VSIEELKDVLAGVPEIVELVGDENASKVLNIKEQDGYMEVKSILRSIFTKVISASKEAVS  217

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +++SKL  RLN +++ R L EKEQLVL LEKQYP+DVGV++AF FN+VKL PGEALY+GA
Sbjct  218  ELLSKLKCRLNVEHKIRMLTEKEQLVLLLEKQYPADVGVISAFFFNYVKLSPGEALYIGA  277

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ G+CIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQGFPEIL+G  L  Y +
Sbjct  278  NEPHAYISGDCIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQGFPEILQGTPLTHYIS  337

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNE--IVAEGDVLF  205
            RY PPF+EFE+D C+LP     VFPA+PGPSIF+++ GEG M   S+++  +V EG V F
Sbjct  338  RYTPPFDEFEVDCCLLPLQESLVFPAIPGPSIFVIVDGEGRMRMGSASDEVMVMEGHVYF  397

Query  204  SPANTNTAV--ATTLGLSLFRAGIXQYVF  124
             PA++   +  A    L L+RAG+   V 
Sbjct  398  VPAHSEIGLTAAPAGPLQLYRAGVNSRVL  426



>emb|CDY67541.1| BnaAnng24620D [Brassica napus]
Length=432

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 194/256 (76%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   ++V 
Sbjct  170  ELKSVIRAIPEIEELVGSEETNQVFCISEHD-EEKVKSAVRTIFTLLMSAGPDTTKQIVF  228

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R+L EKE+LVL+LEKQYP+D+GV++AF FN++KL PGEALYLGANEPH
Sbjct  229  KLKRRLHMESQERHLTEKERLVLKLEKQYPNDIGVISAFFFNYIKLNPGEALYLGANEPH  288

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIE MATSDNVVRAGLT K LD+++LCSMLTYK GFPEILKG  + PY TRYLP
Sbjct  289  AYLFGECIEVMATSDNVVRAGLTSKPLDIQSLCSMLTYKLGFPEILKGTRIRPYITRYLP  348

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D C LP  A  VF +VPGPS+ +V+ GEG M+T +S + V+ GDVLF PA+T 
Sbjct  349  PFEEFEVDICDLPSGASTVFLSVPGPSLLLVIHGEGRMSTDASADEVSVGDVLFVPADTE  408

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAG+
Sbjct  409  IQLKSSSDLKLYRAGV  424



>ref|XP_010499042.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Camelina sativa]
Length=432

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 195/256 (76%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   K+V 
Sbjct  170  ELKSVIRAIPEIEELVGSEEANQVFCISEHD-EEKLKSVVRTIFTLLMSADPDTTKKIVF  228

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R L +KE+LVL+LEKQYP+D+GV++AF FN+VKL PGEALYLGANEPH
Sbjct  229  KLKRRLHMESQERQLTDKERLVLKLEKQYPNDIGVISAFFFNYVKLNPGEALYLGANEPH  288

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIE MATSDNVVRAGLT K LD+++LCSML+YK G+PEILKG+ + PY TRYLP
Sbjct  289  AYLFGECIEVMATSDNVVRAGLTSKPLDIQSLCSMLSYKLGYPEILKGSRIRPYITRYLP  348

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PFEEFE+D C LP  A  VFP+VPGPS+ +V+ GEG M+T +S + ++ GDVLF PA+T 
Sbjct  349  PFEEFEVDLCDLPSGASTVFPSVPGPSLLLVLQGEGRMSTEASADGISVGDVLFVPADTE  408

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAG+
Sbjct  409  IHLRSSSDLKLYRAGV  424



>ref|XP_010415256.1| PREDICTED: mannose-6-phosphate isomerase 2 [Camelina sativa]
Length=444

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 191/266 (72%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK V+  VPEI E+VG+    Q+  + E D     K  +RL+FT+LMS+S     
Sbjct  176  VSLKELKEVITNVPEITELVGSKAAGQIFKVNEHDEDVRVKSVVRLIFTQLMSASSSETK  235

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +VVS++  RL  + + R L +KE+LVL+LE+QY  D+GV++AF FN+VKL PGEALYL A
Sbjct  236  QVVSRMKIRLISETKHRELSDKEKLVLKLEEQYTGDIGVISAFFFNYVKLNPGEALYLDA  295

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ G+C+ECMA SDNVVRAGLTPKH DV+TLCSMLTYK G+PEILKG  L PY T
Sbjct  296  NEPHAYISGDCVECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYVT  355

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LPR    VFPAVPGPS+++V+ GEG + T S+  +V++GDVLF P
Sbjct  356  RYLPPFDEFEVDHCDLPRGKSTVFPAVPGPSVYLVIEGEGKLQTGSTQLLVSQGDVLFVP  415

Query  198  ANTNTAV-ATTLGLSLFRAGIXQYVF  124
            A+    V   +  + L+RAG+    F
Sbjct  416  AHNEIHVTGESDVMKLYRAGVSSRFF  441



>ref|XP_002887099.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63358.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=442

 Score =   295 bits (755),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 190/266 (71%), Gaps = 1/266 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK V+  VPEI E+VG+   +Q+ N+ E D  E  K  +RL+FT+LMS+S +   
Sbjct  174  VPLKELKEVITNVPEITELVGSKAADQIFNVHEHDEDERVKSVVRLIFTQLMSASNNETK  233

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +VVS++ +RL  + + R L EKE LVL LEKQY  D+GV++AF FN+VKL  GEALYL A
Sbjct  234  QVVSRMKNRLISETKHRELSEKENLVLELEKQYSGDIGVISAFFFNYVKLNRGEALYLDA  293

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            N+PHAY+ G+C+ECMA SDNVVRAGLTPKH DV+TLCSMLTYK G+PEILKG  L PY T
Sbjct  294  NDPHAYISGDCVECMAASDNVVRAGLTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYVT  353

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSP  199
            RYLPPF+EFE+D C LP     VFPAVPGPS+++V+ G+G + T SS  +V  GDVLF P
Sbjct  354  RYLPPFDEFEVDHCDLPGGNSTVFPAVPGPSVYLVIEGQGKLQTGSSQLLVNRGDVLFVP  413

Query  198  ANTNTAV-ATTLGLSLFRAGIXQYVF  124
            A+    V   +  + L+RAG+    F
Sbjct  414  AHNEVHVTGESDVMKLYRAGVSSRFF  439



>ref|XP_010916406.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Elaeis guineensis]
Length=426

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/269 (60%), Positives = 199/269 (74%), Gaps = 4/269 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL  VPEI E+VG+    +++N KEQDG    K  L+ +FTKLMS++K+ +S
Sbjct  158  VSIEELKDVLAGVPEIVELVGDEDASKVLNAKEQDGYAEVKPILQSIFTKLMSANKEAVS  217

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            ++VSKL  RLN +N+ R L EKEQLVL LE+QYP+DVGV++AF FN+VKL PGEALY+GA
Sbjct  218  ELVSKLKCRLNVENKIRKLTEKEQLVLLLEQQYPADVGVISAFFFNYVKLSPGEALYIGA  277

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ G+CIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQGFPEIL+G  LN Y +
Sbjct  278  NEPHAYISGDCIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQGFPEILRGTPLNHYIS  337

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNE--IVAEGDVLF  205
            RY PPF+EFE+D C L      VFPA+ GPSIF+V+AGEG M   S+ +   V EG V F
Sbjct  338  RYTPPFDEFEVDCCSLLPQESLVFPALAGPSIFVVVAGEGRMQMGSAVDEATVMEGHVYF  397

Query  204  SPANTNTAV-ATTLG-LSLFRAGIXQYVF  124
             PAN    + A T G L L+RAG+   V 
Sbjct  398  VPANGEIGLTAGTAGPLQLYRAGVNSRVL  426



>ref|XP_008797801.1| PREDICTED: LOW QUALITY PROTEIN: mannose-6-phosphate isomerase 
1-like [Phoenix dactylifera]
Length=424

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 155/269 (58%), Positives = 197/269 (73%), Gaps = 4/269 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL  VPEI E++G+    +++N  EQ G    K  L+ +FTKLMS++K+ +S
Sbjct  156  VSIEELKDVLAGVPEIVELLGDEDASKVMNTTEQGGYVEVKPILQSIFTKLMSANKEAVS  215

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            ++VSKL  RLN +N+ RNL EKEQLVL LE+QYP+DVGV++AF FN++KL PGEALY+GA
Sbjct  216  EMVSKLKCRLNAENKIRNLTEKEQLVLLLEQQYPADVGVISAFFFNYMKLSPGEALYIGA  275

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ G+CIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQG P+IL+G  LN Y +
Sbjct  276  NEPHAYISGDCIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQGSPDILRGTXLNHYIS  335

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSS--NEIVAEGDVLF  205
            RY PPF+EFE+D C L      VFPA+PGPSIF+V+AGEG M   S+   E+V EG V F
Sbjct  336  RYTPPFDEFEVDLCSLSPQESVVFPAIPGPSIFVVVAGEGRMQMGSAIDEEMVMEGHVYF  395

Query  204  SPANTNTAVATTLG--LSLFRAGIXQYVF  124
             PA++   +       L L+RAG+   V 
Sbjct  396  VPAHSEIGLTAGAAAPLQLYRAGVNNRVL  424



>ref|XP_008807084.1| PREDICTED: mannose-6-phosphate isomerase 2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807085.1| PREDICTED: mannose-6-phosphate isomerase 2-like isoform X1 [Phoenix 
dactylifera]
Length=435

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/278 (56%), Positives = 202/278 (73%), Gaps = 13/278 (5%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL  VPEI E+VG+    +++N+KEQDG    K  LR +FTK++S+SK+ +S
Sbjct  158  VSIEELKDVLAGVPEIVELVGDENASKVLNIKEQDGYMEVKSILRSIFTKVISASKEAVS  217

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +++SKL  RLN +++ R L EKEQLVL LEKQYP+DVGV++AF FN+VKL PGEALY+GA
Sbjct  218  ELLSKLKCRLNVEHKIRMLTEKEQLVLLLEKQYPADVGVISAFFFNYVKLSPGEALYIGA  277

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQ---------GFPEILK  406
            NEPHAY+ G+CIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ         GFPEIL+
Sbjct  278  NEPHAYISGDCIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQVCIPYHLSLGFPEILQ  337

Query  405  GNALNPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNE--  232
            G  L  Y +RY PPF+EFE+D C+LP     VFPA+PGPSIF+++ GEG M   S+++  
Sbjct  338  GTPLTHYISRYTPPFDEFEVDCCLLPLQESLVFPAIPGPSIFVIVDGEGRMRMGSASDEV  397

Query  231  IVAEGDVLFSPANTNTAV--ATTLGLSLFRAGIXQYVF  124
            +V EG V F PA++   +  A    L L+RAG+   V 
Sbjct  398  MVMEGHVYFVPAHSEIGLTAAPAGPLQLYRAGVNSRVL  435



>ref|XP_004172892.1| PREDICTED: mannose-6-phosphate isomerase 2-like, partial [Cucumis 
sativus]
Length=393

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/263 (57%), Positives = 194/263 (74%), Gaps = 2/263 (1%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL +VPEI E+V  A  E+  +  EQDG E  K     +F+++MSS+K ++ + V 
Sbjct  128  ELKAVLSSVPEIVELVQCADAEKFSHDSEQDGKEKVKQLFESIFSQIMSSNKGIVREAVC  187

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ + ++R L  KEQL+LRLE QYP+DVG+LAA+  N+V+LKPGEALY+G NEPH
Sbjct  188  KLKRRLSLEKKKRQLSAKEQLILRLESQYPADVGILAAYFLNYVELKPGEALYVGPNEPH  247

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GECIECMATSDNVVRAGLT K  DV+ L SML YKQGFPEIL+G +LN YT +Y P
Sbjct  248  AYISGECIECMATSDNVVRAGLTSKKRDVQALLSMLNYKQGFPEILRGVSLNEYTRKYAP  307

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNE-IVAEGDVLFSPANT  190
            PF+EFE+D+CILP+AA   FP+VPGPS+F+VM+G+G + T  S E  + EG+VLF PA  
Sbjct  308  PFDEFEVDRCILPQAASVSFPSVPGPSLFLVMSGKGTIITGYSEETTLQEGEVLFVPAYM  367

Query  189  NTAV-ATTLGLSLFRAGIXQYVF  124
              ++ AT + L ++RAGI    F
Sbjct  368  EVSITATAIELHMYRAGINNRFF  390



>ref|XP_009383606.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=425

 Score =   289 bits (740),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 153/270 (57%), Positives = 203/270 (75%), Gaps = 5/270 (2%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL  VPEI +++GN    ++++ ++ +G  +AK  L+L+FTKLM++SK+ +S
Sbjct  157  VSIEELKDVLVAVPEITQLLGNDEASKILS-QDLNGYVDAKSFLQLVFTKLMTASKEAVS  215

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            ++VSKL +RL+ +N+ R L EKEQLVL LEKQY +DVGV+AAFLFN+VKL PGEALY+G 
Sbjct  216  ELVSKLKARLDLENKIRTLTEKEQLVLLLEKQYQADVGVIAAFLFNYVKLSPGEALYIGP  275

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLTPK++D +TLCSMLTYKQGFP IL+G+ +NPY +
Sbjct  276  NEPHAYISGECIECMATSDNVVRAGLTPKYIDKQTLCSMLTYKQGFPVILRGSPINPYVS  335

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNE--IVAEGDVLF  205
            R+ PPF+EFE+D+C+LP      F A+PGPSIF+V+AGEG M   S  E   + EGDV F
Sbjct  336  RFRPPFDEFEVDRCLLPSKESVEFSAIPGPSIFVVVAGEGRMEVSSVVEELKIMEGDVYF  395

Query  204  SPANTNTAVATTLG--LSLFRAGIXQYVFC  121
             PA T   ++      + L+RAG+   +F 
Sbjct  396  VPAQTEIRLSACADGPIKLYRAGVNSRIFA  425



>ref|XP_009409962.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Musa acuminata 
subsp. malaccensis]
Length=462

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/269 (56%), Positives = 196/269 (73%), Gaps = 4/269 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL  VPEI E++GN    ++I  K+ DG  +AK  LR +FTKLMS+SK+ + 
Sbjct  193  VNIEELKDVLVGVPEITELIGNEEASKIIGSKDLDGYLDAKALLRSIFTKLMSASKEAVL  252

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            ++V KL  RL+ +++ R L EKEQLVL LEKQY +DVGV+AAFLFN+VKL PGEALY+G+
Sbjct  253  ELVPKLKDRLDVESKIRTLTEKEQLVLLLEKQYQADVGVIAAFLFNYVKLSPGEALYIGS  312

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ G+CIECMA SDNVVRAGLT K++DV TLCSMLTYKQGFPEIL+G  +  Y +
Sbjct  313  NEPHAYISGDCIECMAASDNVVRAGLTAKYIDVPTLCSMLTYKQGFPEILRGVPIYSYVS  372

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAM--TTPSSNEIVAEGDVLF  205
            RY PPF+EFE+D+C+LP     VF A+PGPSIF+++AGEG M  ++P+    V +GD  F
Sbjct  373  RYTPPFDEFEVDRCLLPPKESVVFSAIPGPSIFVIVAGEGTMQISSPAEERKVIQGDAFF  432

Query  204  SPANTNTAVATTLG--LSLFRAGIXQYVF  124
             PA     +  +    + L+RAG+   VF
Sbjct  433  VPAQNEIRLIASADAPIHLYRAGVNNRVF  461



>gb|ABR16432.1| unknown [Picea sitchensis]
Length=432

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/277 (56%), Positives = 199/277 (72%), Gaps = 19/277 (7%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLIN--LKEQDGAENAKLTLRLLFTKLMssskdviskv  733
            ELK VLQTVPEI  ++G A  + L+N  L EQ  A   K  LR  FT+LM+ +K+ +++ 
Sbjct  158  ELKDVLQTVPEIESILGEAGAQALMNVELHEQIDA-YVKNPLRSAFTQLMTLNKEAVAEA  216

Query  732  vskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
            +SK+  RLN++N+ R L  KEQLVLRLEKQYP DVGVL+AF FN++KL PGEALYL ANE
Sbjct  217  LSKIKKRLNEENQIRTLTPKEQLVLRLEKQYPDDVGVLSAFFFNYIKLAPGEALYLDANE  276

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRY  373
            PHAYL GEC+ECMATSDNVVRAGLTPK+ DVKTLCSMLTYKQG PEIL+G  ++ +T+RY
Sbjct  277  PHAYLYGECVECMATSDNVVRAGLTPKYRDVKTLCSMLTYKQGLPEILEGVPVDAFTSRY  336

Query  372  LPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVA---EGDVLFS  202
             PPF EFE+D+CILP +    FPAVPGPSIF+V+ G+G +T   +NE ++   +GDVLF 
Sbjct  337  SPPFYEFEVDRCILPSSGTVTFPAVPGPSIFLVLYGKGVVTV--NNESISRLQQGDVLFV  394

Query  201  PANTNTAVATTLG-----------LSLFRAGIXQYVF  124
            P  T   +++ +            L L+RAG+    F
Sbjct  395  PVATELEISSIIEVDGDADKACSPLHLYRAGVNSKAF  431



>ref|XP_004143675.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Cucumis sativus]
 gb|KGN50328.1| hypothetical protein Csa_5G167200 [Cucumis sativus]
Length=451

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/263 (57%), Positives = 194/263 (74%), Gaps = 2/263 (1%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL +VPEI E+V  A  E+  +  EQDG E  K     +F+++MSS+K ++ + V 
Sbjct  186  ELKAVLSSVPEIVELVQCADAEKFSHDSEQDGKEKVKQLFESIFSQIMSSNKGIVREAVC  245

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ + ++R L  KEQL+LRLE QYP+DVG+LAA+  N+V+LKPGEALY+G NEPH
Sbjct  246  KLKRRLSLEKKKRQLSAKEQLILRLESQYPADVGILAAYFLNYVELKPGEALYVGPNEPH  305

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GECIECMATSDNVVRAGLT K  DV+ L SML YKQGFPEIL+G +LN YT +Y P
Sbjct  306  AYISGECIECMATSDNVVRAGLTSKKRDVQALLSMLNYKQGFPEILRGVSLNEYTRKYAP  365

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNE-IVAEGDVLFSPANT  190
            PF+EFE+D+CILP+AA   FP+VPGPS+F+VM+G+G + T  S E  + EG+VLF PA  
Sbjct  366  PFDEFEVDRCILPQAASVSFPSVPGPSLFLVMSGKGTIITGYSEETTLQEGEVLFVPAYM  425

Query  189  NTAV-ATTLGLSLFRAGIXQYVF  124
              ++ AT + L ++RAGI    F
Sbjct  426  EVSITATAIELHMYRAGINNRFF  448



>dbj|BAJ88474.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/270 (56%), Positives = 192/270 (71%), Gaps = 4/270 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL+TVPE+  +VG   I +L+  KE DG    +  L+  FTKLM +SK+ ++
Sbjct  167  VSVQELKDVLRTVPEVRMLVGKEDIAKLMTAKEHDGGIGVRSYLQSAFTKLMGTSKEAVA  226

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            + +SKL SRLN +N+ R   EKEQLVL LE+QYP DVG+L+AF FN+VKL PGEALY+GA
Sbjct  227  EAISKLKSRLNAENKIRTFTEKEQLVLSLEQQYPGDVGILSAFFFNYVKLSPGEALYIGA  286

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GEC+ECMATSDNV+RAGLTPK+ DV+TLCSMLTYKQ FPEIL+G  + PY  
Sbjct  287  NEPHAYLSGECVECMATSDNVIRAGLTPKYKDVQTLCSMLTYKQMFPEILQGVLVQPYVI  346

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNE--IVAEGDVLF  205
            RY PPF+EFE+D+ +LP+       AVPGPSIF++M GEG +      +  +  EGDV F
Sbjct  347  RYTPPFDEFEVDRYLLPQGESVTMLAVPGPSIFLIMTGEGEIQADGMPDEGVAKEGDVFF  406

Query  204  SPANTNTAV-ATTLG-LSLFRAGIXQYVFC  121
             PA T   + A+  G L L+RAG+    FC
Sbjct  407  VPARTEVKLHASGPGCLQLYRAGVNSRFFC  436



>ref|XP_004165797.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Cucumis sativus]
Length=441

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 195/268 (73%), Gaps = 3/268 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VL TVPE  E++G A   +L+ L ++D  E+ K  LRL FT+LMS+   +IS
Sbjct  167  ISLEELKDVLHTVPESVEMIGTAATNRLLLLDDEDEEEDLKSALRLAFTRLMSAPTLLIS  226

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            KV+S+L  RL+ ++E R L  KE LVL LEKQYP DVGV+AAF  N+VKL PGEALYLGA
Sbjct  227  KVISELTRRLHSESEVRQLTAKEVLVLNLEKQYPDDVGVIAAFFLNYVKLSPGEALYLGA  286

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLTPK  DV+TLC+MLTYKQGFPEIL+G  +NPY T
Sbjct  287  NEPHAYIKGECIECMATSDNVVRAGLTPKFRDVQTLCAMLTYKQGFPEILQGVPVNPYIT  346

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS---SNEIVAEGDVL  208
            +Y+PPF+EFE+D+C LP     +FPA PGPSIF+V  G+G M        +++++EGDVL
Sbjct  347  KYVPPFDEFEVDRCALPMGTSVLFPASPGPSIFLVAGGKGMMLLNEESLKSDVISEGDVL  406

Query  207  FSPANTNTAVATTLGLSLFRAGIXQYVF  124
            F PA T   + + + L +FR G+    F
Sbjct  407  FVPAETEINLTSEVELLIFRTGVNNKFF  434



>ref|XP_004145852.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Cucumis sativus]
 gb|KGN57784.1| Phosphomannose isomerase [Cucumis sativus]
Length=441

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 195/268 (73%), Gaps = 3/268 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VL TVPE  E++G A   +L+ L ++D  E+ K  LRL FT+LMS+   +IS
Sbjct  167  ISLEELKDVLHTVPESVEMIGTAATNRLLLLDDEDEEEDLKSALRLAFTRLMSAPTLLIS  226

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            KV+S+L  RL+ ++E R L  KE LVL LEKQYP DVGV+AAF  N+VKL PGEALYLGA
Sbjct  227  KVISELTRRLHSESEVRQLTAKEVLVLNLEKQYPDDVGVIAAFFLNYVKLSPGEALYLGA  286

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLTPK  DV+TLC+MLTYKQGFPEIL+G  +NPY T
Sbjct  287  NEPHAYIKGECIECMATSDNVVRAGLTPKFRDVQTLCAMLTYKQGFPEILQGVPVNPYIT  346

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS---SNEIVAEGDVL  208
            +Y+PPF+EFE+D+C LP     +FPA PGPSIF+V  G+G M        +++++EGDVL
Sbjct  347  KYVPPFDEFEVDRCALPMGTSVLFPASPGPSIFLVAGGKGMMLLNEESLKSDVISEGDVL  406

Query  207  FSPANTNTAVATTLGLSLFRAGIXQYVF  124
            F PA T   + + + L +FR G+    F
Sbjct  407  FVPAETEINLTSEVELLIFRTGVNNKFF  434



>ref|XP_010549921.1| PREDICTED: mannose-6-phosphate isomerase 1 [Tarenaya hassleriana]
Length=428

 Score =   286 bits (733),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 189/256 (74%), Gaps = 1/256 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+ VPEI E+VG     Q++++ EQ   E  K  L+ +FT LMS+  D   +++S
Sbjct  167  ELKGVLRDVPEIEELVGTEEANQVLSISEQH-TEEVKSVLQTIFTLLMSAGADSTKEIIS  225

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            K+  RL  ++++R L +KE+LVLRLEKQYP D+GV++AF FN+VKL PGEALYLGANEPH
Sbjct  226  KMKQRLCMESKERQLTDKERLVLRLEKQYPDDIGVISAFFFNYVKLNPGEALYLGANEPH  285

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GE IE MATSDNVVRAGLT K  D++TLCSMLTYKQGFPEILKG+ +  Y TRYLP
Sbjct  286  AYLSGESIEIMATSDNVVRAGLTSKLRDIQTLCSMLTYKQGFPEILKGSNVGAYITRYLP  345

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PF+EFEID C LP+    VF  V GPS+ +V+ GEG ++  +S + +  GDVLF+PA+T 
Sbjct  346  PFDEFEIDLCDLPQGESTVFSCVSGPSLVLVVQGEGKLSAGASTDDIVAGDVLFAPADTE  405

Query  186  TAVATTLGLSLFRAGI  139
              + ++  L L+RAG+
Sbjct  406  IHLESSSDLKLYRAGV  421



>ref|XP_008457018.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Cucumis melo]
Length=441

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 152/268 (57%), Positives = 196/268 (73%), Gaps = 3/268 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VL TVPE  E++G A   +L+ L ++D  E+ K  LRL FT+LMS+ K +IS
Sbjct  167  ISLEELKYVLHTVPESVEMIGTAATNRLLLLDDEDEEEDLKSALRLAFTQLMSAPKLLIS  226

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            KV+S+L  RL+ ++E R L  KE LVL LEKQYP DVG++AAF  N+VKL  GEALYLGA
Sbjct  227  KVISELTRRLHSESEVRQLTAKEALVLNLEKQYPDDVGIIAAFFLNYVKLSAGEALYLGA  286

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLTPK  DV+TLC+MLTYKQGFPEIL+G  +NPY T
Sbjct  287  NEPHAYIKGECIECMATSDNVVRAGLTPKFRDVQTLCAMLTYKQGFPEILQGVPMNPYIT  346

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMT---TPSSNEIVAEGDVL  208
            +Y+PPF+EFE+D+C LP+    +FP+ PGPSIF+V  G+G M        +++++EGDVL
Sbjct  347  KYVPPFDEFEVDRCALPKGTSVLFPSSPGPSIFLVAGGKGMMMLNEESVESDVISEGDVL  406

Query  207  FSPANTNTAVATTLGLSLFRAGIXQYVF  124
            F PA T   + + + L +FR G+    F
Sbjct  407  FVPAETEINLTSEVELLIFRTGVNNKFF  434



>gb|EEE52368.1| hypothetical protein OsJ_34433 [Oryza sativa Japonica Group]
Length=370

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/270 (57%), Positives = 190/270 (70%), Gaps = 4/270 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL+TVPE+ E+VG     +L+  KE DG    +  L+  FT LM++SK+ +S
Sbjct  101  VSVQELKDVLRTVPEVRELVGKEEAVKLMGAKEHDGGIGVRSYLQSAFTNLMTASKETVS  160

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            + VSKL SRLN +++ R L +KEQLVL LE QYP DVGVLAAF FN+VKL PGEALY+GA
Sbjct  161  EAVSKLKSRLNIESKVRTLTKKEQLVLSLEMQYPEDVGVLAAFFFNYVKLNPGEALYIGA  220

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GEC+ECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ +PEIL+G  +  Y T
Sbjct  221  NEPHAYLSGECVECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQNYPEILRGVPVQAYVT  280

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS--SNEIVAEGDVLF  205
            RY+PP EEFE+D+C+LP         VPGPSIF+VM GEG +   S        EGDV F
Sbjct  281  RYIPPSEEFEVDRCLLPSGESVTMSPVPGPSIFLVMTGEGKIEADSMLDEGKAKEGDVFF  340

Query  204  SPANTNTAV-ATTLG-LSLFRAGIXQYVFC  121
             PA+T   + A+  G + L+RAG+    F 
Sbjct  341  VPAHTEVRILASGPGSMQLYRAGVNSRFFS  370



>ref|XP_004979620.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Setaria italica]
Length=455

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/260 (58%), Positives = 189/260 (73%), Gaps = 4/260 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+TVPE+ E+VG     +L+++KEQDG    +  L+  FTKLM +S++ +S+ ++
Sbjct  190  ELKEVLRTVPEVQELVGKEESRKLLSVKEQDGGIGVRSYLKSAFTKLMIASEEAVSEAIA  249

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL SRLN +++ R L +KE+LVL LEKQYP DVGVLAAF  N+VKL PGEALY+GANEPH
Sbjct  250  KLKSRLNVESKVRTLTKKEKLVLSLEKQYPGDVGVLAAFFLNYVKLSPGEALYVGANEPH  309

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTY Q FPE+L+G  + PY TRY P
Sbjct  310  AYLSGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYNQTFPEVLQGVPVQPYVTRYTP  369

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS--SNEIVAEGDVLFSPAN  193
              +EFE+D+ +LPR        VPGPSIFIVM GEG +   S   N    EGD+ F PA+
Sbjct  370  STDEFEVDRYLLPRGKSVTMSPVPGPSIFIVMTGEGEIQGGSMPDNAKAKEGDIFFVPAH  429

Query  192  TNTAVATT--LGLSLFRAGI  139
            T   + T+    + LFRAG+
Sbjct  430  TEVKLYTSGPRSMQLFRAGV  449



>ref|XP_006842317.1| hypothetical protein AMTR_s00079p00142130 [Amborella trichopoda]
 gb|ERN03992.1| hypothetical protein AMTR_s00079p00142130 [Amborella trichopoda]
Length=421

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/261 (56%), Positives = 190/261 (73%), Gaps = 0/261 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL +VPEI ++VG+    QL+N++E DG E  K TL+ +FTKLMS+   V+S+ VS
Sbjct  160  ELKGVLSSVPEILDLVGDEAALQLLNIEEGDGEETVKATLQSIFTKLMSADNVVVSEAVS  219

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            K+ SRL  + ++R L  KE LVLRLEKQYP DVGV++AF  N++KL+PGEALYL ANEPH
Sbjct  220  KMKSRLEMEVKERKLTTKEHLVLRLEKQYPVDVGVISAFFLNYLKLQPGEALYLDANEPH  279

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTYK+G PEIL G  L+PYT RY P
Sbjct  280  AYIHGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKRGLPEILSGIPLDPYTMRYSP  339

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTN  187
            PF+EFE+D+CI+P  A+ V PA  GP+I IV++G+G +   +  E + +GDV F    + 
Sbjct  340  PFDEFEVDRCIIPLGAQVVLPASLGPAILIVLSGKGLVELDAVTEDLVKGDVFFVSCESE  399

Query  186  TAVATTLGLSLFRAGIXQYVF  124
              +     L ++RA +    F
Sbjct  400  LRLTAHDELHMYRAEVNHRFF  420



>gb|EAY72377.1| hypothetical protein OsI_00230 [Oryza sativa Indica Group]
Length=269

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/265 (57%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+TVPE+ ++VG     +L+++KE  G    K  LR  FTKLM++SK+ +S+ ++
Sbjct  4    ELKDVLRTVPEVEDLVGPEDAAKLLSVKEYHGVNEVKSCLRSAFTKLMTASKEAVSEAIT  63

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KLI RLN +++ R L EKE LVL LEKQYP DVGVL+AF FN++KL PGEALY+GANEPH
Sbjct  64   KLIFRLNAESKVRTLTEKENLVLSLEKQYPEDVGVLSAFFFNYIKLSPGEALYIGANEPH  123

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ FPEIL+G  + PY  RY P
Sbjct  124  AYLSGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQVFPEILRGVPVQPYVRRYTP  183

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS--SNEIVAEGDVLFSPAN  193
            PF+EFE+D C LP     V   V GPS+++VMAGEG +   S  + E   +GDV F PA 
Sbjct  184  PFDEFEVDCCSLPPGELVVISPVSGPSVYLVMAGEGEIQVDSMPNGEKSKQGDVFFVPAY  243

Query  192  TNTAVATT--LGLSLFRAGIXQYVF  124
            T    + +    + L+RAG+    F
Sbjct  244  TEVKFSASGPECMQLYRAGVNSRFF  268



