BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF040L16

Length=816
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07966.1|  unnamed protein product                                297   1e-92   Coffea canephora [robusta coffee]
gb|ABK95746.1|  unknown                                                 280   2e-91   Populus trichocarpa [western balsam poplar]
ref|XP_009801460.1|  PREDICTED: pentatricopeptide repeat-containi...    292   3e-90   Nicotiana sylvestris
emb|CBI27495.3|  unnamed protein product                                289   4e-90   Vitis vinifera
ref|XP_002269531.1|  PREDICTED: pentatricopeptide repeat-containi...    290   1e-89   Vitis vinifera
emb|CBI24106.3|  unnamed protein product                                288   1e-89   Vitis vinifera
ref|XP_002273494.2|  PREDICTED: pentatricopeptide repeat-containi...    287   8e-89   Vitis vinifera
ref|XP_004237182.2|  PREDICTED: pentatricopeptide repeat-containi...    288   1e-88   Solanum lycopersicum
ref|XP_009601923.1|  PREDICTED: pentatricopeptide repeat-containi...    286   2e-88   Nicotiana tomentosiformis
ref|XP_002521865.1|  pentatricopeptide repeat-containing protein,...    281   4e-88   
ref|XP_011021682.1|  PREDICTED: pentatricopeptide repeat-containi...    280   6e-88   Populus euphratica
ref|XP_002314741.2|  hypothetical protein POPTR_0010s10900g             282   6e-87   
ref|XP_010270795.1|  PREDICTED: pentatricopeptide repeat-containi...    283   6e-87   Nelumbo nucifera [Indian lotus]
ref|XP_006470889.1|  PREDICTED: pentatricopeptide repeat-containi...    280   3e-86   Citrus sinensis [apfelsine]
ref|XP_006420692.1|  hypothetical protein CICLE_v10004581mg             280   5e-86   Citrus clementina [clementine]
ref|XP_011021681.1|  PREDICTED: pentatricopeptide repeat-containi...    280   8e-86   Populus euphratica
gb|KDO57832.1|  hypothetical protein CISIN_1g007461mg                   278   2e-85   Citrus sinensis [apfelsine]
gb|KDP38220.1|  hypothetical protein JCGZ_04863                         270   2e-84   Jatropha curcas
ref|XP_007015128.1|  Pentatricopeptide repeat superfamily protein...    275   4e-84   
ref|XP_004151188.1|  PREDICTED: pentatricopeptide repeat-containi...    272   6e-83   Cucumis sativus [cucumbers]
ref|XP_004172063.1|  PREDICTED: pentatricopeptide repeat-containi...    272   6e-83   
ref|XP_008465506.1|  PREDICTED: pentatricopeptide repeat-containi...    271   8e-83   Cucumis melo [Oriental melon]
ref|XP_010043883.1|  PREDICTED: pentatricopeptide repeat-containi...    271   1e-82   Eucalyptus grandis [rose gum]
ref|XP_003555735.1|  PREDICTED: pentatricopeptide repeat-containi...    271   2e-82   Glycine max [soybeans]
ref|XP_011090005.1|  PREDICTED: pentatricopeptide repeat-containi...    271   2e-82   Sesamum indicum [beniseed]
gb|KHN38588.1|  Pentatricopeptide repeat-containing protein, chlo...    270   5e-82   Glycine soja [wild soybean]
ref|XP_003529243.2|  PREDICTED: pentatricopeptide repeat-containi...    270   9e-82   Glycine max [soybeans]
ref|XP_008778816.1|  PREDICTED: pentatricopeptide repeat-containi...    268   1e-81   Phoenix dactylifera
gb|KJB35742.1|  hypothetical protein B456_006G126500                    263   2e-81   Gossypium raimondii
ref|XP_007222296.1|  hypothetical protein PRUPE_ppa003348mg             266   1e-80   
ref|XP_010668078.1|  PREDICTED: pentatricopeptide repeat-containi...    266   2e-80   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX91096.1|  BnaC02g05010D                                          265   2e-80   
ref|XP_007153172.1|  hypothetical protein PHAVU_003G013000g             265   3e-80   Phaseolus vulgaris [French bean]
ref|XP_002871585.1|  pentatricopeptide repeat-containing protein        265   3e-80   Arabidopsis lyrata subsp. lyrata
dbj|BAB10598.1|  unnamed protein product                                263   4e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008220989.1|  PREDICTED: pentatricopeptide repeat-containi...    265   4e-80   Prunus mume [ume]
gb|KJB35743.1|  hypothetical protein B456_006G126500                    263   6e-80   Gossypium raimondii
ref|NP_196881.2|  pentatricopeptide repeat-containing protein           264   8e-80   Arabidopsis thaliana [mouse-ear cress]
gb|KHN48767.1|  Pentatricopeptide repeat-containing protein, chlo...    252   8e-80   Glycine soja [wild soybean]
gb|KFK25604.1|  hypothetical protein AALP_AA8G136200                    263   1e-79   Arabis alpina [alpine rockcress]
ref|XP_009125945.1|  PREDICTED: pentatricopeptide repeat-containi...    264   1e-79   Brassica rapa
ref|XP_010492155.1|  PREDICTED: pentatricopeptide repeat-containi...    263   2e-79   Camelina sativa [gold-of-pleasure]
ref|XP_006576030.1|  PREDICTED: pentatricopeptide repeat-containi...    252   3e-79   Glycine max [soybeans]
ref|XP_006289562.1|  hypothetical protein CARUB_v10003108mg             262   3e-79   Capsella rubella
ref|XP_009351650.1|  PREDICTED: pentatricopeptide repeat-containi...    261   1e-78   Pyrus x bretschneideri [bai li]
ref|XP_010453475.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    260   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_006399876.1|  hypothetical protein EUTSA_v10016019mg             260   2e-78   Eutrema salsugineum [saltwater cress]
ref|XP_010547300.1|  PREDICTED: pentatricopeptide repeat-containi...    257   4e-77   Tarenaya hassleriana [spider flower]
ref|XP_009400607.1|  PREDICTED: pentatricopeptide repeat-containi...    257   4e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004298632.1|  PREDICTED: pentatricopeptide repeat-containi...    256   1e-76   Fragaria vesca subsp. vesca
ref|XP_008340510.1|  PREDICTED: pentatricopeptide repeat-containi...    255   1e-76   Malus domestica [apple tree]
gb|EYU36097.1|  hypothetical protein MIMGU_mgv1a020159mg                254   1e-76   Erythranthe guttata [common monkey flower]
ref|XP_006853735.1|  hypothetical protein AMTR_s00056p00173630          254   4e-76   Amborella trichopoda
ref|XP_006420695.1|  hypothetical protein CICLE_v10006779mg             248   5e-76   
ref|XP_004498165.1|  PREDICTED: pentatricopeptide repeat-containi...    254   8e-76   Cicer arietinum [garbanzo]
gb|KEH40726.1|  PPR containing plant-like protein                       252   2e-75   Medicago truncatula
ref|XP_011025175.1|  PREDICTED: pentatricopeptide repeat-containi...    235   6e-69   Populus euphratica
ref|XP_002312498.2|  hypothetical protein POPTR_0008s14240g             235   7e-69   
emb|CCI55317.1|  PH01B001I13.13                                         234   3e-68   Phyllostachys edulis [kikko-chiku]
ref|NP_001174064.1|  Os04g0583150                                       231   3e-67   
gb|EAY95290.1|  hypothetical protein OsI_17116                          231   3e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_008350824.1|  PREDICTED: pentatricopeptide repeat-containi...    230   3e-67   
gb|EMT31983.1|  hypothetical protein F775_29312                         227   8e-66   
ref|NP_001142291.1|  uncharacterized protein LOC100274460               221   2e-65   Zea mays [maize]
ref|XP_006652694.1|  PREDICTED: pentatricopeptide repeat-containi...    224   8e-65   Oryza brachyantha
ref|XP_004976594.1|  PREDICTED: pentatricopeptide repeat-containi...    223   3e-64   Setaria italica
gb|ACG27989.1|  hypothetical protein                                    223   3e-64   Zea mays [maize]
ref|XP_003580383.1|  PREDICTED: pentatricopeptide repeat-containi...    222   5e-64   Brachypodium distachyon [annual false brome]
tpg|DAA36322.1|  TPA: hypothetical protein ZEAMMB73_184989              221   1e-63   
emb|CAN71209.1|  hypothetical protein VITISV_030057                     171   7e-50   Vitis vinifera
gb|KDO42183.1|  hypothetical protein CISIN_1g044084mg                   177   3e-49   Citrus sinensis [apfelsine]
dbj|BAD95045.1|  putative protein                                       160   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001783392.1|  predicted protein                                  137   2e-33   
ref|XP_009782000.1|  PREDICTED: pentatricopeptide repeat-containi...    105   5e-22   Nicotiana sylvestris
ref|XP_009781997.1|  PREDICTED: pentatricopeptide repeat-containi...    105   6e-22   Nicotiana sylvestris
ref|XP_009625746.1|  PREDICTED: pentatricopeptide repeat-containi...    102   8e-21   Nicotiana tomentosiformis
emb|CDP08449.1|  unnamed protein product                                102   8e-21   Coffea canephora [robusta coffee]
ref|XP_009625742.1|  PREDICTED: pentatricopeptide repeat-containi...    102   9e-21   Nicotiana tomentosiformis
ref|XP_004237581.1|  PREDICTED: pentatricopeptide repeat-containi...  95.5    2e-18   Solanum lycopersicum
ref|XP_011090170.1|  PREDICTED: pentatricopeptide repeat-containi...  95.5    2e-18   
gb|AIU48580.1|  tetratricopeptide repeat-like superfamily protein     93.6    3e-18   Houttuynia cordata [chameleon-plant]
gb|AHC02098.1|  pentatricopeptide repeat-containing protein 123       92.8    4e-18   Aloysia polygalifolia
ref|XP_010936410.1|  PREDICTED: pentatricopeptide repeat-containi...  94.0    6e-18   Elaeis guineensis
gb|AHC02090.1|  pentatricopeptide repeat-containing protein 123       91.3    7e-18   Aloysia gratissima
gb|AHC02101.1|  pentatricopeptide repeat-containing protein 123       91.3    8e-18   Aloysia scorodonioides
gb|AHC02095.1|  pentatricopeptide repeat-containing protein 123       91.3    8e-18   Aloysia looseri
gb|AHC02079.1|  pentatricopeptide repeat-containing protein 123       91.3    9e-18   Aloysia peruviana
gb|AHC02094.1|  pentatricopeptide repeat-containing protein 123       91.3    9e-18   Aloysia hatschbachii
gb|AHC02092.1|  pentatricopeptide repeat-containing protein 123       90.9    1e-17   Aloysia pulchra
gb|AHC02080.1|  pentatricopeptide repeat-containing protein 123       91.3    1e-17   Aloysia axillaris
gb|AHC02103.1|  pentatricopeptide repeat-containing protein 123       91.3    1e-17   Aloysia scorodonioides
gb|AHC02085.1|  pentatricopeptide repeat-containing protein 123       91.3    1e-17   Aloysia chamaedryfolia
gb|AHC02097.1|  pentatricopeptide repeat-containing protein 123       91.3    1e-17   Aloysia macrostachya
gb|ACU25763.1|  pentatricopeptide repeat-containing protein           91.3    1e-17   Aloysia virgata
gb|AHC02105.1|  pentatricopeptide repeat-containing protein 123       91.3    1e-17   Aloysia scorodonioides
gb|AHC02100.1|  pentatricopeptide repeat-containing protein 123       91.3    1e-17   Aloysia pulchra
gb|AFV61114.1|  pentatricopeptide repeat-containing protein 123       91.3    1e-17   Aloysia lycioides
gb|AHC02096.1|  pentatricopeptide repeat-containing protein 123       91.3    1e-17   Aloysia lycioides
gb|AHC02087.1|  pentatricopeptide repeat-containing protein 123       91.3    1e-17   Aloysia dusenii
gb|AHC02084.1|  pentatricopeptide repeat-containing protein 123       91.3    1e-17   Aloysia chamaedryfolia
gb|AHC02107.1|  pentatricopeptide repeat-containing protein 123       91.3    1e-17   Aloysia wrightii
gb|AHC02091.1|  pentatricopeptide repeat-containing protein 123       91.3    2e-17   Aloysia gratissima
gb|AHC02088.1|  pentatricopeptide repeat-containing protein 123       91.3    2e-17   Aloysia dusenii
gb|AHC02106.1|  pentatricopeptide repeat-containing protein 123       91.3    2e-17   Aloysia wrightii
gb|AHC02102.1|  pentatricopeptide repeat-containing protein 123       90.9    2e-17   Aloysia virgata
ref|XP_008790326.1|  PREDICTED: pentatricopeptide repeat-containi...  92.0    2e-17   
gb|ACU25762.1|  pentatricopeptide repeat-containing protein           90.9    2e-17   Xeroaloysia ovatifolia
gb|AFV61154.1|  pentatricopeptide repeat-containing protein 123       90.9    2e-17   Xeroaloysia ovatifolia
gb|ACU25764.1|  pentatricopeptide repeat-containing protein           90.5    2e-17   Dipyrena glaberrima
ref|XP_006338777.1|  PREDICTED: pentatricopeptide repeat-containi...  92.0    3e-17   
gb|KDP42575.1|  hypothetical protein JCGZ_24349                       90.9    3e-17   Jatropha curcas
gb|AFV61115.1|  pentatricopeptide repeat-containing protein 123       90.5    3e-17   Aloysia macrostachya
gb|AHC02093.1|  pentatricopeptide repeat-containing protein 123       89.7    3e-17   Aloysia oblanceolata
gb|AFV61116.1|  pentatricopeptide repeat-containing protein 123       90.1    3e-17   Aloysia virgata
gb|AFV61146.1|  pentatricopeptide repeat-containing protein 123       89.0    4e-17   Lippia rhodocnemis
gb|ACU25737.1|  pentatricopeptide repeat-containing protein           89.7    4e-17   Verbena macdougalii [New Mexico vervain]
gb|AFV61121.1|  pentatricopeptide repeat-containing protein 123       89.0    5e-17   Lantana cujabensis
gb|AIU48553.1|  tetratricopeptide repeat-like superfamily protein     90.1    5e-17   Chimonanthus praecox [wintersweet]
gb|AIU48560.1|  tetratricopeptide repeat-like superfamily protein     90.1    5e-17   Erythranthe guttata [common monkey flower]
gb|AFV61120.1|  pentatricopeptide repeat-containing protein 123       89.0    6e-17   Lantana camara
gb|AFV61133.1|  pentatricopeptide repeat-containing protein 123       89.0    6e-17   Lippia brasiliensis
gb|ACU25758.1|  pentatricopeptide repeat-containing protein           88.6    7e-17   Mulguraea scoparia
gb|AFV61118.1|  pentatricopeptide repeat-containing protein 123       89.4    7e-17   Coelocarpum swinglei
gb|AFV61141.1|  pentatricopeptide repeat-containing protein 123       88.6    7e-17   Lippia macrophylla
gb|AIU48544.1|  tetratricopeptide repeat-like superfamily protein     89.0    8e-17   Carica papaya [mamon]
gb|AFV61125.1|  pentatricopeptide repeat-containing protein 123       89.0    8e-17   Lantana micrantha
gb|AFV61123.1|  pentatricopeptide repeat-containing protein 123       89.0    8e-17   Lantana urticoides
gb|EYU42850.1|  hypothetical protein MIMGU_mgv1a0029291mg             89.0    8e-17   Erythranthe guttata [common monkey flower]
gb|AFV61110.1|  pentatricopeptide repeat-containing protein 123       89.0    9e-17   Acantholippia seriphioides
gb|AHC02089.1|  pentatricopeptide repeat-containing protein 123       88.2    1e-16   Aloysia herrerae
ref|XP_004486551.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    1e-16   
gb|ACU25760.1|  pentatricopeptide repeat-containing protein           88.6    1e-16   Phyla dulcis
ref|XP_004173911.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    1e-16   
ref|XP_001777347.1|  predicted protein                                89.7    1e-16   
gb|ACU25753.1|  pentatricopeptide repeat-containing protein           87.8    1e-16   Glandularia incisa
gb|ACU25757.1|  pentatricopeptide repeat-containing protein           88.6    1e-16   Mulguraea asparagoides
ref|XP_003538631.1|  PREDICTED: pentatricopeptide repeat-containi...  90.1    1e-16   Glycine max [soybeans]
gb|AFV61128.1|  pentatricopeptide repeat-containing protein 123       87.8    1e-16   Lantana rugosa
gb|AFV61130.1|  pentatricopeptide repeat-containing protein 123       87.4    1e-16   Lantana viburnoides
gb|AFV61113.1|  pentatricopeptide repeat-containing protein 123       88.6    1e-16   Aloysia herrerae
gb|AFV61119.1|  pentatricopeptide repeat-containing protein 123       87.8    1e-16   Junellia succulentifolia
gb|AIU48547.1|  tetratricopeptide repeat-like superfamily protein     89.0    1e-16   Eucalyptus grandis [rose gum]
emb|CBI24234.3|  unnamed protein product                              89.4    1e-16   Vitis vinifera
gb|KJB75396.1|  hypothetical protein B456_012G039700                  89.4    2e-16   Gossypium raimondii
gb|AFV61135.1|  pentatricopeptide repeat-containing protein 123       87.8    2e-16   Lippia duartei
ref|XP_010275891.1|  PREDICTED: pentatricopeptide repeat-containi...  89.4    2e-16   Nelumbo nucifera [Indian lotus]
ref|XP_008464651.1|  PREDICTED: pentatricopeptide repeat-containi...  89.0    2e-16   Cucumis melo [Oriental melon]
gb|AFV61117.1|  pentatricopeptide repeat-containing protein 123       87.4    2e-16   Burroughsia fastigiata
gb|KHG20151.1|  hypothetical protein F383_02209                       89.0    2e-16   Gossypium arboreum [tree cotton]
gb|ACU25749.1|  pentatricopeptide repeat-containing protein           88.2    2e-16   Glandularia araucana
gb|AFV61137.1|  pentatricopeptide repeat-containing protein 123       87.4    2e-16   Lippia hederifolia
gb|AFV61149.1|  pentatricopeptide repeat-containing protein 123       87.4    2e-16   Lippia salviifolia
gb|AFV61111.1|  pentatricopeptide repeat-containing protein 123       87.4    2e-16   Aloysia barbata
gb|AIU48543.1|  tetratricopeptide repeat-like superfamily protein     88.6    2e-16   Gossypium raimondii
emb|CAN63985.1|  hypothetical protein VITISV_001389                   89.4    2e-16   Vitis vinifera
gb|ACU25759.1|  pentatricopeptide repeat-containing protein           88.2    2e-16   Mulguraea aspera
gb|AFV61145.1|  pentatricopeptide repeat-containing protein 123       87.4    2e-16   Lippia rehmannii
gb|ACU25741.1|  pentatricopeptide repeat-containing protein           87.8    2e-16   Verbena hastata [American blue vervain]
gb|AFV61151.1|  pentatricopeptide repeat-containing protein 123       87.4    2e-16   Lippia velutina
gb|ACU25744.1|  pentatricopeptide repeat-containing protein           87.8    2e-16   Verbena montevidensis
gb|ACU25743.1|  pentatricopeptide repeat-containing protein           87.8    2e-16   Verbena bonariensis [purpletop]
gb|AFV61153.1|  pentatricopeptide repeat-containing protein 123       87.8    2e-16   Phyla nodiflora
gb|ACU25740.1|  pentatricopeptide repeat-containing protein           87.8    2e-16   Verbena canescens [gray vervain]
gb|ACU25735.1|  pentatricopeptide repeat-containing protein           87.8    2e-16   Verbena perennis
gb|AFV61122.1|  pentatricopeptide repeat-containing protein 123       87.4    2e-16   Lantana fucata
gb|ACU25751.1|  pentatricopeptide repeat-containing protein           87.8    2e-16   Glandularia subincana
gb|ACU25754.1|  pentatricopeptide repeat-containing protein           87.8    2e-16   Junellia spathulata
gb|AFV61132.1|  pentatricopeptide repeat-containing protein 123       87.4    2e-16   Lippia aristata
gb|ACU25756.1|  pentatricopeptide repeat-containing protein           87.8    2e-16   Junellia uniflora
gb|ACU25750.1|  pentatricopeptide repeat-containing protein           87.8    2e-16   Glandularia flava
gb|ACU25742.1|  pentatricopeptide repeat-containing protein           87.8    2e-16   Verbena hispida
gb|ACU25736.1|  pentatricopeptide repeat-containing protein           87.8    2e-16   Verbena bracteata [creeping vervain]
gb|AFV61131.1|  pentatricopeptide repeat-containing protein 123       87.8    2e-16   Lippia alba [bushy matgrass]
gb|AHC02104.1|  pentatricopeptide repeat-containing protein 123       87.4    2e-16   Aloysia sonorensis
gb|ACU25748.1|  pentatricopeptide repeat-containing protein           87.8    2e-16   Glandularia microphylla
ref|XP_010687511.1|  PREDICTED: pentatricopeptide repeat-containi...  89.0    2e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002275790.2|  PREDICTED: pentatricopeptide repeat-containi...  89.0    3e-16   
gb|EMS45043.1|  hypothetical protein TRIUR3_16364                     88.2    3e-16   Triticum urartu
ref|XP_008464650.1|  PREDICTED: pentatricopeptide repeat-containi...  88.6    3e-16   Cucumis melo [Oriental melon]
gb|AFV61150.1|  pentatricopeptide repeat-containing protein 123       87.8    3e-16   Lippia turbinata
gb|ACU25746.1|  pentatricopeptide repeat-containing protein           87.4    3e-16   Verbena intermedia
gb|AFV61147.1|  pentatricopeptide repeat-containing protein 123       87.8    3e-16   Lippia rotundifolia
gb|AFV61138.1|  pentatricopeptide repeat-containing protein 123       87.0    3e-16   Lippia hermannioides
gb|AFV61136.1|  pentatricopeptide repeat-containing protein 123       87.4    3e-16   Lippia filifolia
gb|ACU25761.1|  pentatricopeptide repeat-containing protein           87.4    3e-16   Lantana canescens
gb|AFV61127.1|  pentatricopeptide repeat-containing protein 123       87.4    3e-16   Lantana montevidensis
gb|EMT18607.1|  hypothetical protein F775_09904                       87.8    3e-16   
ref|XP_008451469.1|  PREDICTED: pentatricopeptide repeat-containi...  88.6    3e-16   Cucumis melo [Oriental melon]
gb|AFV61126.1|  pentatricopeptide repeat-containing protein 123       87.4    3e-16   Lantana microcephala
ref|XP_004166285.1|  PREDICTED: pentatricopeptide repeat-containi...  88.6    3e-16   
ref|XP_004135985.1|  PREDICTED: pentatricopeptide repeat-containi...  88.6    3e-16   Cucumis sativus [cucumbers]
gb|ACU25765.1|  pentatricopeptide repeat-containing protein           87.4    3e-16   Lampayo castellani
gb|AFV61129.1|  pentatricopeptide repeat-containing protein 123       87.4    4e-16   Lantana trifolia
ref|XP_010670642.1|  PREDICTED: pentatricopeptide repeat-containi...  88.2    4e-16   
gb|AIU48578.1|  tetratricopeptide repeat-like superfamily protein     87.4    4e-16   Platanus x hispanica [London plane tree]
gb|AIU48542.1|  tetratricopeptide repeat-like superfamily protein     87.4    4e-16   Citrus clementina [clementine]
gb|AFV61134.1|  pentatricopeptide repeat-containing protein 123       86.3    4e-16   Lippia diamantinensis
gb|AFV61109.1|  pentatricopeptide repeat-containing protein 123       87.0    4e-16   Acantholippia salsoloides
gb|AHC02083.1|  pentatricopeptide repeat-containing protein 123       87.0    4e-16   Aloysia catamarcensis
gb|AHC02077.1|  pentatricopeptide repeat-containing protein 123       87.0    4e-16   Acantholippia salsoloides
gb|AIU48532.1|  tetratricopeptide repeat-like superfamily protein     87.4    4e-16   Arabidopsis lyrata [lyrate rockcress]
gb|AFV61142.1|  pentatricopeptide repeat-containing protein 123       87.0    4e-16   Lippia micromera
gb|AHC02076.1|  pentatricopeptide repeat-containing protein 123       87.0    4e-16   Acantholippia salsoloides
gb|AIU48562.1|  tetratricopeptide repeat-like superfamily protein     87.4    5e-16   Solanum tuberosum [potatoes]
gb|AFV61143.1|  pentatricopeptide repeat-containing protein 123       86.7    5e-16   Lippia origanoides
gb|AHC02099.1|  pentatricopeptide repeat-containing protein 123       86.3    5e-16   Aloysia polystachya
ref|XP_002517447.1|  pentatricopeptide repeat-containing protein,...  87.8    5e-16   Ricinus communis
ref|XP_004149531.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    5e-16   Cucumis sativus [cucumbers]
ref|XP_010035946.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    5e-16   Eucalyptus grandis [rose gum]
ref|XP_010035947.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    6e-16   Eucalyptus grandis [rose gum]
gb|AIU48545.1|  tetratricopeptide repeat-like superfamily protein     87.0    6e-16   Capsella rubella
gb|ACU25770.1|  pentatricopeptide repeat-containing protein           86.7    6e-16   Tamonea boxiana
gb|AIU48574.1|  tetratricopeptide repeat-like superfamily protein     87.0    6e-16   Vitis vinifera
ref|XP_006357891.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    6e-16   Solanum tuberosum [potatoes]
gb|KHN24013.1|  Pentatricopeptide repeat-containing protein, chlo...  87.0    6e-16   Glycine soja [wild soybean]
gb|ACU25755.1|  pentatricopeptide repeat-containing protein           86.7    6e-16   Junellia seriphioides
ref|XP_010934958.1|  PREDICTED: putative pentatricopeptide repeat...  87.8    6e-16   Elaeis guineensis
gb|AFV61124.1|  pentatricopeptide repeat-containing protein 123       86.7    7e-16   Lantana macropoda
ref|XP_002878256.1|  pentatricopeptide repeat-containing protein      87.4    7e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010091910.1|  hypothetical protein L484_010474                 87.4    7e-16   Morus notabilis
gb|ACU25766.1|  pentatricopeptide repeat-containing protein           86.3    7e-16   Neosparton ephedroides
ref|XP_010244205.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    7e-16   Nelumbo nucifera [Indian lotus]
ref|XP_003610900.1|  Pentatricopeptide repeat-containing protein      88.2    7e-16   Medicago truncatula
ref|XP_008796942.1|  PREDICTED: putative pentatricopeptide repeat...  87.4    7e-16   Phoenix dactylifera
gb|AIU48541.1|  tetratricopeptide repeat-like superfamily protein     86.7    8e-16   Sarcandra glabra
gb|ACU25752.1|  pentatricopeptide repeat-containing protein           86.3    8e-16   Glandularia dissecta
gb|AIU48549.1|  tetratricopeptide repeat-like superfamily protein     86.7    8e-16   Buxus sinica