>ref|XP_002449802.1| hypothetical protein SORBIDRAFT_05g023560 [Sorghum bicolor]
 gb|EES08790.1| hypothetical protein SORBIDRAFT_05g023560 [Sorghum bicolor]
Length=284

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/260 (56%), Positives = 186/260 (72%), Gaps = 4/260 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+TVPE+ E+VG     +L+++KEQDG    +  L+  FTKLM++S + IS+ ++
Sbjct  19   ELKEVLRTVPEVQELVGKEESRKLLSVKEQDGGIGVRSYLKSAFTKLMTASDEAISEAIA  78

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
             L +RLN +++ R+L +KEQLVL LEKQYP DVGVLAAF  N VKL PGEALY+GANEPH
Sbjct  79   NLKTRLNSESKARSLTKKEQLVLSLEKQYPGDVGVLAAFFLNFVKLNPGEALYVGANEPH  138

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTY Q  PEI++G  + PY TRY P
Sbjct  139  AYLSGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYNQASPEIMQGMPVQPYVTRYTP  198

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTP--SSNEIVAEGDVLFSPAN  193
              +EFE+D+ +LP         V GPSIFIV+ GEG +     + N    EGDV F PA+
Sbjct  199  STDEFEVDRYLLPPGKSVTMSPVAGPSIFIVVTGEGEIQAGFMTDNAKAKEGDVFFVPAH  258

Query  192  TNTAVATTL--GLSLFRAGI  139
            T   + T+L   + L+RAG+
Sbjct  259  TKVKLYTSLPRSMQLYRAGV  278



>gb|ACG45229.1| mannose-6-phosphate isomerase [Zea mays]
Length=437

 Score =   285 bits (728),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 190/265 (72%), Gaps = 4/265 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+T PEI  +VG+    +L+N+KE DG    K +L+  F KLM++SKD++S+ V+
Sbjct  172  ELKDVLRTFPEIEGLVGHEDTGKLMNMKEDDGVSEVKSSLQSAFAKLMTASKDMVSEAVA  231

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KLISRLN K++ R L +KEQLVL LE+QY  DVGV+AA  FN+VKL PGEALY+GANEPH
Sbjct  232  KLISRLNTKSKIRTLTDKEQLVLSLERQYQDDVGVIAALFFNYVKLSPGEALYIGANEPH  291

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQGFPEIL+G  + P+  RY P
Sbjct  292  AYLSGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQGFPEILRGVPVQPHVRRYTP  351

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTP--SSNEIVAEGDVLFSPAN  193
            PF EFE+D C++P     V   VPGPSIF+V+ GEG +     S  E   EGDV F PA 
Sbjct  352  PFNEFEVDWCLVPPGGLVVISPVPGPSIFLVITGEGEIQLDFMSDGEKAEEGDVFFVPAY  411

Query  192  TNTAVAT--TLGLSLFRAGIXQYVF  124
            T   ++      + L+RAG+    F
Sbjct  412  TEVKISACGPESVQLYRAGVNSRFF  436



>dbj|BAJ97590.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=467

 Score =   285 bits (730),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 149/260 (57%), Positives = 191/260 (73%), Gaps = 4/260 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++TVPE+  ++G+   ++L+ +KE  G  + K +L+  F KLM++SK+ +S+ V+
Sbjct  181  ELKDVIRTVPEVGGLIGHEDADKLMTVKEYHGGNDVKSSLQSAFAKLMTASKEAVSEAVN  240

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RLN +++ R L EKE+LVL LE+QYP DVGVLAA LFN+VKL PGEA+Y+GANEPH
Sbjct  241  KLKGRLNDESKIRTLTEKEELVLSLERQYPEDVGVLAALLFNYVKLSPGEAIYIGANEPH  300

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ FPEIL+G  + PY  RY P
Sbjct  301  AYLSGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQIFPEILRGVPVQPYVRRYTP  360

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTP--SSNEIVAEGDVLFSPAN  193
            P +EFE+D C+LPR   AV   VPGPSIF+VM GEG +     S  E   EGDV F PA+
Sbjct  361  PTDEFEVDCCLLPRGEVAVMAPVPGPSIFLVMTGEGEVQIDCMSDGEKAKEGDVFFVPAH  420

Query  192  TNTAVATT--LGLSLFRAGI  139
            T   ++      + L+RAG+
Sbjct  421  TEVKLSACGHASMQLYRAGV  440



>gb|ABA94585.1| mannose-6-phosphate isomerase, class I family protein, expressed 
[Oryza sativa Japonica Group]
Length=460

 Score =   285 bits (728),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 154/270 (57%), Positives = 190/270 (70%), Gaps = 4/270 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL+TVPE+ E+VG     +L+  KE DG    +  L+  FT LM++SK+ +S
Sbjct  191  VSVQELKDVLRTVPEVRELVGKEEAVKLMGAKEHDGGIGVRSYLQSAFTNLMTASKETVS  250

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            + VSKL SRLN +++ R L +KEQLVL LE QYP DVGVLAAF FN+VKL PGEALY+GA
Sbjct  251  EAVSKLKSRLNIESKVRTLTKKEQLVLSLEMQYPEDVGVLAAFFFNYVKLNPGEALYIGA  310

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GEC+ECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ +PEIL+G  +  Y T
Sbjct  311  NEPHAYLSGECVECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQNYPEILRGVPVQAYVT  370

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS--SNEIVAEGDVLF  205
            RY+PP EEFE+D+C+LP         VPGPSIF+VM GEG +   S        EGDV F
Sbjct  371  RYIPPSEEFEVDRCLLPSGESVTMSPVPGPSIFLVMTGEGKIEADSMLDEGKAKEGDVFF  430

Query  204  SPANTNTAV-ATTLG-LSLFRAGIXQYVFC  121
             PA+T   + A+  G + L+RAG+    F 
Sbjct  431  VPAHTEVRILASGPGSMQLYRAGVNSRFFS  460



>gb|EAY81490.1| hypothetical protein OsI_36663 [Oryza sativa Indica Group]
Length=460

 Score =   285 bits (728),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 154/270 (57%), Positives = 190/270 (70%), Gaps = 4/270 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL+TVPE+ E+VG     +L+  KE DG    +  L+  FT LM++SK+ +S
Sbjct  191  VSVQELKDVLRTVPEVRELVGKEEAVKLMGAKEHDGGIGVRSYLQSAFTNLMTASKETVS  250

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            + VSKL SRLN +++ R L +KEQLVL LE QYP DVGVLAAF FN+VKL PGEALY+GA
Sbjct  251  EAVSKLKSRLNIESKVRTLTKKEQLVLSLEMQYPEDVGVLAAFFFNYVKLNPGEALYIGA  310

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GEC+ECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ +PEIL+G  +  Y T
Sbjct  311  NEPHAYLSGECVECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQNYPEILRGVPVQAYVT  370

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS--SNEIVAEGDVLF  205
            RY+PP EEFE+D+C+LP         VPGPSIF+VM GEG +   S        EGDV F
Sbjct  371  RYIPPSEEFEVDRCLLPSGESVTMSPVPGPSIFLVMTGEGKIEADSMLDEGKAKEGDVFF  430

Query  204  SPANTNTAV-ATTLG-LSLFRAGIXQYVFC  121
             PA+T   + A+  G + L+RAG+    F 
Sbjct  431  VPAHTEVRILASGPGSMQLYRAGVNSRFFS  460



>ref|XP_004968078.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Setaria italica]
Length=440

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 195/265 (74%), Gaps = 4/265 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+TVPE+  +VG+    +L+++KE DG    K +L+  F KLM++SKD++S+ +S
Sbjct  175  ELKDVLRTVPEVEGLVGHEDTGKLMSMKEYDGGSEVKSSLQSAFAKLMTASKDMVSEAIS  234

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KLISRLN +++ R L +KEQLVL LEKQY  DVGVLAA  FN+VKL PGEALY+GANEPH
Sbjct  235  KLISRLNIESKIRTLTDKEQLVLSLEKQYQEDVGVLAALFFNYVKLSPGEALYIGANEPH  294

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ FPEIL+G  + P+  RY P
Sbjct  295  AYLSGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQAFPEILRGVPVQPHVRRYTP  354

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAM--TTPSSNEIVAEGDVLFSPAN  193
            PF+EFE+D C++P     V   VPGPS+F++M GEG +   + S+ E   +GDV F PA 
Sbjct  355  PFDEFEVDCCLVPPGELVVIAPVPGPSMFLIMMGEGELQIDSLSAGEKAKDGDVFFVPAY  414

Query  192  TNTAVAT--TLGLSLFRAGIXQYVF  124
            T   ++T  T  + L+RAGI    F
Sbjct  415  TEVKLSTFGTESMQLYRAGINSRFF  439



>gb|ABY59214.1| At1g67070, partial [Arabidopsis thaliana]
 gb|ABY59215.1| At1g67070, partial [Arabidopsis thaliana]
 gb|ABY59216.1| At1g67070, partial [Arabidopsis thaliana]
 gb|ABY59217.1| At1g67070, partial [Arabidopsis thaliana]
 gb|ABY59221.1| At1g67070, partial [Arabidopsis thaliana]
 gb|ABY59224.1| At1g67070, partial [Arabidopsis thaliana]
 gb|ABY59225.1| At1g67070, partial [Arabidopsis thaliana]
 gb|ABY59227.1| At1g67070, partial [Arabidopsis thaliana]
Length=219

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 168/217 (77%), Gaps = 0/217 (0%)
 Frame = -1

Query  843  EQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSRLNKKNEQRNLCEKEQL  664
            +Q+ N+ E D  E  K  +RL+FT+LMS+S +   +VVS++ +RL  + + R L EKE+L
Sbjct  1    DQIFNVHEHDEDERIKSVVRLIFTQLMSASNNETKQVVSRMKNRLLLETKHRELSEKEKL  60

Query  663  VLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVVRAG  484
            VL LEKQY  D+GV++AF FN+VKL PGEALYL ANEPHAY+ G+C+ECMA SDNVVRAG
Sbjct  61   VLELEKQYTGDIGVISAFFFNYVKLNPGEALYLDANEPHAYISGDCVECMAASDNVVRAG  120

Query  483  LTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEEFEIDQCILPRAAKAVFP  304
            LTPKH DV+TLCSMLTYK G+PEILKG  L PY TRYLPPF+EFE+D C LPR    VFP
Sbjct  121  LTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYVTRYLPPFDEFEVDHCDLPRGKSTVFP  180

Query  303  AVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPAN  193
            AVPGPS+++V+ G+G + T SS  +V  GDVLF PA+
Sbjct  181  AVPGPSVYLVIEGKGQLRTGSSKVLVNRGDVLFVPAD  217



>ref|NP_001140535.1| uncharacterized protein LOC100272600 [Zea mays]
 gb|ACF84028.1| unknown [Zea mays]
 tpg|DAA53656.1| TPA: mannose-6-phosphate isomerase [Zea mays]
Length=437

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/265 (57%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+  PEI  +VG+    +L+N+KE DG    K +L+  F KLM++SKD++S+ V+
Sbjct  172  ELKDVLRAFPEIEGLVGHEDTGKLMNMKEDDGVSEVKSSLQSAFAKLMTASKDMVSEAVA  231

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KLISRLN K++ R L +KEQLVL LE+QY  DVGV+AA  FN+VKL PGEALY+GANEPH
Sbjct  232  KLISRLNTKSKIRTLTDKEQLVLSLERQYQDDVGVIAALFFNYVKLSPGEALYIGANEPH  291

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQGFPEIL+G  + P+  RY P
Sbjct  292  AYLSGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQGFPEILRGVPVQPHVRRYTP  351

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTP--SSNEIVAEGDVLFSPAN  193
            PF EFE+D C++P     V   VPGPSIF+V+ GEG +     S  E   EGDV F PA 
Sbjct  352  PFNEFEVDWCLVPPGGLVVISPVPGPSIFLVITGEGEIQLDFMSDGEKAEEGDVFFVPAY  411

Query  192  TNTAVAT--TLGLSLFRAGIXQYVF  124
            T   ++      + L+RAG+    F
Sbjct  412  TEVKISACGPESVQLYRAGVNSRFF  436



>ref|XP_006643701.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Oryza brachyantha]
Length=284

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+TVPE+ ++VG     +L+++KE  G    K +L   FTKLM ++K+ +S+ ++
Sbjct  19   ELKDVLRTVPEVEDLVGPEDAAKLLSVKEYHGVNEVKSSLCSAFTKLMMANKEAVSEAIA  78

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KLI RL+ +++ R L EKE LVL LEKQYP DVGVLAAF FN++KL PGEALY+GANEPH
Sbjct  79   KLICRLDAESKVRTLTEKENLVLSLEKQYPEDVGVLAAFFFNYIKLSPGEALYIGANEPH  138

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ FPEIL+G  + P+  RY P
Sbjct  139  AYLSGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQVFPEILRGVPVEPHVRRYTP  198

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS--SNEIVAEGDVLFSPAN  193
            PF+EFE+D C LP     V   VPGPS+++VMAGEG +   S    E   +GDV F PA+
Sbjct  199  PFDEFEVDCCSLPSGELVVISPVPGPSVYLVMAGEGEIQVDSMPEGEKSKQGDVFFVPAH  258

Query  192  TNTAVATT--LGLSLFRAGIXQYVF  124
            T    + +    + L+RAG+    F
Sbjct  259  TEVKFSASGPECMLLYRAGVNSRFF  283



>ref|XP_010532333.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010532338.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=456

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 191/264 (72%), Gaps = 3/264 (1%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            EL+ VL T+PEI E++G    E+++ +KEQ+  + AK  L  +F K++ SS++ IS  ++
Sbjct  189  ELREVLLTIPEIVELIGLENTEKVLCMKEQEKDQEAKSILEFIFAKILVSSQERISDTIT  248

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL  + ++R L +KEQLVL+LE+QYP+D G+LAAFL N+VKL  GEALYLG NEPH
Sbjct  249  KLKRRLQTEKKKRLLSDKEQLVLKLERQYPTDTGILAAFLLNYVKLNRGEALYLGPNEPH  308

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GEC+ECMATSDNVVRAGLT K+ D KTL SMLTYKQGFPEIL+G  LN +T RYLP
Sbjct  309  AYIRGECVECMATSDNVVRAGLTSKYRDTKTLLSMLTYKQGFPEILRGIPLNRHTKRYLP  368

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSN--EIVAEGDVLFSPAN  193
            PFEEFE+D+CIL  A   VFP+V GPS+FI + G+G M +   +  E + EGDVLF  AN
Sbjct  369  PFEEFEVDRCILGEAEWTVFPSVAGPSLFICLTGQGTMESDEGHRPETLGEGDVLFVAAN  428

Query  192  TNTAV-ATTLGLSLFRAGIXQYVF  124
                V A +  + L+RAG+    F
Sbjct  429  VQVRVTAESREMELYRAGVSSRCF  452



>gb|ABY59220.1| At1g67070, partial [Arabidopsis thaliana]
Length=219

 Score =   275 bits (703),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 168/217 (77%), Gaps = 0/217 (0%)
 Frame = -1

Query  843  EQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSRLNKKNEQRNLCEKEQL  664
            +Q+ N+ E D  E  K  +RL+FT+LMS+S +   +VVS++ +RL  + + R L EKE+L
Sbjct  1    DQIFNVHEHDEDERIKSVVRLIFTQLMSASNNETKQVVSRMKNRLLLETKHRELSEKEKL  60

Query  663  VLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVVRAG  484
            VL LEKQY  D+GV++AF FN+VKL PGEALYL ANEPHAY+ G+C+ECMA SDNVVRAG
Sbjct  61   VLELEKQYTCDIGVISAFFFNYVKLNPGEALYLDANEPHAYISGDCVECMAASDNVVRAG  120

Query  483  LTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEEFEIDQCILPRAAKAVFP  304
            LTPKH DV+TLCSMLTYK G+PEILKG  L PY TRYLPPF+EFE+D C LPR    VFP
Sbjct  121  LTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYVTRYLPPFDEFEVDHCDLPRGKSTVFP  180

Query  303  AVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPAN  193
            AVPGPS+++V+ G+G + T SS  +V  GDVLF PA+
Sbjct  181  AVPGPSVYLVIEGKGQLRTGSSKVLVNRGDVLFVPAD  217



>ref|XP_006663584.1| PREDICTED: mannose-6-phosphate isomerase 1-like, partial [Oryza 
brachyantha]
Length=337

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/265 (57%), Positives = 193/265 (73%), Gaps = 4/265 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+TVPE+ E+VG     +L+  KE DG    K  L+  FTKLM++S++ +S+ VS
Sbjct  72   ELKDVLRTVPEVRELVGKEEAAKLLAAKELDGGIGVKSHLQSAFTKLMTASEETVSEAVS  131

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL SRLN +++ R L +KEQLVL LE Q+P DVGVL+AF FN+VKL PGEALY+GANEPH
Sbjct  132  KLKSRLNIESKVRTLTKKEQLVLSLEMQFPEDVGVLSAFFFNYVKLNPGEALYIGANEPH  191

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GEC+ECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ FPEIL+G+ +  + TRY P
Sbjct  192  AYLSGECVECMATSDNVVRAGLTPKYKDVQTLCSMLTYKQNFPEILRGDPIQAHVTRYTP  251

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSS-NEIVAE-GDVLFSPAN  193
            P EEFE+D+C+LP+        VPGPSIF+VM GEG +   S  +E  A+ GDV F PA+
Sbjct  252  PSEEFEVDRCLLPQGESVTMSPVPGPSIFLVMTGEGEIRADSMLDEGKAKVGDVFFVPAH  311

Query  192  TNTAV-ATTLG-LSLFRAGIXQYVF  124
            T   +  +  G + L+RAG+    F
Sbjct  312  TEVRIFGSGPGCMQLYRAGVNSRFF  336



>gb|ABY59218.1| At1g67070, partial [Arabidopsis thaliana]
 gb|ABY59222.1| At1g67070, partial [Arabidopsis thaliana]
 gb|ABY59223.1| At1g67070, partial [Arabidopsis thaliana]
Length=219

 Score =   275 bits (702),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 168/217 (77%), Gaps = 0/217 (0%)
 Frame = -1

Query  843  EQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSRLNKKNEQRNLCEKEQL  664
            +Q+ N+ E D  E  K  +RL+FT+LMS+S +   +VVS++ +RL  + + R L EKE+L
Sbjct  1    DQIFNVHEHDEDERIKSVVRLIFTQLMSASNNETKQVVSRMKNRLLLETKHRELSEKEKL  60

Query  663  VLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVVRAG  484
            VL LEKQY  D+GV++AF FN+VKL PG+ALYL ANEPHAY+ G+C+ECMA SDNVVRAG
Sbjct  61   VLELEKQYTGDIGVISAFFFNYVKLNPGDALYLDANEPHAYISGDCVECMAASDNVVRAG  120

Query  483  LTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEEFEIDQCILPRAAKAVFP  304
            LTPKH DV+TLCSMLTYK G+PEILKG  L PY TRYLPPF+EFE+D C LPR    VFP
Sbjct  121  LTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYVTRYLPPFDEFEVDHCDLPRGKSTVFP  180

Query  303  AVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPAN  193
            AVPGPS+++V+ G+G + T SS  +V  GDVLF PA+
Sbjct  181  AVPGPSVYLVIEGKGQLRTGSSKVLVNRGDVLFVPAD  217



>gb|ABY59228.1| At1g67070-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=220

 Score =   274 bits (701),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 167/218 (77%), Gaps = 0/218 (0%)
 Frame = -1

Query  843  EQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSRLNKKNEQRNLCEKEQL  664
            +Q+ N+ E D  E  K  +RL+FT+LMS+S +   +VVS++ +RL  + + R L EKE+L
Sbjct  1    DQIFNVHEHDEDERVKSVVRLIFTQLMSASNNETKQVVSRMKNRLISETKHRELSEKERL  60

Query  663  VLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVVRAG  484
            VL LEKQY  D+GV++AF FN+VKL PGEALYL ANEPHAY+ G+C+ECMA SDNVVRAG
Sbjct  61   VLELEKQYSGDIGVISAFFFNYVKLNPGEALYLDANEPHAYISGDCVECMAASDNVVRAG  120

Query  483  LTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEEFEIDQCILPRAAKAVFP  304
            LTPKH DV+TLCSMLTYK G+PEILKG  L PY TRYLPPF+EFE+D C LP     VFP
Sbjct  121  LTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYVTRYLPPFDEFEVDHCDLPGGKSTVFP  180

Query  303  AVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANT  190
            AVPGPS+++V+ G+G + T SS  +V  GDVLF PA+ 
Sbjct  181  AVPGPSVYLVIEGQGKLQTGSSQLLVNRGDVLFVPAHN  218



>gb|ABY59226.1| At1g67070, partial [Arabidopsis thaliana]
Length=219

 Score =   273 bits (699),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 167/217 (77%), Gaps = 0/217 (0%)
 Frame = -1

Query  843  EQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSRLNKKNEQRNLCEKEQL  664
            +Q+ N+ E D  E  K  +RL+FT+LMS+S +   +VVS++ +RL  + + R L EKE+L
Sbjct  1    DQIFNVHEHDEDERIKSVVRLIFTQLMSASNNETKQVVSRMKNRLLLETKHRELSEKEKL  60

Query  663  VLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVVRAG  484
            VL LEKQY  D+GV++AF FN+VKL PG+ALYL ANEPHAY+ G+C+ECMA SDNVVRAG
Sbjct  61   VLELEKQYTGDIGVISAFFFNYVKLNPGDALYLDANEPHAYISGDCVECMAASDNVVRAG  120

Query  483  LTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEEFEIDQCILPRAAKAVFP  304
            LTPKH DV+TLCSMLTYK G+PEILKG  L PY TRYLPPF EFE+D C LPR    VFP
Sbjct  121  LTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYVTRYLPPFNEFEVDHCDLPRGKSTVFP  180

Query  303  AVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPAN  193
            AVPGPS+++V+ G+G + T SS  +V  GDVLF PA+
Sbjct  181  AVPGPSVYLVIEGKGQLRTGSSKVLVNRGDVLFVPAD  217



>gb|ABY59229.1| At1g67070-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=220

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 165/218 (76%), Gaps = 0/218 (0%)
 Frame = -1

Query  843  EQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSRLNKKNEQRNLCEKEQL  664
            +Q+ N+ E D  E  K  +RL+FT+LMS+S +   +VVS++ +RL  + + R L EKE L
Sbjct  1    DQIFNVHEHDEDERVKSVVRLIFTQLMSASNNETKQVVSRMKNRLISETKHRELSEKENL  60

Query  663  VLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVVRAG  484
            VL  EKQY  D+GV++AF FN+VKL PGEALYL ANEPHAY+ G+C+ECMA SDNVVRAG
Sbjct  61   VLEFEKQYSGDIGVISAFFFNYVKLNPGEALYLDANEPHAYISGDCVECMAASDNVVRAG  120

Query  483  LTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEEFEIDQCILPRAAKAVFP  304
            LTPKH DV+TLCSMLTYK G+PEILKG  L PY TRYLPPF+EFE+D C LP     VFP
Sbjct  121  LTPKHRDVQTLCSMLTYKLGYPEILKGFPLTPYVTRYLPPFDEFEVDHCDLPGGKSTVFP  180

Query  303  AVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANT  190
            AVPGPS+++V+ G+G + T SS  +V  GDVLF PA+ 
Sbjct  181  AVPGPSVYLVIEGQGKLQTGSSQLLVNRGDVLFVPAHN  218



>gb|ABY59219.1| At1g67070, partial [Arabidopsis thaliana]
Length=219

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 167/217 (77%), Gaps = 0/217 (0%)
 Frame = -1

Query  843  EQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSRLNKKNEQRNLCEKEQL  664
            +Q+ N+ E D  E  K  +RL+FT+LMS+S +   +VVS++ +RL  + + R L EKE+L
Sbjct  1    DQIFNVHEHDEDERIKSVVRLIFTQLMSASNNETKQVVSRMKNRLLLETKHRELSEKEKL  60

Query  663  VLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVVRAG  484
            VL LEKQY  D+GV++AF FN+VKL PGEALYL ANEPHAY+ G+C+ECMA SDNVVRAG
Sbjct  61   VLELEKQYTGDIGVISAFFFNYVKLNPGEALYLDANEPHAYISGDCVECMAASDNVVRAG  120

Query  483  LTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEEFEIDQCILPRAAKAVFP  304
            LTPKH DV+TL SMLTYK G+PEILKG  L PY TRYLPPF+EFE+D C LPR    VFP
Sbjct  121  LTPKHRDVQTLSSMLTYKLGYPEILKGFPLTPYVTRYLPPFDEFEVDHCDLPRGKSTVFP  180

Query  303  AVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPAN  193
            AVPGPS+++V+ G+G + T SS  +V  GDVLF PA+
Sbjct  181  AVPGPSVYLVIEGKGQLRTGSSKVLVNRGDVLFVPAD  217



>ref|NP_001041907.1| Os01g0127900 [Oryza sativa Japonica Group]
 dbj|BAB18294.1| putative mannose-6-phosphate isomerase [Oryza sativa Japonica 
Group]
 dbj|BAF03821.1| Os01g0127900 [Oryza sativa Japonica Group]
 dbj|BAG91810.1| unnamed protein product [Oryza sativa Japonica Group]
Length=428

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 150/265 (57%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+TVPE+ ++VG     +L+++KE  G    K  LR  FTKLM++SK+ +S+ ++
Sbjct  163  ELKDVLRTVPEVEDLVGPEDAAKLLSVKEYHGVNEVKSCLRSAFTKLMTASKEAVSEAIT  222

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KLI RLN +++ R L EKE LVL LEKQYP DVGVL+AF FN++KL PGEALY+GANEPH
Sbjct  223  KLIFRLNAESKVRTLTEKENLVLSLEKQYPEDVGVLSAFFFNYIKLSPGEALYIGANEPH  282

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ FPEIL+G  + PY  RY P
Sbjct  283  AYLSGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQVFPEILRGVPVQPYVRRYTP  342

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS--SNEIVAEGDVLFSPAN  193
            PF+EFE+D C LP     V   V GPS+++VMAGEG +   S  + E   +GDV F PA 
Sbjct  343  PFDEFEVDCCSLPPGELVVISPVSGPSVYLVMAGEGEIQVDSMPNGEKSKQGDVFFVPAY  402

Query  192  TNTAVATT--LGLSLFRAGIXQYVF  124
            T    + +    + L+RAG+    F
Sbjct  403  TEVKFSASGPECMQLYRAGVNSRFF  427



>ref|NP_001063081.2| Os09g0389000 [Oryza sativa Japonica Group]
 dbj|BAD26072.1| putative mannose-6-phosphate isomerase (Phosphomannose isomerase) 
(PMI) (Phosphohexomutase) [Oryza sativa Japonica Group]
 gb|EAZ44604.1| hypothetical protein OsJ_29229 [Oryza sativa Japonica Group]
 dbj|BAF24995.2| Os09g0389000 [Oryza sativa Japonica Group]
Length=399

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 189/265 (71%), Gaps = 3/265 (1%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+TVPE+  ++G+ +  +L++ KE D     K TL+  F  LM +SKD++S+ +S
Sbjct  135  ELKDVLRTVPEVEGLIGHEHAAKLMSFKEYDAGNQVKSTLQSAFANLMLASKDMVSEALS  194

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KLISRLN +++ R L +KE+LVL LE+QY  DVGVLAA  FN+VKL PGEAL++GANEPH
Sbjct  195  KLISRLNIESKIRTLTDKEELVLSLERQYQEDVGVLAALFFNYVKLSPGEALHIGANEPH  254

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ D++TLCSMLTYKQ FPEIL+G  + P+  RY P
Sbjct  255  AYLSGECIECMATSDNVVRAGLTPKYKDIQTLCSMLTYKQAFPEILQGVPVQPHVRRYSP  314

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS---SNEIVAEGDVLFSPA  196
            PF+EFE+D C++P        +VPGPS+F+V+ GEG +   S     +   EGDV F PA
Sbjct  315  PFDEFEVDWCLVPADEVVTISSVPGPSVFLVITGEGELHAESLSGGKKEAKEGDVFFVPA  374

Query  195  NTNTAVATTLGLSLFRAGIXQYVFC  121
             T   ++T   + L+RAG+    F 
Sbjct  375  YTEINLSTHKSMQLYRAGVNSRFFS  399



>ref|XP_003577385.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Brachypodium 
distachyon]
Length=460

 Score =   279 bits (714),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 149/270 (55%), Positives = 188/270 (70%), Gaps = 4/270 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK+VL+TVPE+  +V      +L+  KE DG    +  L+  FTKLM ++K+ +S
Sbjct  191  VSVQELKIVLRTVPEVRMLVNKEDAVKLMTAKEHDGGIGVRSHLQSAFTKLMGTTKEAVS  250

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            + +SKL  RLN +++ R L EKEQL+L LE+QYP DVGVL+AF FN+VKL PGEALY+GA
Sbjct  251  EAISKLKIRLNGESKIRTLTEKEQLILSLEQQYPGDVGVLSAFFFNYVKLSPGEALYIGA  310

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAYL GEC+ECMATSDNV+RAGLTPK+ DV+TLCSMLTY Q FPEIL+G  + PY T
Sbjct  311  NEPHAYLSGECVECMATSDNVIRAGLTPKYKDVQTLCSMLTYNQMFPEILRGVPVQPYVT  370

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTP--SSNEIVAEGDVLF  205
            RY PPF+EFE+D+ +LP        AVPGPSIF+VM GEG +     +       GDV F
Sbjct  371  RYTPPFDEFEVDRYLLPHGKSVTTQAVPGPSIFLVMTGEGEIEADGMADGGKANVGDVFF  430

Query  204  SPANTNTAV-ATTLG-LSLFRAGIXQYVFC  121
             PA T   + A+  G L L+RAG+    FC
Sbjct  431  VPARTEVKLQASGPGCLQLYRAGVNSRFFC  460



>gb|EAZ08978.1| hypothetical protein OsI_31243 [Oryza sativa Indica Group]
Length=421

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 189/265 (71%), Gaps = 3/265 (1%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+TVPE+  ++G+ +  +L++ KE D     K TL+  F  LM +SKD++S+ +S
Sbjct  157  ELKDVLRTVPEVEGLIGHEHAAKLMSFKEYDAGNQVKSTLQSAFANLMLASKDMVSEALS  216

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KLISRLN +++ R L +KE+LVL LE+QY  DVGVLAA  FN+VKL PGEAL++GANEPH
Sbjct  217  KLISRLNIESKIRTLTDKEELVLSLERQYQEDVGVLAALFFNYVKLSPGEALHIGANEPH  276

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ D++TLCSMLTYKQ FPEIL+G  + P+  RY P
Sbjct  277  AYLSGECIECMATSDNVVRAGLTPKYKDIQTLCSMLTYKQAFPEILQGVPVQPHVRRYSP  336

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS---SNEIVAEGDVLFSPA  196
            PF+EFE+D C++P        +VPGPS+F+V+ GEG +   S     +   EGDV F PA
Sbjct  337  PFDEFEVDWCLVPADEVVTISSVPGPSVFLVITGEGELHAESLSGGKKEAKEGDVFFVPA  396

Query  195  NTNTAVATTLGLSLFRAGIXQYVFC  121
             T   ++T   + L+RAG+    F 
Sbjct  397  YTEINLSTHKSMQLYRAGVNSRFFS  421



>ref|NP_001147755.1| LOC100281365 [Zea mays]
 gb|ACG28581.1| mannose-6-phosphate isomerase [Zea mays]
Length=444