ref|XP_011036388.1|  PREDICTED: pentatricopeptide repeat-containi...  85.5    8e-16   Populus euphratica
gb|ACU25776.1|  pentatricopeptide repeat-containing protein           86.3    9e-16   Duranta serratifolia
ref|XP_009411130.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    9e-16   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX71917.1|  BnaC08g29570D                                        86.7    9e-16   
ref|XP_011036387.1|  PREDICTED: pentatricopeptide repeat-containi...  85.5    9e-16   Populus euphratica
gb|ACU25747.1|  pentatricopeptide repeat-containing protein           85.9    9e-16   Verbena rigida [veined verbena]
ref|XP_003552765.1|  PREDICTED: pentatricopeptide repeat-containi...  87.0    1e-15   Glycine max [soybeans]
ref|XP_006290805.1|  hypothetical protein CARUB_v10016912mg           86.7    1e-15   Capsella rubella
ref|XP_004147489.1|  PREDICTED: pentatricopeptide repeat-containi...  87.0    1e-15   Cucumis sativus [cucumbers]
gb|ACU25768.1|  pentatricopeptide repeat-containing protein           85.9    1e-15   Priva cordifolia
ref|XP_006446275.1|  hypothetical protein CICLE_v10017597mg           87.0    1e-15   Citrus clementina [clementine]
ref|XP_010106170.1|  hypothetical protein L484_012715                 84.7    1e-15   
gb|AIU48571.1|  tetratricopeptide repeat-like superfamily protein     86.3    1e-15   Solanum lycopersicum
ref|XP_001765565.1|  predicted protein                                86.3    1e-15   
ref|XP_009602284.1|  PREDICTED: pentatricopeptide repeat-containi...  86.7    1e-15   Nicotiana tomentosiformis
gb|AIU48556.1|  tetratricopeptide repeat-like superfamily protein     85.9    1e-15   Aristolochia tagala
ref|XP_008442691.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  86.7    1e-15   Cucumis melo [Oriental melon]
gb|KDO54847.1|  hypothetical protein CISIN_1g004758mg                 86.3    1e-15   Citrus sinensis [apfelsine]
ref|XP_004232248.1|  PREDICTED: pentatricopeptide repeat-containi...  86.7    1e-15   Solanum lycopersicum
ref|XP_004156125.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  87.0    1e-15   
ref|XP_010252754.1|  PREDICTED: pentatricopeptide repeat-containi...  86.7    1e-15   Nelumbo nucifera [Indian lotus]
gb|AFV61144.1|  pentatricopeptide repeat-containing protein 123       85.1    1e-15   Lippia pusilla
ref|XP_010227899.1|  PREDICTED: pentatricopeptide repeat-containi...  87.0    1e-15   Brachypodium distachyon [annual false brome]
ref|XP_002278350.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    1e-15   Vitis vinifera
ref|XP_008224621.1|  PREDICTED: pentatricopeptide repeat-containi...  86.7    2e-15   Prunus mume [ume]
gb|AHX42025.1|  pentatricopeptide repeat-containing protein 11        83.6    2e-15   Campanula peregrina
ref|XP_009379098.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    2e-15   Pyrus x bretschneideri [bai li]
gb|KEH33884.1|  PPR containing plant-like protein                     86.7    2e-15   Medicago truncatula
ref|XP_009795979.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    2e-15   Nicotiana sylvestris
ref|XP_007213618.1|  hypothetical protein PRUPE_ppa002169mg           86.3    2e-15   Prunus persica
ref|XP_004243629.1|  PREDICTED: pentatricopeptide repeat-containi...  85.9    2e-15   Solanum lycopersicum
gb|KDP45457.1|  hypothetical protein JCGZ_09706                       86.3    2e-15   Jatropha curcas
gb|AFV61152.1|  pentatricopeptide repeat-containing protein 123       85.1    2e-15   Nashia inaguensis
gb|AIU48551.1|  tetratricopeptide repeat-like superfamily protein     85.5    2e-15   Chloranthus japonicus
ref|XP_006298996.1|  hypothetical protein CARUB_v10015123mg           83.2    2e-15   
ref|XP_006878653.1|  hypothetical protein AMTR_s00011p00265800        86.7    2e-15   Amborella trichopoda
ref|XP_006338491.1|  PREDICTED: pentatricopeptide repeat-containi...  85.9    2e-15   Solanum tuberosum [potatoes]
ref|XP_009602216.1|  PREDICTED: pentatricopeptide repeat-containi...  85.9    2e-15   Nicotiana tomentosiformis
ref|XP_008443439.1|  PREDICTED: pentatricopeptide repeat-containi...  85.9    2e-15   Cucumis melo [Oriental melon]
ref|XP_002969127.1|  hypothetical protein SELMODRAFT_61162            85.9    2e-15   
ref|XP_006446843.1|  hypothetical protein CICLE_v10014674mg           85.9    2e-15   Citrus clementina [clementine]
ref|XP_006468968.1|  PREDICTED: pentatricopeptide repeat-containi...  85.9    2e-15   Citrus sinensis [apfelsine]
ref|XP_006470579.1|  PREDICTED: pentatricopeptide repeat-containi...  85.9    2e-15   
gb|KDO63442.1|  hypothetical protein CISIN_1g007543mg                 85.5    2e-15   Citrus sinensis [apfelsine]
gb|KDO54845.1|  hypothetical protein CISIN_1g004758mg                 85.9    2e-15   Citrus sinensis [apfelsine]
gb|KHN35111.1|  Pentatricopeptide repeat-containing protein, chlo...  86.3    2e-15   Glycine soja [wild soybean]
gb|KDO63441.1|  hypothetical protein CISIN_1g007543mg                 85.5    2e-15   Citrus sinensis [apfelsine]
ref|XP_010687146.1|  PREDICTED: pentatricopeptide repeat-containi...  85.5    3e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006842614.1|  hypothetical protein AMTR_s00077p00176610        85.9    3e-15   Amborella trichopoda
gb|ACU25777.1|  pentatricopeptide repeat-containing protein           84.7    3e-15   Petrea racemosa
ref|XP_008370969.1|  PREDICTED: pentatricopeptide repeat-containi...  85.9    3e-15   
gb|AHX41978.1|  pentatricopeptide repeat-containing protein 11        82.8    3e-15   Campanula carpatha
gb|ACU25769.1|  pentatricopeptide repeat-containing protein           84.7    3e-15   
gb|ACU25734.1|  pentatricopeptide repeat-containing protein           84.7    3e-15   
gb|AIU48533.1|  tetratricopeptide repeat-like superfamily protein     85.1    3e-15   
ref|XP_002313272.1|  hypothetical protein POPTR_0009s07170g           84.3    3e-15   
ref|XP_006590462.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    3e-15   
gb|ACU25767.1|  pentatricopeptide repeat-containing protein           84.7    3e-15   
gb|KJB11399.1|  hypothetical protein B456_001G256500                  85.5    3e-15   
gb|AFV61112.1|  pentatricopeptide repeat-containing protein 123       84.7    3e-15   
gb|AHX42011.1|  pentatricopeptide repeat-containing protein 11        82.8    3e-15   
ref|XP_002973937.1|  hypothetical protein SELMODRAFT_100758           85.5    3e-15   
gb|KDP42583.1|  hypothetical protein JCGZ_24357                       82.8    3e-15   
ref|XP_001759643.1|  predicted protein                                85.9    3e-15   
gb|AIU48535.1|  tetratricopeptide repeat-like superfamily protein     84.7    3e-15   
ref|XP_004149490.1|  PREDICTED: putative pentatricopeptide repeat...  85.5    3e-15   
gb|AHC02086.1|  pentatricopeptide repeat-containing protein 123       83.6    3e-15   
ref|XP_007032420.1|  Tetratricopeptide repeat (TPR)-like superfam...  85.1    4e-15   
ref|XP_009116575.1|  PREDICTED: pentatricopeptide repeat-containi...  85.1    4e-15   
ref|XP_002971064.1|  hypothetical protein SELMODRAFT_95253            85.5    4e-15   
ref|NP_974457.1|  pentatricopeptide repeat-containing protein         85.1    4e-15   
gb|AIU48582.1|  tetratricopeptide repeat-like superfamily protein     83.6    4e-15   
ref|XP_007215021.1|  hypothetical protein PRUPE_ppa003340mg           84.7    4e-15   
ref|XP_009374903.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  84.7    4e-15   
ref|XP_009757618.1|  PREDICTED: pentatricopeptide repeat-containi...  84.7    4e-15   
emb|CAB86932.1|  putative protein                                     84.7    4e-15   
ref|XP_010527103.1|  PREDICTED: pentatricopeptide repeat-containi...  85.1    4e-15   
ref|NP_191463.2|  pentatricopeptide repeat-containing protein         84.7    5e-15   
ref|XP_011008363.1|  PREDICTED: pentatricopeptide repeat-containi...  84.7    5e-15   
gb|KDP37826.1|  hypothetical protein JCGZ_06728                       84.7    5e-15   
gb|ACU25774.1|  pentatricopeptide repeat-containing protein           84.0    5e-15   
gb|AIU48548.1|  tetratricopeptide repeat-like superfamily protein     84.3    5e-15   
gb|KEH36980.1|  pentatricopeptide (PPR) repeat protein                84.7    5e-15   
emb|CDY06027.1|  BnaA09g37530D                                        84.3    5e-15   
gb|EPS73544.1|  hypothetical protein M569_01211                       84.0    6e-15   
gb|KFK35145.1|  hypothetical protein AALP_AA5G244100                  84.3    6e-15   
gb|AIU48552.1|  tetratricopeptide repeat-like superfamily protein     84.0    6e-15   
ref|XP_010524118.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    6e-15   
ref|XP_006450275.1|  hypothetical protein CICLE_v10007356mg           85.1    6e-15   
ref|XP_010524120.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    6e-15   
ref|XP_008466646.1|  PREDICTED: putative pentatricopeptide repeat...  84.7    6e-15   
ref|XP_001779828.1|  predicted protein                                84.7    6e-15   
gb|AIU48576.1|  tetratricopeptide repeat-like superfamily protein     84.0    6e-15   
gb|ACU25775.1|  pentatricopeptide repeat-containing protein           83.6    6e-15   
ref|XP_010524119.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    6e-15   
gb|AFV61139.1|  pentatricopeptide repeat-containing protein 123       83.2    6e-15   
gb|AHX42020.1|  pentatricopeptide repeat-containing protein 11        81.6    6e-15   
ref|XP_010908404.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    7e-15   
ref|XP_009797419.1|  PREDICTED: pentatricopeptide repeat-containi...  84.7    7e-15   
ref|XP_006483487.1|  PREDICTED: pentatricopeptide repeat-containi...  84.7    7e-15   
ref|XP_006491812.1|  PREDICTED: pentatricopeptide repeat-containi...  84.7    7e-15   
gb|EPS66249.1|  hypothetical protein M569_08528                       84.3    8e-15   
ref|XP_002276556.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    8e-15   
ref|XP_008379319.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    8e-15   
gb|AIU48581.1|  tetratricopeptide repeat-like superfamily protein     83.6    8e-15   
ref|XP_010544417.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    8e-15   
gb|AIU48573.1|  tetratricopeptide repeat-like superfamily protein     83.6    8e-15   
gb|KHN44490.1|  Pentatricopeptide repeat-containing protein, chlo...  84.0    8e-15   
ref|XP_008230711.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    8e-15   
ref|XP_006491807.1|  PREDICTED: pentatricopeptide repeat-containi...  84.7    8e-15   
ref|XP_004231646.1|  PREDICTED: putative pentatricopeptide repeat...  84.3    9e-15   
ref|XP_008662715.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    9e-15   
ref|XP_003538522.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    9e-15   
ref|XP_006856269.1|  hypothetical protein AMTR_s00047p00074820        84.0    1e-14   
gb|EYU43001.1|  hypothetical protein MIMGU_mgv1a009466mg              82.0    1e-14   
gb|EEC80183.1|  hypothetical protein OsI_22045                        83.6    1e-14   
ref|XP_010265385.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    1e-14   
ref|XP_004511471.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    1e-14   
gb|AHX42072.1|  pentatricopeptide repeat-containing protein 11        80.9    1e-14   
gb|KCW52311.1|  hypothetical protein EUGRSUZ_J01726                   83.6    1e-14   
ref|XP_004966645.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    1e-14   
ref|XP_010906095.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    1e-14   
gb|AHC02081.1|  pentatricopeptide repeat-containing protein 123       82.4    1e-14   
ref|XP_009795490.1|  PREDICTED: pentatricopeptide repeat-containi...  83.2    1e-14   
ref|XP_011100440.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    1e-14   
gb|AIU48567.1|  tetratricopeptide repeat-like superfamily protein     83.2    1e-14   
ref|XP_010239993.1|  PREDICTED: putative pentatricopeptide repeat...  82.4    1e-14   
ref|XP_009399996.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    1e-14   
ref|XP_001766736.1|  predicted protein                                83.6    1e-14   
ref|XP_004303905.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    1e-14   
gb|EAZ05871.1|  hypothetical protein OsI_28108                        83.6    1e-14   
ref|XP_004242906.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    1e-14   
gb|ACU25771.1|  pentatricopeptide repeat-containing protein           82.8    1e-14   
ref|NP_181058.1|  pentatricopeptide repeat-containing protein         83.6    1e-14   
ref|NP_001061174.1|  Os08g0191900                                     83.6    1e-14   
gb|AIU48572.1|  tetratricopeptide repeat-like superfamily protein     83.2    1e-14   
ref|XP_008805021.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    1e-14   
ref|XP_002443991.1|  hypothetical protein SORBIDRAFT_07g005470        83.6    1e-14   
ref|XP_006402731.1|  hypothetical protein EUTSA_v10005856mg           83.2    1e-14   
ref|XP_009631369.1|  PREDICTED: putative pentatricopeptide repeat...  83.6    1e-14   
ref|NP_001189682.1|  pentatricopeptide repeat-containing protein      83.2    1e-14   
ref|XP_010509658.1|  PREDICTED: pentatricopeptide repeat-containi...  83.2    1e-14   
ref|XP_007026347.1|  Pentatricopeptide (PPR) repeat-containing pr...  83.6    1e-14   
ref|XP_008795043.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  83.6    1e-14   
ref|XP_010509657.1|  PREDICTED: pentatricopeptide repeat-containi...  83.2    1e-14   
ref|XP_007051141.1|  S uncoupled 1                                    83.6    1e-14   
ref|XP_006420675.1|  hypothetical protein CICLE_v10004591mg           83.2    1e-14   
gb|ACU25773.1|  pentatricopeptide repeat-containing protein           82.4    1e-14   
ref|XP_004502213.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    1e-14   
emb|CDP11481.1|  unnamed protein product                              82.8    2e-14   
ref|XP_003601624.1|  Pentatricopeptide repeat-containing protein      83.2    2e-14   
ref|XP_004507605.1|  PREDICTED: pentatricopeptide repeat-containi...  83.2    2e-14   
ref|XP_002308816.1|  hypothetical protein POPTR_0006s01990g           83.2    2e-14   
ref|XP_002324029.2|  hypothetical protein POPTR_0017s11210g           83.2    2e-14   
ref|XP_001781632.1|  predicted protein                                83.6    2e-14   
ref|NP_001057065.1|  Os06g0199100                                     83.6    2e-14   
gb|EEE65260.1|  hypothetical protein OsJ_20463                        83.6    2e-14   
gb|KDO67437.1|  hypothetical protein CISIN_1g048794mg                 83.2    2e-14   
ref|XP_006344540.1|  PREDICTED: pentatricopeptide repeat-containi...  83.2    2e-14   
gb|AIU48579.1|  tetratricopeptide repeat-like superfamily protein     82.4    2e-14   
ref|XP_002438011.1|  hypothetical protein SORBIDRAFT_10g006490        83.6    2e-14   
ref|XP_002532598.1|  pentatricopeptide repeat-containing protein,...  82.8    2e-14   
ref|XP_011088174.1|  PREDICTED: pentatricopeptide repeat-containi...  83.2    2e-14   
ref|XP_010504882.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    2e-14   
ref|XP_002881377.1|  pentatricopeptide repeat-containing protein      82.8    2e-14   
ref|XP_009629855.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    2e-14   
gb|AFV61148.1|  pentatricopeptide repeat-containing protein 123       82.0    2e-14   
gb|AHX42082.1|  pentatricopeptide repeat-containing protein 11        80.1    2e-14   
ref|XP_010554024.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    2e-14   
ref|XP_010504880.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    2e-14   
ref|XP_010512131.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    2e-14   
ref|XP_006295537.1|  hypothetical protein CARUB_v10024643mg           82.4    2e-14   
emb|CDY16026.1|  BnaC08g40970D                                        82.4    2e-14   
ref|XP_010505013.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    2e-14   
ref|XP_004504624.1|  PREDICTED: putative pentatricopeptide repeat...  82.8    2e-14   
gb|AIU48557.1|  tetratricopeptide repeat-like superfamily protein     82.0    3e-14   
ref|XP_009620134.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    3e-14   
ref|XP_009770050.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    3e-14   
ref|XP_006656740.1|  PREDICTED: pentatricopeptide repeat-containi...  83.2    3e-14   
gb|AIU48563.1|  tetratricopeptide repeat-like superfamily protein     82.0    3e-14   
gb|AHX42086.1|  pentatricopeptide repeat-containing protein 11        80.1    3e-14   
ref|XP_006851711.1|  hypothetical protein AMTR_s00040p00209940        82.8    3e-14   
ref|XP_002321918.2|  hypothetical protein POPTR_0015s13120g           80.9    3e-14   
ref|XP_002518652.1|  pentatricopeptide repeat-containing protein,...  82.8    3e-14   
ref|XP_002269471.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    3e-14   
ref|XP_004293389.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    3e-14   
ref|XP_010032823.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  82.8    3e-14   
ref|XP_002962027.1|  hypothetical protein SELMODRAFT_77588            82.8    3e-14   
gb|AFW57100.1|  hypothetical protein ZEAMMB73_992270                  81.6    3e-14   
ref|XP_006389540.1|  hypothetical protein POPTR_0022s00740g           81.3    3e-14   
gb|AIU48539.1|  tetratricopeptide repeat-like superfamily protein     82.0    3e-14   
emb|CDP16060.1|  unnamed protein product                              82.0    3e-14   
gb|AIU48565.1|  tetratricopeptide repeat-like superfamily protein     82.0    3e-14   
ref|XP_004967498.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    3e-14   
ref|XP_004230715.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    3e-14   
ref|XP_009394893.1|  PREDICTED: putative pentatricopeptide repeat...  82.4    3e-14   
ref|XP_011090619.1|  PREDICTED: putative pentatricopeptide repeat...  82.4    3e-14   
ref|XP_001769572.1|  predicted protein                                82.4    3e-14   
ref|XP_009349886.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    3e-14   
gb|AIU48536.1|  tetratricopeptide repeat-like superfamily protein     81.6    3e-14   
ref|XP_007048893.1|  Tetratricopeptide repeat-like superfamily pr...  82.0    3e-14   
ref|XP_010048714.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    3e-14   
gb|AIU48570.1|  tetratricopeptide repeat-like superfamily protein     81.6    4e-14   
ref|NP_001051352.1|  Os03g0761300                                     81.6    4e-14   
ref|XP_009411534.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    4e-14   
ref|XP_004972659.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    4e-14   
gb|AHX42043.1|  pentatricopeptide repeat-containing protein 11        79.3    4e-14   
ref|XP_002298285.1|  hypothetical protein POPTR_0001s22750g           82.0    4e-14   
ref|XP_004233239.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    4e-14   
gb|AIU48550.1|  tetratricopeptide repeat-like superfamily protein     81.6    4e-14   
ref|XP_010451795.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    4e-14   
ref|XP_010689216.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    4e-14   
emb|CDP02182.1|  unnamed protein product                              81.6    4e-14   
ref|XP_007157017.1|  hypothetical protein PHAVU_002G036500g           82.4    4e-14   
ref|XP_006428510.1|  hypothetical protein CICLE_v100138542mg          82.4    4e-14   
ref|XP_010689214.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    4e-14   
gb|AHX42010.1|  pentatricopeptide repeat-containing protein 11        79.3    5e-14   
ref|XP_010473513.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    5e-14   
gb|AHX42061.1|  pentatricopeptide repeat-containing protein 11        79.3    5e-14   
ref|XP_010450746.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    5e-14   
gb|EPS59551.1|  hypothetical protein M569_15254                       80.9    5e-14   
ref|XP_006293642.1|  hypothetical protein CARUB_v10022597mg           82.0    5e-14   
ref|XP_006346330.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    5e-14   
ref|XP_008233573.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    5e-14   
gb|KCW88409.1|  hypothetical protein EUGRSUZ_A00796                   81.6    5e-14   
ref|XP_004515007.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    5e-14   
ref|XP_008245022.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    5e-14   
gb|AIU48531.1|  tetratricopeptide repeat-like superfamily protein     81.3    6e-14   
ref|XP_004511303.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    6e-14   
ref|XP_006659201.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    6e-14   
ref|XP_006431055.1|  hypothetical protein CICLE_v10011224mg           81.6    6e-14   
ref|XP_003555843.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    6e-14   
ref|XP_010674677.1|  PREDICTED: putative pentatricopeptide repeat...  81.3    6e-14   
gb|AHX42008.1|  pentatricopeptide repeat-containing protein 11        79.0    6e-14   
gb|KHG23705.1|  hypothetical protein F383_04375                       80.9    6e-14   
ref|XP_009792924.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    6e-14   
gb|KHN23100.1|  Pentatricopeptide repeat-containing protein           81.3    6e-14   
gb|AHX42059.1|  pentatricopeptide repeat-containing protein 11        79.0    6e-14   
ref|XP_009792923.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    6e-14   
ref|XP_008778051.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    6e-14   
ref|XP_010545723.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    6e-14   
ref|XP_009412022.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    6e-14   
ref|XP_010674802.1|  PREDICTED: putative pentatricopeptide repeat...  81.3    6e-14   
ref|XP_010043774.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    6e-14   
gb|KJB77329.1|  hypothetical protein B456_012G131800                  80.5    6e-14   
gb|AHX42065.1|  pentatricopeptide repeat-containing protein 11        78.6    7e-14   
ref|XP_004497232.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  81.3    7e-14   
gb|KDO57841.1|  hypothetical protein CISIN_1g003451mg                 81.6    7e-14   
ref|XP_003592720.1|  Pentatricopeptide repeat-containing protein      80.9    7e-14   
ref|XP_010545716.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    7e-14   
gb|KJB68142.1|  hypothetical protein B456_010G228100                  81.3    7e-14   
ref|XP_010043749.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    7e-14   
ref|XP_006856131.1|  hypothetical protein AMTR_s00059p00156460        81.6    7e-14   
gb|ADE76603.1|  unknown                                               79.0    7e-14   
gb|KJB49788.1|  hypothetical protein B456_008G138300                  81.3    7e-14   
ref|XP_010418730.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    7e-14   
ref|XP_010496517.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    7e-14   
gb|KHN42271.1|  Pentatricopeptide repeat-containing protein, chlo...  81.3    7e-14   
ref|XP_006422863.1|  hypothetical protein CICLE_v10030402mg           81.3    7e-14   
gb|AHX42054.1|  pentatricopeptide repeat-containing protein 11        78.6    7e-14   
ref|XP_008662784.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  81.6    7e-14   
gb|AIU48554.1|  tetratricopeptide repeat-like superfamily protein     79.0    8e-14   
emb|CBI36966.3|  unnamed protein product                              81.3    8e-14   
gb|AIU48538.1|  tetratricopeptide repeat-like superfamily protein     80.9    8e-14   
gb|EEE63069.1|  hypothetical protein OsJ_17877                        81.3    8e-14   
ref|XP_002299968.2|  hypothetical protein POPTR_0001s27990g           79.7    8e-14   
gb|KDO72432.1|  hypothetical protein CISIN_1g038401mg                 80.9    8e-14   
ref|XP_006584099.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    8e-14   
ref|XP_011024963.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    8e-14   
ref|XP_009608961.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    8e-14   
ref|XP_004511302.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    8e-14   
ref|XP_011015136.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    8e-14   
gb|EAY97342.1|  hypothetical protein OsI_19265                        81.3    8e-14   