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 184/260 (71%), Gaps = 4/260 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+TVPE+ E+VG     +L+++KEQDG    +  L+  FTKLM++  + +S+ ++
Sbjct  179  ELKEVLRTVPEVQELVGKEESRKLLSVKEQDGGIGVRSYLKSAFTKLMTACDEAVSEAIT  238

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
             L SRL  +++ R+L +KEQLVL LEKQYP DVGVLAAF  N VKL PGEALY+ ANEPH
Sbjct  239  NLKSRLKSESKARSLTKKEQLVLSLEKQYPGDVGVLAAFFLNFVKLNPGEALYVSANEPH  298

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTY Q FPEIL+G  + PY TRY P
Sbjct  299  AYLSGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYNQAFPEILQGMPVQPYVTRYTP  358

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTP--SSNEIVAEGDVLFSPAN  193
              +EFE+D+ +LP         VPGPSIFIV+ GEG +     + +    EGDV F PA+
Sbjct  359  STDEFEVDRYLLPPGKSVTMSPVPGPSIFIVLTGEGEIQAGFMTGSAKAKEGDVFFVPAH  418

Query  192  TNTAVATTL--GLSLFRAGI  139
            T   + T+    + L+RAG+
Sbjct  419  TKVKLYTSCPRSMQLYRAGV  438



>gb|KDO76962.1| hypothetical protein CISIN_1g014147mg [Citrus sinensis]
Length=430

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 194/267 (73%), Gaps = 2/267 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   EL+ VL TVPEI ++VG A  EQ   + E   ++  K  +  +F++++ SSKD I 
Sbjct  161  ISLKELRNVLCTVPEIVDLVGGADAEQCFPVNEFGRSQEVKAIVESIFSQILLSSKDEIC  220

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +++S+L  RLN + ++R L +KE LVLRLE QYP D GVLAAFL N+VKL  GEAL +GA
Sbjct  221  EIISRLKWRLNLEKKKRQLTDKEMLVLRLEGQYPDDAGVLAAFLLNYVKLNRGEALCIGA  280

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLT KH D++TL SML  +QGFP+ILKG +LNPYTT
Sbjct  281  NEPHAYIRGECIECMATSDNVVRAGLTSKHRDIQTLFSMLNRRQGFPQILKGISLNPYTT  340

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNE-IVAEGDVLFS  202
            RYLPPFEEFE+D C++P+AA  VFP+V GPS+F+ ++G G ++   S E IV EG+VLF 
Sbjct  341  RYLPPFEEFEVDCCVIPQAASLVFPSVAGPSLFLFISGNGTLSAGFSKEQIVEEGEVLFV  400

Query  201  PANTNTAVAT-TLGLSLFRAGIXQYVF  124
            PA     +A+ +  L L+RAG+    F
Sbjct  401  PAYMEFTIASQSKELHLYRAGVNSSFF  427



>ref|XP_006469088.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Citrus sinensis]
Length=430

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 194/267 (73%), Gaps = 2/267 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   EL+ VL TVPEI ++VG A  EQ   + E   ++  K  +  +F++++ SSKD I 
Sbjct  161  ISLKELRNVLCTVPEIVDLVGGADAEQCFPVNEFGRSQEVKAIVESIFSQILLSSKDEIC  220

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +++S+L  RLN + ++R L +KE LVLRLE QYP D GVLAAFL N+VKL  GEAL +GA
Sbjct  221  EIISRLKWRLNLEKKKRQLTDKEMLVLRLEGQYPDDAGVLAAFLLNYVKLNRGEALCIGA  280

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLT KH D++TL SML  +QGFP+ILKG +LNPYTT
Sbjct  281  NEPHAYIRGECIECMATSDNVVRAGLTSKHRDIQTLFSMLNRRQGFPQILKGISLNPYTT  340

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNE-IVAEGDVLFS  202
            RYLPPFEEFE+D C++P+AA  VFP+V GPS+F+ ++G G ++   S E IV EG+VLF 
Sbjct  341  RYLPPFEEFEVDCCVIPQAASLVFPSVAGPSLFLFISGNGTLSAGFSKEQIVEEGEVLFV  400

Query  201  PANTNTAVAT-TLGLSLFRAGIXQYVF  124
            PA     +A+ +  L L+RAG+    F
Sbjct  401  PAYMEFTIASQSKELHLYRAGVNSSFF  427



>gb|KDP29436.1| hypothetical protein JCGZ_18357 [Jatropha curcas]
Length=455

 Score =   277 bits (708),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/263 (56%), Positives = 190/263 (72%), Gaps = 2/263 (1%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+ VPE+ E+VG +  EQ +   EQD     K  L  +F++L+SSS++ I +V+S
Sbjct  190  ELKDVLRNVPELEELVGGSNAEQFLYFSEQDRDAKVKAILEYIFSQLLSSSREKIFEVIS  249

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            K+  RL+ + ++R L +KEQLVLRLE QYP+D GV+AAFL N+VKL  GEALYLGANEPH
Sbjct  250  KIKRRLHLEMQERELTDKEQLVLRLESQYPADTGVIAAFLLNYVKLNRGEALYLGANEPH  309

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GECIECMA SDNVVR GLT K  D++TL +ML Y+QGFPEIL+G +LNPYTTRYLP
Sbjct  310  AYIAGECIECMANSDNVVRVGLTSKRRDIQTLLAMLEYRQGFPEILQGVSLNPYTTRYLP  369

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVA-EGDVLFSPANT  190
            P +EFE+D  ++PRAA  VFP+VPGPS+ + + G G +    S +  A EG+VLF PA T
Sbjct  370  PLDEFEVDLSVIPRAASVVFPSVPGPSVLLFIMGRGTIAAGFSKDGKAGEGEVLFVPACT  429

Query  189  NTAV-ATTLGLSLFRAGIXQYVF  124
               + A +  L L+RAG+    F
Sbjct  430  EIRITAESAELHLYRAGVNSRFF  452



>gb|AFW60447.1| mannose-6-phosphate isomerase [Zea mays]
Length=444

 Score =   276 bits (707),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 183/260 (70%), Gaps = 4/260 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+TVPE+ E+V      +L+++KEQDG    +  L+  FTKLM++  + +S+ ++
Sbjct  179  ELKEVLRTVPEVQELVDKEESRKLLSVKEQDGGIGVRSYLKSAFTKLMTACDEAVSEAIT  238

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
             L SRL  +++ R+L +KEQLVL LEKQYP DVGVLAAF  N VKL PGEALY+ ANEPH
Sbjct  239  NLKSRLKSESKARSLTKKEQLVLSLEKQYPGDVGVLAAFFLNFVKLNPGEALYVSANEPH  298

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTY Q FPEIL+G  + PY TRY P
Sbjct  299  AYLSGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYNQAFPEILQGMPVQPYVTRYTP  358

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTP--SSNEIVAEGDVLFSPAN  193
              +EFE+D+ +LP         VPGPSIFIV+ GEG +     + +    EGDV F PAN
Sbjct  359  STDEFEVDRYLLPPGKSVTMSPVPGPSIFIVLTGEGEIQAGFMTGSAKAKEGDVFFVPAN  418

Query  192  TNTAVATTL--GLSLFRAGI  139
            T   + T+    + L+RAG+
Sbjct  419  TKVKLYTSCPRSMQLYRAGV  438



>ref|XP_002526993.1| mannose-6-phosphate isomerase, putative [Ricinus communis]
 gb|EEF35365.1| mannose-6-phosphate isomerase, putative [Ricinus communis]
Length=446

 Score =   276 bits (706),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 190/258 (74%), Gaps = 2/258 (1%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK +L T PEI E+VG++ ++Q +++ EQD  +  K  L+ +F++++ SS D I +++S
Sbjct  179  ELKNMLCTFPEIVELVGDSNVKQFLHMNEQDRDDKGKTFLQSIFSQIVLSSSDEICELIS  238

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
             +  RL+ + ++R L +KE LVLRLE QYP+DVGV+AAFL N+VKL PGEALYL ANEPH
Sbjct  239  NMKRRLHLEMQERELTDKEWLVLRLESQYPADVGVMAAFLLNYVKLSPGEALYLEANEPH  298

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GECIECMA SDNVVRAGLTPK  DV+TL SML Y+QGFPEIL+G  L+P+TTRY P
Sbjct  299  AYVGGECIECMANSDNVVRAGLTPKQRDVQTLLSMLKYRQGFPEILRGVPLSPFTTRYRP  358

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTP-SSNEIVAEGDVLFSPANT  190
            P +EFE+D  ILP AA  VFP++PGPS+F+++ G G +       +IV EG+  F PA T
Sbjct  359  PLDEFEVDLSILPEAASVVFPSIPGPSLFLIIMGRGTIDAGFCDGKIVKEGEAYFVPAYT  418

Query  189  NTAV-ATTLGLSLFRAGI  139
               + A +  L L+RAG+
Sbjct  419  EIRITAKSTKLHLYRAGV  436



>ref|XP_011464099.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Fragaria vesca 
subsp. vesca]
Length=437

 Score =   273 bits (699),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 146/274 (53%), Positives = 194/274 (71%), Gaps = 9/274 (3%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK +L+T+PEIAE+VG A  E+++ + E+  +      L  +F++LM SSK+ IS
Sbjct  161  ISLKELKEMLRTIPEIAELVGVADAEKILLVGERHESGKVNTDLEAMFSRLMLSSKETIS  220

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            K++SKL  RLN++ ++R L  KEQLVLRLE QYP+DVG +AAF  N+VKLK GEALY G 
Sbjct  221  KMISKLKRRLNQEKKKRQLTVKEQLVLRLENQYPADVGAIAAFFLNYVKLKRGEALYCGP  280

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GEC+ECMATSDNVVRAGLT K +DV+TL SML Y+QG PEI++G +LN YTT
Sbjct  281  NEPHAYISGECVECMATSDNVVRAGLTSKQIDVQTLLSMLKYRQGAPEIMQGVSLNAYTT  340

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAM--------TTPSSNEIVA  223
            R++PPFEEFE+D C LP +A  VFP+  GPS+F+V AG+G               ++IV 
Sbjct  341  RFIPPFEEFEVDSCNLPHSASVVFPSFIGPSLFLVTAGKGRFDAGLAGDDVVTEDDDIVE  400

Query  222  EGDVLFSPANTNTAV-ATTLGLSLFRAGIXQYVF  124
            EG+VLF PA+T  ++ A +  L L+R G     F
Sbjct  401  EGEVLFVPAHTKISITARSTELHLYRVGANSTFF  434



>gb|EMT31567.1| Mannose-6-phosphate isomerase [Aegilops tauschii]
Length=422

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/241 (59%), Positives = 177/241 (73%), Gaps = 2/241 (1%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+TVPE+  +VG   + +L+  KE DG    +  L+  FTKLM++SK+ +++ +S
Sbjct  107  ELKDVLRTVPEVRMLVGKEDVVKLMTAKEHDGGIGVRSYLQSAFTKLMATSKEAVAEAIS  166

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL SRLN + + R   EKEQLVL LE+QYP DVGVL+AF FN+VKL+PGEALY+GANEPH
Sbjct  167  KLRSRLNGEIKIRTFTEKEQLVLSLEQQYPGDVGVLSAFFFNYVKLRPGEALYIGANEPH  226

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GEC+ECMATSDNV+RAGLTPK+ DV+TLCSMLTYKQ FPEIL+G  + PY  RY P
Sbjct  227  AYLSGECVECMATSDNVIRAGLTPKYKDVQTLCSMLTYKQMFPEILQGVLVQPYVIRYTP  286

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS--SNEIVAEGDVLFSPAN  193
            PF+EFE+D+ +LP+        VPGPSIF+VM GEG +         +  EGDV F PA 
Sbjct  287  PFDEFEVDRYLLPQGESVTMLPVPGPSIFLVMTGEGEIQADGMPDEGVAKEGDVFFVPAR  346

Query  192  T  190
            T
Sbjct  347  T  347



>ref|XP_008339655.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Malus domestica]
Length=452

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 150/274 (55%), Positives = 190/274 (69%), Gaps = 9/274 (3%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK +L +VPEIAE+V  A  E+++   E     NAK  +  +FT+LM  SKD I+
Sbjct  176  ISVKELKDMLNSVPEIAELVVVADAERILLGSEHHENWNAKTDIESIFTRLMLLSKDTIA  235

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
             ++S+L  RLN + ++R L  KEQLVLRLE QYP DVG +AAF  N+VKL  GEA+ LG 
Sbjct  236  DMISRLKRRLNLEKKKRLLTVKEQLVLRLESQYPDDVGAIAAFFLNYVKLNRGEAISLGP  295

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLT K LDV+TL SML Y+QG PEI++G +LNPYTT
Sbjct  296  NEPHAYISGECIECMATSDNVVRAGLTSKPLDVQTLLSMLKYRQGSPEIMQGVSLNPYTT  355

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTP-SSNEIVAEGD----  214
            RYLPPFEEFE+D C +PR+A  VFP+V GPS+F+  AG+G      S ++IV EGD    
Sbjct  356  RYLPPFEEFEVDCCNIPRSASVVFPSVLGPSLFLFTAGKGHFDAGLSEDDIVVEGDDLVE  415

Query  213  ---VLFSPANTNTAV-ATTLGLSLFRAGIXQYVF  124
               V F PANT  ++ A +  L L+R G+    F
Sbjct  416  EGEVFFVPANTKISITAKSTELQLYRVGVNSRFF  449



>ref|XP_007222285.1| hypothetical protein PRUPE_ppa005896mg [Prunus persica]
 gb|EMJ23484.1| hypothetical protein PRUPE_ppa005896mg [Prunus persica]
Length=438

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 147/274 (54%), Positives = 190/274 (69%), Gaps = 9/274 (3%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK +L +VPEIAE+VG    E+++ + EQ     +K  L  +F+++M  SKD IS
Sbjct  162  ISVKELKDMLSSVPEIAELVGVGNAERILLVNEQHENGKSKTDLESIFSRVMLLSKDTIS  221

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +++SKL  RLN + ++R L  KEQL LRLE QYP+DVG +AAF  N+VKL  GEA+ LG 
Sbjct  222  EMISKLKRRLNLEKKKRQLTVKEQLALRLESQYPADVGAIAAFFLNYVKLNRGEAISLGP  281

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLT K LDV+TL SML Y+QG PEIL+G  LNPYTT
Sbjct  282  NEPHAYISGECIECMATSDNVVRAGLTSKPLDVQTLLSMLKYRQGSPEILQGVPLNPYTT  341

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMT--------TPSSNEIVA  223
            RYLPPFEEFEID C LP++A  +FP+V GPS+F+  AG+G               ++IV 
Sbjct  342  RYLPPFEEFEIDCCNLPQSAAVIFPSVVGPSLFLFTAGKGHFDAGLPEDDMVKEGDDIVE  401

Query  222  EGDVLFSPANTNTAV-ATTLGLSLFRAGIXQYVF  124
            EG+V F PANT   + A +  L L+R G+   ++
Sbjct  402  EGEVFFVPANTKIIITAKSTELQLYRVGVNSKIY  435



>ref|XP_008389272.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X1 [Malus 
domestica]
Length=439

 Score =   269 bits (687),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 147/274 (54%), Positives = 190/274 (69%), Gaps = 9/274 (3%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK +L +VPEIAE+V     E+++   E      AK  +  +FT+LM  SKD I+
Sbjct  163  ISVKELKDMLNSVPEIAELVVVGDAERIVLGSEHHENGIAKTDIESVFTRLMLLSKDTIA  222

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +++S+L  RLN + ++R+L  KEQLVLRLE QYP DVG +AAF  N+VKL  GEA+ LG 
Sbjct  223  EMISRLKRRLNLEKKKRHLTVKEQLVLRLESQYPDDVGAIAAFFLNYVKLNRGEAISLGP  282

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLT K LDV+TL SML Y+QG PEI++G +LNPYTT
Sbjct  283  NEPHAYISGECIECMATSDNVVRAGLTSKPLDVQTLLSMLEYRQGSPEIMQGVSLNPYTT  342

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSS--------NEIVA  223
            RYLPPFEEFE+D C LP +A  VFP+V GPS+F+  AG+G      S        ++IV 
Sbjct  343  RYLPPFEEFEVDCCNLPHSASVVFPSVLGPSLFLFTAGKGHFDASLSEDDIVXEGDDIVE  402

Query  222  EGDVLFSPANTNTAV-ATTLGLSLFRAGIXQYVF  124
            EG+V F PANT  ++ A +  L L+R G+   +F
Sbjct  403  EGEVFFVPANTKISITAKSTELQLYRVGVNSRIF  436



>ref|XP_008243257.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Prunus mume]
Length=438

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 147/274 (54%), Positives = 190/274 (69%), Gaps = 9/274 (3%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK +L +VPEIAE+VG    E+++ +  Q     +K  L  LF+++M  SKD IS
Sbjct  162  ISVKELKDMLSSVPEIAELVGVGNAERILLVNGQHENGKSKTDLESLFSRVMLLSKDTIS  221

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +++SKL  RLN + ++R L  KEQL LRLE QYP+DVG +AAF  N+VKL  GEA+ LG 
Sbjct  222  EMISKLKRRLNLEKKKRQLTVKEQLALRLESQYPADVGAIAAFFLNYVKLNRGEAISLGP  281

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLT K LDV+TL SML Y+QG PEIL+G +LNPYTT
Sbjct  282  NEPHAYISGECIECMATSDNVVRAGLTSKPLDVQTLLSMLKYRQGSPEILQGVSLNPYTT  341

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTT--------PSSNEIVA  223
            RYLPPFEEFEID C LP++A  +FP+V GPS+F+  AG+G               ++IV 
Sbjct  342  RYLPPFEEFEIDCCNLPQSAAVIFPSVLGPSLFLFTAGKGHFDAGLPEDDMVKEGDDIVE  401

Query  222  EGDVLFSPANTNTAV-ATTLGLSLFRAGIXQYVF  124
            EG V F PANT  ++ A +  L L+R G+   ++
Sbjct  402  EGGVFFVPANTKISITAKSTELQLYRVGVNSKIY  435



>gb|EMS46597.1| putative mannose-6-phosphate isomerase [Triticum urartu]
Length=402

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 148/260 (57%), Positives = 192/260 (74%), Gaps = 4/260 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++TVPE+  ++G+   ++L+ +KE  G  + K +L+  F KLM++SK+ +S+ V+
Sbjct  116  ELKDVIRTVPEVGGLIGHEDADKLMTVKEYHGGNDVKSSLQSAFAKLMTASKEAVSEAVN  175

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RLN +++ R L EKE+LVL LE+QYP DVGVLAA LFN+VKL PGEA+Y+GANEPH
Sbjct  176  KLKGRLNDESKIRTLTEKEELVLSLERQYPEDVGVLAALLFNYVKLSPGEAIYIGANEPH  235

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ FPEIL G  + PY  RY P
Sbjct  236  AYLSGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQIFPEILGGVPVQPYVRRYTP  295

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAM--TTPSSNEIVAEGDVLFSPAN  193
            P +EFE+D C+LP     V P VPGPSIF+VM GEG +   + S  E   EGDV F PA+
Sbjct  296  PTDEFEVDCCLLPPGEVVVMPPVPGPSIFLVMTGEGEVQADSMSDGEKAKEGDVFFVPAH  355

Query  192  TNTAVATT--LGLSLFRAGI  139
            T   ++ +  + + L+RAG+
Sbjct  356  TEVRLSASGHVSMQLYRAGV  375



>ref|XP_008367007.1| PREDICTED: LOW QUALITY PROTEIN: mannose-6-phosphate isomerase 
1-like [Malus domestica]
Length=439

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 189/270 (70%), Gaps = 9/270 (3%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK +L +VPEIAE+V     E+++   E      AK  +  +FT+LM  SKD I++++S
Sbjct  167  ELKDMLNSVPEIAELVVVGDAERIVLGSEHHENGIAKTDIESVFTRLMLLSKDTIAEMIS  226

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            +L  RLN + ++R+L  KEQLVLRLE QYP DVG +AAF  N+VKL  GEA+ LG NEPH
Sbjct  227  RLKRRLNLEKKKRHLTVKEQLVLRLESQYPDDVGAIAAFFXNYVKLNRGEAISLGPNEPH  286

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GECIECMATSDNVVRAGLT K LDV+TL SML Y+QG PEI++G +LNPYTTRYLP
Sbjct  287  AYISGECIECMATSDNVVRAGLTSKPLDVQTLLSMLEYRQGSPEIMQGVSLNPYTTRYLP  346

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSS--------NEIVAEGDV  211
            PFEEFE+D C LP +A  VFP+V GPS+F+  AG+G      S        ++IV EG+V
Sbjct  347  PFEEFEVDCCNLPHSASVVFPSVLGPSLFLFTAGKGHFDASLSEDDIVMEGDDIVEEGEV  406

Query  210  LFSPANTNTAV-ATTLGLSLFRAGIXQYVF  124
             F PANT  ++ A +  L L+R G+   +F
Sbjct  407  FFVPANTKISITAKSTELQLYRVGVNSRIF  436



>ref|NP_001140476.1| uncharacterized protein LOC100272536 [Zea mays]
 gb|ACF83911.1| unknown [Zea mays]
 gb|ACG46630.1| mannose-6-phosphate isomerase [Zea mays]
Length=435

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 193/266 (73%), Gaps = 5/266 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL+T+PEI  +VG+    +++N+KE DG    K TL+  F KLM++SKD++S+ V+
Sbjct  169  ELKDVLRTIPEIQGLVGHEDTGKMMNMKEYDGVSEVKSTLQSAFAKLMTASKDMVSEAVA  228

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KLISRLN +++ R L +KEQL+L LE+QY  DVGVLAA  FN+VKL PGEALY+GANEPH
Sbjct  229  KLISRLNTESKIRTLTDKEQLLLSLERQYQDDVGVLAALFFNYVKLSPGEALYIGANEPH  288

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ FPEIL+G  + P+  RY P
Sbjct  289  AYLSGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQAFPEILRGVPVQPHVRRYTP  348

Query  366  PFEEFEIDQCILPRAAK-AVFPAVPGPSIFIVM--AGEGAMTTPSSNEIVAEGDVLFSPA  196
            PF EFE+D+C++P      V P VPGPSIF+VM  AGE  + + S  E   EGDV F PA
Sbjct  349  PFNEFEVDRCLVPPGGSLVVVPPVPGPSIFLVMTGAGEIQLDSASDGEKADEGDVFFVPA  408

Query  195  NTNTAVATT--LGLSLFRAGIXQYVF  124
             T   ++      L L+RAG+    F
Sbjct  409  YTEVKISACGPESLQLYRAGVNSRFF  434



>ref|XP_009356970.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=439

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 187/270 (69%), Gaps = 9/270 (3%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK +L +VPEIAE+V  A  E+++   E      AK  +  +FT+LM  SKD I+ ++S
Sbjct  167  ELKDMLNSVPEIAELVVVADAERILLGSEHHENGKAKTDIESIFTRLMLLSKDTIADMIS  226

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            +L  RLN + ++R L  KEQLVLRLE QYP DVG +AAF  N+VKL  GEA+ LG NEPH
Sbjct  227  RLKRRLNLEKKKRLLTVKEQLVLRLESQYPDDVGAIAAFFLNYVKLNRGEAISLGPNEPH  286

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GECIECMATSDNVVRAGLT K LDV+TL SML Y+QG PEI++G +LNPYTTRYLP
Sbjct  287  AYISGECIECMATSDNVVRAGLTSKPLDVQTLLSMLKYRQGSPEIMQGVSLNPYTTRYLP  346

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTP--------SSNEIVAEGDV  211
            PFEEFE+D C +PR+A  VFP+V GPS+F+  AG+G               +++V EG+V
Sbjct  347  PFEEFEVDCCNIPRSASVVFPSVLGPSLFMFTAGKGHFDASLPEDDIVVEGDDLVEEGEV  406

Query  210  LFSPANTNTAV-ATTLGLSLFRAGIXQYVF  124
             F PANT  ++ A +  L L+R G+    F
Sbjct  407  FFVPANTKISITAKSTELQLYRVGVNSRFF  436



>ref|XP_009356247.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=438

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 187/269 (70%), Gaps = 8/269 (3%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK +L +VPEIAE+V     E ++   E      AK  +  +FT+LM  SKD I++++S
Sbjct  167  ELKDMLNSVPEIAELVVVGDAEWILLGSEHHENGKAKTDIESIFTRLMLLSKDTIAEMIS  226

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            +L  RL  + ++R+L  KEQLVLRLE QYP DVG +AAF  N+VKL  GEA+ LG NEPH
Sbjct  227  RLKRRLYLEKKKRHLTVKEQLVLRLESQYPDDVGAIAAFFLNYVKLNRGEAISLGPNEPH  286

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AY+ GECIECMATSDNVVRAGLT K LDV+TL SML Y+QG PEI++G +LNPYTTRYLP
Sbjct  287  AYISGECIECMATSDNVVRAGLTSKPLDVQTLLSMLEYRQGSPEIMQGISLNPYTTRYLP  346

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSS-------NEIVAEGDVL  208
            PFEEFE+D C LP +A  VFP+V GPS+F+  AG+G      S       ++IV EG+V 
Sbjct  347  PFEEFEVDCCNLPHSASVVFPSVLGPSLFLFTAGKGHFDASLSEDDIVTGDDIVEEGEVF  406

Query  207  FSPANTNTAV-ATTLGLSLFRAGIXQYVF  124
            F PANT  ++ A +  L L+R G+   +F
Sbjct  407  FVPANTKISITAKSTELQLYRVGVNSRIF  435



>gb|EMT11818.1| Mannose-6-phosphate isomerase [Aegilops tauschii]
Length=374

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/260 (57%), Positives = 190/260 (73%), Gaps = 4/260 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++TVPE+  ++G+   ++L+ +KE  G  + K +L+  F KLM++SK+ +S+ V+
Sbjct  88   ELKDVIRTVPEVGGLIGHEDADKLMTVKEYHGGNDVKSSLQSAFAKLMTASKEAVSEAVN  147

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RLN +++ R L EKE+LVL LE+QYP DVGVLAA LFN+VKL PGEA+Y+GANEPH
Sbjct  148  KLKGRLNDESKIRTLTEKEELVLSLERQYPEDVGVLAALLFNYVKLSPGEAIYIGANEPH  207

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL GECIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ FPEIL+G  + PY  RY P
Sbjct  208  AYLSGECIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQIFPEILRGVPVQPYVRRYTP  267

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAM--TTPSSNEIVAEGDVLFSPAN  193
            P +EFE+D C+LP     V P VPGPSIF+VM GEG +   + S  E   E DV F PA+
Sbjct  268  PTDEFEVDCCLLPPGEVVVMPPVPGPSIFLVMTGEGEVQADSMSDGEKAKESDVFFVPAH  327

Query  192  TNTAVATT--LGLSLFRAGI  139
            T   ++      + L+RAG+
Sbjct  328  TEVRLSACGHASMQLYRAGV  347



>emb|CBI26999.3| unnamed protein product [Vitis vinifera]
Length=400

 Score =   262 bits (670),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 186/261 (71%), Gaps = 5/261 (2%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK VL  VPEI E++G A  EQ++   E  G E  K  L  +FT+LMSS+KD IS
Sbjct  136  IGLKELKDVLCGVPEIVELIGKADAEQVLRANEHVGEEKVKAVLEFIFTQLMSSNKDTIS  195

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +++ K+  RLN + E + +     LVLRLE QYP+DVGV+A+   NHVKL  G   +LGA
Sbjct  196  ELIFKIKPRLNMEKEVKMVSYLTFLVLRLEGQYPTDVGVIASPFLNHVKLNSG---FLGA  252

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEP+AY+ GEC ECMAT DNVVRAGLT KH D++ L SMLTY+QGFPEIL G ++NPYT 
Sbjct  253  NEPNAYIPGECTECMATLDNVVRAGLTSKHQDIRKLFSMLTYQQGFPEILVGVSMNPYTK  312

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNE-IVAEGDVLFS  202
            RYLPPF+EFE+D CILP+AA  VFP+VPGPS F++MAG+G +    + E ++ EG VLF 
Sbjct  313  RYLPPFDEFEVDCCILPQAASVVFPSVPGPSPFLIMAGKGTIHAGFAGEHVIGEGSVLFV  372

Query  201  PANTNTAV-ATTLGLSLFRAG  142
            PAN    + A+++ L L+RAG
Sbjct  373  PANMEIRIAASSMELQLYRAG  393



>ref|XP_010693191.1| PREDICTED: mannose-6-phosphate isomerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=479

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 185/264 (70%), Gaps = 7/264 (3%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   +L+ +L+ VPEI+++VG + ++QL+N+  +D     K  L+ LFT++MS+S+ V++
Sbjct  214  VGMKDLQKILKGVPEISQLVGASVVDQLLNITAEDDENAVKAALKQLFTQIMSASEHVVA  273

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +V+S+LI RL KK     L  +E+LVLRLE+QYP DVGVLAAFL N+V LKPG+AL LGA
Sbjct  274  EVLSQLIPRLRKKEV---LTSEEKLVLRLEEQYPGDVGVLAAFLMNYVTLKPGQALCLGA  330

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKG---NALNP  388
            NE HAY+ G+CIECMATSDNVVRAGLTPK  DVKTLC MLTYK G P IL G      N 
Sbjct  331  NELHAYVSGDCIECMATSDNVVRAGLTPKKRDVKTLCEMLTYKLGRPNILSGFYVEGTNE  390

Query  387  YTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVL  208
             T RY PPFEEFE+D C LP      FP++ GPS+F+V  G G + T  S E V  GDVL
Sbjct  391  RTKRYRPPFEEFEVDHCDLPEGTSTHFPSIAGPSLFLVTEGTGTIETSLSTEKVRVGDVL  450

Query  207  FSPANTNTAVATT-LGLSLFRAGI  139
            F+PANT   + ++     L+RAG+
Sbjct  451  FAPANTKLKIKSSGRRFQLYRAGV  474



>ref|XP_003567941.1| PREDICTED: mannose-6-phosphate isomerase 1 [Brachypodium distachyon]
Length=447

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 181/260 (70%), Gaps = 4/260 (2%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V+++VPE+  ++G+    +L+ +K    A + K +L+  F KLM++SK  +S+ ++
Sbjct  171  ELKDVIRSVPEVVGLIGHEDAGKLMAIKGYHEANDVKSSLQSAFAKLMTASKQAVSEAIA  230

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ +++ R L EKE L+L LE+QYP DVGVL+A  FN+VKL PGEA+Y+GANEPH
Sbjct  231  KLKVRLDDESKIRTLTEKEHLLLSLERQYPEDVGVLSALFFNYVKLSPGEAIYIGANEPH  290

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLP  367
            AYL G+CIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ FPEIL+G  + PY  RY P
Sbjct  291  AYLSGDCIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQIFPEILRGVPVQPYVRRYTP  350

Query  366  PFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS--SNEIVAEGDVLFSPAN  193
            P +EFE+D C+LP     V    P PSIF+VM GEG +   S    E   EGDV F PA 
Sbjct  351  PSDEFEVDCCLLPPGEVVVMFPAPSPSIFLVMTGEGEIQVDSMLEGEKAKEGDVFFIPAY  410

Query  192  TNTAVATT--LGLSLFRAGI  139
            T   ++      + L+RAG+
Sbjct  411  TEARLSACGHESMKLYRAGV  430



>ref|NP_001068225.1| Os11g0600900 [Oryza sativa Japonica Group]
 dbj|BAF28588.1| Os11g0600900 [Oryza sativa Japonica Group]
Length=219