>emb|CDP07966.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAY+SMV MYGKTGR  +A RLVAKMKERGCEPNVWIYN+LLD+HGRA N++Q
Sbjct  440  KGFDKCVVAYASMVAMYGKTGRVGDAMRLVAKMKERGCEPNVWIYNSLLDMHGRAVNLRQ  499

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEM RRKV+PDRVSYTSVISAYS+A+E E+C++YYQ F+LNGG  DRAMA IMV 
Sbjct  500  VEKIWKEMNRRKVLPDRVSYTSVISAYSRAREFETCMRYYQKFRLNGGAIDRAMAAIMVA  559

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  294
            VFSK+N+ DELVKLLQD+KT+ TKLD RLYRSALNALRDAGL ++AKWLQESF 
Sbjct  560  VFSKLNRADELVKLLQDMKTEGTKLDVRLYRSALNALRDAGLHVQAKWLQESFG  613



>gb|ABK95746.1| unknown [Populus trichocarpa]
Length=184

 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSM++MYGKTGR ++ATRLVAKMK +GCEPNVWIYN+LLD+HGRA N++Q
Sbjct  9    KGFDKCVVAYSSMISMYGKTGRARDATRLVAKMKLKGCEPNVWIYNSLLDMHGRAKNLRQ  68

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRKV PD+V+Y+SVISAY+K+KE E CV+YY ++++NGG  D AMAGIM G
Sbjct  69   VEKLWKEMKRRKVAPDKVTYSSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAG  128

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK++++DELVKLL+D+K++ T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  129  VFSKISRIDELVKLLRDMKSEGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  181



>ref|XP_009801460.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nicotiana sylvestris]
Length=641

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSM+ MYGKTGR K+A +LVAKMKERGC+PNVW+YN LLDIHG+  N++Q
Sbjct  466  KGFDKCVVAYSSMIAMYGKTGRPKDAMKLVAKMKERGCQPNVWVYNALLDIHGKVLNLRQ  525

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRK+ PDRVSYTS+ISAYS+A+E + C+ YYQ+F LNGGK DRAMAGIMVG
Sbjct  526  VEKIWKEMKRRKIFPDRVSYTSIISAYSRAREFDKCLTYYQEFTLNGGKIDRAMAGIMVG  585

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  294
            VFSKMN+VDEL+ LLQ++K + TKLD RL+RSALN+LRDAGL+I+AKW+QESF 
Sbjct  586  VFSKMNRVDELIGLLQNMKREGTKLDGRLHRSALNSLRDAGLQIQAKWMQESFG  639



>emb|CBI27495.3| unnamed protein product [Vitis vinifera]
Length=552

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GF+KC+VAYSSMV MYGKTGR +EA RLVAKMKERGCEPNVW+YN+L+D+HGR  N++Q
Sbjct  366  KGFNKCVVAYSSMVVMYGKTGRLREAMRLVAKMKERGCEPNVWVYNSLMDMHGRVKNLRQ  425

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG
Sbjct  426  VEKLWKEMKRKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVG  485

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            +FSK  +VDELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  486  IFSKSGRVDELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESF  538



>ref|XP_002269531.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Vitis vinifera]
Length=603

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GF+KC+VAYSSMV MYGKTGR +EA RLVAKMKERGCEPNVW+YN+L+D+HGR  N++Q
Sbjct  428  KGFNKCVVAYSSMVVMYGKTGRLREAMRLVAKMKERGCEPNVWVYNSLMDMHGRVKNLRQ  487

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG
Sbjct  488  VEKLWKEMKRKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVG  547

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            +FSK  +VDELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  548  IFSKSGRVDELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESF  600



>emb|CBI24106.3| unnamed protein product [Vitis vinifera]
Length=568

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 171/219 (78%), Gaps = 8/219 (4%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GF+KC+VAYSSMV MYGKTGR +EA RLVAKMKERGC+PNVW+YN+L+D+HGR  N++Q
Sbjct  352  KGFNKCVVAYSSMVVMYGKTGRLREAMRLVAKMKERGCKPNVWVYNSLMDMHGRVKNLRQ  411

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG
Sbjct  412  VEKLWKEMKRKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVG  471

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*II  276
            +FSK  +VDELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF     I 
Sbjct  472  IFSKSGRVDELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESFDTKVYIF  531

Query  275  SCNSAKKKPKNIVNTRWRISLSETLV*GFKVVPPNLCNH  159
                  K       + W +  S +    F +  P+L + 
Sbjct  532  ------KTAAESTQSLWELLCSSSP--SFSIFEPSLASQ  562



>ref|XP_002273494.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Vitis vinifera]
Length=609

 Score =   287 bits (735),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GF+KC+VAYSSMV MYGKTGR +EA RLVAKMKERGC+PNVW+YN+L+D+HGR  N++Q
Sbjct  429  KGFNKCVVAYSSMVVMYGKTGRLREAMRLVAKMKERGCKPNVWVYNSLMDMHGRVKNLRQ  488

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG
Sbjct  489  VEKLWKEMKRKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVG  548

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            +FSK  +VDELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  549  IFSKSGRVDELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESF  601



>ref|XP_004237182.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Solanum lycopersicum]
Length=642

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSM+ MYGKTGR K+A +LVA MKERGC+PNVW+YN LLDIHG+  N++Q
Sbjct  467  KGFDKCVVAYSSMIAMYGKTGRPKDAMKLVAIMKERGCQPNVWVYNALLDIHGKVLNLRQ  526

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRK+ PDRVSYTS+ISAYSKA+E + C+ YYQ+F LNGG+ DRAMAGIMVG
Sbjct  527  VEKIWKEMKRRKIFPDRVSYTSIISAYSKAREFDKCLIYYQEFTLNGGRLDRAMAGIMVG  586

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  294
            VFSKMN+VDEL+ LLQ++K + TKLD RL +SALN+LRDAGL+I+AKWLQESF 
Sbjct  587  VFSKMNRVDELISLLQNMKREGTKLDGRLQKSALNSLRDAGLQIQAKWLQESFG  640



>ref|XP_009601923.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nicotiana tomentosiformis]
Length=619