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = -1

Query  714  RLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLL  535
            RLN +++ R L +KEQLVL LE QYP DVGVLAAF FN+VKL PGEALY+GANEPHAYL 
Sbjct  18   RLNIESKVRTLTKKEQLVLSLEMQYPEDVGVLAAFFFNYVKLNPGEALYIGANEPHAYLS  77

Query  534  GECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEE  355
            GEC+ECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ +PEIL+G  +  Y TRY+PP EE
Sbjct  78   GECVECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQNYPEILRGVPVQAYVTRYIPPSEE  137

Query  354  FEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS--SNEIVAEGDVLFSPANTNTA  181
            FE+D+C+LP         VPGPSIF+VM GEG +   S        EGDV F PA+T   
Sbjct  138  FEVDRCLLPSGESVTMSPVPGPSIFLVMTGEGKIEADSMLDEGKAKEGDVFFVPAHTEVR  197

Query  180  V-ATTLG-LSLFRAGIXQYVF  124
            + A+  G + L+RAG+    F
Sbjct  198  ILASGPGSMQLYRAGVNSRFF  218



>ref|XP_006448445.1| hypothetical protein CICLE_v10017881mg [Citrus clementina]
 gb|ESR61685.1| hypothetical protein CICLE_v10017881mg [Citrus clementina]
Length=423

 Score =   253 bits (645),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 140/267 (52%), Positives = 184/267 (69%), Gaps = 9/267 (3%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   EL+ VL TVPEI ++VG A  EQ   + E   ++  K  +  +F++++ SS+D I 
Sbjct  161  ISLKELRNVLCTVPEIVDLVGGADAEQCFPVSEFGRSQEVKAIVESIFSQILLSSRDEIC  220

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            ++VS+L  RLN + ++R L +KE LVLRLE QYP D GVLA FL N+VKL  GEAL +GA
Sbjct  221  EIVSRLKWRLNLEKKKRQLTDKEMLVLRLEGQYPDDAGVLATFLLNYVKLNRGEALCIGA  280

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLT KH D+          +GFP+ILKG +LNP+TT
Sbjct  281  NEPHAYIRGECIECMATSDNVVRAGLTSKHRDIDA-------AEGFPQILKGISLNPHTT  333

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNE-IVAEGDVLFS  202
            RYLPPFEEFE+D CI+P+AA  VFP+V GPS+F+ ++  G ++   S E IV EG+VLF 
Sbjct  334  RYLPPFEEFEVDFCIIPQAASVVFPSVAGPSLFLFISRNGTLSAGFSKEQIVEEGEVLFV  393

Query  201  PANTN-TAVATTLGLSLFRAGIXQYVF  124
            PA    T  + +  L L+RAG+    F
Sbjct  394  PAYMEFTITSQSKELHLYRAGVNSSFF  420



>ref|XP_001775706.1| predicted protein [Physcomitrella patens]
 gb|EDQ59509.1| predicted protein [Physcomitrella patens]
Length=425

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/271 (49%), Positives = 172/271 (63%), Gaps = 21/271 (8%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKE-QDGAENAKLTLRLLFTKLMssskdviskvv  730
            ELK  ++TVPE+  V+G A  E LI L + +   + +K  L+  +T LM+   DV+S  V
Sbjct  149  ELKQAVETVPELRSVLGEATSEALIQLGQCKVSGDESKRKLKEAYTILMTLRNDVVSSTV  208

Query  729  skliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEP  550
            S+L+ RL      R L EKE+LVLRLEKQYP+D+GVL+ F  N+++L PGEA+ LGANEP
Sbjct  209  SQLVIRL-----VRQLTEKEELVLRLEKQYPADIGVLSIFFLNYLRLSPGEAVCLGANEP  263

Query  549  HAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYL  370
            HAYL GE IECMA SDNVVRAG TPK+ D +TLCSMLTYKQG P++L G  ++  TTRY 
Sbjct  264  HAYLSGEIIECMAASDNVVRAGFTPKYRDTQTLCSMLTYKQGLPDMLTGTPVSACTTRYT  323

Query  369  PPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEI--VAEGDVLFSPA  196
            PPF+EFE+D  ++P      F  + GPSIFIV  G G +       +  V +GDV F  A
Sbjct  324  PPFDEFEVDHIVVPVGESINFENL-GPSIFIVFEGIGVVAQSDRQTVTSVKKGDVFFVSA  382

Query  195  NTNTAVATTLG------------LSLFRAGI  139
              N  +A T+             L L+RAG+
Sbjct  383  GQNFEIAATVEVDEDVAPAVQAPLHLYRAGV  413



>ref|XP_001754844.1| predicted protein [Physcomitrella patens]
 gb|EDQ80298.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 168/271 (62%), Gaps = 16/271 (6%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAEN-AKLTLRLLFTKLMssskdviskvv  730
            ELK  ++TVPE+  V+     + LI L       N AK  L+  +T LM+   DV++  V
Sbjct  149  ELKEAVETVPELRSVLKEDTCKALIMLGTCKVERNEAKQALKQAYTTLMTLPNDVVASTV  208

Query  729  skliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEP  550
            ++L++R+    + R L  KE LV+ LEKQYP+D+GVL+ F  N+++L PGEA+ L ANEP
Sbjct  209  TELVNRVILLRQVRELTAKEDLVIELEKQYPADIGVLSVFFLNYLQLVPGEAVCLDANEP  268

Query  549  HAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYL  370
            HAYL GE +ECMA SDNVVRAG TPK+ D +TLCSMLTYKQG PE+L G  +N YTTRY 
Sbjct  269  HAYLSGEIVECMAASDNVVRAGFTPKYRDTQTLCSMLTYKQGLPEVLTGTHVNDYTTRYT  328

Query  369  PPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVA--EGDVLFSPA  196
            PPF+EFE+D  ++P  + +    + GPSIF+V  G G +    + +I    +G + F PA
Sbjct  329  PPFDEFEVDHIVVPLGSSSELTTM-GPSIFLVFEGIGVIGNNDAEDITGLKKGVIFFVPA  387

Query  195  NTNTAVATTLG------------LSLFRAGI  139
            +    +A  L             L L+RAG+
Sbjct  388  DQKIVIAAPLDADHSYDDLKRKPLQLYRAGV  418



>ref|XP_002987355.1| hypothetical protein SELMODRAFT_125724 [Selaginella moellendorffii]
 ref|XP_002989145.1| hypothetical protein SELMODRAFT_129293 [Selaginella moellendorffii]
 gb|EFJ09739.1| hypothetical protein SELMODRAFT_129293 [Selaginella moellendorffii]
 gb|EFJ11670.1| hypothetical protein SELMODRAFT_125724 [Selaginella moellendorffii]
Length=422

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 166/266 (62%), Gaps = 13/266 (5%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            EL+  L++VPE+ + +G   +E +I        ++AK  LR  FT LM+  + V++  +S
Sbjct  151  ELQAALESVPELRDALGPLVVESVIR---SGCGQSAKDVLRRAFTCLMTLDESVVTHTLS  207

Query  726  kliSRLNKKNEQRN-LCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEP  550
             LI RL +K++    L  KE+LV+ LEKQYP DVGVL+AF  N+  L+ G+A++L ANEP
Sbjct  208  NLIDRLKRKSKAAGGLSPKEELVVSLEKQYPGDVGVLSAFFLNYTNLEAGQAVFLDANEP  267

Query  549  HAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYL  370
            HAYL GEC+ECMATSDNVVRAGLTPK  D +TLCSML+Y Q    IL G  +NP+T RY 
Sbjct  268  HAYLYGECVECMATSDNVVRAGLTPKFRDTQTLCSMLSYNQASKTILDGCYVNPFTRRYS  327

Query  369  PPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTT----PSSNEIVA---EGDV  211
            PP +EFE+D   +P    A   +  GPSIF+V  G G ++       +N I+A    G++
Sbjct  328  PPSDEFEVDHICVPVGGTAKISSPCGPSIFLVYRGMGVLSRVGKEDEANSIIAGLVRGNI  387

Query  210  LFSPANTNTAVATTL--GLSLFRAGI  139
                A T   V+  +   L L+RAG+
Sbjct  388  FMLVAGTELEVSAVMDDALQLYRAGV  413



>ref|XP_008807087.1| PREDICTED: mannose-6-phosphate isomerase 2-like isoform X3 [Phoenix 
dactylifera]
Length=326

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL  VPEI E+VG+    +++N+KEQDG    K  LR +FTK++S+SK+ +S
Sbjct  158  VSIEELKDVLAGVPEIVELVGDENASKVLNIKEQDGYMEVKSILRSIFTKVISASKEAVS  217

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +++SKL  RLN +++ R L EKEQLVL LEKQYP+DVGV++AF FN+VKL PGEALY+GA
Sbjct  218  ELLSKLKCRLNVEHKIRMLTEKEQLVLLLEKQYPADVGVISAFFFNYVKLSPGEALYIGA  277

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQ  427
            NEPHAY+ G+CIECMATSDNVVRAGLTPK+ DV+TLCSMLTYKQ
Sbjct  278  NEPHAYISGDCIECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQ  321



>ref|XP_011097180.1| PREDICTED: mannose-6-phosphate isomerase 1 isoform X2 [Sesamum 
indicum]
Length=342

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   E K V++ VPEI EVVG A   Q +N+ E DG +  K  L  LFTKLMS+SK +IS
Sbjct  174  VGLEEFKSVVRNVPEIIEVVGTASAHQALNISEDDGEKKLKEVLHSLFTKLMSTSKAIIS  233

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
             VV KLISRLN   + R L +KE+LVLRLEKQ+P DVGV+AAFL N+VKL  GEALY+ A
Sbjct  234  DVVLKLISRLNITRKVRQLTDKEELVLRLEKQFPGDVGVIAAFLLNYVKLSAGEALYVAA  293

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQ  427
            NEPHAY+ GEC+ECMATSDNVVRAGLTPK LDV+TLCSMLTYKQ
Sbjct  294  NEPHAYIHGECVECMATSDNVVRAGLTPKTLDVQTLCSMLTYKQ  337



>ref|XP_007514601.1| mannose-6-phosphate isomerase [Bathycoccus prasinos]
 emb|CCO14841.1| mannose-6-phosphate isomerase [Bathycoccus prasinos]
Length=415

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 165/269 (61%), Gaps = 16/269 (6%)
 Frame = -1

Query  912  FGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDG-AENAKLTLRLLFTKLMssskdvisk  736
              E K  L+  PE+  + G       I L+E D   E+ K  ++ LFTK+M + K+ ++K
Sbjct  157  ISEPKEALEKCPELKLLTG-------IRLEEMDAMKEDKKAQMKYLFTKVMLAEKEEVAK  209

Query  735  vvskliSRLNKKNEQRN---LCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYL  565
             V  L+ RL ++ E +      E+++L LRL  QYP DVGV+ A+L N++KL+PGEA+Y+
Sbjct  210  HVRALVKRLKEEAEGKGGNGDDERDRLALRLNGQYPDDVGVMCAYLLNYIKLQPGEAVYM  269

Query  564  GANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPY  385
             ANEPHAYL GEC+E MATSDNVVRAGLTPK  D + LC MLTYK G PE+L G+ ++  
Sbjct  270  AANEPHAYLDGECVEVMATSDNVVRAGLTPKARDTEILCDMLTYKLGKPEVLTGDVIDKN  329

Query  384  TTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLF  205
            T RY PPF+EFE++     +   A      GPSI +V  G+G   T + + ++ +G V+F
Sbjct  330  TKRYSPPFDEFELEVISCSKNETAELTVSQGPSILLVKNGKG---TLNGDVMIEKGSVVF  386

Query  204  SPANTNTAVATTLG--LSLFRAGIXQYVF  124
            + AN    +  +    +S++RA +   VF
Sbjct  387  ANANEKMTLTNSDDGEVSIYRAQVNTRVF  415



>gb|KHN24248.1| Mannose-6-phosphate isomerase [Glycine soja]
Length=298

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 125/164 (76%), Gaps = 4/164 (2%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   ELK VL TVPE+ E+VG   +  ++ + ++DG E  K  L+ LFT +MS SK+ ++
Sbjct  127  VTLKELKAVL-TVPEVVELVGVENVNLVLQITDEDGEEKVKAILQSLFTDVMSESKESVT  185

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
              V KL +RL+K+++   L +KEQLVL LEKQYPSDVGV+AAF  NHVKL P EAL+LGA
Sbjct  186  GAVDKLRNRLHKESQ---LTDKEQLVLWLEKQYPSDVGVIAAFFLNHVKLAPDEALFLGA  242

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQ  427
            NEPHAY+ GECI C ATSDNVVRAGLTPKH DV+TLCSMLTYKQ
Sbjct  243  NEPHAYIYGECIACKATSDNVVRAGLTPKHRDVQTLCSMLTYKQ  286



>ref|XP_008389273.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X2 [Malus 
domestica]
Length=363

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 135/186 (73%), Gaps = 2/186 (1%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            +   ELK +L +VPEIAE+V     E+++   E      AK  +  +FT+LM  SKD I+
Sbjct  163  ISVKELKDMLNSVPEIAELVVVGDAERIVLGSEHHENGIAKTDIESVFTRLMLLSKDTIA  222

Query  738  kvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
            +++S+L  RLN + ++R+L  KEQLVLRLE QYP DVG +AAF  N+VKL  GEA+ LG 
Sbjct  223  EMISRLKRRLNLEKKKRHLTVKEQLVLRLESQYPDDVGAIAAFFLNYVKLNRGEAISLGP  282

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT  379
            NEPHAY+ GECIECMATSDNVVRAGLT K LDV+TL SML Y+QG PEI++G +LNPYTT
Sbjct  283  NEPHAYISGECIECMATSDNVVRAGLTSKPLDVQTLLSMLEYRQGSPEIMQGVSLNPYTT  342

Query  378  --RYLP  367
              R +P
Sbjct  343  SPRTIP  348



>ref|XP_009356248.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=358

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 136/188 (72%), Gaps = 6/188 (3%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAE--VVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdv  745
            +   ELK +L +VPEIAE  VVG+A  E ++   E      AK  +  +FT+LM  SKD 
Sbjct  163  ISVKELKDMLNSVPEIAELVVVGDA--EWILLGSEHHENGKAKTDIESIFTRLMLLSKDT  220

Query  744  iskvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYL  565
            I++++S+L  RL  + ++R+L  KEQLVLRLE QYP DVG +AAF  N+VKL  GEA+ L
Sbjct  221  IAEMISRLKRRLYLEKKKRHLTVKEQLVLRLESQYPDDVGAIAAFFLNYVKLNRGEAISL  280

Query  564  GANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPY  385
            G NEPHAY+ GECIECMATSDNVVRAGLT K LDV+TL SML Y+QG PEI++G +LNPY
Sbjct  281  GPNEPHAYISGECIECMATSDNVVRAGLTSKPLDVQTLLSMLEYRQGSPEIMQGISLNPY  340

Query  384  TT--RYLP  367
            TT  R +P
Sbjct  341  TTSPRTIP  348



>emb|CDY11497.1| BnaA09g40630D [Brassica napus]
Length=329

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   ++VS
Sbjct  166  ELKSVIRAIPEIEELVGSEEANQVFCISEHD-EEKVKSAVRTIFTLLMSAGPDTTKQIVS  224

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R+L +KE+LVL+LEKQYP D+GV++AF FN+VKL PGEALYLGANEPH
Sbjct  225  KLKHRLHMESQERHLTDKERLVLKLEKQYPDDIGVISAFFFNYVKLNPGEALYLGANEPH  284

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYK  430
            AYL GECIE MATSDNVVRAGLT K LD++TLCSML+YK
Sbjct  285  AYLFGECIEVMATSDNVVRAGLTSKPLDIQTLCSMLSYK  323



>emb|CDH53485.1| mannose-6-phosphate isomerase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=412

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 155/258 (60%), Gaps = 7/258 (3%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   L T PE+A +VG+  ++Q  N  +QD  +  K  L+ +F  +M+SS D + + ++
Sbjct  153  EIAQHLDTYPELAALVGDEKVQQFKNTIKQDNQDQNKAVLKDVFAAIMNSSADKVKEQLA  212

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPS-DVGVLAAFLFNHVKLKPGEALYLGANEP  550
            +L  RL  KNE+  +   ++LVLRL++QYP  D+GV +  + N+V ++PG+A++LGANEP
Sbjct  213  QLTERLRNKNEKTVV---DELVLRLDQQYPGGDIGVFSMLVMNYVTMEPGQAMFLGANEP  269

Query  549  HAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEI--LKGNALNPYTTR  376
            HAYL G+C+ECMA SDNVVRAGLTPK  DV  L  MLTY+ G  E   +KG +   ++  
Sbjct  270  HAYLSGDCVECMAASDNVVRAGLTPKFKDVAVLVDMLTYRYGSAESQKMKGESFGLHSLL  329

Query  375  YLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPA  196
            Y PP +EF +    L          + GPSI IV  G G +   +S   + +G V F  A
Sbjct  330  YDPPIDEFSVVLTRLTGGQAETHEPISGPSILIVTRGAGKLEADNSQFDLKDGYVYFVGA  389

Query  195  NTN-TAVATTLGLSLFRA  145
            N + +A A   GL  +RA
Sbjct  390  NVSISATAEETGLEFYRA  407



>ref|XP_002505002.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66260.1| predicted protein [Micromonas sp. RCC299]
Length=397

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 111/261 (43%), Positives = 150/261 (57%), Gaps = 14/261 (5%)
 Frame = -1

Query  903  LKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvsk  724
            L   L +VPE+  VVG A  +          +   K  LR +FT LM++  DV++  V  
Sbjct  149  LAANLISVPELRAVVGQAAADAFAA------SPGGKDELRAVFTALMTADGDVVAAQVDA  202

Query  723  liSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHA  544
            L +RL+ K ++  +   + L  RL +QYP DVGVL A++ N++ LKPG+ +YL ANEPHA
Sbjct  203  LAARLHAKPDKTPV---DALACRLNEQYPKDVGVLCAYVLNYLALKPGQCIYLAANEPHA  259

Query  543  YLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPP  364
            YL GECIECMATSDNVVRAGLTPK  D   LC MLTY+ G P +L G  ++  TTRY+PP
Sbjct  260  YLAGECIECMATSDNVVRAGLTPKLRDTAILCDMLTYRAGAPVVLDGERVDESTTRYVPP  319

Query  363  FEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTNT  184
            F+EF ++   +   A        GP +++V  G   +      E    G VLF+ A   T
Sbjct  320  FDEFMLETVTVAPGATYELTKSQGPCVYLVHRGSCVV----GGENARRGSVLFAAAGDET  375

Query  183  AVAT-TLGLSLFRAGIXQYVF  124
             VA    G +L+RA I   V+
Sbjct  376  VVAAGEEGATLYRAMINSRVY  396



>ref|XP_006296710.1| hypothetical protein CARUB_v10013753mg [Capsella rubella]
 gb|EOA29608.1| hypothetical protein CARUB_v10013753mg [Capsella rubella]
Length=333

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK V++ +PEI E+VG+    Q+  + E D  E  K  +R +FT LMS+  D   K+V 
Sbjct  170  ELKSVIRAIPEIEELVGSEEANQVFCISEHD-EEKLKSVVRTIFTLLMSADPDTTKKIVF  228

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ ++++R L +KE+LVL+LEKQYP+D+GV++ F FN+VKL PGEALYLGANEPH
Sbjct  229  KLKRRLHMESQERQLTDKERLVLKLEKQYPNDIGVISTFFFNYVKLNPGEALYLGANEPH  288

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYK  430
            AYL GECIE MATSDNVVRAGLT K LD+++LCSMLTYK
Sbjct  289  AYLFGECIEVMATSDNVVRAGLTSKPLDIQSLCSMLTYK  327



>ref|XP_005844140.1| hypothetical protein CHLNCDRAFT_139231 [Chlorella variabilis]
 gb|EFN52038.1| hypothetical protein CHLNCDRAFT_139231 [Chlorella variabilis]
Length=425

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 103/259 (40%), Positives = 150/259 (58%), Gaps = 5/259 (2%)
 Frame = -1

Query  918  VXFGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdvis  739
            V   EL   L+ VPE+A   G A +  L            +  L+  F  +M+   +  +
Sbjct  159  VPHEELVAALRAVPELAACCGEARVAALAAAAPC--GAQRRQALKAAFHAVMACPAERAA  216

Query  738  kvvskliSRLNKKNEQ-RNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
            + V  L SRL ++    R L  +EQL LRL++QYP DVGVLA++  NH++L+PG+A+ L 
Sbjct  217  ECVRALCSRLEREAAAGRQLSAREQLTLRLQRQYPGDVGVLASWFLNHLRLRPGQAVALP  276

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKG--NALNP  388
            ANEPHAY+ GE +ECMATSDNV+RAGLTPK  DV+TLC  LTY+QG PE+++G  +A +P
Sbjct  277  ANEPHAYISGEIVECMATSDNVIRAGLTPKLRDVETLCESLTYRQGVPEVMEGAKSAASP  336

Query  387  YTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVL  208
            +   Y PPF EFEI +   P  ++   P   GP + +V  G   + +   + ++  GDV 
Sbjct  337  HLACYRPPFREFEIWRYTPPAGSREALPPPAGPLLMLVQQGAMHVRSGEQSRLLKRGDVY  396

Query  207  FSPANTNTAVATTLGLSLF  151
            F  A     +  +  +S +
Sbjct  397  FVAAGAELQLEASADVSAW  415



>ref|XP_005645250.1| mannose-6-phosphate isomerase [Coccomyxa subellipsoidea C-169]
 gb|EIE20706.1| mannose-6-phosphate isomerase [Coccomyxa subellipsoidea C-169]
Length=487

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/259 (42%), Positives = 152/259 (59%), Gaps = 23/259 (9%)
 Frame = -1

Query  801  AKLTLRLLFTKLMssskdviskvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGV  622
            +K  L+  F+ LM++    ++  +  +  RL   +E+R L EKE+LVLRL +QYP DVGV
Sbjct  180  SKAALKAAFSALMTADASTVATAIQVMTKRL--LSERRVLTEKEKLVLRLNEQYPLDVGV  237

Query  621  LAAFLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSM  442
            L+AF FN V LKPG+A+YL AN PHAY+ GE +ECMATSDNV+RAGLTPK  D   LC  
Sbjct  238  LSAFFFNLVTLKPGQAVYLAANVPHAYVSGELVECMATSDNVIRAGLTPKLRDTSVLCES  297

Query  441  LTYKQGFPEILKG--NALNPYTTRYLPPFEEFEIDQCILPRAAKAV-----FPAVPGPSI  283
            LTY QG PEIL+G  +    +T  Y PPF+EFE+ +  +P   + +      PA PGP I
Sbjct  298  LTYSQGPPEILEGTPSTSRTWTVTYSPPFDEFEVLRIRIPGTTRPLGLQEAIPASPGPQI  357

Query  282  FIVMAGEGAMTTPSSNEIVAE------------GDVLFSPANTNTAV-ATTLGLSLFRAG  142
             +V  G+G   T +     A+            G V+F PANT   V A  +G+  + A 
Sbjct  358  LLVREGQGRAFTRNPPRADADPKVELQEVELRKGGVVFIPANTPFMVEALNVGVEAWLAT  417

Query  141  IXQYVFCRKI-TEAMKIRR  88
            + + V+ +   T+A  + R
Sbjct  418  VNERVYKQGARTKAAAVER  436



>ref|XP_001416055.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO94347.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=407

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 135/240 (56%), Gaps = 7/240 (3%)
 Frame = -1

Query  876  EIAEVVGNAYIEQLINLKEQDGAENAKLTLR----LLFTKLMssskdviskvvskliSRL  709
            E   V+G+    + +    + G  N    LR     +FT LM++ K  +   +  + +R+
Sbjct  168  EFGRVIGDDDAIEALRKAVESGQSNESAALRDAFKRVFTALMTAEKGKVETELRAMEARV  227

Query  708  NKKNEQRNLCEK-EQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLG  532
              +          E L LRL +QYP DVG   AF+ N+V L+PGEA+Y+ ANEPHAYL G
Sbjct  228  RDEGTTATSSSSVESLFLRLCEQYPGDVGAFCAFVLNYVTLRPGEAIYMAANEPHAYLSG  287

Query  531  ECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEEF  352
            +C+E MATSDNVVRAGLTPK  DV+ LC MLTYK G PEIL G+ ++  T RY+PPF+EF
Sbjct  288  DCVEVMATSDNVVRAGLTPKFRDVQVLCDMLTYKLGAPEILTGDVVDACTRRYVPPFDEF  347

Query  351  EIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAE--GDVLFSPANTNTAV  178
             +D   + R       A  GPS++IV  G  A  +   ++  A   G V F  A+    V
Sbjct  348  LLDVVTVSRGTAYGVVAKSGPSVWIVHRGSCAFASAKDSKTFAAEPGAVFFVDADEECGV  407



>ref|XP_008436962.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Cucumis melo]
 ref|XP_008436963.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Cucumis melo]
Length=390

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ELK VL +VPEI E+V  A  E+  +  EQDG E  K     +F+++MSS+K ++ + V 
Sbjct  186  ELKAVLSSVPEIVELVQCADAEKFSHDSEQDGKEKVKQLFESIFSQIMSSNKGLVREAVC  245

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            KL  RL+ + ++R L  KEQL+LRLE QYP+DVG+LAAF  N+V+LKPGEALY+G NEPH
Sbjct  246  KLKRRLSLEKKKRQLSAKEQLILRLESQYPADVGILAAFFLNYVELKPGEALYVGPNEPH  305

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQ  427
            AY+ GECIECMATSDNVVRAGLT K  DV+ L SML YKQ
Sbjct  306  AYISGECIECMATSDNVVRAGLTSKKRDVQALLSMLNYKQ  345



>gb|KDO27723.1| phosphomannose isomerase type I [Saprolegnia parasitica CBS 223.65]
Length=404

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/256 (39%), Positives = 147/256 (57%), Gaps = 16/256 (6%)
 Frame = -1

Query  891  LQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSR  712
            +Q VPE+  +V  A    LI   ++D       TLR  F  L+    D     ++    R
Sbjct  151  IQEVPELRALVDPAISNALIESHDRD-------TLRAFFQALVYCDHDEAIAQLANHRER  203

Query  711  LNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLG  532
            L   + +  L   ++L+LRL  QYP+D+G    +L N++ ++PG+A++LGANEPHAYL G
Sbjct  204  LEALDARTPL---QKLILRLNDQYPNDIGAFCPYLLNYIVMEPGDAVFLGANEPHAYLSG  260

Query  531  ECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEEF  352
            +CIECMA SDNVVRAGLTPK +D  TLC MLTY+ G P I +GNA++   T Y PP  EF
Sbjct  261  DCIECMACSDNVVRAGLTPKFIDKNTLCDMLTYEAGTPPIGQGNAIDAVVTEYTPPVPEF  320

Query  351  EIDQCILPRAAKAVFPAVPGPSIFIVMAGEG-AMTTP----SSNEIVAEGDVLFSPANTN  187
            ++ +  +            GPSI +V++G+G A  +P    +S   ++ G V F PA   
Sbjct  321  QVQRMDMAPLEHYTLAPAAGPSILLVLSGQGYAHYSPDDALTSKLELSTGHVFFVPAGQK  380

Query  186  TAVATTL-GLSLFRAG  142
             +  + + GL+++R+ 
Sbjct  381  LSFESGIQGLTVYRSS  396



>emb|CDS12287.1| hypothetical protein LRAMOSA04482 [Absidia idahoensis var. thermophila]
Length=413

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 106/259 (41%), Positives = 152/259 (59%), Gaps = 8/259 (3%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   L T PE+A +VGN  ++   N  +QD  +  K  L+ +F  +M+SS D + + ++
Sbjct  153  EIAQHLDTYPELAALVGNEKVQHFNNTIKQDNQDQNKSVLKDVFAAIMNSSADKVKEQLA  212

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPS-DVGVLAAFLFNHVKLKPGEALYLGANEP  550
            +L  RL  K    N    ++LVLRL++QYP  D+GV +  + N+V ++PG+A++LGANEP
Sbjct  213  QLTERLKGK---ENKTVVDELVLRLDQQYPGGDIGVFSMLVMNYVTMEPGQAMFLGANEP  269

Query  549  HAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEI--LKGNALNPYTTR  376
            HAYL G+C+ECMA SDNVVRAGLTPK  DV  L  MLTY+ G  E   +KG    P++  
Sbjct  270  HAYLSGDCVECMAASDNVVRAGLTPKFKDVAVLVDMLTYRYGSAESQKMKGKTFGPHSLL  329

Query  375  YLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPA  196
            Y PP +EF +    L          + GPSI IV  G G +   ++   + +G V F  A
Sbjct  330  YDPPIDEFSVVLTRLSGEETEKHEPIAGPSILIVTRGAGKLEANNAQFDLKDGYVYFIGA  389

Query  195  NTN-TAVAT-TLGLSLFRA  145
            N   +A AT + GL  +RA
Sbjct  390  NVPISATATGSDGLEFYRA  408



>emb|CEG01212.1| Phosphomannose isomerase, type I, conserved site [Ostreococcus 
tauri]
Length=418

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 136/228 (60%), Gaps = 5/228 (2%)
 Frame = -1

Query  846  IEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSRLNKKNEQRNLCEKEQ  667
            +E+ +   + D  +  K   + +FT LM++ K  + + ++ + +R+  K E R+   KE 
Sbjct  182  LERALAAGKGDDDDEVKGAFKRVFTALMTAEKATVERELALMRTRVAAK-ESRDA--KES  238

Query  666  LVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVVRA  487
            L LRL  QYP DVG   AF+ N+V + PG+A+ + ANEPHAYL G+C+E MATSDNVVRA
Sbjct  239  LFLRLCAQYPGDVGAFCAFVLNYVTITPGQAIVMAANEPHAYLSGDCVEVMATSDNVVRA  298

Query  486  GLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEEFEIDQCILPRAAKAVF  307
            GLTPK  DV+ LC MLTY  G PEIL G+ ++  T RY+PPFEEF +D       +  V 
Sbjct  299  GLTPKFRDVRVLCDMLTYTLGPPEILTGDVIDACTRRYVPPFEEFVLDVVACASGSTHVA  358

Query  306  PAVPGPSIFIVMAGEGAMTTPSSNEIVA--EGDVLFSPANTNTAVATT  169
             A  GPS++IV  G    T+ +    +A   G  LF  A  +  VA +
Sbjct  359  AARDGPSVWIVHRGACRATSSADGRTLALTPGAALFIDAGESLDVAAS  406



>ref|XP_008873487.1| mannose-6-phosphate isomerase, class I [Aphanomyces invadans]
 gb|ETV97926.1| mannose-6-phosphate isomerase, class I [Aphanomyces invadans]
Length=396

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 132/219 (60%), Gaps = 4/219 (2%)
 Frame = -1

Query  792  TLRLLFTKLMssskdviskvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAA  613
            +LR  F  ++       +  ++ L +RL    E  +L   + LVLRL +QYP+D+G  + 
Sbjct  173  SLRAFFRAMIYCDPTKATAALASLRTRLESLRE--SLSPLDALVLRLNEQYPNDIGAFSP  230

Query  612  FLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTY  433
            +L N+V L+PG+A++LGANEPHAYL GEC+ECMA SDNVVRAGLTPK +D  TL  MLTY
Sbjct  231  YLLNYVVLEPGDAVFLGANEPHAYLSGECVECMAGSDNVVRAGLTPKFIDKATLVDMLTY  290

Query  432  KQGFPEILKGNALNPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAM  253
              G P +  G  ++ + TRY  P  EF++++  LP +      A  GPSI +V+ G+G  
Sbjct  291  NVGSPPVQCGKTVDEFLTRYTSPVPEFQVERITLPSSKTYNLEATAGPSILLVLNGQGVA  350

Query  252  TTPSSNEI-VAEGDVLFSPANTN-TAVATTLGLSLFRAG  142
            +     E+ V  G V F PA  + T  + + GL ++R+ 
Sbjct  351  SVQGGAELDVGTGQVFFVPAGYSVTLTSRSDGLVVYRSS  389



>ref|XP_008608157.1| phosphomannose isomerase type I [Saprolegnia diclina VS20]
 gb|EQC38565.1| phosphomannose isomerase type I [Saprolegnia diclina VS20]
Length=409

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 146/261 (56%), Gaps = 22/261 (8%)
 Frame = -1

Query  891  LQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSR  712
            +Q VPE+  +V       LI   ++D       TLR  F  L+    D     ++    R
Sbjct  151  IQEVPELRALVDPEISNALIESHDRD-------TLRAFFQALVYCDHDEAIAQLANHRER  203

Query  711  LNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLG  532
            L   +E+  L   ++LVLRL  QYP+D+G    +L N++ ++PG+A++LGANEPHAYL G
Sbjct  204  LEAMDERTPL---QKLVLRLNDQYPNDIGAFCPYLLNYLVMEPGDAVFLGANEPHAYLSG  260

Query  531  ECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEEF  352
            +CIECMA SDNVVRAGLTPK +D  TLC MLTY+ G P I +G A++   T Y PP  EF
Sbjct  261  DCIECMACSDNVVRAGLTPKFIDKTTLCDMLTYEAGTPPIGQGTAIDAVLTEYTPPVPEF  320

Query  351  EIDQCILPRAAKAVFPAVPGPSIFIVMAGEG-AMTTP----------SSNEIVAEGDVLF  205
            ++ +  +            GPSI +V++G+G A  +P          +S   ++ G V F
Sbjct  321  QVQRMDMAPLEHYTLAPATGPSILLVLSGQGYAHFSPTDDDDDDDALTSKLELSTGHVFF  380

Query  204  SPANTNTAVATTL-GLSLFRA  145
             PA    A  + + GL+++R+
Sbjct  381  VPAGQKLAFESGIQGLTVYRS  401



>gb|EPT04877.1| hypothetical protein FOMPIDRAFT_1027596 [Fomitopsis pinicola 
FP-58527 SS1]
Length=424

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 146/274 (53%), Gaps = 14/274 (5%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDG--AENAKLTLRLLFTKLMssskdviskv  733
            ++   L + PE A ++  +   + +++       +  AK  L+ LF+ LM++ +      
Sbjct  158  QIAAYLASTPEFAALIPPSITTKFLSIASSADPTSPEAKTALKDLFSALMTAEEATFKAR  217

Query  732  vskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
            ++ L+SR             + LV+RL+ Q+P D+GV  AF+ N+VK++PGEA++L A E
Sbjct  218  LADLVSRYESGGASEQEAGIKDLVVRLDSQFPGDIGVFCAFVLNYVKMQPGEAIFLAAGE  277

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFP--EILKGNALNP--Y  385
            PHAY+ G+ IECMATSDNV+RAGLTPK  D+  L S LTY  G     ++K  A +   Y
Sbjct  278  PHAYVSGDIIECMATSDNVIRAGLTPKLRDIPNLVSGLTYGAGDASRHMVKPAAFDSVKY  337

Query  384  TTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLF  205
            T  Y PP  EF + Q ++P    A  P + GPSI IV  G GA+        VAEGDV+F
Sbjct  338  TALYDPPIPEFSVLQALVPADQTAAQPPIDGPSIAIVTEGSGALEWAGEKLDVAEGDVVF  397

Query  204  SPANTNTAVATTLGLSLFRAGIXQYVFCRKITEA  103
              A T        G+ L   G  Q    R   EA
Sbjct  398  IGAGT--------GVGLLAGGDSQLAVYRAFVEA  423



>ref|XP_002954744.1| hypothetical protein VOLCADRAFT_65163 [Volvox carteri f. nagariensis]
 gb|EFJ44150.1| hypothetical protein VOLCADRAFT_65163 [Volvox carteri f. nagariensis]
Length=450

 Score =   169 bits (428),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 97/230 (42%), Positives = 130/230 (57%), Gaps = 9/230 (4%)
 Frame = -1

Query  912  FGELKVVLQTVPEIAEVVGNAYIEQLINL----KEQDGAENAKLTLRLLFTKLMssskdv  745
              EL+  L+ VPE+A +VG  +++ L+ L     E+D    +K   +  FT LM++ ++ 
Sbjct  146  IAELQERLRRVPELALLVGQQHVDALLALPTTIAEEDDETASKAAKQTAFTALMTAPQEA  205

Query  744  iskvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYL  565
            ++  V  L+ RL        L   E L LRL +Q+P DVG+++AF  N V+L  G A+YL
Sbjct  206  VTAAVRGLVERLKAIAPGEELTPHEALALRLNEQFPDDVGLMSAFFLNLVRLPDGHAIYL  265

Query  564  GANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPY  385
             ANEPHAYL GE +ECMA SDNV+RAGLTPK      LC  LTY+QG P++L G+     
Sbjct  266  PANEPHAYLAGELVECMAASDNVIRAGLTPKFKHADVLCESLTYRQGLPDVLTGSPAGTG  325

Query  384  TTRYLPPFEEFEIDQC-----ILPRAAKAVFPAVPGPSIFIVMAGEGAMT  250
             T Y PPFEEFEI +        P       PA  GP I +V  GE   T
Sbjct  326  ITVYQPPFEEFEIHRIDCGSESAPGCKAMTLPASEGPRILLVQHGEAEAT  375



>gb|ESA05112.1| hypothetical protein GLOINDRAFT_35949 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX58512.1| mannose-6-phosphate isomerase PMI40 [Rhizophagus irregularis 
DAOM 197198w]
Length=429

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 154/274 (56%), Gaps = 23/274 (8%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGN---AYIEQLINLKE----QDGAENAKLTLRLLFTKLMssskd  748
            E+K +L   PE  E++GN   ++  Q++N +E     +  E  K  LR LFTK+M++++ 
Sbjct  154  EIKSLLNEYPEFTELIGNEISSHFLQIVNGREVSQLTEDIELNKSALRELFTKVMTTNEL  213

Query  747  viskvvskliSRLNKKNEQRNLCEKE--QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEA  574
             +S+ V KLI RL K N    L +    +L++RL  Q+P DVG+    L N++KL PG+A
Sbjct  214  SVSQQVDKLIKRL-KSNNHSPLVKGSVPELLIRLNDQFPGDVGIFCVLLLNYIKLDPGQA  272

Query  573  LYLGANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPE------I  412
            ++LGANEPHAYL G+ +ECMA SDNV+RAGLTPK  DV  L  MLTY+ G  E      I
Sbjct  273  IFLGANEPHAYLSGDIVECMAASDNVIRAGLTPKFKDVNVLTDMLTYRYGSAESQLLAPI  332

Query  411  LKGNALNPYTTRYLPPFEEFEIDQC-ILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSN  235
               N  N  T  Y PP EEF +    I     K VF  +PGPS+ IV  G+G +   +  
Sbjct  333  PYNN--NKLTVLYDPPIEEFSVSMTQINSLDKKEVFDGIPGPSVIIVTNGKGTLKVNNLL  390

Query  234  EIVAEGDVLFSPANTNTAVATTLG----LSLFRA  145
            E +  G V F  AN    +   +     L LFRA
Sbjct  391  ESLEPGSVFFIGANVPITIEAEVDGSNKLDLFRA  424



>gb|EIE85057.1| phosphomannose isomerase type I [Rhizopus delemar RA 99-880]
Length=419

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 159/264 (60%), Gaps = 13/264 (5%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINL--KEQDGAENAKLTLRLLFTKLMssskdviskv  733
            E+   L   PE+AE++G     Q ++     +   ++ K  L+ +F+ +M  S+DVI+++
Sbjct  150  EIAHHLNVYPELAELIGQDITSQFLDTVKSNKSSEQDNKAVLKKVFSAMMHGSQDVITQL  209

Query  732  vskliSRLNKKNEQRNLCEKEQLVLRLEKQYPS-DVGVLAAFLFNHVKLKPGEALYLGAN  556
            ++KLI+RL + NE   +    QL++RL+ QYP  DVGV +  L N+V ++PG+A++LGAN
Sbjct  210  LAKLINRLKESNENDTIS---QLLIRLDHQYPGGDVGVFSCLLLNYVSMEPGQAIFLGAN  266

Query  555  EPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGN--ALNPYT  382
            EPHAYL G+C+ECMA SDNVVRAGLTPK  DV  L  MLTY+ G  E  K      + ++
Sbjct  267  EPHAYLSGDCVECMAASDNVVRAGLTPKFKDVDVLVDMLTYRYGSAESQKMTPVKFSDHS  326

Query  381  TRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS----SNEIVAEGD  214
              Y PP +EF +    +         ++ GPS+ IV  G G +T+ +    ++ ++ EG 
Sbjct  327  LLYDPPIDEFAVIWTNMESGQAEKHRSIDGPSVLIVTRGSGKLTSETLKTETSFVLQEGY  386

Query  213  VLFSPANTNTAVATT-LGLSLFRA  145
            V F  ANT  ++ ++  GL L+RA
Sbjct  387  VYFVGANTPLSIESSESGLELYRA  410



>ref|XP_003075298.1| putative mannose-6-phosphate isomerase (ISS) [Ostreococcus tauri]
Length=500

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 122/191 (64%), Gaps = 3/191 (2%)
 Frame = -1

Query  846  IEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSRLNKKNEQRNLCEKEQ  667
            +E+ +   + D  +  K   + +FT LM++ K  + + ++ + +R+  K E R+   KE 
Sbjct  168  LERALAAGKGDDDDEVKGAFKRVFTALMTAEKATVERELALMRTRVAAK-ESRDA--KES  224

Query  666  LVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVVRA  487
            L LRL  QYP DVG   AF+ N+V + PG+A+ + ANEPHAYL G+C+E MATSDNVVRA
Sbjct  225  LFLRLCAQYPGDVGAFCAFVLNYVTITPGQAIVMAANEPHAYLSGDCVEVMATSDNVVRA  284

Query  486  GLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEEFEIDQCILPRAAKAVF  307
            GLTPK  DV+ LC MLTY  G PEIL G+ ++  T RY+PPFEEF +D       +  V 
Sbjct  285  GLTPKFRDVRVLCDMLTYTLGPPEILTGDVIDACTRRYVPPFEEFVLDVVACASGSTHVA  344

Query  306  PAVPGPSIFIV  274
             A  GPS++IV
Sbjct  345  AARDGPSVWIV  355



>ref|XP_003227566.1| PREDICTED: mannose-6-phosphate isomerase [Anolis carolinensis]
Length=373

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 150/266 (56%), Gaps = 14/266 (5%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   LQ VPE   ++GN   EQL     +D        LR+ FT++M S K V    ++
Sbjct  106  EIVGFLQNVPEFRTLIGNVAAEQL-ERSVRDDPRGVAAALRVCFTRMMKSEKKVFVDQLN  164

Query  726  kliSRLNKKNEQ-RNLCEK-EQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
             L+ R++++     N+     +L+LRL  QYP D+G  A +  N VKL+PGE ++LGANE
Sbjct  165  MLVKRISQEAAAGENISTSCGELLLRLHSQYPGDIGCFAIYFLNVVKLQPGECMFLGANE  224

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILK-----GNALNP  388
            PHAYL G+CIECMA SDN VRAGLTPK +DV TLC ML Y    P   K      + L+P
Sbjct  225  PHAYLYGDCIECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPA-PSSTKLLAPVQSRLDP  283

Query  387  YTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEIVAEG  217
            Y   Y PP  +F + + ++P + K  +  AV   SI +V+ G   G  T  +S   ++ G
Sbjct  284  YVYLYDPPVPDFSVMKIVIPASIKLYLISAVDSASIVLVVQGAAVGTSTAAASEMALSRG  343

Query  216  DVLFSPANTNTA--VATTLGLSLFRA  145
             VLF  AN + +  ++   G+ LFRA
Sbjct  344  SVLFISANESVSLHLSNGEGMLLFRA  369



>ref|XP_007305503.1| mannose-6-phosphate isomerase [Stereum hirsutum FP-91666 SS1]
 gb|EIM85447.1| mannose-6-phosphate isomerase [Stereum hirsutum FP-91666 SS1]
Length=433

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/274 (38%), Positives = 151/274 (55%), Gaps = 18/274 (7%)
 Frame = -1

Query  912  FGELKVVLQTVPEIAEVVGNAYIEQLINLKEQD--------GAENAKLTLRLLFTKLMss  757
            F E+   L + PE A +V  A  ++ I L                 K+ L+ LFT LM++
Sbjct  156  FPEITAFLTSTPEFAALVPPAISQKFITLSPPPSSSPSFSPNTPEQKVALKNLFTALMTA  215

Query  756  skdviskvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGE  577
            + D++SK V  L+SR    NE  +  + + LVLRL++Q+P D+G+  AF+ N+V+L+PGE
Sbjct  216  NPDLLSKQVDLLVSRFKAGNELESERKVKDLVLRLDEQFPGDIGIFCAFVLNYVELEPGE  275

Query  576  ALYLGANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILK---  406
            A+YLGA EPHAY+ G+ IECMA SDNV+RAGLTPK  D+  L S LTY    P   +   
Sbjct  276  AIYLGAGEPHAYVSGDIIECMANSDNVIRAGLTPKLRDIPNLISTLTYNSAPPSAQRLQT  335

Query  405  -----GNALNPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS  241
                   +   +T  Y PP  EF + + ++P+      P V GPS+ I+ AG G +   +
Sbjct  336  SSFPAETSAASFTILYDPPIPEFSVLRVVIPQGKSEDHPGVSGPSLAIITAGGGKIRWYN  395

Query  240  SNEIVAEGDVLFSPANTNTAV--ATTLGLSLFRA  145
                V EG+V+F  A T       T  GL ++RA
Sbjct  396  GELEVGEGEVIFIAAGTEAQWEPGTEEGLVVYRA  429



>ref|XP_008932049.1| PREDICTED: mannose-6-phosphate isomerase isoform X1 [Manacus 
vitellinus]
Length=423

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 154/270 (57%), Gaps = 22/270 (8%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQ VPE+  ++G   +EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  156  EIVSFLQNVPELRALIGEVAVEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  211

Query  735  vvskliSRLNKKNEQRNLCEKE--QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             ++ L+ R++++ E+         +L+LRL  QYP D+G    +  N VKL+PGEA++LG
Sbjct  212  QLNMLVKRISQEAEEGKDTSGSNGELLLRLHSQYPGDIGCFTIYFLNLVKLEPGEAMFLG  271

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGN  400
            ANEPHAYL G+C+ECMA SDN VRAGLTPK +DV TLC ML Y         FP +   +
Sbjct  272  ANEPHAYLRGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKIFPAV--QS  329

Query  399  ALNPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEI  229
             L+P    Y PP  +F I +  +P + K  +  A+   SI +V+ G   G  T  +S   
Sbjct  330  QLDPNVYVYDPPVPDFAIMRIEIPASIKLYLISAIDSASILLVIQGTAVGTSTAAASEMS  389

Query  228  VAEGDVLFSPANTNTA--VATTLGLSLFRA  145
            +  G VLF  AN + +  +++  G+ LFRA
Sbjct  390  LCRGSVLFISANESISLHLSSPDGMLLFRA  419



>gb|KFW76214.1| Mannose-6-phosphate isomerase, partial [Manacus vitellinus]
Length=422

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 154/270 (57%), Gaps = 22/270 (8%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQ VPE+  ++G   +EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  155  EIVSFLQNVPELRALIGEVAVEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  210

Query  735  vvskliSRLNKKNEQRNLCEKE--QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             ++ L+ R++++ E+         +L+LRL  QYP D+G    +  N VKL+PGEA++LG
Sbjct  211  QLNMLVKRISQEAEEGKDTSGSNGELLLRLHSQYPGDIGCFTIYFLNLVKLEPGEAMFLG  270

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGN  400
            ANEPHAYL G+C+ECMA SDN VRAGLTPK +DV TLC ML Y         FP +   +
Sbjct  271  ANEPHAYLRGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKIFPAV--QS  328

Query  399  ALNPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEI  229
             L+P    Y PP  +F I +  +P + K  +  A+   SI +V+ G   G  T  +S   
Sbjct  329  QLDPNVYVYDPPVPDFAIMRIEIPASIKLYLISAIDSASILLVIQGTAVGTSTAAASEMS  388

Query  228  VAEGDVLFSPANTNTA--VATTLGLSLFRA  145
            +  G VLF  AN + +  +++  G+ LFRA
Sbjct  389  LCRGSVLFISANESISLHLSSPDGMLLFRA  418



>gb|KEP49438.1| mannose-6-phosphate isomerase [Rhizoctonia solani 123E]
Length=307

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 113/264 (43%), Positives = 140/264 (53%), Gaps = 18/264 (7%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ++   L +VPE A +     I             + K  LR +F  LMS+  D I   + 
Sbjct  47   KISTFLTSVPEFASL-----IPAQAASALSSSPSDPKSALRDVFGALMSAPSDQIQSALD  101

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            +LI R           E   L   L KQYP DVGV   FL N VKL PGEA++L A+EPH
Sbjct  102  QLIKRYESGGATPVESEVADLAQTLAKQYPGDVGVFCVFLLNVVKLNPGEAMFLQADEPH  161

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG-------FPEILKGNA--L  394
            AY+ G+ IECMATSDNVVRAGLTPK  DV TL SMLTY  G        P+  KG +   
Sbjct  162  AYITGDIIECMATSDNVVRAGLTPKLRDVPTLISMLTYNSGPADAQRMEPKPFKGESSDS  221

Query  393  NPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGD  214
            + YTT Y PP  EF +    +P   KA   A+ GPSIFIV +G G +   S  EI +EG+
Sbjct  222  DSYTTLYDPPIPEFSVLLTDVPAGKKASHRALDGPSIFIVTSGNGNV---SGQEIKSEGE  278

Query  213  VLFSPANTNTA-VATTLGLSLFRA  145
            V F  A  +    A + GL L+RA
Sbjct  279  VWFVGAGQSLEFTAGSEGLLLYRA  302



>ref|XP_009829812.1| mannose-6-phosphate isomerase, class I [Aphanomyces astaci]
 gb|ETV80865.1| mannose-6-phosphate isomerase, class I [Aphanomyces astaci]
Length=398

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 122/200 (61%), Gaps = 3/200 (2%)
 Frame = -1

Query  792  TLRLLFTKLMssskdviskvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAA  613
            +LR  F  ++    D  +  +  L SRL  + E  +L   + LVLRL +QYP+D+G  + 
Sbjct  174  SLRAFFRAMIYCDPDKATSALESLRSRLGAQRE--SLSALDALVLRLNEQYPNDIGAFSP  231

Query  612  FLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTY  433
            +L N+V L+PG+A++LGANEPHAYL GEC+ECMA SDNVVRAGLTPK +D  TL  MLTY
Sbjct  232  YLLNYVVLEPGDAVFLGANEPHAYLSGECVECMAGSDNVVRAGLTPKFIDKATLVDMLTY  291

Query  432  KQGFPEILKGNALNPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEG-A  256
              G P + +G  ++ + T+Y  P  EF++ +  LP +         GPSI +V+ G+G A
Sbjct  292  TVGSPPVQRGKQVDAHLTQYSSPVPEFQVQRMNLPPSTTYDLAVATGPSILLVLEGQGTA  351

Query  255  MTTPSSNEIVAEGDVLFSPA  196
                ++   V  G V F PA
Sbjct  352  NVHGATTHDVGTGQVFFVPA  371



>gb|EMD36598.1| hypothetical protein CERSUDRAFT_115637 [Ceriporiopsis subvermispora 
B]
Length=423

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/262 (36%), Positives = 144/262 (55%), Gaps = 8/262 (3%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDG--AENAKLTLRLLFTKLMssskdviskv  733
            ++   L + P+ A ++ +A + + + +           K  LR LF+ +M++        
Sbjct  158  QIAAYLSSTPQFAALIPSAIVGRFVAIASSSDPTGPTEKAALRDLFSAVMTAEPSTFQPQ  217

Query  732  vskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
            +  L+ R +   E+      + LVLRL  Q+P D+GV  AF+ N+V++ PG+A++L A E
Sbjct  218  LEALVKRYDSGQEKEVERAVKDLVLRLHSQFPGDIGVFCAFILNYVEMNPGDAIFLAAGE  277

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTY--KQGFPEILKGNALNP--Y  385
            PHAY+ G+ IECMATSDNV+RAGLTPK  D+  L S LTY        ++K +A +   +
Sbjct  278  PHAYVSGDIIECMATSDNVIRAGLTPKLRDIPNLVSGLTYAAADATKHLVKPSAFDSVAH  337

Query  384  TTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEI-VAEGDVL  208
            TT Y PP  EF + + +LP       P V GPSI IV  G G        ++ V+EGDVL
Sbjct  338  TTLYDPPIPEFSVLRVVLPAGTTETHPPVDGPSIAIVTGGRGVFAWGQGEKVAVSEGDVL  397

Query  207  FSPANTNTAVATTLG-LSLFRA  145
            F  A +   + +  G L+++RA
Sbjct  398  FVGAGSEVKLTSEDGQLAVYRA  419



>emb|CEL59231.1| mannose-6-phosphate isomerase [Rhizoctonia solani AG-1 IB]
Length=411

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 111/264 (42%), Positives = 142/264 (54%), Gaps = 18/264 (7%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E    L +VPE A ++ +     L +        + K  LR +F  LMS+  D +   + 
Sbjct  151  ETSTFLSSVPEFASLIPDKAASALSSS-----PSDPKSALRDVFGALMSAPSDQVQSALD  205

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            +LI R           +   L   L KQYP DVGV   FL N VKL  GEA++L A+EPH
Sbjct  206  QLIKRYESGGATPAESDVADLAQTLAKQYPGDVGVFCVFLLNVVKLNEGEAMFLQADEPH  265

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG-------FPEILKG--NAL  394
            AY+ G+ IECMATSDNVVRAGLTPK  DV TL SMLTY  G        P+  KG  N  
Sbjct  266  AYISGDIIECMATSDNVVRAGLTPKLRDVPTLVSMLTYNSGPADAQRMEPKPFKGESNDS  325

Query  393  NPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGD  214
            + YTT Y PP  EF +    +P   KA   A+ GPSIFIV +G G++   S  +I +EG+
Sbjct  326  DSYTTLYDPPIPEFSVLLTNVPAGKKASHRALDGPSIFIVTSGSGSV---SGEKINSEGE  382

Query  213  VLFSPANTNTA-VATTLGLSLFRA  145
            V F+ A  +    A   GL L+RA
Sbjct  383  VWFASAGQSLEFTAGDQGLVLYRA  406



>gb|EUC56226.1| mannose-6-phosphate isomerase [Rhizoctonia solani AG-3 Rhs1AP]
Length=411

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 113/264 (43%), Positives = 140/264 (53%), Gaps = 18/264 (7%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ++   L +VPE A +     I             + K  LR +F  LMS+  D I   + 
Sbjct  151  KISTFLTSVPEFASL-----IPAQAASALSSSPSDPKSALRDVFGALMSAPSDQIQSALD  205

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            +LI R           E   L   L KQYP DVGV   FL N VKL PGEA++L A+EPH
Sbjct  206  QLIKRYESGGATPVESEVADLAQTLAKQYPGDVGVFCVFLLNVVKLNPGEAMFLQADEPH  265

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG-------FPEILKGNA--L  394
            AY+ G+ IECMATSDNVVRAGLTPK  DV TL SMLTY  G        P+  KG +   
Sbjct  266  AYITGDIIECMATSDNVVRAGLTPKLRDVPTLISMLTYNSGPADAQRMEPKPFKGESSDS  325

Query  393  NPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGD  214
            + YTT Y PP  EF +    +P   KA   A+ GPSIFIV +G G +   S  EI +EG+
Sbjct  326  DSYTTLYDPPIPEFSVLLTDVPAGKKASHRALDGPSIFIVTSGNGNV---SGQEIKSEGE  382

Query  213  VLFSPANTNTA-VATTLGLSLFRA  145
            V F  A  +    A + GL L+RA
Sbjct  383  VWFVGAGQSLEFTAGSEGLLLYRA  406



>gb|KFM80450.1| Mannose-6-phosphate isomerase, partial [Stegodyphus mimosarum]
Length=410

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 95/262 (36%), Positives = 145/262 (55%), Gaps = 13/262 (5%)
 Frame = -1

Query  912  FGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskv  733
            F E+ + L+ +P+I +VVG   I++ +  + +D       T + LF  LM+   ++   +
Sbjct  152  FNEIMIFLKEIPQIQKVVGKEKIDEFLKTENRD-------TFKSLFRALMTCPAEIYQPL  204

Query  732  vskliSRLNKKNEQRNLCEKE-QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGAN  556
            +S+++          +LC+    + LR+  +YP D+G+ + F  N++KLK GEA++L AN
Sbjct  205  LSEVVQNFKLDKYHGDLCKSVCNIFLRVSDEYPGDIGLFSIFFLNYLKLKCGEAIFLAAN  264

Query  555  EPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTY--KQGFPEILKG--NALNP  388
            EPHAYL G+CIECMA SDNVVRAGLTPK  DV TLC +LTY  K G   + +   ++ +P
Sbjct  265  EPHAYLYGDCIECMACSDNVVRAGLTPKFRDVYTLCDILTYNCKPGNENVFQSTVDSNDP  324

Query  387  YTTRYLPPFEEFEIDQCILPRAAKAV-FPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDV  211
                Y PP +EF ID+  LP   KA     +   SI +V++GE      S  + +  G  
Sbjct  325  LVKTYDPPVKEFTIDKISLPSDHKAYPLKVISSASILLVVSGEATYKYQSEEQSLHPGTA  384

Query  210  LFSPANTNTAVATTLGLSLFRA  145
            LF  +     +     L +FRA
Sbjct  385  LFISSQAEIYLNPISELLIFRA  406



>ref|XP_006264069.1| PREDICTED: mannose-6-phosphate isomerase [Alligator mississippiensis]
Length=422

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 146/266 (55%), Gaps = 15/266 (6%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   LQ VPE   ++G+   EQL      D        LR+ FT++M S K      ++
Sbjct  156  EIVAFLQNVPEFXVLIGDVAAEQL-ERSVNDDPRGVSAALRICFTRMMKSEKKFFVDQLN  214

Query  726  kliSRLNKKN-EQRNLCEKE-QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
             L+ R++++  E ++  +   +L+L+L  Q+P D+G  A +  N V+L PGEA++LGANE
Sbjct  215  LLVKRISQEAAEGKDTSDSNGELLLQLHSQFPGDIGCFAIYFLNVVRLNPGEAMFLGANE  274

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGNALN  391
            PHAYL G+CIECMA SDN VRAGLTPK +DV TLC ML Y         FP I   + L+
Sbjct  275  PHAYLYGDCIECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPASSSAKIFPAI--QSQLD  332

Query  390  PYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGE--GAMTTPSSNEIVAEG  217
            P    Y PP  +F + +  +P     +  AV   SI +V+ G   G  T  +S   +  G
Sbjct  333  PCVYLYDPPVPDFAVMRIQIPSIKLYLISAVDSASILLVIQGTAVGTSTGATSEMTLRRG  392

Query  216  DVLFSPANTNTA--VATTLGLSLFRA  145
             V F  AN + +  V++  G+ LFRA
Sbjct  393  SVFFISANESISLQVSSPDGMLLFRA  418



>ref|XP_002896014.1| mannose-6-phosphate isomerase, putative [Phytophthora infestans 
T30-4]
 gb|EEY53727.1| mannose-6-phosphate isomerase, putative [Phytophthora infestans 
T30-4]
Length=358

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 114/181 (63%), Gaps = 5/181 (3%)
 Frame = -1

Query  672  EQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVV  493
            E+LVLRL+ +YP D+G    FL N++ L+PGEA++LGANEPHAYL G+C+ECMA SDNVV
Sbjct  167  EKLVLRLDDEYPGDIGCFCPFLLNYITLEPGEAMFLGANEPHAYLFGDCMECMACSDNVV  226

Query  492  RAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTR-YLPPFEEFEIDQCILPRAAK  316
            RAGLTPK +D +TL SMLTY  G P + KG+  +   TR Y  P  EFE++   L    +
Sbjct  227  RAGLTPKFIDKETLHSMLTYHTGKPSVYKGDVQSDGVTRLYSSPVPEFEVEAVDLMPRQR  286

Query  315  AVFPAVPGPSIFIVMAGEGAMTTP---SSNEIVAEGDVLFSPANTNTAV-ATTLGLSLFR  148
               PA  G S+ +V++G G+   P   ++   +++G V F P      +     G+S FR
Sbjct  287  YALPARKGDSLVLVISGSGSTVEPLGSANGRNMSKGKVYFLPKGEILEIQGGEGGISAFR  346

Query  147  A  145
            A
Sbjct  347  A  347



>ref|XP_009642214.1| PREDICTED: mannose-6-phosphate isomerase isoform X1 [Egretta 
garzetta]
Length=403

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 151/270 (56%), Gaps = 22/270 (8%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQTVPE+  ++G    EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  136  EIVSFLQTVPELRALIGEVAAEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  191

Query  735  vvskliSRLNKKNEQRNLCEKE--QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             ++ L+ R++++  +          L+LRL  QYP D+G    +  N V+L+PGEA++LG
Sbjct  192  QLNMLVKRISQEAAEGKDTSGSNGDLLLRLHSQYPGDIGCFTIYFLNLVRLEPGEAMFLG  251

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGN  400
            ANEPHAYL G+C+ECMA SDN VRAGLTPK +DV TLC ML Y         FP     +
Sbjct  252  ANEPHAYLHGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKIFPA--AQS  309

Query  399  ALNPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEI  229
             L+P    Y PP  +F I +  +P + K  +  AV   SI +V+ G   G  T  +S   
Sbjct  310  QLDPSVYLYDPPVPDFAIMRIEIPASIKLYLVSAVDSASILLVIQGTAVGTSTAAASEMT  369

Query  228  VAEGDVLFSPANTNTA--VATTLGLSLFRA  145
            +  G VLF  AN + +  +++  G+ LFRA
Sbjct  370  LRRGSVLFISANESISLHLSSPDGMLLFRA  399



>ref|XP_005716739.1| unnamed protein product [Chondrus crispus]
 emb|CDF36920.1| unnamed protein product [Chondrus crispus]
Length=382

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 146/269 (54%), Gaps = 21/269 (8%)
 Frame = -1

Query  891  LQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSR  712
            L+   E+A +VG      L  L     +E+ +  + ++F+ LMS+SK+ ++  +   +  
Sbjct  118  LELRSELAALVGGK--ASLDALSNSSSSEDRRAAIHVVFSSLMSASKEAVASALDATVIA  175

Query  711  LNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLG  532
            +   +E+    + + L LRL   YP DVG  AA+L NH+++ PG+A ++ ANEPHAYL G
Sbjct  176  VKTASER---SDADDLFLRLISYYPGDVGCFAAYLLNHIRISPGQAFFMAANEPHAYLKG  232