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSM+ MYGKT R K+A +LVAKMKERGC+PNVW+YN LLDIHG+  N++Q
Sbjct  444  KGFDKCVVAYSSMIAMYGKTERPKDAMKLVAKMKERGCQPNVWVYNALLDIHGKVLNLRQ  503

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRK+ PDRVSYTS+I+AYS+A+E + C+ YYQ+F LNGG+ DRAMAGIMVG
Sbjct  504  VEKIWKEMKRRKIFPDRVSYTSIITAYSRAREFDKCLTYYQEFTLNGGRIDRAMAGIMVG  563

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  294
            VFSKMN+VDEL+ LLQ++K + TKLD RL+RSALN+LRDAGL+I+AKW+QESF 
Sbjct  564  VFSKMNRVDELIGLLQNMKREGTKLDGRLHRSALNSLRDAGLQIQAKWMQESFG  617



>ref|XP_002521865.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF40501.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=449

 Score =   281 bits (718),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSS+V MYGKTGR ++A RLVAKMK +GCEPNVWIYN+LLD+HGR  N++Q
Sbjct  274  KGFDKCVVAYSSIVAMYGKTGRTRDAMRLVAKMKVKGCEPNVWIYNSLLDMHGRVKNLRQ  333

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRKV PD+V+YTSVI+AY+KAKE E+CV+YY +++ NGG  D+A+AG+MVG
Sbjct  334  VEKLWKEMKRRKVAPDKVTYTSVIAAYNKAKEFETCVRYYHEYRFNGGVIDKAVAGVMVG  393

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK+ ++DEL+KLLQD+KT+ T+LD RLYRSA NALRDAGL+++AKW+QESF
Sbjct  394  VFSKIGRIDELLKLLQDIKTEGTQLDGRLYRSAFNALRDAGLQMQAKWMQESF  446



>ref|XP_011021682.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like isoform X2 [Populus euphratica]
Length=413

 Score =   280 bits (715),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSM++MYGKTGR ++A RLVAKMK +GCEPNVWIYN+LLD+HGRA N++Q
Sbjct  238  KGFDKCVVAYSSMISMYGKTGRARDAMRLVAKMKLKGCEPNVWIYNSLLDMHGRAKNLRQ  297

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRKV PD+V+Y+SVISAY+K+KE E CV+YY ++++NGG  D AMAGIM G
Sbjct  298  VEKLWKEMKRRKVTPDKVTYSSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAG  357

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK++++DELVKLL+D+K++ T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  358  VFSKISRIDELVKLLRDMKSEGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  410


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 74/151 (49%), Gaps = 2/151 (1%)
 Frame = -2

Query  800  CIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVW  621
            CI  + ++VN + K      A ++  ++K  GCEP    Y ++++ + RA    + E V+
Sbjct  175  CI--FCAIVNGFSKRRGFSAAVKVYEELKYDGCEPGQVTYASVINAYCRAGLYSKAEMVF  232

Query  620  KEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKM  441
             EM+ +      V+Y+S+IS Y K       ++     KL G + +  +   ++ +  + 
Sbjct  233  SEMEEKGFDKCVVAYSSMISMYGKTGRARDAMRLVAKMKLKGCEPNVWIYNSLLDMHGRA  292

Query  440  NKVDELVKLLQDLKTDETKLDERLYRSALNA  348
              + ++ KL +++K  +   D+  Y S ++A
Sbjct  293  KNLRQVEKLWKEMKRRKVTPDKVTYSSVISA  323



>ref|XP_002314741.2| hypothetical protein POPTR_0010s10900g [Populus trichocarpa]
 gb|EEF00912.2| hypothetical protein POPTR_0010s10900g [Populus trichocarpa]
Length=582

 Score =   282 bits (721),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSM++MYGKTGR ++ATRLVAKMK +GCEPNVWIYN+LLD+HGRA N++Q
Sbjct  407  KGFDKCVVAYSSMISMYGKTGRARDATRLVAKMKLKGCEPNVWIYNSLLDMHGRAKNLRQ  466

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRKV PD+V+Y+SVISAY+K+KE E CV+YY ++++NGG  D AMAGIM G
Sbjct  467  VEKLWKEMKRRKVAPDKVTYSSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAG  526

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK++++DELVKLL+D+K++ T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  527  VFSKISRIDELVKLLRDMKSEGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  579


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/151 (23%), Positives = 73/151 (48%), Gaps = 2/151 (1%)
 Frame = -2

Query  800  CIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVW  621
            CI  + ++VN + K      A ++  ++K  GC+P    Y ++++ + RA    + E V+
Sbjct  344  CI--FCAIVNGFSKRRGFSAAVKVYEELKYDGCDPGQVTYASVINAYCRAGLYSKAEMVF  401

Query  620  KEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKM  441
             EM+ +      V+Y+S+IS Y K        +     KL G + +  +   ++ +  + 
Sbjct  402  SEMEEKGFDKCVVAYSSMISMYGKTGRARDATRLVAKMKLKGCEPNVWIYNSLLDMHGRA  461

Query  440  NKVDELVKLLQDLKTDETKLDERLYRSALNA  348
              + ++ KL +++K  +   D+  Y S ++A
Sbjct  462  KNLRQVEKLWKEMKRRKVAPDKVTYSSVISA  492



>ref|XP_010270795.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nelumbo nucifera]
Length=636

 Score =   283 bits (724),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKCIVAY++MV+MYGK GR ++A +LVAKMKERGCEPNVWIYN+L+D+HGRA N++Q
Sbjct  433  KGFDKCIVAYATMVSMYGKVGRLRDAMKLVAKMKERGCEPNVWIYNSLIDMHGRAQNLRQ  492

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRKV PD+VSYTS+I+AYSKA E E+C+K YQ+F+ NGGK DRA+AGIMVG
Sbjct  493  VEKLWKEMKRRKVAPDKVSYTSLITAYSKAGEFEACIKLYQEFRFNGGKLDRALAGIMVG  552

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  294
            VFSK ++++EL+KLLQD+K + T LD +LYRSALNALRDAGL+++ KW +ESFA
Sbjct  553  VFSKSSRINELMKLLQDMKLEGTGLDVKLYRSALNALRDAGLQVQVKWFEESFA  606



>ref|XP_006470889.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Citrus sinensis]
Length=603

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYS+MV MYGKTGR ++A RLVAKMK +GCEPNVWIYN+L+D+HGRA N++Q
Sbjct  428  KGFDKCVVAYSTMVAMYGKTGRIRDAMRLVAKMKAKGCEPNVWIYNSLMDMHGRAKNLRQ  487

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEM+RRKV PD+VSYT+VISAY++A+E + CVK+Y +F++NGG  DRA+AGIMVG
Sbjct  488  VEKLWKEMERRKVTPDKVSYTTVISAYNRAREFDMCVKFYNEFRMNGGVIDRAIAGIMVG  547

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK+++++ELVKLLQD+K++ TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  548  VFSKLSQIEELVKLLQDMKSEGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  600



>ref|XP_006420692.1| hypothetical protein CICLE_v10004581mg [Citrus clementina]
 gb|ESR33932.1| hypothetical protein CICLE_v10004581mg [Citrus clementina]
Length=603

 Score =   280 bits (716),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSMV MYGKTGR ++A  LVAKMK +GCEPNVWIYN+L+D+HGRA N++Q
Sbjct  428  KGFDKCVVAYSSMVAMYGKTGRIRDAMWLVAKMKAKGCEPNVWIYNSLMDMHGRAKNLRQ  487

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEM+RRKV PD+VSYT+VISAY++A+E + CVK+Y +F++NGG  DRAMAGIMVG
Sbjct  488  VEKLWKEMERRKVTPDKVSYTTVISAYNRAREFDMCVKFYNEFRMNGGVIDRAMAGIMVG  547

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK+++++ELVKLLQD+K++ TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  548  VFSKLSQIEELVKLLQDMKSEGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  600



>ref|XP_011021681.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like isoform X1 [Populus euphratica]
Length=613

 Score =   280 bits (715),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSM++MYGKTGR ++A RLVAKMK +GCEPNVWIYN+LLD+HGRA N++Q
Sbjct  438  KGFDKCVVAYSSMISMYGKTGRARDAMRLVAKMKLKGCEPNVWIYNSLLDMHGRAKNLRQ  497

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRKV PD+V+Y+SVISAY+K+KE E CV+YY ++++NGG  D AMAGIM G
Sbjct  498  VEKLWKEMKRRKVTPDKVTYSSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAG  557

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK++++DELVKLL+D+K++ T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  558  VFSKISRIDELVKLLRDMKSEGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  610


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 74/151 (49%), Gaps = 2/151 (1%)
 Frame = -2

Query  800  CIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVW  621
            CI  + ++VN + K      A ++  ++K  GCEP    Y ++++ + RA    + E V+
Sbjct  375  CI--FCAIVNGFSKRRGFSAAVKVYEELKYDGCEPGQVTYASVINAYCRAGLYSKAEMVF  432

Query  620  KEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKM  441
             EM+ +      V+Y+S+IS Y K       ++     KL G + +  +   ++ +  + 
Sbjct  433  SEMEEKGFDKCVVAYSSMISMYGKTGRARDAMRLVAKMKLKGCEPNVWIYNSLLDMHGRA  492

Query  440  NKVDELVKLLQDLKTDETKLDERLYRSALNA  348
              + ++ KL +++K  +   D+  Y S ++A
Sbjct  493  KNLRQVEKLWKEMKRRKVTPDKVTYSSVISA  523



>gb|KDO57832.1| hypothetical protein CISIN_1g007461mg [Citrus sinensis]
Length=603

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSMV MYGKTGR ++A  LVAKMK +GCEPNVWIYN+L+D+HGRA N++Q
Sbjct  428  KGFDKCVVAYSSMVAMYGKTGRIRDAMWLVAKMKAKGCEPNVWIYNSLMDMHGRAKNLRQ  487

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEM+RRKV PD+VSYT+VISAY++A+E + CVK+Y +F++NGG  DRA+AGIMVG
Sbjct  488  VEKLWKEMERRKVTPDKVSYTTVISAYNRAREFDMCVKFYNEFRMNGGVIDRAIAGIMVG  547

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK+++++ELVKLLQD+K++ TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  548  VFSKLSQIEELVKLLQDMKSEGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  600



>gb|KDP38220.1| hypothetical protein JCGZ_04863 [Jatropha curcas]
Length=415

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSS++ MYGKTGR ++A RLVAKMK  GCEPNVWIYN+LLD+HGR  N++Q
Sbjct  237  KGFDKCVVAYSSIIAMYGKTGRLRDAMRLVAKMKVNGCEPNVWIYNSLLDMHGRVKNLRQ  296

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+ KEMKRRK+ PD+V+YTSVISAY+K KE ++CV YY ++++NGG  D+AMAGIMVG
Sbjct  297  VEKLRKEMKRRKIAPDKVTYTSVISAYNKVKEFDTCVSYYHEYRINGGAIDKAMAGIMVG  356

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK+ ++DEL++LL D+K + T LD RLYRSA NALRDAGL+++AKWLQESF
Sbjct  357  VFSKIGRIDELLRLLHDMKIEGTPLDGRLYRSAFNALRDAGLQMQAKWLQESF  409


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/151 (22%), Positives = 76/151 (50%), Gaps = 2/151 (1%)
 Frame = -2

Query  800  CIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVW  621
            CI  + ++VN + +    + A R+  ++K   CEP    Y ++++ + R     + E V+
Sbjct  174  CI--FCAIVNGFARRRGFRAAVRVYEELKSDDCEPGQVTYASIINAYCRVGLYSKAEIVF  231

Query  620  KEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKM  441
             EM+ +      V+Y+S+I+ Y K   L   ++     K+NG + +  +   ++ +  ++
Sbjct  232  LEMQEKGFDKCVVAYSSIIAMYGKTGRLRDAMRLVAKMKVNGCEPNVWIYNSLLDMHGRV  291

Query  440  NKVDELVKLLQDLKTDETKLDERLYRSALNA  348
              + ++ KL +++K  +   D+  Y S ++A
Sbjct  292  KNLRQVEKLRKEMKRRKIAPDKVTYTSVISA  322



>ref|XP_007015128.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
 gb|EOY32747.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
Length=608

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSM+ MYGKTGR ++A +LVAKMK +GC+PNVWIYN+L+D+HGR  N++Q
Sbjct  433  KGFDKCVVAYSSMIAMYGKTGRIRDAMKLVAKMKHKGCQPNVWIYNSLMDMHGRVKNLRQ  492

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRK  PD+VSYT++ISAYS+A+E E C+K YQ+F+LNGG  D+AMAGIMVG
Sbjct  493  VEKLWKEMKRRKTAPDKVSYTTIISAYSRAREYEMCLKCYQEFRLNGGLIDKAMAGIMVG  552

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            +FSK +++DELVKLLQD+K + T+LD RLY SA+NALRDAGLE +AKWLQ++F
Sbjct  553  IFSKTSRIDELVKLLQDMKAEGTQLDGRLYHSAMNALRDAGLETQAKWLQKNF  605



>ref|XP_004151188.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cucumis sativus]
 gb|KGN49761.1| hypothetical protein Csa_5G114580 [Cucumis sativus]
Length=608

 Score =   272 bits (695),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSS+++MYGKTGR K+A RL+AKMKE+GC+PNVWIYN L+++HG+A N+KQ
Sbjct  429  KGFDKCVVAYSSLISMYGKTGRLKDAMRLLAKMKEKGCQPNVWIYNILMEMHGKAKNLKQ  488

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR+K+ PD+VSYTS+ISAY KA E E C +YY++F++NGG  D+A  GIMVG
Sbjct  489  VEKLWKEMKRKKIAPDKVSYTSIISAYVKASEFEKCEQYYREFRMNGGTIDKAFGGIMVG  548

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  294
            VFSK ++VDELVKLL+D+K + T+LDERLYR+ALNAL DAGL+++AKWLQ+ +A
Sbjct  549  VFSKTSRVDELVKLLRDMKLEGTRLDERLYRTALNALMDAGLQVQAKWLQDHYA  602


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/155 (24%), Positives = 76/155 (49%), Gaps = 2/155 (1%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G   CI  + ++VN Y     ++ A ++  K+ E GCEP    Y + ++ + R     + 
Sbjct  362  GVSDCI--FCAIVNGYATRRGYEAAVKVYEKLIEDGCEPGQVTYASAINAYCRVGLYSKA  419

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            E ++ EM+ +      V+Y+S+IS Y K   L+  ++     K  G + +  +  I++ +
Sbjct  420  EDIFGEMEEKGFDKCVVAYSSLISMYGKTGRLKDAMRLLAKMKEKGCQPNVWIYNILMEM  479

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
              K   + ++ KL +++K  +   D+  Y S ++A
Sbjct  480  HGKAKNLKQVEKLWKEMKRKKIAPDKVSYTSIISA  514



>ref|XP_004172063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cucumis sativus]
Length=608

 Score =   272 bits (695),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSS+++MYGKTGR K+A RL+AKMKE+GC+PNVWIYN L+++HG+A N+KQ
Sbjct  429  KGFDKCVVAYSSLISMYGKTGRLKDAMRLLAKMKEKGCQPNVWIYNILMEMHGKAKNLKQ  488

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR+K+ PD+VSYTS+ISAY KA E E C +YY++F++NGG  D+A  GIMVG
Sbjct  489  VEKLWKEMKRKKIAPDKVSYTSIISAYVKASEFEKCEQYYREFRMNGGTIDKAFGGIMVG  548

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  294
            VFSK ++VDELVKLL+D+K + T+LDERLYR+ALNAL DAGL+++AKWLQ+ +A
Sbjct  549  VFSKTSRVDELVKLLRDMKLEGTRLDERLYRTALNALMDAGLQVQAKWLQDHYA  602


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/155 (24%), Positives = 76/155 (49%), Gaps = 2/155 (1%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G   CI  + ++VN Y     ++ A ++  K+ E GCEP    Y + ++ + R     + 
Sbjct  362  GVSDCI--FCAIVNGYATRRGYEAAVKVYEKLIEDGCEPGQVTYASAINAYCRVGLYSKA  419

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            E ++ EM+ +      V+Y+S+IS Y K   L+  ++     K  G + +  +  I++ +
Sbjct  420  EDIFGEMEEKGFDKCVVAYSSLISMYGKTGRLKDAMRLLAKMKEKGCQPNVWIYNILMEM  479

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
              K   + ++ KL +++K  +   D+  Y S ++A
Sbjct  480  HGKAKNLKQVEKLWKEMKRKKIAPDKVSYTSIISA  514



>ref|XP_008465506.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Cucumis melo]
Length=608

 Score =   271 bits (694),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSS+++MYGKTGR K+A RL+AKMKE+GC+PNVWIYN L+++HG+A N+KQ
Sbjct  429  KGFDKCVVAYSSLISMYGKTGRLKDAMRLLAKMKEKGCQPNVWIYNILMEMHGKAKNLKQ  488

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR+K+ PD+VSYTS+I+AY KA E E C +YY++F++NGG  D+A+ GIMVG
Sbjct  489  VEKLWKEMKRKKIAPDKVSYTSIINAYVKASEFEKCEQYYREFRMNGGTIDKAIGGIMVG  548

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  294
            VFSK ++VDELVKLL+D+K + T+LDERLYRSALNAL DAGL+++AKWLQ+ +A
Sbjct  549  VFSKTSRVDELVKLLRDMKLEGTRLDERLYRSALNALMDAGLQVQAKWLQDHYA  602


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/155 (24%), Positives = 74/155 (48%), Gaps = 2/155 (1%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G   CI  + ++VN Y     +  A ++  K+   GCEP    Y + ++ + R     + 
Sbjct  362  GVSDCI--FCAIVNGYATRRGYDAAVKVYEKLIGDGCEPGQVTYASAINAYCRVGLYSKA  419

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            E ++ EM+ +      V+Y+S+IS Y K   L+  ++     K  G + +  +  I++ +
Sbjct  420  EDIFGEMEEKGFDKCVVAYSSLISMYGKTGRLKDAMRLLAKMKEKGCQPNVWIYNILMEM  479

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
              K   + ++ KL +++K  +   D+  Y S +NA
Sbjct  480  HGKAKNLKQVEKLWKEMKRKKIAPDKVSYTSIINA  514



>ref|XP_010043883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Eucalyptus grandis]
 gb|KCW85901.1| hypothetical protein EUGRSUZ_B02618 [Eucalyptus grandis]
Length=615

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G+DKC+VAYSSMV MYGK G+ +EA +LVAKMK RGC+PNVW+YNTLL+IHGRA N++Q
Sbjct  433  KGYDKCVVAYSSMVAMYGKRGKIREAMKLVAKMKARGCKPNVWVYNTLLEIHGRAKNLRQ  492

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            V+K+WKEMKR+KV PD+VSYTS+I+AY++A+E E+C+K+Y++F+ NGG  DRAM GIMVG
Sbjct  493  VDKIWKEMKRKKVAPDKVSYTSLIAAYNRAREFETCIKFYEEFRANGGSIDRAMGGIMVG  552

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK ++++EL++ LQD+K++ T+LD RLY SALNALRD+GL ++A+W QESF++A
Sbjct  553  VFSKSSRIEELIRFLQDMKSEGTELDGRLYGSALNALRDSGLLVQARWFQESFSMA  608