Query  531  ECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFEEF  352
            +C+E MA SDNVVRAGLTPK  DV TL  MLTYK   P+I+ G  ++  +  Y PP EEF
Sbjct  233  QCVEIMACSDNVVRAGLTPKFKDVSTLVKMLTYKDDPPKIMSGEKVDGCSVVYKPPVEEF  292

Query  351  EIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTT---------------PSSNEIVAEG  217
            ++ + ++P  +     A  GP + +V+ G+G +                 P S   VA+ 
Sbjct  293  QLTKTVVPSGSTYEITAAKGPGMIMVIGGQGWIGVLSGERQKPESRLPLQPGSVYYVADS  352

Query  216  DVLFSPANTNTAV-ATTLGLSLFRAGIXQ  133
              ++  A+   A  A +  L  FRA I Q
Sbjct  353  TRIYIEADHAMAADAPSPDLLFFRANINQ  381



>ref|XP_006029163.1| PREDICTED: mannose-6-phosphate isomerase [Alligator sinensis]
Length=421

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 146/266 (55%), Gaps = 15/266 (6%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   LQ VPE   ++G+   EQL      D        LR+ FT++M S K      ++
Sbjct  155  EIVAFLQNVPEFRVLIGDVAAEQL-ERSVNDDPRGVSAALRICFTRMMKSEKKFFVDQLN  213

Query  726  kliSRLNKKN-EQRNLCEKE-QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
             L+ R +++  E ++  +   +L+L+L  Q+P D+G  A +  N V+L PGEA++LGANE
Sbjct  214  LLVKRTSQEAAEGKDTSDSNGELLLQLHSQFPGDIGCFAIYFLNVVRLNPGEAMFLGANE  273

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGNALN  391
            PHAYL G+CIECMA SDN VRAGLTPK +DV TLC ML Y         FP I   + L+
Sbjct  274  PHAYLYGDCIECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPASSSAKIFPAI--QSQLD  331

Query  390  PYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGE--GAMTTPSSNEIVAEG  217
            P    Y PP  +F + +  +P     +  AV   SI +V+ G   G  T  +S+  +  G
Sbjct  332  PCVYLYDPPVPDFAVMRIQIPSIKLYLISAVDSASILLVIQGTAVGTSTGATSDMTLRRG  391

Query  216  DVLFSPANTNTA--VATTLGLSLFRA  145
             V F  AN + +  V++  G+ LFRA
Sbjct  392  SVFFISANESISLQVSSPDGMLLFRA  417



>emb|CEP08577.1| hypothetical protein [Parasitella parasitica]
Length=291

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 153/270 (57%), Gaps = 20/270 (7%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLI--------NLKEQDGAENAKLTLRLLFTKLMsssk  751
            E+   L+  PE+ +++G    ++ +        +  E+D A N ++ L+  F  LM SS+
Sbjct  19   EIARHLEIYPELKDLLGKDVSDEFLATVKATGNSESEKDVAHNKEI-LKKAFGALMRSSQ  77

Query  750  dviskvvskliSRLNKKNEQRNLCEKEQLVLRLEKQYPS-DVGVLAAFLFNHVKLKPGEA  574
              ++  +SKLI+RLN      ++    +LV+RL++QYP  DVGV +  + N+V ++PG+A
Sbjct  78   KDVTHFLSKLIARLNDTKADDSIS---KLVIRLDEQYPGGDVGVFSCLMLNYVIMEPGQA  134

Query  573  LYLGANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGN--  400
            ++LGANEPHAYL G+C+ECMA SDNVVRAGLTPK  DV  L  MLTY+ G  E  K    
Sbjct  135  IFLGANEPHAYLSGDCVECMAASDNVVRAGLTPKFKDVNVLVDMLTYRYGSAESQKMTPE  194

Query  399  ALNPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS----SNE  232
                ++  Y PP +EF I +  +          + GPS+ IV +G G MT  +    SN 
Sbjct  195  KFGEHSLLYDPPIDEFSIVRTKMDADQTEKHKPIQGPSVLIVTSGSGKMTGEALKTESNY  254

Query  231  IVAEGDVLFSPANTN-TAVATTLGLSLFRA  145
             + EG V F  ANT   A A   GL  +RA
Sbjct  255  KLEEGYVYFVGANTPLIAQAGNSGLEFYRA  284



>gb|KFP20073.1| Mannose-6-phosphate isomerase, partial [Egretta garzetta]
Length=422

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 151/270 (56%), Gaps = 22/270 (8%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQTVPE+  ++G    EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  155  EIVSFLQTVPELRALIGEVAAEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  210

Query  735  vvskliSRLNKKNEQRNLCEKE--QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             ++ L+ R++++  +          L+LRL  QYP D+G    +  N V+L+PGEA++LG
Sbjct  211  QLNMLVKRISQEAAEGKDTSGSNGDLLLRLHSQYPGDIGCFTIYFLNLVRLEPGEAMFLG  270

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGN  400
            ANEPHAYL G+C+ECMA SDN VRAGLTPK +DV TLC ML Y         FP     +
Sbjct  271  ANEPHAYLHGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKIFPA--AQS  328

Query  399  ALNPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEI  229
             L+P    Y PP  +F I +  +P + K  +  AV   SI +V+ G   G  T  +S   
Sbjct  329  QLDPSVYLYDPPVPDFAIMRIEIPASIKLYLVSAVDSASILLVIQGTAVGTSTAAASEMT  388

Query  228  VAEGDVLFSPANTNTA--VATTLGLSLFRA  145
            +  G VLF  AN + +  +++  G+ LFRA
Sbjct  389  LRRGSVLFISANESISLHLSSPDGMLLFRA  418



>ref|XP_009672132.1| PREDICTED: mannose-6-phosphate isomerase [Struthio camelus australis]
Length=373

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/267 (39%), Positives = 146/267 (55%), Gaps = 16/267 (6%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   LQTVPE+  ++G+   EQL      D        LR+ FT++M S K      ++
Sbjct  106  EIVSFLQTVPELRALIGDVAAEQL-ERSVSDDPRGVSAALRVCFTRMMKSEKKFFVDQLN  164

Query  726  kliSRLNKKNEQRNLCEKE--QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
             L+ R++++  +          L+LRL  QYP D+G    +  N V+L+PGEA++LGANE
Sbjct  165  MLVKRISQEAAEGKDTSGSNGDLLLRLHSQYPGDIGCFTIYFLNLVRLEPGEAMFLGANE  224

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGNALN  391
            PHAYL G+CIECMA SDN VRAGLTPK +DV TLC ML Y         FP     + L+
Sbjct  225  PHAYLHGDCIECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKIFPA--TQSQLD  282

Query  390  PYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEIVAE  220
            P    Y PP  +F + +  +P + K  +  AV   SI +V+ G   G  T  +S   +  
Sbjct  283  PSVYLYDPPVPDFTLMRIEIPSSIKLYLVSAVDSASILLVIQGMAVGTSTAAASEMTLRR  342

Query  219  GDVLFSPANTNTA--VATTLGLSLFRA  145
            G VLF  AN + +  +++  G+ LFRA
Sbjct  343  GSVLFISANESISLHLSSPDGMLLFRA  369



>emb|CEG82939.1| Putative Mannose-6-phosphate isomerase [Rhizopus microsporus]
Length=416

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/263 (38%), Positives = 152/263 (58%), Gaps = 13/263 (5%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   ++  PE+ E++G     + + + +    +  K  L+ +F  +M  S+D I+++++
Sbjct  150  EIAHHMKVYPELTELIGQDLTHEFLEITKSSDEQAKKAVLKKVFAAVMRGSQDTITQLLA  209

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPS-DVGVLAAFLFNHVKLKPGEALYLGANEP  550
            KLI RL + +++  +    +L++RL++QYP  DVGV +  L N+V ++PG+A++LGANEP
Sbjct  210  KLIHRLKESDDKDTIS---KLLIRLDEQYPGGDVGVFSCLLLNYVSMEPGQAIFLGANEP  266

Query  549  HAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGN--ALNPYTTR  376
            HAYL G+C+ECMATSDNVVRAGLTPK  DV  L  MLTY+ G  E  K        ++  
Sbjct  267  HAYLSGDCVECMATSDNVVRAGLTPKFKDVDVLVEMLTYRYGSAESQKMTPVKFGEHSLL  326

Query  375  YLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMT-----TPSSNEIVAEGDV  211
            Y PP EEF +    +          + GPSI IV  G G +T     T  S ++  EG V
Sbjct  327  YDPPIEEFSVVWTNMESNQTEKHKPIEGPSILIVTRGNGKLTGDVLKTEQSYDL-QEGYV  385

Query  210  LFSPANTN-TAVATTLGLSLFRA  145
             F  ANT  +A +   GL  +RA
Sbjct  386  YFVGANTPISAESGESGLEFYRA  408



>emb|CAG01059.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=417

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 153/268 (57%), Gaps = 19/268 (7%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            ++   L  VPE   +VG+   E+L        A    L L+  FT++M+  K ++   ++
Sbjct  151  QILAFLHAVPEFCALVGSEAAEEL--QASVGDAVQTGLALKKCFTRMMNCEKKLLVDQLN  208

Query  726  kliSRLNKKNEQRNLCEKEQ--LVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
             L+ R+ ++        +    L+LRL  QYP D+G  + +  NHV L+PG+A++LGANE
Sbjct  209  VLVKRVTEEGAAGKDTSRSHGDLLLRLHSQYPGDIGCFSIYFLNHVVLEPGQAMFLGANE  268

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGNALN  391
            PHAY+ G+C+ECMA SDN VRAGLTPK++DV TLC ML Y         FP +  G   +
Sbjct  269  PHAYIYGDCVECMACSDNTVRAGLTPKYIDVNTLCEMLNYSPAPAASKVFPGVQDGA--D  326

Query  390  PYTTRYLPPFEEFEIDQCILPRAAK--AVFPAVPGPSIFIVMAGEGAMT-TPSSNEI-VA  223
            P  T Y PP  +F + +  +P + +  A+ P V   SI +V+ G+ A T T S +E+ + 
Sbjct  327  PCVTLYDPPVPDFSVMRIQIPPSVQQYAIAP-VDSASILLVIDGDAAATCTTSLSEVTLG  385

Query  222  EGDVLFSPANTNTA--VATTLGLSLFRA  145
             G VLF  AN + +  V++  G+++FRA
Sbjct  386  RGTVLFVSANESLSLQVSSPAGMTMFRA  413



>ref|XP_006957699.1| mannose-6-phosphate isomerase [Wallemia sebi CBS 633.66]
 gb|EIM22458.1| mannose-6-phosphate isomerase [Wallemia sebi CBS 633.66]
Length=415

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 152/257 (59%), Gaps = 11/257 (4%)
 Frame = -1

Query  891  LQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSR  712
            L+ V E+   V N ++    +LK+    E  +  L+ +F  +MS+S++ I+ +   ++ R
Sbjct  158  LENVKELRAFVENKHVN---DLKQATTDEQTRGALKNVFRNIMSASENKIADLTKAIVDR  214

Query  711  LNKKN----EQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHA  544
             + ++       N+    QLVL L +Q+P D+G+  AFL N V LKPGE+++L A++PHA
Sbjct  215  YSNQSGEDVSDENVYLVRQLVLTLNEQFPGDIGIFCAFLLNVVHLKPGESVFLKADDPHA  274

Query  543  YLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPE--ILKGNALN--PYTTR  376
            Y+ G+ +ECMATS+NVVRAGLTPK  DV TL +MLTY+    +  ++   +L+    T  
Sbjct  275  YISGDIMECMATSNNVVRAGLTPKLRDVDTLVNMLTYESATADAQLMDTKSLDGAAGTVV  334

Query  375  YLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPA  196
            Y PP +EF + +  L         A+ GPS+ +V++G G++ T S  E + +G+VLF  A
Sbjct  335  YDPPIDEFSVARVTLSNGKSTEHRALNGPSVIVVVSGSGSIETDSQTETLRKGEVLFVGA  394

Query  195  NTNTAVATTLGLSLFRA  145
            +T   +  +  + L+RA
Sbjct  395  DTPAVIKASPDIELYRA  411



>gb|KFV80707.1| Mannose-6-phosphate isomerase, partial [Struthio camelus australis]
Length=394

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/267 (39%), Positives = 146/267 (55%), Gaps = 16/267 (6%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   LQTVPE+  ++G+   EQL      D        LR+ FT++M S K      ++
Sbjct  127  EIVSFLQTVPELRALIGDVAAEQL-ERSVSDDPRGVSAALRVCFTRMMKSEKKFFVDQLN  185

Query  726  kliSRLNKKNEQRNLCEKE--QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
             L+ R++++  +          L+LRL  QYP D+G    +  N V+L+PGEA++LGANE
Sbjct  186  MLVKRISQEAAEGKDTSGSNGDLLLRLHSQYPGDIGCFTIYFLNLVRLEPGEAMFLGANE  245

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGNALN  391
            PHAYL G+CIECMA SDN VRAGLTPK +DV TLC ML Y         FP     + L+
Sbjct  246  PHAYLHGDCIECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKIFPA--TQSQLD  303

Query  390  PYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEIVAE  220
            P    Y PP  +F + +  +P + K  +  AV   SI +V+ G   G  T  +S   +  
Sbjct  304  PSVYLYDPPVPDFTLMRIEIPSSIKLYLVSAVDSASILLVIQGMAVGTSTAAASEMTLRR  363

Query  219  GDVLFSPANTNTA--VATTLGLSLFRA  145
            G VLF  AN + +  +++  G+ LFRA
Sbjct  364  GSVLFISANESISLHLSSPDGMLLFRA  390



>ref|XP_010569926.1| PREDICTED: mannose-6-phosphate isomerase isoform X2 [Haliaeetus 
leucocephalus]
Length=373

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/270 (39%), Positives = 151/270 (56%), Gaps = 22/270 (8%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQ+VPE+  ++G    EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  106  EIVSFLQSVPELRALIGEVAAEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  161

Query  735  vvskliSRLNKKNEQRNLCEKE--QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             ++ L+ R++++  +          L+LRL  QYP D+G    +  N VKL+PGEA++LG
Sbjct  162  QLNMLVKRISQEAAEGKDTSGSNGDLLLRLHSQYPGDIGCFTIYFLNLVKLEPGEAMFLG  221

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGN  400
            ANEPHAYL G+C+ECMA SDN VRAGLTPK +DV TLC ML Y         FP     +
Sbjct  222  ANEPHAYLHGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKIFPA--AQS  279

Query  399  ALNPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEI  229
             L+P    Y PP  +F I +  +P + K  +  A+   SI +V+ G   G  T  +S   
Sbjct  280  QLDPSVYLYDPPVPDFAIMRIEIPPSIKLYLVSAMDSASILLVIQGTAVGTSTAAASEMT  339

Query  228  VAEGDVLFSPANTNTA--VATTLGLSLFRA  145
            +  G VLF  AN + +  +++  G+ LFRA
Sbjct  340  LRRGSVLFISANESISLHLSSPDGMLLFRA  369



>emb|CEI89889.1| Putative Mannose-6-phosphate isomerase [Rhizopus microsporus]
Length=416

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/262 (38%), Positives = 149/262 (57%), Gaps = 11/262 (4%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   ++  PE+ E++G     + + + +    +  K  L+ +F  +M  S+D I+++++
Sbjct  150  EIAHHMKVYPELTELIGQDLTHEFLEITKSSDEQAKKAALKKVFAAVMRGSQDTITQLLA  209

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPS-DVGVLAAFLFNHVKLKPGEALYLGANEP  550
            KLI RL + +++  +    +L++RL++QYP  DVGV +  L N+V ++PG+A++LGANEP
Sbjct  210  KLIHRLKESDDKDTIS---KLLIRLDEQYPGGDVGVFSCLLLNYVSMEPGQAIFLGANEP  266

Query  549  HAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGN--ALNPYTTR  376
            HAYL G+C+ECMATSDNVVRAGLTPK  DV  L  MLTY+ G  E  K        ++  
Sbjct  267  HAYLSGDCVECMATSDNVVRAGLTPKFKDVDVLVEMLTYRYGSAESQKMTPVKFGEHSLL  326

Query  375  YLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMT----TPSSNEIVAEGDVL  208
            Y PP EEF +    +          + GPSI IV  G G +T           + EG V 
Sbjct  327  YDPPIEEFSVVWTNMESNQTEKHKPIEGPSILIVTRGNGKLTGSLLKTEQTYDLQEGYVY  386

Query  207  FSPANTN-TAVATTLGLSLFRA  145
            F  ANT  +A +   GL  +RA
Sbjct  387  FVGANTPISAESGESGLEFYRA  408



>gb|ETM42356.1| mannose-6-phosphate isomerase, class I [Phytophthora parasitica]
Length=403

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 104/159 (65%), Gaps = 4/159 (3%)
 Frame = -1

Query  663  VLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVVRAG  484
            VLRL+ +YP D+G    FL N++ L+PGEA++LGANEPHAYL G+C+ECMA SDNVVRAG
Sbjct  215  VLRLDNEYPGDIGCFCPFLLNYITLEPGEAMFLGANEPHAYLFGDCVECMACSDNVVRAG  274

Query  483  LTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTR-YLPPFEEFEIDQCILPRAAKAVF  307
            LTPK +D +TL SMLTY  G P + KG+  +   TR Y  P  EFE++   L    +   
Sbjct  275  LTPKFIDKETLHSMLTYYTGKPRVYKGDVQSDGVTRLYSSPVPEFEVEAVELKPRQRYAL  334

Query  306  PAVPGPSIFIVMAGEGAMTTPSSN---EIVAEGDVLFSP  199
            PA  G SI +V++G G+   PS N     +++G V F P
Sbjct  335  PARKGDSIVLVISGGGSTVEPSGNADGRKMSKGKVYFLP  373



>gb|ETE58039.1| Mannose-6-phosphate isomerase, partial [Ophiophagus hannah]
Length=429

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 147/267 (55%), Gaps = 16/267 (6%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   LQ VPE   ++GN   EQL     +D        LR+ FT++M S K +    ++
Sbjct  162  EIVAFLQYVPEFRALIGNVAAEQL-ERSGRDDPRGVSAALRVCFTRMMKSEKKIFVDHLN  220

Query  726  kliSRLNKKNEQRNLCEKE--QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
            +L+ R++++            +L+L+L  QYP D+G    +  N +KL+PGE ++LGANE
Sbjct  221  QLVKRISQEAAAGKDISASCGELLLKLHSQYPGDIGCFVIYFLNQMKLQPGECMFLGANE  280

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGNALN  391
            PHAYL G+CIECMA SDN VRAGLTPK++DV TLC ML Y          P I   + L+
Sbjct  281  PHAYLFGDCIECMACSDNTVRAGLTPKYIDVLTLCEMLNYTPAPASSKLLPPI--QSRLD  338

Query  390  PYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEIVAE  220
            P  + Y PP  +F + +  +P + K  +  A+   SI + + G   G  T  +S  I+  
Sbjct  339  PCISLYDPPIPDFAVMRIEIPSSIKLYLISAIDSASILLTVKGSAVGTSTAAASEMILRP  398

Query  219  GDVLFSPANTNTAVA--TTLGLSLFRA  145
            G VLF  AN + ++   +  G+ LFRA
Sbjct  399  GTVLFISANESLSLHFNSAEGMVLFRA  425



>ref|XP_008908744.1| mannose-6-phosphate isomerase, class I [Phytophthora parasitica 
INRA-310]
 gb|ETI42461.1| mannose-6-phosphate isomerase, class I [Phytophthora parasitica 
P1569]
 gb|ETK82477.1| mannose-6-phosphate isomerase, class I [Phytophthora parasitica]
 gb|ETL35862.1| mannose-6-phosphate isomerase, class I [Phytophthora parasitica]
 gb|ETL89106.1| mannose-6-phosphate isomerase, class I [Phytophthora parasitica]
 gb|ETN06242.1| mannose-6-phosphate isomerase, class I [Phytophthora parasitica 
INRA-310]
 gb|ETO71080.1| mannose-6-phosphate isomerase, class I [Phytophthora parasitica 
P1976]
 gb|ETP12174.1| mannose-6-phosphate isomerase, class I [Phytophthora parasitica 
CJ01A1]
 gb|ETP40301.1| mannose-6-phosphate isomerase, class I [Phytophthora parasitica 
P10297]
Length=403

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 104/159 (65%), Gaps = 4/159 (3%)
 Frame = -1

Query  663  VLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLLGECIECMATSDNVVRAG  484
            VLRL+ +YP D+G    FL N++ L+PGEA++LGANEPHAYL G+C+ECMA SDNVVRAG
Sbjct  215  VLRLDNEYPGDIGCFCPFLLNYITLEPGEAMFLGANEPHAYLFGDCVECMACSDNVVRAG  274

Query  483  LTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTR-YLPPFEEFEIDQCILPRAAKAVF  307
            LTPK +D +TL SMLTY  G P + KG+  +   TR Y  P  EFE++   L    +   
Sbjct  275  LTPKFIDKETLHSMLTYYTGKPRVYKGDVQSDGVTRLYSSPVPEFEVEAVELKPRQRYAL  334

Query  306  PAVPGPSIFIVMAGEGAMTTPSSN---EIVAEGDVLFSP  199
            PA  G SI +V++G G+   PS N     +++G V F P
Sbjct  335  PARKGDSIVLVISGGGSTVEPSGNADGRKMSKGKVYFLP  373



>gb|KDD74657.1| type I phosphomannose isomerase [Helicosporidium sp. ATCC 50920]
Length=412

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 98/252 (39%), Positives = 136/252 (54%), Gaps = 19/252 (8%)
 Frame = -1

Query  879  PEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSRLNKK  700
            PEIAE+ G A ++  +  + +DG + A   L+ +F  LM++  + +   V + + R    
Sbjct  145  PEIAELSGRAAVDAFLVTEGKDGQKRA---LQQVFQNLMTADSERVQAAVERALRRTQDV  201

Query  699  NEQRN------------LCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGAN  556
            +E  +            L  +  L+ RL++QYP DVGVL + LFN+V+L PGEA++L  N
Sbjct  202  SEGSDGKEDGAVSSDGSLASRVGLMRRLQRQYPGDVGVLCSVLFNYVRLSPGEAMFLAPN  261

Query  555  EPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYT--  382
            EPHAY+ G  IECMA SDNV+RAGLTPK  D   LC+ LTY  G P + +G A+      
Sbjct  262  EPHAYVAGNAIECMACSDNVIRAGLTPKARDTDALCASLTYAMGPPSVERGEAVEACAGL  321

Query  381  TRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGE--GAMTTPSSNEIVAEGDVL  208
             RY  PF EFE+    L  AA    P   GP I IV AG   G      +   +A G V+
Sbjct  322  RRYPSPFAEFEVWSLNLEAAASVSLPPAQGPVIGIVQAGRASGLGGKDGAPMELARGRVV  381

Query  207  FSPANTNTAVAT  172
            F  A T+  V +
Sbjct  382  FLAAETSLEVES  393



>ref|XP_005145786.1| PREDICTED: mannose-6-phosphate isomerase [Melopsittacus undulatus]
Length=423

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 157/271 (58%), Gaps = 22/271 (8%)
 Frame = -1

Query  909  GELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvis  739
             E+   LQ+VPE+  ++G    EQL    E+ G+++ +     LR+ FT+LM S K +  
Sbjct  155  AEIVSFLQSVPELRALIGEVAAEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKLFV  210

Query  738  kvvskliSRLNKK-NEQRNLC-EKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYL  565
              ++ L+ R++++  E ++       L+LRL  QYP D+G    +  N V+L+PGEA++L
Sbjct  211  DQLNMLVKRISQEVAEGKDTSGSNGDLLLRLHSQYPGDIGCFTIYFLNLVRLEPGEAMFL  270

Query  564  GANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKG  403
            GANEPHAYL G+C+ECMA SDN VRAGLTPK +DV TLC ML Y         FP     
Sbjct  271  GANEPHAYLHGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPASSSSKIFPA--AQ  328

Query  402  NALNPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGEGAMT-TPSSNEI  229
            + L+P    Y PP  +F I +  +P + K  +  AV   SI +V+ G    T T +++EI
Sbjct  329  SQLDPNVYIYDPPVPDFAIMRIEIPSSIKLYLISAVDSASILLVIQGAAVGTSTAAASEI  388

Query  228  -VAEGDVLFSPANTNTA--VATTLGLSLFRA  145
             +  G VLF  AN + +  +++  G+ LFRA
Sbjct  389  PLCRGSVLFISANESVSLQLSSPDGMLLFRA  419



>emb|CEI87990.1| Putative Mannose-6-phosphate isomerase [Rhizopus microsporus]
Length=416

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 99/262 (38%), Positives = 150/262 (57%), Gaps = 11/262 (4%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   ++  PE+ E++G     + + + +    +  K  L+ +F  +M  S+D I+++++
Sbjct  150  EITHHMKVYPELTELIGQDLTREFLEITKSSDEQAKKAVLKKVFAAVMRGSQDTITQLLA  209

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPS-DVGVLAAFLFNHVKLKPGEALYLGANEP  550
            KLI RL + +++  +    +L++RL++QYP  DVGV +  L N+V ++PG+A++LGANEP
Sbjct  210  KLIHRLKESDDKDTIS---KLLIRLDEQYPGGDVGVFSCLLLNYVSMEPGQAIFLGANEP  266

Query  549  HAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALN--PYTTR  376
            HAYL G+C+ECMATSDNVVRAGLTPK  DV  L  MLTY+ G  E  K   +    ++  
Sbjct  267  HAYLSGDCVECMATSDNVVRAGLTPKFKDVDVLVEMLTYRYGSAESQKMTPIKFGEHSLL  326

Query  375  YLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMT----TPSSNEIVAEGDVL  208
            Y PP EEF +    +          + GPSI IV  G G +T           + EG V 
Sbjct  327  YDPPIEEFSVVWTNMGSNQTEKHKPIEGPSILIVTRGNGKLTGNLLKTEQTYDLQEGYVY  386

Query  207  FSPANTN-TAVATTLGLSLFRA  145
            F  ANT  +A +   GL  +RA
Sbjct  387  FVGANTPISAESGESGLEFYRA  408



>emb|CEG73470.1| Putative Mannose-6-phosphate isomerase [Rhizopus microsporus]
Length=416

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 99/262 (38%), Positives = 150/262 (57%), Gaps = 11/262 (4%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   ++  PE+ E++G     + + + +    +  K  L+ +F  +M  S+D I+++++
Sbjct  150  EITHHMKVYPELTELIGQDLTREFLEITKSSDEQAKKAVLKKVFAAVMRGSQDTITQLLA  209

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPS-DVGVLAAFLFNHVKLKPGEALYLGANEP  550
            KLI RL + +++  +    +L++RL++QYP  DVGV +  L N+V ++PG+A++LGANEP
Sbjct  210  KLIHRLKESDDKDTIS---KLLIRLDEQYPGGDVGVFSCLLLNYVSMEPGQAIFLGANEP  266

Query  549  HAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALN--PYTTR  376
            HAYL G+C+ECMATSDNVVRAGLTPK  DV  L  MLTY+ G  E  K   +    ++  
Sbjct  267  HAYLSGDCVECMATSDNVVRAGLTPKFKDVDVLVEMLTYRYGSAESQKMTPIKFGEHSLL  326

Query  375  YLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMT----TPSSNEIVAEGDVL  208
            Y PP EEF +    +          + GPSI IV  G G +T           + EG V 
Sbjct  327  YDPPIEEFSVVWTNMGSNQTEKHKPIEGPSILIVTRGNGKLTGNLLKTEQTYDLQEGYVY  386

Query  207  FSPANTN-TAVATTLGLSLFRA  145
            F  ANT  +A +   GL  +RA
Sbjct  387  FVGANTPISAESGESGLEFYRA  408



>ref|XP_003060607.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55376.1| predicted protein [Micromonas pusilla CCMP1545]
Length=444

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 108/261 (41%), Positives = 143/261 (55%), Gaps = 6/261 (2%)
 Frame = -1

Query  891  LQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRL--LFTKLMssskdviskvvskli  718
            L  VPE+A V G A  + L  +    G   A    R+  +F  +M + K  I   V  L 
Sbjct  153  LTEVPELAAVAGEAAEDFLGYMPNSVGWVPAASRRRIKGVFAAVMRAEKPEIEHAVETLQ  212

Query  717  SRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYL  538
             RL+  +    L + + L LRL +QYP DVGVL A+L N+V L+P E +YL ANEPHAYL
Sbjct  213  KRLSAADPA-TLRDVDTLALRLCEQYPKDVGVLCAYLLNYVTLEPDECIYLAANEPHAYL  271

Query  537  LGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRYLPPFE  358
             G CIECMATSDNVVRAGLTPK  DV  L  MLTY  G  +IL+G+ ++  T RY+PPF+
Sbjct  272  AGTCIECMATSDNVVRAGLTPKLRDVDVLVEMLTYACGPTKILRGDVVDEKTRRYVPPFD  331

Query  357  EFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIV--AEGDVLFSPANTNT  184
            EF+++   L            GP +++V  G G +   +  E +    G V FS A    
Sbjct  332  EFQLETINLGPNDVYDVAVSKGPCVYLVREGGGTVNGTTGTEAMEAKRGGVFFSSAGEAV  391

Query  183  AVATTL-GLSLFRAGIXQYVF  124
              A +  G+   RA I  +VF
Sbjct  392  RFAASAEGMRAHRAMINDWVF  412



>ref|XP_009544248.1| hypothetical protein HETIRDRAFT_473320 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW84599.1| hypothetical protein HETIRDRAFT_473320 [Heterobasidion irregulare 
TC 32-1]
Length=424

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 94/263 (36%), Positives = 143/263 (54%), Gaps = 9/263 (3%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAEN--AKLTLRLLFTKLMssskdviskv  733
            ++   L  VPE + +V  + ++   +++      +  AK  L+ +F+ +M++++  I   
Sbjct  158  QIAAFLSVVPEFSALVPPSILKSFQDIQSSSDPTDPSAKSALKDVFSAVMTTNESDIKFQ  217

Query  732  vskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
            +  LI R +   E       + LVL L +Q+P D+GV  AF+ N+V+LKPGEA++LGA E
Sbjct  218  LDMLIQRYSIGKEHAEERTIKDLVLTLNEQFPGDIGVFCAFMLNYVQLKPGEAIFLGAGE  277

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG-------FPEILKGNAL  394
            PHAY+ G+ +ECMA SDNV+RAGLTPK  DV  L S LTY           P      + 
Sbjct  278  PHAYISGDIMECMANSDNVIRAGLTPKLRDVPNLVSGLTYTAAPWTKHRVQPSSFPAQSP  337

Query  393  NPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGD  214
              ++T Y PP  +F + Q +LP+  K   P V GPSI IV  G+G ++       V+EG 
Sbjct  338  TSFSTLYDPPIPDFSVVQVVLPQDHKERHPKVNGPSIVIVTNGKGKISWTEGQLDVSEGY  397

Query  213  VLFSPANTNTAVATTLGLSLFRA  145
            V F  A     +     L+++RA
Sbjct  398  VFFVSAGLEIEIRAEEELTMYRA  420



>gb|KFP85624.1| Mannose-6-phosphate isomerase, partial [Acanthisitta chloris]
Length=410

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 101/255 (40%), Positives = 144/255 (56%), Gaps = 17/255 (7%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQ VPE+  ++G    EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  155  EIVCFLQNVPELRALIGAVAAEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  210

Query  735  vvskliSRLNKKNEQRNLC-EKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGA  559
             ++ L+ R+++  E ++       L+LRL  QYP D+G    +  N VKL+PGEAL+LGA
Sbjct  211  QLNMLVKRISQAAEGKDTSGSNGALLLRLHSQYPGDIGCFTIYFLNLVKLEPGEALFLGA  270