>ref|XP_003555735.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Glycine max]
 gb|KHM98995.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=609

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+ AYS+M+ MYG+TGR + A +LVAKMKERGC+PNVWIYN+L+D+HGR  N+KQ
Sbjct  434  KGFDKCVYAYSTMIVMYGRTGRVRSAMKLVAKMKERGCKPNVWIYNSLIDMHGRDKNLKQ  493

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            +EK+WKEMKRR+V PD+VSYTS+I AYSKA E E+CVK++ ++++NGG  DRAMAGIMVG
Sbjct  494  LEKLWKEMKRRRVAPDKVSYTSIIGAYSKAGEFETCVKFFNEYRMNGGLIDRAMAGIMVG  553

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK+  VDELVKLLQD+K + T+LD+RLY+SA NA +DAGL+I+A+W++ESF V 
Sbjct  554  VFSKVGLVDELVKLLQDMKAEGTRLDQRLYQSAWNAFKDAGLQIQARWMKESFLVT  609



>ref|XP_011090005.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Sesamum indicum]
Length=621

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFD CIVAYSSMV  Y K GR ++A RLVAKMKERGCEPNVW YN+LLD++GRA N++ 
Sbjct  446  KGFDNCIVAYSSMVAAYAKMGRTRDAMRLVAKMKERGCEPNVWTYNSLLDMNGRALNLRF  505

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK WKEMKRRK++PDRVSYT+VISAY++A+E E+CVKYY++FKL GGK DRAMAG MV 
Sbjct  506  VEKTWKEMKRRKIIPDRVSYTTVISAYNRAREFETCVKYYEEFKLTGGKMDRAMAGTMVA  565

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSKMN+V+E+++LL+D+K   T+LD R YRSA+NALRDAGL+ +A+WLQE+F
Sbjct  566  VFSKMNRVEEVIELLRDMKLQGTELDARFYRSAMNALRDAGLQSQARWLQETF  618



>gb|KHN38588.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=601

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+ AYS+M+ MYG+TGR + A +LVAKMKERGC+PNVWIYN+L+D+HGR  N+KQ
Sbjct  426  KGFDKCVYAYSTMIVMYGRTGRVRSAMKLVAKMKERGCKPNVWIYNSLIDMHGRDKNLKQ  485

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            +EK+WKEMKRR+V PD+VSYTS+I AYSKA E E+CVK + ++++NGG  DRA+AGIMVG
Sbjct  486  LEKLWKEMKRRRVAPDKVSYTSIIGAYSKAGEFETCVKLFNEYRMNGGLIDRALAGIMVG  545

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK+ +VDELVKLLQD+KT+ T+LD+RLY+SA NA +DAGL+++A+W++ESF V 
Sbjct  546  VFSKVGQVDELVKLLQDMKTEGTRLDQRLYQSAWNAFKDAGLQLQARWMKESFLVT  601



>ref|XP_003529243.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Glycine max]
Length=631

 Score =   270 bits (689),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+ AYS+M+ MYG+TGR + A +LVAKMKERGC+PNVWIYN+L+D+HGR  N+KQ
Sbjct  456  KGFDKCVYAYSTMIVMYGRTGRVRSAMKLVAKMKERGCKPNVWIYNSLIDMHGRDKNLKQ  515

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            +EK+WKEMKRR+V PD+VSYTS+I AYSKA E E+CVK + ++++NGG  DRA+AGIMVG
Sbjct  516  LEKLWKEMKRRRVAPDKVSYTSIIGAYSKAGEFETCVKLFNEYRMNGGLIDRALAGIMVG  575

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK+ +VDELVKLLQD+KT+ T+LD+RLY+SA NA +DAGL+++A+W++ESF V 
Sbjct  576  VFSKVGQVDELVKLLQDMKTEGTRLDQRLYQSAWNAFKDAGLQLQARWMKESFLVT  631



>ref|XP_008778816.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Phoenix dactylifera]
Length=614

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYS+M++MYGK GR ++A RL+AKMKE+GCEPNV++YN+L+D+HGR  N++Q
Sbjct  432  KGFDKCVVAYSNMISMYGKVGRVRDAMRLLAKMKEKGCEPNVYVYNSLIDMHGRRLNLRQ  491

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEKVWKEMKRR+V PD++SYTS+ISAY+KA++L+ C+++Y++FK+N GK DRA+AGIMVG
Sbjct  492  VEKVWKEMKRRRVXPDKISYTSIISAYNKARKLDECIRFYEEFKMNRGKVDRALAGIMVG  551

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  291
            VFSK ++ DELVKLLQD+K++ T LDERLY SALNALRDAGL++  KW ++SF +
Sbjct  552  VFSKGSRFDELVKLLQDMKSEGTGLDERLYESALNALRDAGLQVHMKWFEKSFGL  606



>gb|KJB35742.1| hypothetical protein B456_006G126500 [Gossypium raimondii]
Length=441

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSM+ MYGK G  ++A +++A+MK +GC+PNVWIYN+L+D+HGR  N++Q
Sbjct  260  KGFDKCVVAYSSMIAMYGKAGMIRDAMKVLAQMKAKGCQPNVWIYNSLMDMHGRVKNLRQ  319

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRK+ PD+VSYT+VISAY++ +E E CVK+YQ+F+LNGG  D+AMAG MVG
Sbjct  320  VEKLWKEMKRRKLAPDKVSYTTVISAYNRVRECEMCVKFYQEFRLNGGSIDKAMAGTMVG  379

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK +++DELV+LLQD+K + T+LD RLY SA+NALRDAGLE + KWLQ++F
Sbjct  380  VFSKTSRIDELVRLLQDMKAEGTELDGRLYHSAMNALRDAGLENQVKWLQKNF  432



>ref|XP_007222296.1| hypothetical protein PRUPE_ppa003348mg [Prunus persica]
 gb|EMJ23495.1| hypothetical protein PRUPE_ppa003348mg [Prunus persica]
Length=583

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSMV MYGKTGR ++A RLVAKMKERGC+PNVWIYN+L+D+HGR +N++Q
Sbjct  408  KGFDKCVVAYSSMVVMYGKTGRPRDAMRLVAKMKERGCKPNVWIYNSLMDMHGRDNNLRQ  467

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            V K+W EMKRRKV PD+VSYT+VI AY+KA + E C++YY +F+++GG  D+AMAG+MVG
Sbjct  468  VSKLWTEMKRRKVAPDKVSYTTVIGAYNKAGDFEMCMRYYHEFRIHGGVLDKAMAGMMVG  527

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK  +VDELVKLL+D+K++ T LD RLYRSALNAL D+GL+ + KWLQ SF V 
Sbjct  528  VFSKTGRVDELVKLLRDMKSEGTGLDGRLYRSALNALTDSGLQTQVKWLQGSFKVT  583



>ref|XP_010668078.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=617

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RGFDKC+VAYS+M+ MYGK G+ +EA  L+AKMKE+GCEPNVW+YN L+D HGR  NM+Q
Sbjct  435  RGFDKCVVAYSTMIVMYGKMGQLREAMTLLAKMKEKGCEPNVWVYNALIDSHGRVKNMRQ  494

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            V+K+WKEMKRRKV PDRVSYTS+I AYS+A+E E+C  +Y +++ +GG  D A+AGIMVG
Sbjct  495  VDKIWKEMKRRKVEPDRVSYTSIIGAYSRAREYETCTIFYDEYRKSGGVIDLALAGIMVG  554

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK+N++DE++KLLQDLK + TK+D RLYRSALNALRDAGL+++ +WL+E+F
Sbjct  555  VFSKINRIDEIIKLLQDLKAEGTKMDTRLYRSALNALRDAGLQMQVRWLEENF  607


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/155 (23%), Positives = 77/155 (50%), Gaps = 2/155 (1%)
 Frame = -2

Query  800  CIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVW  621
            CI  + ++VN Y K    K A R+  ++  +GCEP    Y+++++++ R +   + +KV+
Sbjct  372  CI--FCAIVNGYAKKRGLKVAARVYQELVSQGCEPGQVTYSSIINVYFRLALFYKAKKVF  429

Query  620  KEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKM  441
             EM+ R      V+Y+++I  Y K  +L   +      K  G + +  +   ++    ++
Sbjct  430  DEMQERGFDKCVVAYSTMIVMYGKMGQLREAMTLLAKMKEKGCEPNVWVYNALIDSHGRV  489

Query  440  NKVDELVKLLQDLKTDETKLDERLYRSALNALRDA  336
              + ++ K+ +++K  + + D   Y S + A   A
Sbjct  490  KNMRQVDKIWKEMKRRKVEPDRVSYTSIIGAYSRA  524



>emb|CDX91096.1| BnaC02g05010D [Brassica napus]
Length=613

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYS++++MYGKT R  +A +L+AKMK+RGC PN+WIYN+L+D+HGRA ++++
Sbjct  417  KGFDKCVVAYSNIIDMYGKTRRLSDAVKLMAKMKQRGCRPNIWIYNSLIDMHGRAMDLRR  476

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR KV+PD+VSYTS+ISAY++AKE E+CV+ Y +F++N GK DRAMAGIMVG
Sbjct  477  VEKIWKEMKRMKVLPDKVSYTSMISAYNRAKEFETCVELYHEFRMNRGKIDRAMAGIMVG  536

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK +++DEL++LLQD++ + T+LD RLY SALNALRDAGL  + +WLQESF +A
Sbjct  537  VFSKTSRIDELMRLLQDMRVERTRLDARLYSSALNALRDAGLNSQIRWLQESFDIA  592



>ref|XP_007153172.1| hypothetical protein PHAVU_003G013000g [Phaseolus vulgaris]
 gb|ESW25166.1| hypothetical protein PHAVU_003G013000g [Phaseolus vulgaris]
Length=609

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+ AYSSM+ MYG+TGR + ATRLVAKMKERGC+PNVWIYN+L+D+HGR  N+KQ
Sbjct  434  KGFDKCVYAYSSMIVMYGRTGRVRSATRLVAKMKERGCKPNVWIYNSLIDMHGRDKNLKQ  493

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            +EK+W+EMKRRKV PD+V+YTS+ISAY+KA E ESC+K + ++++ GG  DRAMAG MVG
Sbjct  494  LEKLWREMKRRKVAPDKVTYTSIISAYNKAGEFESCMKLFDEYRMKGGLIDRAMAGTMVG  553

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            V++K+ +VD+LVKLLQD+KT+ T+LD+RLY+SA NA +DAGL+++AKW++E F VA
Sbjct  554  VYTKVGQVDDLVKLLQDMKTEGTRLDQRLYQSAWNAFKDAGLQLQAKWMKEIFLVA  609



>ref|XP_002871585.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47844.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=609

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 162/196 (83%), Gaps = 6/196 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYS++++MYGKT R  +A +L+AKMK+RGC+PN+WIYN+L+D+HGRA ++++
Sbjct  417  KGFDKCVVAYSNIMDMYGKTQRLSDAVKLMAKMKQRGCKPNIWIYNSLIDMHGRAKDLRR  476

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             EK+WKEMKR KV+PD+VSYTS+ISAY++AKELE CV+ YQ+F++N GK DRAMAGIMVG
Sbjct  477  AEKIWKEMKRAKVLPDKVSYTSMISAYNRAKELERCVELYQEFRMNRGKIDRAMAGIMVG  536

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*II  276
            VFSK +++DEL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A    
Sbjct  537  VFSKTSRIDELMRLLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA----  592

Query  275  SCNSAKKKPKNIVNTR  228
               ++  +  N  NTR
Sbjct  593  --QTSASRYSNTKNTR  606



>dbj|BAB10598.1| unnamed protein product [Arabidopsis thaliana]
Length=563

 Score =   263 bits (673),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYS++++MYGKT R  +A RL+AKMK+RGC+PN+WIYN+L+D+HGRA ++++
Sbjct  371  KGFDKCVVAYSNIMDMYGKTRRLSDAVRLMAKMKQRGCKPNIWIYNSLIDMHGRAMDLRR  430

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             EK+WKEMKR KV+PD+VSYTS+ISAY+++KELE CV+ YQ+F++N GK DRAMAGIMVG
Sbjct  431  AEKIWKEMKRAKVLPDKVSYTSMISAYNRSKELERCVELYQEFRMNRGKIDRAMAGIMVG  490

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK +++DEL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  491  VFSKTSRIDELMRLLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA  546



>ref|XP_008220989.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Prunus mume]
 ref|XP_008220990.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Prunus mume]
Length=615

 Score =   265 bits (676),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSMV MYGKTGR ++A RLVAKMKERGC+PNVWIYN+L+D+HGR +N++Q
Sbjct  440  KGFDKCVVAYSSMVVMYGKTGRPRDAMRLVAKMKERGCKPNVWIYNSLMDMHGRDNNLRQ  499

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            V K+W EMKRRKV PD+VSYT+VI AY+KA + E C++YY +F+++GG  D+AMAG+MVG
Sbjct  500  VSKLWTEMKRRKVAPDKVSYTTVIGAYNKAGDFEMCMRYYHEFRIHGGVLDKAMAGMMVG  559

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK  +VDELVKLL+D+K++ T LD RLYRSALNAL D+GL+ + KWLQ SF V 
Sbjct  560  VFSKTGQVDELVKLLRDMKSEGTGLDGRLYRSALNALTDSGLQTQVKWLQGSFKVT  615



>gb|KJB35743.1| hypothetical protein B456_006G126500 [Gossypium raimondii]
Length=585

 Score =   263 bits (673),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSM+ MYGK G  ++A +++A+MK +GC+PNVWIYN+L+D+HGR  N++Q
Sbjct  404  KGFDKCVVAYSSMIAMYGKAGMIRDAMKVLAQMKAKGCQPNVWIYNSLMDMHGRVKNLRQ  463

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRK+ PD+VSYT+VISAY++ +E E CVK+YQ+F+LNGG  D+AMAG MVG
Sbjct  464  VEKLWKEMKRRKLAPDKVSYTTVISAYNRVRECEMCVKFYQEFRLNGGSIDKAMAGTMVG  523

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK +++DELV+LLQD+K + T+LD RLY SA+NALRDAGLE + KWLQ++F
Sbjct  524  VFSKTSRIDELVRLLQDMKAEGTELDGRLYHSAMNALRDAGLENQVKWLQKNF  576



>ref|NP_196881.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q66GP4.1|PP379_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AAU05481.1| At5g13770 [Arabidopsis thaliana]
 gb|AAU95422.1| At5g13770 [Arabidopsis thaliana]
 gb|AED91939.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=609

 Score =   264 bits (674),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYS++++MYGKT R  +A RL+AKMK+RGC+PN+WIYN+L+D+HGRA ++++
Sbjct  417  KGFDKCVVAYSNIMDMYGKTRRLSDAVRLMAKMKQRGCKPNIWIYNSLIDMHGRAMDLRR  476

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             EK+WKEMKR KV+PD+VSYTS+ISAY+++KELE CV+ YQ+F++N GK DRAMAGIMVG
Sbjct  477  AEKIWKEMKRAKVLPDKVSYTSMISAYNRSKELERCVELYQEFRMNRGKIDRAMAGIMVG  536

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK +++DEL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  537  VFSKTSRIDELMRLLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA  592



>gb|KHN48767.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=221

 Score =   252 bits (643),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+ AYS+M+ MYG+ GR   A +LVAKMK+RGC+PNVWIYN+L+D+H R +N+KQ
Sbjct  46   KGFDKCVYAYSTMIVMYGRMGRVTSAMKLVAKMKQRGCKPNVWIYNSLIDMHRRDNNLKQ  105

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            +EK+WKEMKRR+V PD+VSYT++I AYSKA E E+CVK + ++++NGG  DRAMAGIMVG
Sbjct  106  LEKLWKEMKRRRVAPDKVSYTTIIGAYSKAGEFETCVKLFNEYRMNGGLIDRAMAGIMVG  165

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK+  VDEL+KLLQD+K +  +LD+RLY+SA NA +D GL+I+A+W++E F V 
Sbjct  166  VFSKVGLVDELLKLLQDMKAEGKRLDQRLYQSAWNAFKDVGLQIQARWMKEIFFVT  221



>gb|KFK25604.1| hypothetical protein AALP_AA8G136200 [Arabis alpina]
Length=606

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYS++++MYGKT R  +A +L+AKMK+RGC PN+WIYN+L+D+HGRA ++++
Sbjct  412  KGFDKCVVAYSNIMDMYGKTRRLSDAVKLMAKMKQRGCRPNIWIYNSLIDMHGRAMDLRR  471

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR +V+PD+VSYTS+ISAY++AKE E CV+ YQ+F++N GK DRAMAGIMVG
Sbjct  472  VEKIWKEMKRMRVLPDKVSYTSMISAYNRAKEFEQCVELYQEFRMNRGKIDRAMAGIMVG  531

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK +++DEL++LLQD+K + TKLD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  532  VFSKTSRIDELMRLLQDMKAERTKLDVRLYTSALNALRDAGLNSQIRWLQESFDSA  587



>ref|XP_009125945.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Brassica rapa]
 emb|CDX85626.1| BnaA02g01870D [Brassica napus]
Length=613

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYS++++MYGKT R  +A +L+AKMK+RGC PN+WIYN+L+D+HGR  ++++
Sbjct  417  KGFDKCVVAYSNIIDMYGKTRRLSDAVKLMAKMKQRGCRPNIWIYNSLIDMHGRGMDLRR  476

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR KV+PD+VSYTS+ISAY++AKE E+CV+ Y +F++N GK DRAMAGIMVG
Sbjct  477  VEKIWKEMKRMKVLPDKVSYTSMISAYNRAKEFEACVELYHEFRMNRGKIDRAMAGIMVG  536

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK +++DEL++LLQD++ + T+LD RLY SALNALRDAGL  + +WLQESF +A
Sbjct  537  VFSKTSRIDELMRLLQDMRVERTRLDARLYSSALNALRDAGLNSQIRWLQESFDIA  592



>ref|XP_010492155.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Camelina sativa]
Length=614

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYS++++MYGKT R  +A +L+AKMK+RGC+PN+WIYN+L+D+HGRA ++++
Sbjct  414  KGFDKCVVAYSNIMDMYGKTRRLSDAVKLMAKMKQRGCKPNIWIYNSLIDMHGRAMDIRR  473

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR KV+PD+VSYTS+ISAY++AKELE C++ YQ+F++N GK DRAM GIMVG
Sbjct  474  VEKIWKEMKRAKVLPDKVSYTSMISAYNRAKELERCMELYQEFRMNRGKIDRAMGGIMVG  533

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*II  276
            VFSK +++DEL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A    
Sbjct  534  VFSKTSRIDELMRLLQDMKVEGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAAQTSA  593

Query  275  SCNSAKKKPKNI  240
            S  S  K  KN+
Sbjct  594  SRYSNMKNTKNL  605



>ref|XP_006576030.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Glycine max]
Length=258

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+ AYS+M+ MYG+ GR   A +LVAKMK+RGC+PNVWIYN+L+D+H R +N+KQ
Sbjct  83   KGFDKCVYAYSTMIVMYGRMGRVTSAMKLVAKMKQRGCKPNVWIYNSLIDMHRRDNNLKQ  142

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            +EK+WKEMKRR+V PD+VSYT++I AYSKA E E+CVK + ++++NGG  DRAMAGIMVG
Sbjct  143  LEKLWKEMKRRRVAPDKVSYTTIIGAYSKAGEFETCVKLFNEYRMNGGLIDRAMAGIMVG  202

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK+  VDEL+KLLQD+K +  +LD+RLY+SA NA +D GL+I+A+W++E F V 
Sbjct  203  VFSKVGLVDELLKLLQDMKAEGKRLDQRLYQSAWNAFKDVGLQIQARWMKEIFFVT  258



>ref|XP_006289562.1| hypothetical protein CARUB_v10003108mg [Capsella rubella]
 gb|EOA22460.1| hypothetical protein CARUB_v10003108mg [Capsella rubella]
Length=612

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYS++++MYGKT R  +A +L+AKMK+RGC+PN+WIYN+L+D+HGRA ++++
Sbjct  418  KGFDKCVVAYSNIMDMYGKTRRLSDAVKLMAKMKQRGCKPNIWIYNSLIDMHGRAMDIRR  477

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR KV+PD+VSYTS+ISAY++AKEL+ CV+ YQ+F++N GK DRAMAGIMVG
Sbjct  478  VEKIWKEMKRAKVLPDKVSYTSMISAYNRAKELDRCVELYQEFRMNRGKIDRAMAGIMVG  537

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK +++DEL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  538  VFSKTSRIDELMRLLQDMKVEGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAA  593



>ref|XP_009351650.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Pyrus x bretschneideri]
Length=608

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GF KC+VAYSSMV MYGKTGR ++A RLVAKMKERGC+PNVWIYN+L+D+HGR  N++Q
Sbjct  433  KGFGKCVVAYSSMVVMYGKTGRPRDAMRLVAKMKERGCKPNVWIYNSLMDMHGRDKNLRQ  492

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            V ++W EMKRRK+VPD+VSYT++I AY+KA E E C+KYY +F+++GG  D+A+AG+MVG
Sbjct  493  VSRIWTEMKRRKIVPDKVSYTTIIGAYNKAGEYEMCMKYYHEFRVHGGVLDKALAGMMVG  552

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            +FSK  ++DELVKLL+D+K + T+LD RLYRSAL AL D+GLE++ KWLQ SF V 
Sbjct  553  IFSKTGRIDELVKLLRDMKAEGTELDGRLYRSALKALSDSGLEMQVKWLQGSFKVT  608



>ref|XP_010453475.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g13770, chloroplastic-like [Camelina sativa]
Length=602

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYS++++MYGKT R  +A +L+AKMK+RGC+PN+WIYN+L+D+HGRA ++++
Sbjct  414  KGFDKCVVAYSNIMDMYGKTRRLSDAVKLMAKMKQRGCKPNIWIYNSLIDMHGRAMDIRR  473

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR KV+PD+VSYTS+ISAY++AKELE C++ YQ+F+++ G+ DRAMAGIMVG
Sbjct  474  VEKIWKEMKRAKVLPDKVSYTSMISAYNRAKELERCMELYQEFRMSRGEIDRAMAGIMVG  533

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK +++DEL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  534  VFSKTSRIDELMRLLQDMKVEGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAA  589



>ref|XP_006399876.1| hypothetical protein EUTSA_v10016019mg [Eutrema salsugineum]
 gb|ESQ41329.1| hypothetical protein EUTSA_v10016019mg [Eutrema salsugineum]
Length=611

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYS++++MYGKT R  +A +L+AKMK+RGC+PN+WIYN+L+D+HGRA ++++
Sbjct  417  KGFDKCVVAYSNIIDMYGKTRRLSDAVKLMAKMKQRGCKPNIWIYNSLIDMHGRAMDLRR  476

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR KV+PD+VSYTS+I A ++AKELE CV+ Y +F++N GK DRAMAGIMVG
Sbjct  477  VEKIWKEMKRMKVLPDKVSYTSMIGACNRAKELERCVELYNEFRMNRGKIDRAMAGIMVG  536

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK +++DEL++LLQD+K + TKLD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  537  VFSKTSRIDELMRLLQDMKVERTKLDARLYSSALNALRDAGLNSQIRWLQESFDTA  592


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 68/147 (46%), Gaps = 0/147 (0%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            Y+ +     K+GR  EA   + +MK++G +    +Y+TL+     A  +  VEK++KE  
Sbjct  251  YTILCTSLAKSGRAFEALEFLEEMKDKGIQETSALYSTLIRALAGAREVTTVEKLFKEAG  310

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
             +K++ D      V+  Y +  ++E  ++     + N  +    +   +V  FSK     
Sbjct  311  EKKLLKDPEMCLKVVLMYVREGKMERTLEVVAAMRKNDLRVSDCILCAIVNGFSKQRGFA  370

Query  428  ELVKLLQDLKTDETKLDERLYRSALNA  348
            E V+  + LK  E +  +  Y   +NA
Sbjct  371  EAVRAYEWLKKQECEAGQVTYAITINA  397



>ref|XP_010547300.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Tarenaya hassleriana]
Length=632

 Score =   257 bits (657),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYS+MV+MYGKT R  +A +LVAKMK +GC+PN+++YN+L+D+H RA N+++
Sbjct  438  KGFDKCVVAYSNMVDMYGKTRRLSDAMKLVAKMKLKGCKPNIYVYNSLIDMHARAKNVRR  497

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKR KVVPD+V+YTS+ISAY+K KE E CV+ Y +F++N G+ DRAMAGIMVG
Sbjct  498  VEKIWKEMKRMKVVPDKVTYTSMISAYNKTKEFERCVELYHEFRMNRGEIDRAMAGIMVG  557

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT  285
            VFSK+++ DEL++LLQD+K   T+LD RLY SALNALRDAGL+++ +WLQE+F   T
Sbjct  558  VFSKISRFDELMRLLQDMKVQGTRLDGRLYSSALNALRDAGLQVQIRWLQENFEATT  614



>ref|XP_009400607.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=614

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYS+M++MYGK G+ K+A RL+AKMKE+GC+PNVW+YN+LLDIHGR  N++Q
Sbjct  434  KGFDKCVVAYSNMISMYGKMGKVKDAMRLLAKMKEKGCKPNVWVYNSLLDIHGRLMNLRQ  493

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+W+EMKRR++ PD+VSYTS+ISAYSKA+ ++ C+ ++++FK NGGK DRAMAGIMVG
Sbjct  494  VEKLWQEMKRRQIAPDKVSYTSIISAYSKARRIDECIDFFEEFKGNGGKVDRAMAGIMVG  553

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK +++DEL+KLLQD++   T LD RL+ SALNALRDAGL++     ++SF
Sbjct  554  VFSKGSRLDELIKLLQDMELAGTGLDARLHESALNALRDAGLQVHMNGFRKSF  606



>ref|XP_004298632.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=604

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSMV MYGKTGR +EA RLVAKMKERGC+PNVWIYN+L+D++GR +N + 
Sbjct  429  KGFDKCVVAYSSMVVMYGKTGRPREAMRLVAKMKERGCKPNVWIYNSLMDMYGRDNNTRH  488

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            V K+W EMKRRKV PD+VSYT+VI AY+KA + E C+++Y +++++GG  D+ MA +MVG
Sbjct  489  VAKLWSEMKRRKVAPDKVSYTTVIGAYNKAGDFEMCLRFYNEYRIHGGVLDKTMAAMMVG  548

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            VFSK  +VDELVKLL+D+K + T LD RLYRSALNAL D+GLE++ KWLQ SF V 
Sbjct  549  VFSKSGRVDELVKLLRDMKAEGTGLDVRLYRSALNALADSGLEMQVKWLQSSFEVT  604



>ref|XP_008340510.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Malus domestica]
Length=608

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GF KC+VAYSSMV MYGKTGR ++A RLVAKMKERGC+PNVWIYN+L+D+HGR  N++Q
Sbjct  433  KGFGKCVVAYSSMVVMYGKTGRPRDAMRLVAKMKERGCKPNVWIYNSLMDMHGRDKNLRQ  492

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            V K+W EMKRRK+ PD+VSYT++I AY+KA E E C+KYY +F++ GG  D+A+AG+MV 
Sbjct  493  VSKIWTEMKRRKIAPDKVSYTTIIGAYNKAGEYEMCMKYYHEFRVQGGVLDKALAGMMVA  552

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            +FSK  ++DELVKLL+D+K +  +LD RLYRSAL AL D+GLE++ KWLQ SF V 
Sbjct  553  IFSKTGRIDELVKLLRDMKAEGAELDGRLYRSALKALTDSGLEMQVKWLQGSFKVT  608



>gb|EYU36097.1| hypothetical protein MIMGU_mgv1a020159mg [Erythranthe guttata]
Length=573

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G+  C+VAYSSM+  Y KTGR KEA  LVAKMK+RGCEPNVWIYN++LD++GRASNM+ 
Sbjct  399  KGYRNCVVAYSSMIAAYAKTGRTKEANMLVAKMKQRGCEPNVWIYNSILDMNGRASNMRL  458

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK WKEMKRR++VPDRVSYTSVIS Y++ KE + C++YY++FK+ GGK D+AMAG+MV 
Sbjct  459  VEKTWKEMKRRRIVPDRVSYTSVISGYNRVKEFDKCIEYYEEFKMTGGKIDKAMAGVMVA  518

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            V+SK N+V ELV+LLQD+K +   LD R Y SA++ALRDAGL+++ +WLQE F
Sbjct  519  VYSKTNRVAELVELLQDMKMEGAVLDARFYSSAMSALRDAGLQVQTRWLQEMF  571



>ref|XP_006853735.1| hypothetical protein AMTR_s00056p00173630 [Amborella trichopoda]
 gb|ERN15202.1| hypothetical protein AMTR_s00056p00173630 [Amborella trichopoda]
Length=616

 Score =   254 bits (649),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GF++CI+AYS++V +YGKTGR K+A +LVA+MK+ GC PNVW+YN+LLD+HG+A N++Q
Sbjct  434  QGFNECIIAYSNVVAIYGKTGRIKDAMKLVAQMKQVGCSPNVWVYNSLLDMHGKAMNLRQ  493

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK WKEMKRR+V PDRVSYTSVI AYSKA E E C++++++F++NGG+ D+ M GIMVG
Sbjct  494  VEKTWKEMKRRRVQPDRVSYTSVILAYSKAGECEECMRFFKEFRMNGGRIDKIMGGIMVG  553

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  294
            VFSK N++DELV LLQD+K + T LDERL RSA NALRDAGL+ +  WL ESF 
Sbjct  554  VFSKSNRIDELVTLLQDMKLEGTLLDERLKRSAANALRDAGLQAQVGWLNESFG  607



>ref|XP_006420695.1| hypothetical protein CICLE_v10006779mg [Citrus clementina]
 gb|ESR33935.1| hypothetical protein CICLE_v10006779mg [Citrus clementina]
Length=382

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 146/173 (84%), Gaps = 10/173 (6%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSMV MYGKTGR ++A RLVAKMK +GCEPNVWIYN+L+D+HGRA N++Q
Sbjct  217  KGFDKCVVAYSSMVAMYGKTGRIRDAMRLVAKMKAKGCEPNVWIYNSLMDMHGRAKNLRQ  276

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRKV P+          Y+ A+  +  VK+Y +FK+NGG  DRAMAGIMVG
Sbjct  277  VEKLWKEMKRRKVTPE----------YNMARGFDMFVKFYNEFKMNGGVIDRAMAGIMVG  326

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK+++++ELVKLL D+K++ TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  327  VFSKLSQIEELVKLLGDMKSEGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  379



>ref|XP_004498165.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cicer arietinum]
 ref|XP_004517308.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cicer arietinum]
Length=632

 Score =   254 bits (648),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSM+ MYGKTGR   A RLVAKMKERGC+PNVWIYN+L+D+HG+  N++Q
Sbjct  457  KGFDKCVVAYSSMIVMYGKTGRLSNAMRLVAKMKERGCKPNVWIYNSLIDMHGKEKNLRQ  516

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            +EK+WKEMKRRKV PD+++YTS+I AY K  E + C++ Y +++LN G  D+AMAG MVG
Sbjct  517  LEKLWKEMKRRKVAPDKITYTSIIGAYCKIGEFDKCIELYNEYRLNKGVIDKAMAGTMVG  576

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            V+SK+ +VDELVKLLQD+K++ T+LD+RLY+SA NA  +AG++++ KW++ESF V 
Sbjct  577  VYSKVGQVDELVKLLQDMKSEGTRLDQRLYQSAWNAFAEAGMQVQVKWMKESFHVT  632



>gb|KEH40726.1| PPR containing plant-like protein [Medicago truncatula]
Length=605

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSM+ MYG+TGR + A +LVAKMKE+GC+PNVWIYN+L+D+HG+  N++Q
Sbjct  430  KGFDKCVVAYSSMIVMYGRTGRLRNAMKLVAKMKEKGCKPNVWIYNSLIDMHGKEKNLRQ  489

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            +EK+W EMKRRKV PD+++YTS+I AY KA+E + C+K Y +++LN G  D+AMAG MVG
Sbjct  490  IEKLWNEMKRRKVAPDKITYTSIIGAYCKAQEFDKCIKLYNEYRLNKGAIDKAMAGTMVG  549

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            V+SK+  VDELVKLLQD+K + T+LD+RLY+SA NA  +AG++++ KW++ESF V 
Sbjct  550  VYSKVGMVDELVKLLQDMKMEGTRLDQRLYQSAWNAFTEAGMQLQVKWMKESFIVT  605



>ref|XP_011025175.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Populus euphratica]
Length=603

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 144/167 (86%), Gaps = 2/167 (1%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSS+++MYGKTGR ++A RLVAKMK +GC+PN WIYN+L+D+HGRA ++++
Sbjct  437  KGFDKCVVAYSSIISMYGKTGRPRDAMRLVAKMKLKGCQPNTWIYNSLVDMHGRAKDLRR  496

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRKV PD+V+YTS+ISAYSK+KE E CV+++ ++++NGG  D A+AGIMVG
Sbjct  497  VEKLWKEMKRRKVAPDKVTYTSIISAYSKSKEYEMCVRFFHEYRINGGVIDGAIAGIMVG  556

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  315
            VFSK++++DEL+KLL+D+K++   +DERLY SA NA+     E+R K
Sbjct  557  VFSKISRIDELLKLLRDMKSEGAPIDERLYISATNAM--VAKELRGK  601



>ref|XP_002312498.2| hypothetical protein POPTR_0008s14240g [Populus trichocarpa]
 gb|EEE89865.2| hypothetical protein POPTR_0008s14240g [Populus trichocarpa]
Length=603

 Score =   235 bits (599),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 144/167 (86%), Gaps = 2/167 (1%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSS+++MYGKTGR ++A RLVAKMK +GC+PN WIYN+L+D+HGRA ++++
Sbjct  437  KGFDKCVVAYSSIISMYGKTGRPRDAMRLVAKMKLKGCQPNTWIYNSLVDMHGRAKDLRR  496

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            VEK+WKEMKRRKV PD+V+YTS+ISAYSK+KE E CV+++ ++++NGG  D A+AGIMVG
Sbjct  497  VEKLWKEMKRRKVAPDKVTYTSIISAYSKSKEYEMCVRFFHEYRINGGVIDGAIAGIMVG  556

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  315
            VFSK++++DEL+KLL+D+K++   +DERLY SA NA+     E+R K
Sbjct  557  VFSKISRIDELLKLLRDMKSEGAPIDERLYVSATNAM--VAKELRGK  601



>emb|CCI55317.1| PH01B001I13.13 [Phyllostachys edulis]
Length=636

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG+DKC+VAY +M++MYGK  R  +A RL+A MK++GCEPNVW+YN+LLD+HGR  + +Q
Sbjct  425  RGYDKCVVAYGNMISMYGKIRRASDAMRLLALMKQKGCEPNVWVYNSLLDMHGRLGDSRQ  484

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             EK+WKEM RR V PDRVSYT++ISA++++ EL+ C+  YQ+F+  GGK D+A+AG+M G
Sbjct  485  AEKIWKEMMRRTVQPDRVSYTAIISAFNRSGELDRCMDLYQEFRETGGKVDKALAGLMAG  544

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  294
            VFSK ++ +EL+ LL+D+K +  KLD RLY S LN+LR+AGLE+  KWLQ +F+
Sbjct  545  VFSKCSRFNELIDLLKDMKLEGAKLDRRLYMSVLNSLREAGLEVHVKWLQSNFS  598



>ref|NP_001174064.1| Os04g0583150 [Oryza sativa Japonica Group]
 emb|CAE04154.2| OSJNBa0088A01.11 [Oryza sativa Japonica Group]
 gb|EAZ31756.1| hypothetical protein OsJ_15910 [Oryza sativa Japonica Group]
 dbj|BAG89668.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH92792.1| Os04g0583150 [Oryza sativa Japonica Group]
Length=606

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RGFDKC+VAY +M++MYGK  R  +A RL+A MK++GCEPN+W+YN+LLD+HGR  N +Q
Sbjct  429  RGFDKCVVAYGNMISMYGKISRASDAMRLLAVMKKKGCEPNIWVYNSLLDMHGRLGNSRQ  488

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             EK+WKEM RRK+ PDR+SYT++I+A++++ EL+ C+  YQ+F+  GGK D A+AG+MVG
Sbjct  489  AEKIWKEMMRRKIQPDRISYTAIINAFNRSGELDRCMDLYQEFRETGGKVDTALAGLMVG  548

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  294
            VFSK ++ +EL++LL+D++   T+LD RLY + L +LRDAGLE+  KWLQ +F+
Sbjct  549  VFSKCSRFNELIELLKDMQG--TRLDRRLYLTVLRSLRDAGLEVHVKWLQTNFS  600



>gb|EAY95290.1| hypothetical protein OsI_17116 [Oryza sativa Indica Group]
Length=608

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RGFDKC+VAY +M++MYGK  R  +A RL+A MK++GCEPN+W+YN+LLD+HGR  N +Q
Sbjct  431  RGFDKCVVAYGNMISMYGKISRASDAMRLLAVMKKKGCEPNIWVYNSLLDMHGRLGNSRQ  490

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             EK+WKEM RRK+ PDR+SYT++I+A++++ EL+ C+  YQ+F+  GGK D A+AG+MVG
Sbjct  491  AEKIWKEMMRRKIQPDRISYTAIINAFNRSGELDRCMDLYQEFRETGGKVDTALAGLMVG  550

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  294
            VFSK ++ +EL++LL+D++   T+LD RLY + L +LRDAGLE+  KWLQ +F+
Sbjct  551  VFSKCSRFNELIELLKDMQG--TRLDRRLYLTVLRSLRDAGLEVHVKWLQTNFS  602



>ref|XP_008350824.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like, partial [Malus domestica]
Length=585

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GF KC VAYSSMV MYGKTGR ++A RLVAKMKERGC+PNVWIYN+L+D+HGR  N++Q
Sbjct  433  KGFGKCAVAYSSMVVMYGKTGRPRDAMRLVAKMKERGCKPNVWIYNSLMDMHGRDKNLRQ  492