Query  558  NEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILK-----GNAL  394
            NEPHAYL G+C+ECMA SDN VRAGLTPK +DV TLC ML Y    P   K      + L
Sbjct  271  NEPHAYLHGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPA-PSSSKIFAAAQSQL  329

Query  393  NPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEIVA  223
            +P+   Y PP  +F I +  +P + K  +  A+   SI +V+ G   G  T  +S   + 
Sbjct  330  DPHVYLYDPPVPDFAIMRIEIPASIKLYLVSAMDSASILLVIQGTAVGTSTAAASEMALH  389

Query  222  EGDVLFSPANTNTAV  178
             G VLF  AN + ++
Sbjct  390  RGSVLFVSANESISL  404



>ref|XP_010569925.1| PREDICTED: mannose-6-phosphate isomerase isoform X1 [Haliaeetus 
leucocephalus]
Length=446

 Score =   158 bits (400),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 104/270 (39%), Positives = 151/270 (56%), Gaps = 22/270 (8%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQ+VPE+  ++G    EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  179  EIVSFLQSVPELRALIGEVAAEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  234

Query  735  vvskliSRLNKKNEQRNLCEKE--QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             ++ L+ R++++  +          L+LRL  QYP D+G    +  N VKL+PGEA++LG
Sbjct  235  QLNMLVKRISQEAAEGKDTSGSNGDLLLRLHSQYPGDIGCFTIYFLNLVKLEPGEAMFLG  294

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGN  400
            ANEPHAYL G+C+ECMA SDN VRAGLTPK +DV TLC ML Y         FP     +
Sbjct  295  ANEPHAYLHGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKIFPA--AQS  352

Query  399  ALNPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEI  229
             L+P    Y PP  +F I +  +P + K  +  A+   SI +V+ G   G  T  +S   
Sbjct  353  QLDPSVYLYDPPVPDFAIMRIEIPPSIKLYLVSAMDSASILLVIQGTAVGTSTAAASEMT  412

Query  228  VAEGDVLFSPANTNTA--VATTLGLSLFRA  145
            +  G VLF  AN + +  +++  G+ LFRA
Sbjct  413  LRRGSVLFISANESISLHLSSPDGMLLFRA  442



>gb|ELU39697.1| mannose-6-phosphate isomerase [Rhizoctonia solani AG-1 IA]
Length=406

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 110/265 (42%), Positives = 140/265 (53%), Gaps = 19/265 (7%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   L  VPE A +     I +           + K TLR +F  LMS+  D +   + 
Sbjct  145  EISTFLSAVPEFASL-----IPEKAASALSSSPSDPKSTLRDVFGALMSAPSDQVQSALD  199

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            +L+ R           +   L   L KQYP DVGV   FL N VKL  GEA++L A+EPH
Sbjct  200  QLVKRYESGGATSAESQVADLAQTLAKQYPGDVGVFCVFLLNVVKLNEGEAMFLQADEPH  259

Query  546  AYLLG-ECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG-------FPEILKGNA--  397
            AY+ G + IECMATSDNVVRAGLTPK  DV TL SMLTY  G        P+  KG +  
Sbjct  260  AYISGADIIECMATSDNVVRAGLTPKLRDVPTLVSMLTYNSGPADAQRMEPKPFKGESSD  319

Query  396  LNPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEG  217
             + +TT Y PP  EF +    +P   KA   A+ GPSIFIV +G G +   S  EI +EG
Sbjct  320  SDSFTTLYDPPIPEFSVLLTDIPAGKKASHRALEGPSIFIVTSGSGNV---SGQEIKSEG  376

Query  216  DVLFSPANTNTA-VATTLGLSLFRA  145
            +V F+ A  +    A   GL L+RA
Sbjct  377  EVWFAGAGQSLEFTAGDQGLVLYRA  401



>ref|XP_009567147.1| PREDICTED: mannose-6-phosphate isomerase isoform X1 [Cuculus 
canorus]
Length=373

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 150/270 (56%), Gaps = 22/270 (8%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQ VPE+  ++G    EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  106  EIVSFLQAVPELRALIGEVAAEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  161

Query  735  vvskliSRLNKKNEQ--RNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             ++ L+ R++++  +          L+LRL  Q+P D+G    +  N V+L+PGEA+YLG
Sbjct  162  QLNTLVKRVSQEAAEGKDTSASNGDLLLRLHSQFPGDIGCFTIYFLNLVRLEPGEAMYLG  221

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGN  400
            ANEPHAYL G+C+ECMA SDN VRAGLTPK +DV TLC ML Y         FP     +
Sbjct  222  ANEPHAYLHGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKIFPA--TQS  279

Query  399  ALNPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEI  229
             L+P    Y PP  +F + +  +P + K  +  AV   SI +V+ G   G  T  +S   
Sbjct  280  QLDPSVYLYDPPVPDFAVMKIEIPASIKLYLVSAVDSASILLVIQGTAVGTSTAAASEMP  339

Query  228  VAEGDVLFSPANTNTA--VATTLGLSLFRA  145
            +  G VLF  AN + +  +++  G+ LFRA
Sbjct  340  LRRGSVLFISANESISLHLSSPDGMLLFRA  369



>ref|XP_005239458.1| PREDICTED: mannose-6-phosphate isomerase [Falco peregrinus]
Length=423

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 150/270 (56%), Gaps = 22/270 (8%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQ+VPE+  ++G    EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  156  EIVSFLQSVPELRALIGEVAAEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  211

Query  735  vvskliSRLNKKNEQRNLCEKE--QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             ++ L+ R++++  +          L+LRL  QYP D+G    +  N V+L+PGEA++LG
Sbjct  212  QLNMLVKRISQEAAEGKDTSGSNGDLLLRLHSQYPGDIGCFTIYFLNLVRLEPGEAMFLG  271

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGN  400
            ANEPHAYL G+C+ECMA SDN VRAGLTPK +DV TLC ML Y         FP     +
Sbjct  272  ANEPHAYLHGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKIFPA--TQS  329

Query  399  ALNPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEI  229
             L+P    Y PP  +F I +  +P + K  +  AV   SI +V+ G   G  T  +S   
Sbjct  330  QLDPSIYLYDPPVPDFAIMRIEIPASIKLYLVSAVDSASILLVIQGTAVGTSTAAASEMT  389

Query  228  VAEGDVLFSPANTNTA--VATTLGLSLFRA  145
            +  G VLF  AN + +  +++  G+  FRA
Sbjct  390  LRRGSVLFISANESISLHLSSPDGMLFFRA  419



>ref|XP_638475.1| mannose-6-phosphate isomerase [Dictyostelium discoideum AX4]
 sp|Q54PA0.1|MPI_DICDI RecName: Full=Probable mannose-6-phosphate isomerase; AltName: 
Full=Phosphohexomutase; AltName: Full=Phosphomannose isomerase; 
Short=PMI [Dictyostelium discoideum]
 gb|EAL65112.1| mannose-6-phosphate isomerase [Dictyostelium discoideum AX4]
Length=452

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 102/277 (37%), Positives = 159/277 (57%), Gaps = 24/277 (9%)
 Frame = -1

Query  912  FGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskv  733
              E++  + T+PE    + N     LI L      ++ K  L+ + T L+ +   +IS  
Sbjct  185  LSEIQSFIDTIPEFKNSLPN----NLIKL------DDCKEYLKSIVTSLLKADGLLISNN  234

Query  732  vskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
            + +L +RLN+K E+    + ++LVL+L  QYP DVGV  A++ N++ LKPGEAL+LGA E
Sbjct  235  LKELNNRLNEKREEER-DDLDRLVLKLYSQYPGDVGVFFAYILNYIVLKPGEALFLGAGE  293

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGN-----ALNP  388
            PHAY+ G+C+ECMA SDNVVRAGLTPK  DV TL  MLTY+ G P+++        +L  
Sbjct  294  PHAYISGDCVECMAPSDNVVRAGLTPKLKDVDTLGDMLTYRTGRPDLVVPQQRPDLSLTN  353

Query  387  YTTRYLPPFEEFEIDQCILPRAAKAV-FPAVPGPSIFIVMAGEGAMTTPSSNEIVAE---  220
            Y   Y PP +EF+++   L    K +   +  GPSI +V +G  ++   S+   +     
Sbjct  354  YRC-YQPPVDEFQVEYYHLDDCCKNINVYSSKGPSIVLVYSGNLSIENKSNQSTLNNLHT  412

Query  219  GDVLFSPANTNTAV---ATTLGLSLFRAGIXQYVFCR  118
            G +LF PANT+       +++ +S++ A +   +F +
Sbjct  413  GSILFVPANTDYQFIQSDSSIPVSIYVASVSNRIFNK  449



>ref|XP_009909891.1| PREDICTED: mannose-6-phosphate isomerase isoform X1 [Picoides 
pubescens]
Length=423

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 154/270 (57%), Gaps = 22/270 (8%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQ VPE+  ++G    EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  156  EIVSFLQNVPELRALIGEVAAEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  211

Query  735  vvskliSRLNKKN-EQRNLC-EKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             ++ L+ R++++  E +++      L+LRL  QYP D+G    +  N V+L+PGEA++LG
Sbjct  212  QLNMLVKRISQEAAEGKDISGSNGDLLLRLHSQYPGDIGCFTIYFLNLVRLEPGEAMFLG  271

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGN  400
            ANEPHAYL G+C+ECMA SDN VRAGLTPK +DV TLC ML Y         FP +   +
Sbjct  272  ANEPHAYLQGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKIFPAV--QS  329

Query  399  ALNPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEI  229
             L+P    + PP  +F I +  +P + K  +  A+   SI +V+ G   G  T  +S   
Sbjct  330  QLDPSVYLFDPPVPDFAIMKIEIPASIKLYLVSAMDSASILLVIQGTAVGTSTAAASEMS  389

Query  228  VAEGDVLFSPANTNTA--VATTLGLSLFRA  145
            +  G VLF  AN + +  +++  G+ LFRA
Sbjct  390  LRRGSVLFISANESISLHLSSPDGMLLFRA  419



>ref|XP_007435657.1| PREDICTED: mannose-6-phosphate isomerase [Python bivittatus]
Length=373

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/265 (38%), Positives = 150/265 (57%), Gaps = 12/265 (5%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   LQ VPE   ++G+   EQL     +D        LR+ FT++M S K V    ++
Sbjct  106  EIVGFLQNVPEFRALIGSVAAEQL-ERSVRDDPRGVSAALRICFTRMMKSEKKVFVDHLN  164

Query  726  kliSRLNKKNEQ-RNLCEK-EQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
             L+ R++++    R++     +L+L+L  Q+P D+G    +  N +KL+PGE ++LGANE
Sbjct  165  LLVKRISREAAAGRDISASCGELLLKLHSQFPGDIGCFVIYFLNQMKLQPGECMFLGANE  224

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFP--EIL--KGNALNPY  385
            PHAYL G+CIECMA SDN VRAGLTPK +DV TLC ML Y    P  ++L    + L+P 
Sbjct  225  PHAYLYGDCIECMACSDNTVRAGLTPKFIDVLTLCEMLNYAPAPPNSKLLAPTQSRLDPC  284

Query  384  TTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEIVAEGD  214
             + Y PP  +F + +  +P + K  +  A+   SI +V+ G   G  T   S   +  G 
Sbjct  285  VSLYDPPIPDFAVMRIEIPSSVKLYLVSAIDSASILLVVRGSAVGTSTAAGSEMALRPGA  344

Query  213  VLFSPANTNTAV--ATTLGLSLFRA  145
            VLF  AN + ++  ++  G+ LFRA
Sbjct  345  VLFMSANESVSLHFSSAKGMLLFRA  369



>gb|KFV63742.1| Mannose-6-phosphate isomerase, partial [Picoides pubescens]
Length=422

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 154/270 (57%), Gaps = 22/270 (8%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQ VPE+  ++G    EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  155  EIVSFLQNVPELRALIGEVAAEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  210

Query  735  vvskliSRLNKKN-EQRNLC-EKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             ++ L+ R++++  E +++      L+LRL  QYP D+G    +  N V+L+PGEA++LG
Sbjct  211  QLNMLVKRISQEAAEGKDISGSNGDLLLRLHSQYPGDIGCFTIYFLNLVRLEPGEAMFLG  270

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGN  400
            ANEPHAYL G+C+ECMA SDN VRAGLTPK +DV TLC ML Y         FP +   +
Sbjct  271  ANEPHAYLQGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKIFPAV--QS  328

Query  399  ALNPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEI  229
             L+P    + PP  +F I +  +P + K  +  A+   SI +V+ G   G  T  +S   
Sbjct  329  QLDPSVYLFDPPVPDFAIMKIEIPASIKLYLVSAMDSASILLVIQGTAVGTSTAAASEMS  388

Query  228  VAEGDVLFSPANTNTA--VATTLGLSLFRA  145
            +  G VLF  AN + +  +++  G+ LFRA
Sbjct  389  LRRGSVLFISANESISLHLSSPDGMLLFRA  418



>gb|KFO82051.1| Mannose-6-phosphate isomerase, partial [Cuculus canorus]
Length=420

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 150/270 (56%), Gaps = 22/270 (8%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQ VPE+  ++G    EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  153  EIVSFLQAVPELRALIGEVAAEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  208

Query  735  vvskliSRLNKKNEQ--RNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             ++ L+ R++++  +          L+LRL  Q+P D+G    +  N V+L+PGEA+YLG
Sbjct  209  QLNTLVKRVSQEAAEGKDTSASNGDLLLRLHSQFPGDIGCFTIYFLNLVRLEPGEAMYLG  268

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGN  400
            ANEPHAYL G+C+ECMA SDN VRAGLTPK +DV TLC ML Y         FP     +
Sbjct  269  ANEPHAYLHGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKIFPA--TQS  326

Query  399  ALNPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEI  229
             L+P    Y PP  +F + +  +P + K  +  AV   SI +V+ G   G  T  +S   
Sbjct  327  QLDPSVYLYDPPVPDFAVMKIEIPASIKLYLVSAVDSASILLVIQGTAVGTSTAAASEMP  386

Query  228  VAEGDVLFSPANTNTA--VATTLGLSLFRA  145
            +  G VLF  AN + +  +++  G+ LFRA
Sbjct  387  LRRGSVLFISANESISLHLSSPDGMLLFRA  416



>gb|AAG10203.1|AF291701_1 mannose-6-phosphate isomerase [Cryptococcus neoformans var. neoformans]
Length=434

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 143/272 (53%), Gaps = 28/272 (10%)
 Frame = -1

Query  885  TVPEIAEVVGNAYIEQLINL----------------KEQDGAENAKLTLRLLFTKLMsss  754
            TVPE+ E V ++  E L +                  E       K  L+ +F  LMS+ 
Sbjct  162  TVPELQEFVDSSLTESLASSLDLPTSQPPDSSLFKPTESPATAEQKDILKQIFAALMSAD  221

Query  753  kdviskvvskliSRLNKKNEQRNLCEKEQ----LVLRLEKQYPSDVGVLAAFLFNHVKLK  586
            K  + + +SKLI R   K   R++ E E+    L LRL  QYP DVGVL  FL N V+LK
Sbjct  222  KKHVEEAISKLIKRYKAK---RDIKENEKDLVDLALRLNDQYPGDVGVLCVFLLNVVELK  278

Query  585  PGEALYLGANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQ--GFPEI  412
             GEA +LGANEPHAY+ G+ IECMATSDNVVRAGLTPK  DV TL SMLTY+   G  ++
Sbjct  279  RGEAAFLGANEPHAYIEGDIIECMATSDNVVRAGLTPKLRDVDTLVSMLTYEAAPGNKQL  338

Query  411  LKGNAL---NPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS  241
            L+  +    +  T  Y PP  EF + +  L +  K     V GPS+ ++  GEG +   +
Sbjct  339  LQPTSFQKGDDTTKLYDPPIAEFSVLRTELSKGMKTSHRPVEGPSLCVITEGEGVVRDGN  398

Query  240  SNEIVAEGDVLFSPANTNTAVATTLGLSLFRA  145
                   GDV+F  A          GL +FRA
Sbjct  399  DQTEFVRGDVIFVGAGKEVEWEAIKGLEMFRA  430



>ref|XP_006126332.1| PREDICTED: mannose-6-phosphate isomerase isoform X1 [Pelodiscus 
sinensis]
Length=421

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 149/266 (56%), Gaps = 14/266 (5%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   LQ VPE   ++GN   EQL      D        LR+ FT++M S K V    ++
Sbjct  154  EIVAFLQKVPEFRALIGNVAAEQL-ERSVCDDPRGVSAALRVCFTRMMKSEKKVFVDQLN  212

Query  726  kliSRLNKKN-EQRNLCEKE-QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
             L+ R++++  E ++  E   +L+L+L  Q+P D+G  A +  N V L+PGEA++LGANE
Sbjct  213  MLVKRISQEAAEGKDASESSGKLLLQLHSQFPGDIGCFAIYFLNLVMLQPGEAMFLGANE  272

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNA-----LNP  388
            PHAYL G+CIECMA SDN VRAGLTPK +DV TLC ML Y    P   K  A     L+P
Sbjct  273  PHAYLYGDCIECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPA-PSSAKVFAPTQSRLDP  331

Query  387  YTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGEGAMTTPS--SNEIVAEG  217
                Y PP  +F + +  +P + K  +  AV   SI +V+ G    T+ +  S   +  G
Sbjct  332  CLYLYDPPIPDFTVMKIEIPSSIKLYLISAVDSASILLVIQGTAVATSTAAVSEMTLRRG  391

Query  216  DVLFSPANTNTA--VATTLGLSLFRA  145
             VLF  AN + +  +++  G+ LFRA
Sbjct  392  SVLFISANESISLHLSSPDGMLLFRA  417



>ref|XP_006782485.1| PREDICTED: mannose-6-phosphate isomerase-like isoform X2 [Neolamprologus 
brichardi]
Length=372

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/267 (37%), Positives = 148/267 (55%), Gaps = 17/267 (6%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   L+ VPE   +VG+   ++L        A+     L+  FT++M   K V+ + ++
Sbjct  106  EILEFLEKVPEFHTLVGHGAAQEL--RASVGDADRTSQALKRCFTRMMDWEKKVVVENLN  163

Query  726  kliSRLNKKNEQRNLCE--KEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
            +L+ R+ +              L+LRL  QYP D+G  + +  NHV L PG+A++LGANE
Sbjct  164  ELVKRVTEDAAAGKDTSGISGDLLLRLHSQYPGDIGCFSIYFLNHVVLNPGQAMFLGANE  223

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGNALN  391
            PHAYL G+CIECMA SDN VRAGLTPK++DV TLC ML Y         FP +   +  +
Sbjct  224  PHAYLYGDCIECMACSDNTVRAGLTPKYIDVNTLCEMLNYSPAPASSKIFPCL--QDPSD  281

Query  390  PYTTRYLPPFEEFEIDQCILPRAAKAVFPA-VPGPSIFIVMAGEGAMTTPS--SNEIVAE  220
            P  + Y PP  +F + +  +P + K    A V   SI +V+ GE   T+P+  S+  +  
Sbjct  282  PCVSIYNPPVPDFTVMRIQIPASVKQYNIAPVDSASILLVIEGEATGTSPAALSDLTLTR  341

Query  219  GDVLFSPANTNTA--VATTLGLSLFRA  145
            G VLF  AN + +  + +  G++LFRA
Sbjct  342  GSVLFVSANESISLHITSQSGMTLFRA  368



>ref|XP_006126333.1| PREDICTED: mannose-6-phosphate isomerase isoform X2 [Pelodiscus 
sinensis]
Length=421

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 149/266 (56%), Gaps = 14/266 (5%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   LQ VPE   ++GN   EQL      D        LR+ FT++M S K V    ++
Sbjct  154  EIVAFLQKVPEFRALIGNVAAEQL-ERSVCDDPRGVSAALRVCFTRMMKSEKKVFVDQLN  212

Query  726  kliSRLNKKN-EQRNLCEKE-QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
             L+ R++++  E ++  E   +L+L+L  Q+P D+G  A +  N V L+PGEA++LGANE
Sbjct  213  MLVKRISQEAAEGKDASESSGKLLLQLHSQFPGDIGCFAIYFLNLVMLQPGEAMFLGANE  272

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNA-----LNP  388
            PHAYL G+CIECMA SDN VRAGLTPK +DV TLC ML Y    P   K  A     L+P
Sbjct  273  PHAYLYGDCIECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPA-PSSAKVFAPTQSRLDP  331

Query  387  YTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGEGAMTTPS--SNEIVAEG  217
                Y PP  +F + +  +P + K  +  AV   SI +V+ G    T+ +  S   +  G
Sbjct  332  CLYLYDPPIPDFTVMKIEIPSSIKLYLISAVDSASILLVIQGTAVATSTAAVSEMTLRRG  391

Query  216  DVLFSPANTNTA--VATTLGLSLFRA  145
             VLF  AN + +  +++  G+ LFRA
Sbjct  392  SVLFISANESISLHLSSPDGMLLFRA  417



>gb|KIJ18653.1| mannose-6-phosphate isomerase [Paxillus involutus ATCC 200175]
Length=413

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/259 (38%), Positives = 144/259 (56%), Gaps = 12/259 (5%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E++  L++VPE   +V N   E  ++ +E    E     L+LLF+ LM +  D +   ++
Sbjct  159  EIESYLRSVPEFRTLVSNEIAESFLSAEESGKREQ----LQLLFSALMQADADAVKDKLA  214

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            +L  R N ++E+    E + LVL L  Q+P DVGV   F+ NHVKL  G+A++LGA EPH
Sbjct  215  QLTERYNAESEK---SEIQDLVLTLNNQHPGDVGVFCVFMLNHVKLTAGQAIFLGAGEPH  271

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG-FPEILKGNALNPY--TTR  376
            AY+ G+ +ECMA SDNV+RAGLTPK  D+  L S LTYK G + + +   + +P   T  
Sbjct  272  AYVSGDIMECMANSDNVIRAGLTPKPKDIPNLLSGLTYKAGPWSDHMVRPSTSPGSPTIT  331

Query  375  YLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVA--EGDVLFS  202
            Y PP  EF +    L   AK     + GPSI I   G G+++  +  + +    G V F 
Sbjct  332  YDPPIPEFTVLATDLKHEAKESHRPIHGPSIVIATDGSGSISWDNDAKSLGLQPGSVAFI  391

Query  201  PANTNTAVATTLGLSLFRA  145
             AN   +  T   L+++RA
Sbjct  392  GANVPVSFQTATNLTVYRA  410



>ref|XP_004069506.1| PREDICTED: mannose-6-phosphate isomerase [Oryzias latipes]
Length=421

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 152/267 (57%), Gaps = 17/267 (6%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   LQ VPE   +VGN   E+L +    DGA  ++  L+  FT++MS  K V    ++
Sbjct  155  EILAFLQRVPEFHALVGNEAAEELQH-AVGDGARTSQ-ALKKCFTRMMSCEKKVFVDELN  212

Query  726  kliSRLNKKNE--QRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
            +L+ R+ ++    +        L+LRL  QYP D+G  + +  N+V L+PG+A++LGANE
Sbjct  213  ELVKRVTEEGAAGKDTSGSNGDLLLRLHSQYPGDIGCFSIYFLNYVVLEPGQAMFLGANE  272

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGNALN  391
            PHAYL G+CIECMA SDN VRAGLT K++DV TLC ML Y         FP +   +  +
Sbjct  273  PHAYLYGDCIECMACSDNTVRAGLTRKYIDVSTLCEMLNYSPAPASSKIFPCV--QDPSD  330

Query  390  PYTTRYLPPFEEFEIDQCILPRAAKAVFPA-VPGPSIFIVMAGEGAMTTPSSNEIVA--E  220
            P  T Y PP  +F + +  +P + K    A V   SI +V+ G+   T P+++  +    
Sbjct  331  PCVTLYDPPVPDFTVIKIQVPASVKDYTVAPVDSASILLVIEGDAMATAPAAHSDITMRR  390

Query  219  GDVLFSPANTNTA--VATTLGLSLFRA  145
            G VLF  AN + +  +++  G+ LFRA
Sbjct  391  GTVLFVSANESLSLHISSPSGMLLFRA  417



>ref|XP_002116196.1| hypothetical protein TRIADDRAFT_30639 [Trichoplax adhaerens]
 gb|EDV21229.1| hypothetical protein TRIADDRAFT_30639 [Trichoplax adhaerens]
Length=440

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 146/261 (56%), Gaps = 15/261 (6%)
 Frame = -1

Query  909  GELKVVLQTVPEIAEVVGNAYIE------QLINLKEQDGAENAKLTLRLLFTKLMssskd  748
            GE+   LQT+PE   +VG  + E      ++++ K+++     +  L+  FT +M    +
Sbjct  165  GEIVTFLQTIPEFYNIVGKDHAEVLLRSSRMVSAKDENSILACQNALKSCFTSVMQCDPE  224

Query  747  viskvvskliSRLNKKNEQRNLCEKEQ--LVLRLEKQYPSDVGVLAAFLFNHVKLKPGEA  574
             + + ++ L+ RL+  +E     +  Q  L+ RL KQ+P DVG    + FN+++L+PG+ 
Sbjct  225  AVQRHLTTLLERLSNIDEHDEYYQASQGTLLSRLNKQFPGDVGCFCIYFFNYIRLEPGQC  284

Query  573  LYLGANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPE----ILK  406
            L+L A  PHAYL G+C+ECMA SDNVVRAGLTPK+ DV TLC ML Y+   P        
Sbjct  285  LFLAAGVPHAYLAGDCMECMACSDNVVRAGLTPKYKDVPTLCEMLNYRCATPSENLFSCH  344

Query  405  GNALNPYTTRYLPPFEEFEIDQCILPRAAKAV-FPAVPGPSIFIVMAG--EGAMTTPSSN  235
             + ++ + + Y PP  +F +    +P+   +    A+PGPSIF+V+ G  EG++      
Sbjct  345  TDPVDEFVSVYDPPVGDFAVHVIRVPKTVSSYEMRALPGPSIFLVVHGNAEGSINEEHHV  404

Query  234  EIVAEGDVLFSPANTNTAVAT  172
              +  G V+F  A  + ++ T
Sbjct  405  MNLRRGSVVFLAAEHSYSLRT  425



>ref|XP_572705.1| mannose-6-phosphate isomerase [Cryptococcus neoformans var. neoformans 
JEC21]
 sp|Q9HFU4.2|MPI_CRYNJ RecName: Full=Mannose-6-phosphate isomerase; AltName: Full=Phosphohexomutase; 
AltName: Full=Phosphomannose isomerase; Short=PMI 
[Cryptococcus neoformans var. neoformans JEC21]
 gb|AAW45398.1| mannose-6-phosphate isomerase [Cryptococcus neoformans var. neoformans 
JEC21]
Length=434

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 143/272 (53%), Gaps = 28/272 (10%)
 Frame = -1

Query  885  TVPEIAEVVGNAYIEQLINL----------------KEQDGAENAKLTLRLLFTKLMsss  754
            TVPE+ E V ++  E L +                  E       K  L+ +F  LMS+ 
Sbjct  162  TVPELQEFVDSSLTESLASSLGLPTSQPPDTSLFKPTESPATAEQKDILKQIFAALMSAD  221

Query  753  kdviskvvskliSRLNKKNEQRNLCEKEQ----LVLRLEKQYPSDVGVLAAFLFNHVKLK  586
            K ++ + +SKLI R   K   R++ E E+    L LRL  QYP DVGVL  FL N V+LK
Sbjct  222  KKLVEEAISKLIKRYQAK---RDIKENEKSLVDLALRLNDQYPGDVGVLCVFLLNVVELK  278

Query  585  PGEALYLGANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQ--GFPEI  412
             GEA +LGANEPHAY+ G+ IECMATSDNVVRAGLTPK  DV TL SMLTY+   G  ++
Sbjct  279  RGEAAFLGANEPHAYIEGDIIECMATSDNVVRAGLTPKLRDVDTLVSMLTYEAAPGNKQL  338

Query  411  LKGNAL---NPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS  241
            L+       +  T  Y PP  EF + +  L +  K     V GPS+ ++  GEG +   +
Sbjct  339  LQPTPFQKGDDTTKLYDPPIAEFSVLRTELSKGMKTSHRPVEGPSLCVITEGEGVVRNGN  398

Query  240  SNEIVAEGDVLFSPANTNTAVATTLGLSLFRA  145
                   GDV+F  A          GL +FRA
Sbjct  399  DRSEFVRGDVIFVGAGKEVEWEAIKGLEMFRA  430



>ref|XP_007363350.1| mannose-6-phosphate isomerase [Dichomitus squalens LYAD-421 SS1]
 gb|EJF63632.1| mannose-6-phosphate isomerase [Dichomitus squalens LYAD-421 SS1]
Length=427

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 134/239 (56%), Gaps = 13/239 (5%)
 Frame = -1

Query  891  LQTVPEIAEVVGNAYIEQLINLKE-QDGAE-NAKLTLRLLFTKLMssskdviskvvskli  718
            L   PE A +V  A  EQ + +   +D A+   K  L+ +F+ +M++   +    + KL+
Sbjct  165  LVDTPEFAALVPQAIREQFLQVASTEDSADLKVKQALKDVFSAVMTADASLFQPELEKLV  224

Query  717  SRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYL  538
            +R      + +  +   LVLRL+ Q+P D+GV  AFL NH+ L PGEA++L A EPHAY+
Sbjct  225  ARYKSGGAKPSEKDVRDLVLRLDSQFPGDIGVFCAFLLNHLSLHPGEAIFLAAGEPHAYV  284

Query  537  LGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGF-------PEILKGNALNPYTT  379
             G+ +ECMATSDNV+RAGLTPK  DV  L + LTY           P   + +    ++T
Sbjct  285  SGDIVECMATSDNVIRAGLTPKLRDVPNLVAGLTYNAAHASKHLVEPRSFQAST---HST  341

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEI-VAEGDVLF  205
             Y PP  EF + + ++P       P + GPSI IV  G+G +   S  ++ V+EGDV F
Sbjct  342  LYDPPIPEFSVLRAVVPSGETETHPPIDGPSIAIVTGGKGTVVWGSREQLNVSEGDVFF  400



>ref|XP_009078147.1| PREDICTED: mannose-6-phosphate isomerase [Acanthisitta chloris]
Length=382

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 101/256 (39%), Positives = 143/256 (56%), Gaps = 18/256 (7%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQ VPE+  ++G    EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  106  EIVCFLQNVPELRALIGAVAAEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  161

Query  735  vvskliSRLNKKNEQRNLCEKEQ--LVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             ++ L+ RL+++  +          L+LRL  QYP D+G    +  N VKL+PGEAL+LG
Sbjct  162  QLNMLVKRLSQEAAEGKDTSGSNGALLLRLHSQYPGDIGCFTIYFLNLVKLEPGEALFLG  221

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILK-----GNA  397
            ANEPHAYL G+C+ECMA SDN VRAGLTPK +DV TLC ML Y    P   K      + 
Sbjct  222  ANEPHAYLHGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPA-PSSSKIFAAAQSQ  280

Query  396  LNPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEIV  226
            L+P+   Y PP  +F I +  +P + K  +  A+   SI +V+ G   G  T  +S   +
Sbjct  281  LDPHVYLYDPPVPDFAIMRIEIPASIKLYLVSAMDSASILLVIQGTAVGTSTAAASEMAL  340

Query  225  AEGDVLFSPANTNTAV  178
              G VLF  AN + ++
Sbjct  341  HRGSVLFVSANESISL  356



>ref|XP_003967298.1| PREDICTED: mannose-6-phosphate isomerase-like [Takifugu rubripes]
Length=440

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 98/260 (38%), Positives = 145/260 (56%), Gaps = 13/260 (5%)
 Frame = -1

Query  891  LQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvskliSR  712
            L +VPE   +VGN   E+L    E   A + +L L+  FT++M+  K V    ++ L+ R
Sbjct  179  LHSVPEFRALVGNEAAEELQCSVED--AVHTRLVLKNCFTRMMNCEKKVFVDQLNMLVKR  236

Query  711  LNKKNE--QRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYL  538
            + ++    +        L+LRL  QYP D+G  + F  NH+ L+PG+A++LGANEPHAY+
Sbjct  237  VTEEGAAAKDTSSSNGDLLLRLHSQYPGDIGCFSIFFLNHIMLEPGQAMFLGANEPHAYI  296

Query  537  LGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYK--QGFPEILKG--NALNPYTTRYL  370
             G+CIECMA SDN VRAGLTPK++DV TLC ML Y       +I  G  +  +P  T Y 
Sbjct  297  YGDCIECMACSDNTVRAGLTPKYIDVNTLCEMLNYSPAPAASKIFLGVPDGADPCVTVYD  356

Query  369  PPFEEFEIDQC-ILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS--SNEIVAEGDVLFSP  199
            PP  +F + +  I P   +     V   SI +V  G    T  +  S  ++  G VLF  
Sbjct  357  PPVPDFSVLRIQIPPSLLQYTISPVDSASILLVTEGHATATCATGLSEIMLRRGTVLFVS  416

Query  198  ANTNTAV--ATTLGLSLFRA  145
            AN + ++   + +G+++FRA
Sbjct  417  ANESISLEEVSPVGVTMFRA  436



>ref|XP_007379255.1| mannos-6-phosphate isomerase [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN14338.1| mannos-6-phosphate isomerase [Punctularia strigosozonata HHB-11173 
SS5]
Length=422

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 105/271 (39%), Positives = 144/271 (53%), Gaps = 17/271 (6%)
 Frame = -1

Query  891  LQTVPEIAEVVGNAYIEQLINL---KEQDGAENAKLTLRLLFTKLMssskdviskvvskl  721
            L+  PE A +V     ++LI+      +DGA+  K  LR +FT +M++ + +  + +S L
Sbjct  160  LEDSPEFAALVPPEDRQKLIDSTTPSAEDGAQQ-KAALRAVFTAVMTAPEHLFKEQLSLL  218

Query  720  iSRLNKKN--EQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
            I R       +     + ++LVLRL  Q+P D+G+  AF+ N+VKL PGEA++LGA EPH
Sbjct  219  IQRYTSSAGVQPTPPDDLKELVLRLHSQFPGDIGIFCAFMLNYVKLTPGEAIFLGAGEPH  278

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTY--KQGFPEILK-GNALNPYTTR  376
            AY+ G+ +ECMATSDNV+RAGLTPK  DV  L S LTY        ++K     +  T  
Sbjct  279  AYVSGDIVECMATSDNVIRAGLTPKLRDVPNLVSGLTYVAAPSSKHVVKPATGPSGATKL  338

Query  375  YLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPA  196
            Y PP  EF + Q +LP  A    PA+ GPSI I   G G +T P     +  G+V F  A
Sbjct  339  YDPPVPEFAVLQTVLPAGASEEHPALDGPSIAIATHGRGKLTWPDGETEINTGEVFFVGA  398

Query  195  NTNTAVATTLGLSLFRAGIXQYVFCRKITEA  103
             T         L L   G    V  R   EA
Sbjct  399  GTP--------LRLTSQGEADLVLHRAFVEA  421



>ref|XP_002593357.1| hypothetical protein BRAFLDRAFT_261743 [Branchiostoma floridae]
 gb|EEN49368.1| hypothetical protein BRAFLDRAFT_261743, partial [Branchiostoma 
floridae]
Length=425

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 97/266 (36%), Positives = 145/266 (55%), Gaps = 12/266 (5%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   L+ V E   VVG+   E L+  +     +     ++  FT LM+  KD ++K +S
Sbjct  156  EIVGFLKGVAEFQAVVGSEAAEALMTAQSSGQPDQVSQAMQRCFTALMTCDKDTVAKQLS  215

Query  726  kliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPH  547
             L+ RL K+ +       ++L  RL  Q+P DVG    F  NH++L+PGEA++LG N+PH
Sbjct  216  SLLDRLAKQGDVAMSDSNKELFQRLHSQFPGDVGCFVIFFLNHMRLQPGEAMFLGPNKPH  275

Query  546  AYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPE----ILKGNALNPYTT  379
            AYL G+C+ECMA SDNVVRAGLTPK++DV TLC ML Y    P+      + +  +   +
Sbjct  276  AYLSGDCMECMACSDNVVRAGLTPKYIDVSTLCEMLDYVPSSPQQQIFQCQNHPTDSSVS  335

Query  378  RYLPPFEEFEIDQCILP----RAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEI---VAE  220
             Y PP  +F + +  +P    +       AV   SI + + GEG  TT S  E     + 
Sbjct  336  IYNPPVPDFAVAKIQIPSDCTQPCSYTLEAVDSASIILTIEGEGEGTTASVTEHKVKFSR  395

Query  219  GDVLFSPANTNTAVAT-TLGLSLFRA  145
            G V+F  AN +  ++  + G+ +FRA
Sbjct  396  GSVVFVSANQSVNISCRSKGMLMFRA  421



>gb|AFR97043.2| mannose-6-phosphate isomerase [Cryptococcus neoformans var. grubii 
H99]
Length=434

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 142/272 (52%), Gaps = 28/272 (10%)
 Frame = -1

Query  885  TVPEIAEVVGNAYIEQLINL----------------KEQDGAENAKLTLRLLFTKLMsss  754
            TVPE+ E V ++  E L +                  E       K  L+ +F  LMS+ 
Sbjct  162  TVPELQEFVDSSLTESLASSLDLPTSQPPDSSLFKPTESPATAEQKDILKQIFAALMSAD  221

Query  753  kdviskvvskliSRLNKKNEQRNLCEKEQ----LVLRLEKQYPSDVGVLAAFLFNHVKLK  586
            K  + + +SKLI R   K   R++ E E+    L LRL  QYP DVGVL  FL N V+LK
Sbjct  222  KKHVEEAISKLIKRYKAK---RDIKENEKDLVDLALRLNDQYPGDVGVLCVFLLNVVELK  278

Query  585  PGEALYLGANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQ--GFPEI  412
             GEA +LGANEPHAY+ G  IECMATSDNVVRAGLTPK  DV TL SMLTY+   G  ++
Sbjct  279  RGEAAFLGANEPHAYIEGNIIECMATSDNVVRAGLTPKLRDVDTLVSMLTYEAAPGNKQL  338

Query  411  LKGNAL---NPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS  241
            L+  +    +  T  Y PP  EF + +  L +  K     V GPS+ ++  GEG +   +
Sbjct  339  LQPTSFQKGDDTTKLYDPPIAEFSVLRTELSKGMKTSHRPVEGPSLCVITEGEGVVRDGN  398

Query  240  SNEIVAEGDVLFSPANTNTAVATTLGLSLFRA  145
                   GDV+F  A          GL +FRA
Sbjct  399  DQTEFVRGDVIFVGAGKEVEWEAIKGLEMFRA  430



>ref|XP_773772.1| hypothetical protein CNBH2250 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL19125.1| hypothetical protein CNBH2250 [Cryptococcus neoformans var. neoformans 
B-3501A]
Length=434

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 143/272 (53%), Gaps = 28/272 (10%)
 Frame = -1

Query  885  TVPEIAEVVGNAYIEQLINL----------------KEQDGAENAKLTLRLLFTKLMsss  754
            TVPE+ E V ++  E L +                  E       K  L+ +F  LMS+ 
Sbjct  162  TVPELQEFVDSSLTESLASSLGLPTSQPPDTSLFKPTESPATAEQKDILKQIFAALMSAD  221

Query  753  kdviskvvskliSRLNKKNEQRNLCEKEQ----LVLRLEKQYPSDVGVLAAFLFNHVKLK  586
            K ++ + +SKLI R   K   R++ E E+    L LRL  QYP DVGVL  FL N V+LK
Sbjct  222  KKLVEEAISKLIKRYQAK---RDIKENEKSLVDLALRLNDQYPGDVGVLCVFLLNVVELK  278

Query  585  PGEALYLGANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQ--GFPEI  412
             GEA +LGANEPHAY+ G+ IECMATSDNVVRAGLTPK  DV TL SMLTY+   G  ++
Sbjct  279  RGEAAFLGANEPHAYIEGDIIECMATSDNVVRAGLTPKLRDVDTLVSMLTYEAAPGNKQL  338

Query  411  LKGNAL---NPYTTRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPS  241
            L+       +  T  Y PP  EF + +  L +  K     V GPS+ ++  GEG +   +
Sbjct  339  LQPTPFQKGDDTTKLYDPPIAEFSVLRTELSKGMKTSHRPVEGPSLCVITEGEGVVRNGN  398

Query  240  SNEIVAEGDVLFSPANTNTAVATTLGLSLFRA  145
                   GDV+F  A          GL +FRA
Sbjct  399  DRTEFVRGDVIFVGAGKEVEWEAIKGLEMFRA  430



>ref|XP_006782484.1| PREDICTED: mannose-6-phosphate isomerase-like isoform X1 [Neolamprologus 
brichardi]
Length=422

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 99/267 (37%), Positives = 148/267 (55%), Gaps = 17/267 (6%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   L+ VPE   +VG+   ++L        A+     L+  FT++M   K V+ + ++
Sbjct  156  EILEFLEKVPEFHTLVGHGAAQEL--RASVGDADRTSQALKRCFTRMMDWEKKVVVENLN  213

Query  726  kliSRLNKKNEQRNLCE--KEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
            +L+ R+ +              L+LRL  QYP D+G  + +  NHV L PG+A++LGANE
Sbjct  214  ELVKRVTEDAAAGKDTSGISGDLLLRLHSQYPGDIGCFSIYFLNHVVLNPGQAMFLGANE  273

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGNALN  391
            PHAYL G+CIECMA SDN VRAGLTPK++DV TLC ML Y         FP +   +  +
Sbjct  274  PHAYLYGDCIECMACSDNTVRAGLTPKYIDVNTLCEMLNYSPAPASSKIFPCL--QDPSD  331

Query  390  PYTTRYLPPFEEFEIDQCILPRAAKAVFPA-VPGPSIFIVMAGEGAMTTPS--SNEIVAE  220
            P  + Y PP  +F + +  +P + K    A V   SI +V+ GE   T+P+  S+  +  
Sbjct  332  PCVSIYNPPVPDFTVMRIQIPASVKQYNIAPVDSASILLVIEGEATGTSPAALSDLTLTR  391

Query  219  GDVLFSPANTNTA--VATTLGLSLFRA  145
            G VLF  AN + +  + +  G++LFRA
Sbjct  392  GSVLFVSANESISLHITSQSGMTLFRA  418



>ref|XP_005731511.1| PREDICTED: mannose-6-phosphate isomerase-like [Pundamilia nyererei]
 ref|XP_005931723.1| PREDICTED: mannose-6-phosphate isomerase-like [Haplochromis burtoni]
Length=422

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 100/270 (37%), Positives = 150/270 (56%), Gaps = 23/270 (9%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLT---LRLLFTKLMssskdvisk  736
            E+   L+ VPE   +VG+   ++L     + G  +A  T   L+  FT++M   K V+ +
Sbjct  156  EILEFLEKVPEFHTLVGHGAAQEL-----RGGVGDADRTSQALKRCFTRMMDWEKKVVVE  210

Query  735  vvskliSRLNKKNEQRNLCE--KEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             +++L+ R+ +              L+LRL  QYP D+G  + +  NHV L PG+A++LG
Sbjct  211  NLNELVKRVTEDAAAGKDTSGISGDLLLRLHSQYPGDIGCFSIYFLNHVVLNPGQAMFLG  270

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGN  400
            ANEPHAYL G+CIECMA SDN VRAGLTPK++DV TLC ML Y         FP +   +
Sbjct  271  ANEPHAYLYGDCIECMACSDNTVRAGLTPKYIDVNTLCEMLNYSPAPASSKIFPCL--QD  328

Query  399  ALNPYTTRYLPPFEEFEIDQCILPRAAKAV-FPAVPGPSIFIVMAGEGAMTTPS--SNEI  229
              +P  + Y PP  +F + +  +P + K      V   SI +V+ GE   T+P+  S+  
Sbjct  329  PSDPCVSIYNPPVPDFTVMRIQIPASVKQYNISPVDSASILLVIEGEATGTSPAALSDLT  388

Query  228  VAEGDVLFSPANTNTA--VATTLGLSLFRA  145
            +  G VLF  AN + +  + +  G++LFRA
Sbjct  389  LTRGSVLFVSANESVSLHITSQSGMTLFRA  418



>ref|XP_008289753.1| PREDICTED: mannose-6-phosphate isomerase [Stegastes partitus]
Length=422

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 101/267 (38%), Positives = 149/267 (56%), Gaps = 17/267 (6%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   L++VPE   +VGN   E+L      D     +  L+  FT++M+  K V    ++
Sbjct  156  EILGFLKSVPEFHALVGNEAAEEL-RCSMGDAVRTGQ-ALKKCFTRMMNCEKKVFVDQLN  213

Query  726  kliSRLNKKN--EQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
             L+ R+ ++   E+        L+LRL  QYP D+G  + +  NH+ L PG+A++LGANE
Sbjct  214  MLVKRVTEEGAAEKDTSSSNGDLLLRLHSQYPGDIGCFSIYFLNHMLLDPGQAMFLGANE  273

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGNALN  391
            PHAYL G+CIECMA SDN VRAGLTPK++DV TLC ML Y         FP +   +A +
Sbjct  274  PHAYLYGDCIECMACSDNTVRAGLTPKYIDVNTLCEMLNYSPAPAASKIFPCV--EDASD  331

Query  390  PYTTRYLPPFEEFEIDQCILPRAAKAVFPA-VPGPSIFIVMAGEGAMTTPSSNEIVA--E  220
            P  T Y PP  +F + +  +P + K    A V   SI +V+ GE   T+ ++   +    
Sbjct  332  PCVTLYDPPVPDFTVMRIQVPASMKQYIVAPVDSASILLVIEGEATATSAAALSDITLRR  391

Query  219  GDVLFSPANTNTA--VATTLGLSLFRA  145
            G VLF  AN + +  + +  G++LFRA
Sbjct  392  GTVLFVSANESVSLHITSQTGMTLFRA  418



>ref|XP_003455422.1| PREDICTED: mannose-6-phosphate isomerase-like [Oreochromis niloticus]
Length=422

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 99/267 (37%), Positives = 148/267 (55%), Gaps = 17/267 (6%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   L+ VPE   +VG+   ++L        A+     L+  FT++M   K V+ + ++
Sbjct  156  EILEFLEKVPEFHTLVGHGAAQEL--RASVGDADRTSQALKRCFTRMMDWEKKVVVENLN  213

Query  726  kliSRLNKKNEQRNLCE--KEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
            +L+ R+ +              L+LRL  QYP D+G  + +  NHV L PG+A++LGANE
Sbjct  214  ELVKRVTEDAAAGKDTSGINGDLLLRLHSQYPGDIGCFSIYFLNHVVLNPGQAMFLGANE  273

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGNALN  391
            PHAYL G+CIECMA SDN VRAGLTPK++DV TLC ML Y         FP +   +  +
Sbjct  274  PHAYLYGDCIECMACSDNTVRAGLTPKYIDVNTLCEMLNYSPAPASSKIFPCL--QDPSD  331

Query  390  PYTTRYLPPFEEFEIDQCILPRAAKAVFPA-VPGPSIFIVMAGEGAMTTPS--SNEIVAE  220
            P  + Y PP  +F + +  +P + K    A V   SI +V+ GE   T+P+  S+  +  
Sbjct  332  PCVSIYNPPVPDFTVMRIQIPASVKQYNIAPVDSASILLVIEGEATGTSPAALSDLTLMR  391

Query  219  GDVLFSPANTNTA--VATTLGLSLFRA  145
            G VLF  AN + +  + +  G++LFRA
Sbjct  392  GSVLFVSANESVSLHITSQSGMTLFRA  418



>ref|XP_001630002.1| predicted protein [Nematostella vectensis]
 gb|EDO37939.1| predicted protein [Nematostella vectensis]
Length=366

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 107/264 (41%), Positives = 147/264 (56%), Gaps = 16/264 (6%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+K  LQ+VPE+A V+G      L  L   D A   +  ++  F+ LM+  +  ++K +S
Sbjct  104  EIKEFLQSVPELASVIGEQPCALL--LGSNDKASECE-GIKQCFSSLMTRDEIAVTKHLS  160

Query  726  kliSRLN--KKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
            +L+ R+   K  E         L L L  Q+P DVG    +  NHV LKPG+A++LG N 
Sbjct  161  ELLDRIKTMKSAEIDVTGCLGDLFLSLHGQFPGDVGCFCIYFLNHVMLKPGQAMFLGPNL  220

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGNALN  391
            PHAYL G+C+ECMA SDNVVRAGLTPK+ DV+TLC ML Y  G      FP  L  +  +
Sbjct  221  PHAYLSGDCMECMACSDNVVRAGLTPKYKDVQTLCDMLDYSPGTAEDNIFPSQL--DPED  278

Query  390  PYTTRYLPPFEEFEIDQCILPRA-AKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGD  214
             +   Y PP ++F + +  LP + +     AV GPSI IV++G G   T    ++   G 
Sbjct  279  SHVVVYDPPVKDFSVARINLPASLSSYTVKAVEGPSILIVISGGGETLTQQPLKL-ERGA  337

Query  213  VLFSPANTNTAVAT-TLGLSLFRA  145
            VLF PA+    V T   GL +FRA
Sbjct  338  VLFMPASVELPVKTGNEGLLVFRA  361



>ref|XP_001950664.1| PREDICTED: mannose-6-phosphate isomerase isoform X1 [Acyrthosiphon 
pisum]
 ref|XP_003247282.1| PREDICTED: mannose-6-phosphate isomerase isoform X1 [Acyrthosiphon 
pisum]
Length=405

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 96/260 (37%), Positives = 146/260 (56%), Gaps = 11/260 (4%)
 Frame = -1

Query  912  FGELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskv  733
            + E++  L+ +PE   +VG   I+Q      +    N++  L+ +F KLM+S K +IS+ 
Sbjct  149  YSEIRFFLEEIPEFKLIVGCDLIDQF-----KKDTTNSQYLLKDIFYKLMTSEKGIISQN  203

Query  732  vskliSRLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
            +S    +L    + +      +L  +L+  YP+DVG    +  N+++L PG+A+YLGANE
Sbjct  204  LSSHKKKLQSLCDDKKNVFLAKLFNQLDCWYPNDVGCFCIYFLNYIQLSPGQAIYLGANE  263

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFP---EILKGNALNPYT  382
            PHAY+ G+CIECMA SDNVVRAGLTPK++DVKTLC +L +  G P   ++  G   N YT
Sbjct  264  PHAYIYGDCIECMACSDNVVRAGLTPKYIDVKTLCRVLNF-NGAPAESKLFCGVKENSYT  322

Query  381  TRYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFS  202
            T + PP  +F +    +P             SI IV+ G+G +T P  + I++ G V   
Sbjct  323  TLFRPPVPDFAVACIKVPADEIYELLKRDVASIIIVVHGQGKITAP-QDLILSAGKVFMV  381

Query  201  PANTNTAVATTL-GLSLFRA  145
            PAN    +      L L++A
Sbjct  382  PANVILQIHVGFESLELYQA  401



>ref|XP_002195681.1| PREDICTED: mannose-6-phosphate isomerase [Taeniopygia guttata]
Length=423

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 152/268 (57%), Gaps = 18/268 (7%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQ VPE+  ++G    EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  156  EIVSFLQNVPELRALIGEVAAEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  211

Query  735  vvskliSRLNKKNEQRNLCEKE--QLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             ++ L+ R++++  +         +L+LRL  QYP D+G    +  N V+L+PGEA++LG
Sbjct  212  QLNMLVKRISQEAAEGKDTSGSNGELLLRLHSQYPGDIGCFTIYFLNLVRLEPGEAMFLG  271

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG--FPEILKG--NAL  394
            ANEPHAYL G+C+E MA SDN VRAGLTPK +DV TLC ML Y       +IL    + L
Sbjct  272  ANEPHAYLHGDCVEIMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKILPAAQSQL  331

Query  393  NPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEIVA  223
            +P+   Y PP  +F I +  +P + K  +  A+   SI +V+ G   G  T  +S   + 
Sbjct  332  DPHVYLYDPPVPDFTIMRIEIPASVKLYLISAMDSASILLVIQGTAVGTSTAAASEMSLH  391

Query  222  EGDVLFSPANTNTA--VATTLGLSLFRA  145
             G VLF  AN + +  +++  G+ LFRA
Sbjct  392  RGSVLFVSANESISLHLSSPDGMLLFRA  419



>ref|XP_002675323.1| mannose phosphate isomerase [Naegleria gruberi]
 gb|EFC42579.1| mannose phosphate isomerase [Naegleria gruberi]
Length=373

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 90/245 (37%), Positives = 144/245 (59%), Gaps = 15/245 (6%)
 Frame = -1

Query  891  LQTVPEIAEVVGNAYIEQLINLKEQDGA-ENAKLTLRLLFTKLMssskdviskvvskliS  715
            ++++  +     N  I+ +++   +D + ++ K+ L+ LF  LM+S K ++   +  L+ 
Sbjct  123  IESLQSLLRAQNNELIDSILSNDVKDSSQDDRKIILKSLFKSLMTSPKSLVEAHLPNLV-  181

Query  714  RLNKKNEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYLL  535
                KN Q +   ++QL+LRL K Y +D+G  + +  NHV+L+PGE L+LG NEPH+YL 
Sbjct  182  ----KNLQNSTSSRDQLILRLYKDYGNDIGCFSVYFLNHVELQPGEGLFLGPNEPHSYLY  237

Query  534  GECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILK--GNALNPYTTRYLPPF  361
            G+C+ECMA+SDNVVRAGLTPK +D +TL  MLTY     E +K  G  +N + T Y  P 
Sbjct  238  GDCVECMASSDNVVRAGLTPKFIDTETLIEMLTYDDHALEKMKMGGEKVNQFETLYTTPV  297

Query  360  EEFEIDQCILPRAAKAVFPAVPGP-SIFIVMAGEGAMTTPSSNEIVAEGDVLFSPANTNT  184
             EF++ + +L +  K  +   P   +I IV+ G G +   +S     +GDVL  P N+ T
Sbjct  298  SEFKVQKIVLSKGDK--YTLTPNAITIAIVINGSGLVNGENS----KKGDVLLFPFNSKT  351

Query  183  AVATT  169
             +  +
Sbjct  352  DLENS  356



>emb|CDQ60375.1| unnamed protein product [Oncorhynchus mykiss]
Length=441

 Score =   155 bits (392),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 97/267 (36%), Positives = 152/267 (57%), Gaps = 17/267 (6%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvvs  727
            E+   L++VPE   +VG+   E+L++ + + G     L L+  FT++M+  K V    ++
Sbjct  175  EIIGFLKSVPEFHTLVGSETAEELVSSRGEAG--RTSLALKKCFTRMMNCEKKVFVDQLN  232

Query  726  kliSRLNKKNE--QRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
             L+ R+ ++    +       +L+LRL  QYP D+G  + +  N + L+PG+A++LGANE
Sbjct  233  MLVKRVTEEAAAGKDTSDSNSELLLRLHSQYPGDIGCFSIYFLNRIVLEPGDAMFLGANE  292

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGNALN  391
            PHAYL G+CIECMA SDN VRAGLTPK +DV TLC ML Y         FP I   +  +
Sbjct  293  PHAYLNGDCIECMACSDNTVRAGLTPKFIDVNTLCEMLNYSPAPASAKIFPSI--QDPSD  350

Query  390  PYTTRYLPPFEEFEIDQCILPRAAKAVFPA-VPGPSIFIVMAGEGAMTTPS--SNEIVAE  220
            P+   Y PP  +F + +  +P + +    A V    I +V+ GE   TT +  S+  ++ 
Sbjct  351  PFVYLYDPPVPDFTVMRIQVPDSVRQYTVAPVDCAGILLVIEGEATGTTAAALSDITLSR  410

Query  219  GDVLFSPANTNTAVATT--LGLSLFRA  145
            G VLF  AN + ++  T   G++++RA
Sbjct  411  GTVLFISANESVSLHITSPSGMTMYRA  437



>ref|XP_009705978.1| PREDICTED: mannose-6-phosphate isomerase [Cariama cristata]
Length=287

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 143/260 (55%), Gaps = 22/260 (8%)
 Frame = -1

Query  882  VPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdviskvvskliSR  712
            VPE+  ++G   +EQL    E+ G+++ +     LR+ FT+LM S K      ++ L+ R
Sbjct  32   VPELRALIGEVAVEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFIDQLNMLVKR  87

Query  711  LNKK--NEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANEPHAYL  538
            ++++  + +        ++LRL  QYP D+G    +  N V+L+PGEA++LGANEPHAYL
Sbjct  88   ISQEGGSSKHTSGSNGDVLLRLHSQYPGDIGCFTIYFLNLVRLEPGEAMFLGANEPHAYL  147

Query  537  LGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQG------FPEILKGNALNPYTTR  376
             G+C+ECMA SDN VRAGLTPK +DV TLC ML Y         FP     + L+P    
Sbjct  148  HGDCVECMACSDNTVRAGLTPKFIDVLTLCEMLNYTPAPSSSKIFPA--AQSQLDPSIYL  205

Query  375  YLPPFEEFEIDQC-ILPRAAKAVFPAVPGPSIFIVMAGE--GAMTTPSSNEIVAEGDVLF  205
            Y PP  +F I +  ILP     +  A+   SI +V+ G   G  T  +S   +  G VLF
Sbjct  206  YDPPVPDFAIMRIEILPSIKLYLISAMDSASILLVIQGTAVGTSTAAASEMTLRRGSVLF  265

Query  204  SPANTNTAVATTLGLSLFRA  145
              A  N +++  L    FRA
Sbjct  266  ISA--NESISLHLSSPDFRA  283



>ref|XP_001695020.1| mannose-6-phosphate isomerase [Chlamydomonas reinhardtii]
 gb|EDP02172.1| mannose-6-phosphate isomerase, partial [Chlamydomonas reinhardtii]
Length=365

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 123/220 (56%), Gaps = 4/220 (2%)
 Frame = -1

Query  909  GELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvv  730
             EL+  L   PE+A +VG   +  L  L      ++     +  FT LM++    +++ V
Sbjct  145  AELQARLAATPELAGLVGAEQVAALAALPAGAAGQDHPAAKQSAFTHLMTAPPAAVTEAV  204

Query  729  skliSRLNKKNEQRN-LCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
              L++RL         L E E L LRL  Q+P DVG+ +AF  N V+L  G A+YL ANE
Sbjct  205  RSLVARLEAAQAAGAALSEHEALALRLNAQFPDDVGIFSAFFLNIVRLPAGSAIYLPANE  264

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTT--  379
            PHAYL GE +ECMA SDNV+RAGLTPK      LC  LTY+QG P++L+G+   P  +  
Sbjct  265  PHAYLAGELVECMAASDNVIRAGLTPKFKHADVLCESLTYRQGLPDVLEGSPAGPGGSVR  324

Query  378  RYLPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEG  259
             Y PPFEEFE+ Q +     +    A  GP I +V AGE 
Sbjct  325  VYQPPFEEFEL-QKLEVSGGEVALAASQGPRILLVTAGEA  363



>ref|XP_009096484.1| PREDICTED: mannose-6-phosphate isomerase isoform X1 [Serinus 
canaria]
Length=373

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 101/269 (38%), Positives = 151/269 (56%), Gaps = 20/269 (7%)
 Frame = -1

Query  906  ELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAK---LTLRLLFTKLMssskdvisk  736
            E+   LQ VPE+  ++G    EQL    E+ G+++ +     LR+ FT+LM S K     
Sbjct  106  EIVSFLQNVPELRALIGEVAAEQL----ERSGSDDPRGVSAALRVCFTRLMKSEKKFFVD  161

Query  735  vvskliSRLNKK--NEQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLG  562
             ++ L+ R++++    +       +L+LRL  QYP D+G    +  N V+L+PGEA++LG
Sbjct  162  QLNMLVKRISQEVAEGKDTAGSNGELLLRLHSQYPGDIGCFTIYFLNLVRLEPGEAMFLG  221

Query  561  ANEPHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILK-----GNA  397
            ANEPHAYL G+C+E MA SDN VRAGLTPK +DV TLC ML Y    P   K      + 
Sbjct  222  ANEPHAYLHGDCVEVMACSDNTVRAGLTPKFIDVLTLCEMLNYTPA-PSSSKILPVAQSQ  280

Query  396  LNPYTTRYLPPFEEFEIDQCILPRAAKA-VFPAVPGPSIFIVMAGE--GAMTTPSSNEIV  226
            L+P+   Y PP  +F + +  +P + K  +  A+   SI +V+ G   G  T  +S   +
Sbjct  281  LDPHVYLYDPPVPDFTVMRIEIPASIKLYLISAMDSASILLVIQGTAVGTSTAAASEMSL  340

Query  225  AEGDVLFSPANTNTA--VATTLGLSLFRA  145
              G VLF  AN + +  +++  G+ LFRA
Sbjct  341  HRGSVLFVSANESISLHLSSPDGMLLFRA  369



>emb|CCI46765.1| unnamed protein product [Albugo candida]
Length=397

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 136/240 (57%), Gaps = 10/240 (4%)
 Frame = -1

Query  909  GELKVVLQTVPEIAEVVGNAYIEQLINLKEQDGAENAKLTLRLLFTKLMssskdviskvv  730
             E+   L+TV E  E+V    ++QL+  K+Q+        L++ F   M+    +I   V
Sbjct  145  SEISTFLETVVEFRELVQPQIVQQLVAKKDQEA-------LKIFFEAFMNVDTQIIEAQV  197

Query  729  skliSRLNKKN-EQRNLCEKEQLVLRLEKQYPSDVGVLAAFLFNHVKLKPGEALYLGANE  553
            +K++ RLN  +  Q ++ EK  LVLRL   +P+D+G    FL N+++LKPGEA++L +NE
Sbjct  198  NKIVGRLNAVSVSQHSMVEK--LVLRLHAAFPNDIGCFCPFLLNYLELKPGEAIFLASNE  255

Query  552  PHAYLLGECIECMATSDNVVRAGLTPKHLDVKTLCSMLTYKQGFPEILKGNALNPYTTRY  373
            PHAYL G+C+ECMA SDNV+RA LT K +D  TLC +LTY  G P + +G  ++     Y
Sbjct  256  PHAYLSGDCVECMACSDNVIRAALTSKLVDKVTLCELLTYSTGLPTVQQGQQIDDKYRLY  315

Query  372  LPPFEEFEIDQCILPRAAKAVFPAVPGPSIFIVMAGEGAMTTPSSNEIVAEGDVLFSPAN  193
                 EF++++  +P  +    P     SI +++ G G +   S+   + +G V    AN
Sbjct  316  TSIVPEFQVERYDIPSHSTYDVPIRKAASILLILQGTGRLRGESAEFSIQQGKVFLVSAN  375



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2065028817815