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            V K+W  MKRRKVVPD+VSYT+VISAY+KA E E C+KYY +F+++GG  D+A+AG+MVG
Sbjct  493  VSKIWTXMKRRKVVPDKVSYTTVISAYNKAGEFEMCMKYYHEFRVHGGVLDKALAGMMVG  552

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSA  357
            +FSK  ++DELVKLL+D+K++   LD RLYRSA
Sbjct  553  IFSKTGRIDELVKLLRDMKSEGMALDGRLYRSA  585



>gb|EMT31983.1| hypothetical protein F775_29312 [Aegilops tauschii]
Length=609

 Score =   227 bits (578),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RGFDKC+VAY +M++MYG+  R  +ATRL+A MK++GCEPNVW+YN+LLD+ G+  + +Q
Sbjct  430  RGFDKCVVAYGNMISMYGQIRRASDATRLLALMKQKGCEPNVWVYNSLLDMRGKLGDSRQ  489

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             EK+WKEM RRKV PDRVSYT+++ A++++ EL+ C+ YYQ+F+  GG  D+ +AG+MVG
Sbjct  490  AEKIWKEMMRRKVQPDRVSYTAIVGAFNRSGELDRCMDYYQEFRETGGTVDKTLAGLMVG  549

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VF K ++ ++L++LL+D+K   TKLD RLY   LN+LR+AGLE+  +WLQ+ F
Sbjct  550  VFCKTSRFNDLIQLLRDMKLQGTKLDRRLYMIVLNSLREAGLEVHVRWLQDYF  602



>ref|NP_001142291.1| uncharacterized protein LOC100274460 [Zea mays]
 gb|ACF78649.1| unknown [Zea mays]
 gb|ACF88108.1| unknown [Zea mays]
Length=419

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 136/173 (79%), Gaps = 2/173 (1%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RGFD+C+VAY +M++MYGK  R  EATRL+A MK++GCEPNV +YN+LLD+HGR  N KQ
Sbjct  242  RGFDRCVVAYGNMISMYGKIRRASEATRLLALMKQKGCEPNVLVYNSLLDMHGRLGNSKQ  301

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             EK+WKEM RRKV PDR+SYT++I A ++A EL+ C++ YQ+F+  G K D  MAG+MVG
Sbjct  302  AEKIWKEMVRRKVRPDRISYTAIILANNRAGELDRCMELYQEFRETGRKVDMVMAGLMVG  361

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            V SK ++ +EL++LL+++  + TKLD RLY S L +LRDAGLE+  KWLQ +F
Sbjct  362  VLSKTSRFNELIELLKEM--NGTKLDRRLYMSVLRSLRDAGLEVHVKWLQSNF  412



>ref|XP_006652694.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Oryza brachyantha]
Length=608

 Score =   224 bits (571),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 140/173 (81%), Gaps = 2/173 (1%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RGFDKC+VAY +M++MYGK  R  +ATRL+A MK++GCEPNVW+YN+LLD+HGR  + +Q
Sbjct  431  RGFDKCVVAYGNMISMYGKIRRASDATRLLAVMKKKGCEPNVWVYNSLLDMHGRLGSSRQ  490

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             EK+WKEM RRKV PDRVSYT++I++++++ EL+ C+  YQ+F+  GG  D+A+ G+MVG
Sbjct  491  AEKIWKEMMRRKVQPDRVSYTAIINSFNRSGELDRCMDLYQEFRETGGNVDKALGGLMVG  550

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK ++ +EL++L++D++   T+LD RLY + L +LRDAGLE+  KWL+ +F
Sbjct  551  VFSKCSRFNELIELMKDMQG--TRLDRRLYLTVLRSLRDAGLEVHEKWLETNF  601



>ref|XP_004976594.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Setaria italica]
Length=607

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 136/173 (79%), Gaps = 2/173 (1%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RGF+KC+VAY +M++MYGK  R  EA +L+A MK++GCEPNV +YN+LLD+HGR  N KQ
Sbjct  430  RGFEKCVVAYGNMISMYGKIRRASEAMKLLAMMKQKGCEPNVLVYNSLLDMHGRLGNAKQ  489

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             EK+WKEM RRKV PD++SYT +I A ++A EL  CV+ YQ+F+  GGK D++MAG+M G
Sbjct  490  AEKIWKEMARRKVRPDQISYTGIILANNRAGELHRCVELYQEFREAGGKVDKSMAGLMAG  549

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VFSK ++ +EL++LL+D+  + TKLD RLY S L +LRDAGLE+  KWL+ +F
Sbjct  550  VFSKCSRFNELIELLKDM--NATKLDRRLYMSVLRSLRDAGLEVHVKWLKSNF  600



>gb|ACG27989.1| hypothetical protein [Zea mays]
Length=603

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RGFD+C+VAY +M++MYGK  R  EATRL+A MK++GCEPNV +YN+LLD+HGR  N KQ
Sbjct  426  RGFDRCVVAYGNMISMYGKIRRASEATRLLALMKQKGCEPNVLVYNSLLDMHGRLGNSKQ  485

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             EK+WKEM RRKV PDR+SYT++I A ++A EL+ C++ YQ+F+  G K D+ MAG+MVG
Sbjct  486  AEKIWKEMLRRKVRPDRISYTAIILANNRAGELDRCMELYQEFRETGRKVDKVMAGLMVG  545

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            V SK ++ +EL++LL+++  + TKLD RLY S L +LRDAGLE+  KWLQ +F
Sbjct  546  VLSKTSRFNELIELLKEM--NGTKLDRRLYMSVLRSLRDAGLEVHVKWLQSNF  596



>ref|XP_003580383.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Brachypodium distachyon]
Length=612

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RGFDKC+VAY +M++MYG+  R  +ATRL+A MK++GCEPNVW+YN+LLD+ G+  + +Q
Sbjct  433  RGFDKCVVAYGNMISMYGQIRRASDATRLLALMKQKGCEPNVWVYNSLLDMRGKLGDSRQ  492

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             EK+WKEM RRKV PDR+SYT++I A++++ EL+ C+ +YQ+F+  G K D+ MA +MVG
Sbjct  493  AEKIWKEMVRRKVQPDRISYTAIIGAFNRSGELDRCMNFYQEFRETGMKVDQTMASLMVG  552

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  294
            VF K ++ +EL++LL+D+K    KLD RLY   LN+LR+AGLE+  KWLQ  F+
Sbjct  553  VFCKSSRFNELIELLRDMKLQGIKLDRRLYMIVLNSLREAGLEVHVKWLQNYFS  606



>tpg|DAA36322.1| TPA: hypothetical protein ZEAMMB73_184989 [Zea mays]
Length=603

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 136/173 (79%), Gaps = 2/173 (1%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RGFD+C+VAY +M++MYGK  R  EATRL+A MK++GCEPNV +YN+LLD+HGR  N KQ
Sbjct  426  RGFDRCVVAYGNMISMYGKIRRASEATRLLALMKQKGCEPNVLVYNSLLDMHGRLGNSKQ  485

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             EK+WKEM RRKV PDR+SYT++I A ++A EL+ C++ YQ+F+  G K D  MAG+MVG
Sbjct  486  AEKIWKEMVRRKVRPDRISYTAIILANNRAGELDRCMELYQEFRETGRKVDMVMAGLMVG  545

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            V SK ++ +EL++LL+++  + TKLD RLY S L +LRDAGLE+  KWLQ +F
Sbjct  546  VLSKTSRFNELIELLKEM--NGTKLDRRLYMSVLRSLRDAGLEVHVKWLQSNF  596



>emb|CAN71209.1| hypothetical protein VITISV_030057 [Vitis vinifera]
Length=109

 Score =   171 bits (434),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            MKR+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG+FSK  +
Sbjct  1    MKRKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGR  60

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            VDELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  61   VDELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESF  106



>gb|KDO42183.1| hypothetical protein CISIN_1g044084mg, partial [Citrus sinensis]
Length=343

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 104/131 (79%), Gaps = 16/131 (12%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +GFDKC+VAYSSMV MYGKTGR ++A RLVAKMK +GCEPNVWIYN+L+D+HGRA N++Q
Sbjct  229  KGFDKCVVAYSSMVAMYGKTGRIRDAMRLVAKMKPKGCEPNVWIYNSLMDMHGRAKNLRQ  288

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            +EK                YT+VISAY+ A+E + CVK+Y +F++NGG  DRAMAGIMVG
Sbjct  289  LEK----------------YTTVISAYNMAREFDMCVKFYNEFRMNGGVIDRAMAGIMVG  332

Query  455  VFSKMNKVDEL  423
            VFSK+++++EL
Sbjct  333  VFSKLSQIEEL  343



>dbj|BAD95045.1| putative protein [Arabidopsis thaliana]
Length=126

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = -2

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            MKR KV+PD+VSYTS+ISAY+++KELE CV+ YQ+F++N GK DRAMAGIMVGVFSK ++
Sbjct  1    MKRAKVLPDKVSYTSMISAYNRSKELERCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSR  60

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  288
            +DEL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  61   IDELMRLLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA  109



>ref|XP_001783392.1| predicted protein [Physcomitrella patens]
 gb|EDQ51786.1| predicted protein [Physcomitrella patens]
Length=540

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 107/161 (66%), Gaps = 0/161 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            GF + +VAYS++++MYGK G+ +EATRL + MK++GC+ N+ +YNT+LD++G+A  +   
Sbjct  334  GFRRNVVAYSTLIDMYGKVGKLQEATRLFSTMKQQGCKGNLIVYNTMLDMYGKAGRINDA  393

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            E++  E+K  K+VPD V+YT++I+AY++    E C++ ++  + +G K DR +  IM+ V
Sbjct  394  ERLMAELKDSKLVPDTVTYTTLINAYNRLGRFEECIRVFEQHRADGLKLDRILVAIMINV  453

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
            + K  +  +L +LL+ +     + D R+ ++ +    D G+
Sbjct  454  YGKARQYSKLAELLEVMPKSGIQPDTRILKTVVEIYEDGGM  494


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 84/171 (49%), Gaps = 5/171 (3%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            VAYS +++M+GK GRH++A     +++  G  P+   YNTL+    +   + Q   V+KE
Sbjct  165  VAYSILIDMFGKAGRHEDAAATFRELQMSGYLPDSVAYNTLIHAFAKVGMVDQATLVFKE  224

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
             +R   + D V + ++I  Y+KA+  +  +   +  K  G + +    G ++  F + N+
Sbjct  225  AQRSFCLDDPVIFYTMIQVYAKARMADQALHVLKLMKEIGLQPNELGYGSVLNAFMRANQ  284

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGL-----EIRAKWLQESF  297
                +KL ++++    +  E  Y + LN    AG      E+ AK  Q  F
Sbjct  285  PMGAIKLFEEMQESNCRFGESTYITMLNVYSKAGFHSAAEELLAKMRQLGF  335


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 79/160 (49%), Gaps = 4/160 (3%)
 Frame = -2

Query  758  TGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVS  579
            TGR + A    +KMK  GC P++ IYN L+  +G+  N  Q  K + ++K   ++PD  +
Sbjct  72   TGRFQTAQHWFSKMKLLGCPPDIVIYNILILEYGKRGNFSQAMKYFSQLKDEGLLPDSGT  131

Query  578  YTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  399
            Y +V+SA  K   ++   +  ++ +  G K D+    I++ +F K  + ++     ++L+
Sbjct  132  YCAVLSACRKVGNIDKGNETLKEMREAGIKPDQVAYSILIDMFGKAGRHEDAAATFRELQ  191

Query  398  TDETKLDERLYRSALNALRDAGLEIRA----KWLQESFAV  291
                  D   Y + ++A    G+  +A    K  Q SF +
Sbjct  192  MSGYLPDSVAYNTLIHAFAKVGMVDQATLVFKEAQRSFCL  231


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 64/124 (52%), Gaps = 0/124 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            IV Y+ ++  YGK G   +A +  +++K+ G  P+   Y  +L    +  N+ +  +  K
Sbjct  94   IVIYNILILEYGKRGNFSQAMKYFSQLKDEGLLPDSGTYCAVLSACRKVGNIDKGNETLK  153

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   + PD+V+Y+ +I  + KA   E     +++ +++G   D      ++  F+K+ 
Sbjct  154  EMREAGIKPDQVAYSILIDMFGKAGRHEDAAATFRELQMSGYLPDSVAYNTLIHAFAKVG  213

Query  437  KVDE  426
             VD+
Sbjct  214  MVDQ  217


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/162 (23%), Positives = 81/162 (50%), Gaps = 0/162 (0%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            Y ++++   K G   +    + +M+E G +P+   Y+ L+D+ G+A   +     ++E++
Sbjct  132  YCAVLSACRKVGNIDKGNETLKEMREAGIKPDQVAYSILIDMFGKAGRHEDAAATFRELQ  191

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
                +PD V+Y ++I A++K   ++     +++ + +    D  +   M+ V++K    D
Sbjct  192  MSGYLPDSVAYNTLIHAFAKVGMVDQATLVFKEAQRSFCLDDPVIFYTMIQVYAKARMAD  251

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  303
            + + +L+ +K    + +E  Y S LNA   A   + A  L E
Sbjct  252  QALHVLKLMKEIGLQPNELGYGSVLNAFMRANQPMGAIKLFE  293


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/154 (21%), Positives = 76/154 (49%), Gaps = 0/154 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            + Y S++N + +  +   A +L  +M+E  C      Y T+L+++ +A      E++  +
Sbjct  270  LGYGSVLNAFMRANQPMGAIKLFEEMQESNCRFGESTYITMLNVYSKAGFHSAAEELLAK  329

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M++     + V+Y+++I  Y K  +L+   + +   K  G K +  +   M+ ++ K  +
Sbjct  330  MRQLGFRRNVVAYSTLIDMYGKVGKLQEATRLFSTMKQQGCKGNLIVYNTMLDMYGKAGR  389

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            +++  +L+ +LK  +   D   Y + +NA    G
Sbjct  390  INDAERLMAELKDSKLVPDTVTYTTLINAYNRLG  423


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/132 (23%), Positives = 70/132 (53%), Gaps = 0/132 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            ++ Y++M++MYGK GR  +A RL+A++K+    P+   Y TL++ + R    ++  +V++
Sbjct  374  LIVYNTMLDMYGKAGRINDAERLMAELKDSKLVPDTVTYTTLINAYNRLGRFEECIRVFE  433

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            + +   +  DR+    +I+ Y KA++     +  +    +G + D  +   +V ++    
Sbjct  434  QHRADGLKLDRILVAIMINVYGKARQYSKLAELLEVMPKSGIQPDTRILKTVVEIYEDGG  493

Query  437  KVDELVKLLQDL  402
              +   +LL+ +
Sbjct  494  MCENAAELLRKI  505



>ref|XP_009782000.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X2 [Nicotiana sylvestris]
Length=608

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 87/156 (56%), Gaps = 0/156 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G   C++ Y+S++N   K G+++ A +L+ +M E G  P+   YNTLL    R  N+++ 
Sbjct  181  GLRPCLLTYNSIINGLCKNGQYRRARQLLVEMVESGLAPDTASYNTLLAECCRTGNLQEA  240

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            E V+KEM  R ++PD VSY+S+I  +S+   L   + YY+D K  G   D  +  I++G 
Sbjct  241  ESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILIGG  300

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
            F ++  + E +K+  ++      +D   Y + LN L
Sbjct  301  FCRIGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGL  336


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V Y+++++ + +     +A  LV +M  RG  P+V  YNT+LD   +   MK+   ++++
Sbjct  502  VTYNTLLDGFIREENMDKALDLVNEMGNRGLSPDVITYNTILDGFCKFGRMKEANMLYRK  561

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  483
            M  R + PD+ +YTS+I+ +     L+   +++ +    G   D
Sbjct  562  MVERGINPDKSTYTSLINGHVSQDNLKEAFRFHDEMLQRGFVPD  605


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG    ++ Y+++++ + K GR KEA  L  KM ERG  P+   Y +L++ H    N+K+
Sbjct  530  RGLSPDVITYNTILDGFCKFGRMKEANMLYRKMVERGINPDKSTYTSLINGHVSQDNLKE  589

Query  635  VEKVWKEMKRRKVVPD  588
              +   EM +R  VPD
Sbjct  590  AFRFHDEMLQRGFVPD  605


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/155 (23%), Positives = 69/155 (45%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V+YSS++ ++ +TGR   +      MK +G  P+  +Y  L+    R  +MK+  K+  
Sbjct  256  LVSYSSLIGLFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILIGGFCRIGSMKEAMKMRD  315

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM  + +  D V+Y ++++   K K L    + + +    G   D      ++    K  
Sbjct  316  EMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNPDFYTFTTVINGCCKCG  375

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             +D+ + L + +     K D   Y S ++     G
Sbjct  376  NMDKALTLFEAMLLRNLKPDVVTYNSLIDGFCKVG  410


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 52/112 (46%), Gaps = 0/112 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    IV  +S++  Y ++G    A + +  M+ +   P+   YNTLLD   R  NM + 
Sbjct  461  GIKPTIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIYPDSVTYNTLLDGFIREENMDKA  520

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRA  477
              +  EM  R + PD ++Y +++  + K   ++     Y+     G   D++
Sbjct  521  LDLVNEMGNRGLSPDVITYNTILDGFCKFGRMKEANMLYRKMVERGINPDKS  572


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/149 (19%), Positives = 67/149 (45%), Gaps = 0/149 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            + YS  +N +   G   +A RL  +M + G +P +   N+++  + R+ +  + +K    
Sbjct  432  ITYSIFINGFCNKGCVSDALRLWDEMIDLGIKPTIVTCNSIIKGYCRSGDASRADKFLNN  491

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M+ +++ PD V+Y +++  + + + ++  +    +    G   D      ++  F K  +
Sbjct  492  MRSQRIYPDSVTYNTLLDGFIREENMDKALDLVNEMGNRGLSPDVITYNTILDGFCKFGR  551

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNA  348
            + E   L + +       D+  Y S +N 
Sbjct  552  MKEANMLYRKMVERGINPDKSTYTSLING  580



>ref|XP_009781997.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009781998.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana sylvestris]
Length=726

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 87/156 (56%), Gaps = 0/156 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G   C++ Y+S++N   K G+++ A +L+ +M E G  P+   YNTLL    R  N+++ 
Sbjct  299  GLRPCLLTYNSIINGLCKNGQYRRARQLLVEMVESGLAPDTASYNTLLAECCRTGNLQEA  358

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            E V+KEM  R ++PD VSY+S+I  +S+   L   + YY+D K  G   D  +  I++G 
Sbjct  359  ESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILIGG  418

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
            F ++  + E +K+  ++      +D   Y + LN L
Sbjct  419  FCRIGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGL  454


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V Y+++++ + +     +A  LV +M  RG  P+V  YNT+LD   +   MK+   ++++
Sbjct  620  VTYNTLLDGFIREENMDKALDLVNEMGNRGLSPDVITYNTILDGFCKFGRMKEANMLYRK  679

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  483
            M  R + PD+ +YTS+I+ +     L+   +++ +    G   D
Sbjct  680  MVERGINPDKSTYTSLINGHVSQDNLKEAFRFHDEMLQRGFVPD  723


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG    ++ Y+++++ + K GR KEA  L  KM ERG  P+   Y +L++ H    N+K+
Sbjct  648  RGLSPDVITYNTILDGFCKFGRMKEANMLYRKMVERGINPDKSTYTSLINGHVSQDNLKE  707

Query  635  VEKVWKEMKRRKVVPD  588
              +   EM +R  VPD
Sbjct  708  AFRFHDEMLQRGFVPD  723


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/155 (23%), Positives = 69/155 (45%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V+YSS++ ++ +TGR   +      MK +G  P+  +Y  L+    R  +MK+  K+  
Sbjct  374  LVSYSSLIGLFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILIGGFCRIGSMKEAMKMRD  433

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM  + +  D V+Y ++++   K K L    + + +    G   D      ++    K  
Sbjct  434  EMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNPDFYTFTTVINGCCKCG  493

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             +D+ + L + +     K D   Y S ++     G
Sbjct  494  NMDKALTLFEAMLLRNLKPDVVTYNSLIDGFCKVG  528


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 52/112 (46%), Gaps = 0/112 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    IV  +S++  Y ++G    A + +  M+ +   P+   YNTLLD   R  NM + 
Sbjct  579  GIKPTIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIYPDSVTYNTLLDGFIREENMDKA  638

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRA  477
              +  EM  R + PD ++Y +++  + K   ++     Y+     G   D++
Sbjct  639  LDLVNEMGNRGLSPDVITYNTILDGFCKFGRMKEANMLYRKMVERGINPDKS  690


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/149 (19%), Positives = 67/149 (45%), Gaps = 0/149 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            + YS  +N +   G   +A RL  +M + G +P +   N+++  + R+ +  + +K    
Sbjct  550  ITYSIFINGFCNKGCVSDALRLWDEMIDLGIKPTIVTCNSIIKGYCRSGDASRADKFLNN  609

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M+ +++ PD V+Y +++  + + + ++  +    +    G   D      ++  F K  +
Sbjct  610  MRSQRIYPDSVTYNTLLDGFIREENMDKALDLVNEMGNRGLSPDVITYNTILDGFCKFGR  669

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNA  348
            + E   L + +       D+  Y S +N 
Sbjct  670  MKEANMLYRKMVERGINPDKSTYTSLING  698



>ref|XP_009625746.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X2 [Nicotiana tomentosiformis]
Length=608

 Score =   102 bits (253),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 85/156 (54%), Gaps = 0/156 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G   C++ Y+S++N   K G +  A +L+ ++ E G  P+   YNTLL    R  N+++ 
Sbjct  181  GLRPCLLTYNSIINGLCKNGHYSRARQLLVELAESGLAPDTASYNTLLAECCRTGNLQEA  240

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            E V+KEM  R ++PD VSY+S+I  +S+   L+  + YY+D K  G   D  +  I++G 
Sbjct  241  ESVFKEMLCRAIIPDLVSYSSLIGLFSRTGRLDCSLAYYEDMKSKGLTPDNVVYTILIGG  300

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
            F +   + E +K+  ++      +D   Y + LN L
Sbjct  301  FCRNGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGL  336


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 84/183 (46%), Gaps = 3/183 (2%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V Y+ ++  + + G  KEA ++  +M E+G   +V  YNT+L+   +   + + ++++ E
Sbjct  292  VVYTILIGGFCRNGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNE  351

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  R V PD  ++T++I+   K   ++  +  ++   L   K D      ++  F K+  
Sbjct  352  MVERGVNPDFYTFTTLINGCCKCGNMDKALTLFEGMLLRNLKPDVVTYNSLIDGFCKVGD  411

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE---SFAVAT*IISCNS  264
            +++   L  ++ +     +   Y   +N   + G    A  L +      +   I++CNS
Sbjct  412  MEKAFNLRDEMISVNISPNYITYSILINGFCNKGCVSDALRLWDEMIDLGIKPTIVTCNS  471

Query  263  AKK  255
              K
Sbjct  472  IIK  474


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V  +++++ + + G   +A  LV +M  +G  P+V  YNT+LD   +   MK+   ++++
Sbjct  502  VTSNTLLDGFIREGNMDKALDLVNEMGNQGLSPDVITYNTILDGFCKFGRMKEANMLYRK  561

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  483
            M  R + PD+ +YTS+I+ +     L+   +++ +    G   D
Sbjct  562  MVERGINPDKSTYTSLINGHVSLDNLKEAFRFHDEMLQRGFVPD  605


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/155 (23%), Positives = 69/155 (45%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V+YSS++ ++ +TGR   +      MK +G  P+  +Y  L+    R  +MK+  K+  
Sbjct  256  LVSYSSLIGLFSRTGRLDCSLAYYEDMKSKGLTPDNVVYTILIGGFCRNGSMKEAMKMRD  315

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM  + +  D V+Y ++++   K K L    + + +    G   D      ++    K  
Sbjct  316  EMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNPDFYTFTTLINGCCKCG  375

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             +D+ + L + +     K D   Y S ++     G
Sbjct  376  NMDKALTLFEGMLLRNLKPDVVTYNSLIDGFCKVG  410


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G    ++ Y+++++ + K GR KEA  L  KM ERG  P+   Y +L++ H    N+K+
Sbjct  530  QGLSPDVITYNTILDGFCKFGRMKEANMLYRKMVERGINPDKSTYTSLINGHVSLDNLKE  589

Query  635  VEKVWKEMKRRKVVPD  588
              +   EM +R  VPD
Sbjct  590  AFRFHDEMLQRGFVPD  605



>emb|CDP08449.1| unnamed protein product [Coffea canephora]
Length=714

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 91/156 (58%), Gaps = 0/156 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            GF  C++ ++ +VN   K G++ +AT+++ +M + G  P+   YN+LL    R+ N+ + 
Sbjct  287  GFKPCLLTFNCIVNGLCKNGKYGKATQVLDEMVKIGLSPDTATYNSLLAECCRSGNLSEA  346

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            E V+ EM  R V+PD VSY+S+I+ +S+   L+  + YY+D K NG   D+ +  I++G 
Sbjct  347  ESVFSEMLHRGVIPDLVSYSSLIALFSRVGLLDRALGYYKDMKSNGLIPDKVIYTILIGG  406

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
            F K   + E +++  ++      +D   Y + LNAL
Sbjct  407  FCKHGSMLEAMRIRDEMLEKGCLMDVVTYNTILNAL  442


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 81/183 (44%), Gaps = 3/183 (2%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V Y+ ++  + K G   EA R+  +M E+GC  +V  YNT+L+       + + +++  E
Sbjct  398  VIYTILIGGFCKHGSMLEAMRIRDEMLEKGCLMDVVTYNTILNALCNKKMLSEADQLLNE  457

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  R V PD  +YT++I+ Y K   +   +  ++       K D      ++  F K  +
Sbjct  458  MFERGVFPDYYTYTTLINGYCKDGNMSKALTLFRSMLQRNLKPDIVTYNTLIDGFCKAGE  517

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA---VAT*IISCNS  264
            ++E + L  ++ T     +   Y   +N     G    A  L E      +   +++CNS
Sbjct  518  IEEAILLRDEMITKSVLPNLITYSILINGFCSRGFISDALRLWEKMVDTRIQPSLVTCNS  577

Query  263  AKK  255
              K
Sbjct  578  LIK  580


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V Y++++N         EA +L+ +M ERG  P+ + Y TL++ + +  NM +   +++
Sbjct  432  VVTYNTILNALCNKKMLSEADQLLNEMFERGVFPDYYTYTTLINGYCKDGNMSKALTLFR  491

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCV  525
             M +R + PD V+Y ++I  + KA E+E  +
Sbjct  492  SMLQRNLKPDIVTYNTLIDGFCKAGEIEEAI  522


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 56/109 (51%), Gaps = 1/109 (1%)
 Frame = -2

Query  809  FDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVE  630
            F  C   Y++++N Y K     +A  L+++M+ +G  PNV  YN +LD   +   M++  
Sbjct  604  FPDCF-TYNTLINGYIKEENMDKAFDLLSEMENQGLSPNVITYNVMLDGFCKLGRMQEAN  662

Query  629  KVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  483
             ++++M  R + PDR +YTS+I+ +      +    ++ +    G   D
Sbjct  663  MLYRKMSGRGINPDRATYTSLINGHVSLDNFKEAAWFHDEMLQRGFMPD  711



>ref|XP_009625742.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625743.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625745.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
Length=726

 Score =   102 bits (254),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 85/156 (54%), Gaps = 0/156 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G   C++ Y+S++N   K G +  A +L+ ++ E G  P+   YNTLL    R  N+++ 
Sbjct  299  GLRPCLLTYNSIINGLCKNGHYSRARQLLVELAESGLAPDTASYNTLLAECCRTGNLQEA  358

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            E V+KEM  R ++PD VSY+S+I  +S+   L+  + YY+D K  G   D  +  I++G 
Sbjct  359  ESVFKEMLCRAIIPDLVSYSSLIGLFSRTGRLDCSLAYYEDMKSKGLTPDNVVYTILIGG  418

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
            F +   + E +K+  ++      +D   Y + LN L
Sbjct  419  FCRNGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGL  454


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 84/183 (46%), Gaps = 3/183 (2%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V Y+ ++  + + G  KEA ++  +M E+G   +V  YNT+L+   +   + + ++++ E
Sbjct  410  VVYTILIGGFCRNGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNE  469

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  R V PD  ++T++I+   K   ++  +  ++   L   K D      ++  F K+  
Sbjct  470  MVERGVNPDFYTFTTLINGCCKCGNMDKALTLFEGMLLRNLKPDVVTYNSLIDGFCKVGD  529

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE---SFAVAT*IISCNS  264
            +++   L  ++ +     +   Y   +N   + G    A  L +      +   I++CNS
Sbjct  530  MEKAFNLRDEMISVNISPNYITYSILINGFCNKGCVSDALRLWDEMIDLGIKPTIVTCNS  589

Query  263  AKK  255
              K
Sbjct  590  IIK  592


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V  +++++ + + G   +A  LV +M  +G  P+V  YNT+LD   +   MK+   ++++
Sbjct  620  VTSNTLLDGFIREGNMDKALDLVNEMGNQGLSPDVITYNTILDGFCKFGRMKEANMLYRK  679

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  483
            M  R + PD+ +YTS+I+ +     L+   +++ +    G   D
Sbjct  680  MVERGINPDKSTYTSLINGHVSLDNLKEAFRFHDEMLQRGFVPD  723


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/155 (23%), Positives = 69/155 (45%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V+YSS++ ++ +TGR   +      MK +G  P+  +Y  L+    R  +MK+  K+  
Sbjct  374  LVSYSSLIGLFSRTGRLDCSLAYYEDMKSKGLTPDNVVYTILIGGFCRNGSMKEAMKMRD  433

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM  + +  D V+Y ++++   K K L    + + +    G   D      ++    K  
Sbjct  434  EMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNPDFYTFTTLINGCCKCG  493

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             +D+ + L + +     K D   Y S ++     G
Sbjct  494  NMDKALTLFEGMLLRNLKPDVVTYNSLIDGFCKVG  528


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G    ++ Y+++++ + K GR KEA  L  KM ERG  P+   Y +L++ H    N+K+
Sbjct  648  QGLSPDVITYNTILDGFCKFGRMKEANMLYRKMVERGINPDKSTYTSLINGHVSLDNLKE  707

Query  635  VEKVWKEMKRRKVVPD  588
              +   EM +R  VPD
Sbjct  708  AFRFHDEMLQRGFVPD  723



>ref|XP_004237581.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Solanum lycopersicum]
Length=738

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 90/171 (53%), Gaps = 6/171 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G   C++ Y+S++N   K G++  A  L+ +M+E G  P+   YN LL    RA N+ + 
Sbjct  311  GLRPCLLTYNSILNGLCKNGQYGRARELLVEMEECGLAPDTTSYNALLAECCRAGNVLEA  370

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            E V+KEM  R ++PD VSY+S+I  +++   L+  + YY+  K  G   D  +  I++G 
Sbjct  371  ESVFKEMLCRAIIPDLVSYSSLIGLFARTGRLDRSLVYYEHMKRKGLTPDNVVYTILIGG  430

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQES  300
            F +   + E +K+  ++      +D   Y + LN L       + K LQE+
Sbjct  431  FCRNGSMKEAMKMRDEMLERSLVMDVVTYNTILNGL------CKGKMLQEA  475


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 70/155 (45%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V+YSS++ ++ +TGR   +      MK +G  P+  +Y  L+    R  +MK+  K+  
Sbjct  386  LVSYSSLIGLFARTGRLDRSLVYYEHMKRKGLTPDNVVYTILIGGFCRNGSMKEAMKMRD  445

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM  R +V D V+Y ++++   K K L+   + + +        D      ++  + K  
Sbjct  446  EMLERSLVMDVVTYNTILNGLCKGKMLQEANELFNEMLERDVNPDFYTFTTLINGYCKCG  505

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             +D+   L + +     K D   Y S ++     G
Sbjct  506  NMDKAQTLFEAMLLRNLKPDVVTYNSLIDGFCKVG  540


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 52/112 (46%), Gaps = 0/112 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    IV  +S++  Y + G    A + + KM+ +G  P+   YNTLLD   R  NM + 
Sbjct  591  GIKPTIVTCNSIIKGYCRCGDTSRAAKFLNKMQIQGLFPDSITYNTLLDGLIREENMDKA  650

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRA  477
              +  EM ++ + PD  SY +++  + K   ++     Y      G   DR+
Sbjct  651  LDLVNEMGKQGLSPDVFSYNTILDGFCKFGRMQEANMLYSKMVERGINPDRS  702


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            + Y+++++   +     +A  LV +M ++G  P+V+ YNT+LD   +   M++   ++ +
Sbjct  632  ITYNTLLDGLIREENMDKALDLVNEMGKQGLSPDVFSYNTILDGFCKFGRMQEANMLYSK  691

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  483
            M  R + PDR +YTS+I+ +     L+   +++ +    G   D
Sbjct  692  MVERGINPDRSTYTSLINGHVSQDNLKEAFRFHDEMLQRGFIPD  735


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G    + +Y+++++ + K GR +EA  L +KM ERG  P+   Y +L++ H    N+K+
Sbjct  660  QGLSPDVFSYNTILDGFCKFGRMQEANMLYSKMVERGINPDRSTYTSLINGHVSQDNLKE  719

Query  635  VEKVWKEMKRRKVVPD  588
              +   EM +R  +PD
Sbjct  720  AFRFHDEMLQRGFIPD  735



>ref|XP_011090170.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Sesamum indicum]
Length=715

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 85/154 (55%), Gaps = 0/154 (0%)
 Frame = -2

Query  806  DKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEK  627
            + C++ Y+S+VN   K GR++ A  +  +M + G  P+   YNTLL    R  N+ + E 
Sbjct  290  EPCLLTYNSIVNGLCKNGRYERAKEVFNEMIQIGMSPDTATYNTLLVECCRKDNVVEAEG  349

Query  626  VWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFS  447
            ++ EM RR VVPD VSY+S+I  +S+   L+  + YY+D +  G   D+ +  I++G F 
Sbjct  350  LFDEMLRRGVVPDLVSYSSIIGFFSRTGNLDRMMTYYRDMQSKGLTPDKFVYTILIGGFC  409

Query  446  KMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
            +   + + +K+  ++      +D   Y S LN L
Sbjct  410  RHGAISDAMKVRDEMMKLGCHMDVVTYNSILNGL  443


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 70/149 (47%), Gaps = 0/149 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            + Y +++N +   G   EA +L  +M ++G EPN+ I N L+  + R  +  +  +  K+
Sbjct  539  ITYGTLMNGFCDGGFLSEAFKLWNEMIDKGIEPNIIICNCLIKGYCRHGDPGKALEFLKK  598

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            MK R + PD +SY ++I  + K + +++     +  +      D     +++  F ++ +
Sbjct  599  MKPRGIFPDCISYNTLIHGFMKEENIDTAFDLVKRMEKEDLVPDLVTYNVILAQFCRLGR  658

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNA  348
            + E   + + +       D   Y S +N 
Sbjct  659  MQEANTIYRKMIEKGVNPDRSTYTSLING  687


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/188 (21%), Positives = 81/188 (43%), Gaps = 15/188 (8%)
 Frame = -2

Query  791  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  612
             Y+ ++  + + G   +A ++  +M + GC  +V  YN++L+   +   + + + ++ EM
Sbjct  400  VYTILIGGFCRHGAISDAMKVRDEMMKLGCHMDVVTYNSILNGLCKEKMLCEADALFNEM  459

Query  611  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  432
              R V PD  +YT++I+ Y K   ++     +        K D      ++  F K  ++
Sbjct  460  LERGVFPDFCTYTTLINGYCKTGYMDKASSLFTSMLQRNLKPDVITYNTLIDGFCKAGEM  519

Query  431  DELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF---------AVAT*I  279
            +  ++L  D+ +     +   Y + +N   D G      +L E+F          +   I
Sbjct  520  ERAIELRDDMISKMIHPNYITYGTLMNGFCDGG------FLSEAFKLWNEMIDKGIEPNI  573

Query  278  ISCNSAKK  255
            I CN   K
Sbjct  574  IICNCLIK  581


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 51/96 (53%), Gaps = 0/96 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V Y+S++N   K     EA  L  +M ERG  P+   Y TL++ + +   M +   ++ 
Sbjct  433  VVTYNSILNGLCKEKMLCEADALFNEMLERGVFPDFCTYTTLINGYCKTGYMDKASSLFT  492

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQD  510
             M +R + PD ++Y ++I  + KA E+E  ++   D
Sbjct  493  SMLQRNLKPDVITYNTLIDGFCKAGEMERAIELRDD  528


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/139 (21%), Positives = 69/139 (50%), Gaps = 0/139 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG       Y++++N Y KTG   +A+ L   M +R  +P+V  YNTL+D   +A  M++
Sbjct  462  RGVFPDFCTYTTLINGYCKTGYMDKASSLFTSMLQRNLKPDVITYNTLIDGFCKAGEMER  521

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
              ++  +M  + + P+ ++Y ++++ +     L    K + +    G + +  +   ++ 
Sbjct  522  AIELRDDMISKMIHPNYITYGTLMNGFCDGGFLSEAFKLWNEMIDKGIEPNIIICNCLIK  581

Query  455  VFSKMNKVDELVKLLQDLK  399
             + +     + ++ L+ +K
Sbjct  582  GYCRHGDPGKALEFLKKMK  600


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 56/109 (51%), Gaps = 1/109 (1%)
 Frame = -2

Query  809  FDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVE  630
            F  CI +Y+++++ + K      A  LV +M++    P++  YN +L    R   M++  
Sbjct  605  FPDCI-SYNTLIHGFMKEENIDTAFDLVKRMEKEDLVPDLVTYNVILAQFCRLGRMQEAN  663

Query  629  KVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  483
             ++++M  + V PDR +YTS+I+ Y   + L+   K + +    G   D
Sbjct  664  TIYRKMIEKGVNPDRSTYTSLINGYVSQENLKQAFKLHDEMLQRGFVPD  712


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/134 (22%), Positives = 61/134 (46%), Gaps = 0/134 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G +  I+  + ++  Y + G   +A   + KMK RG  P+   YNTL+    +  N+  
Sbjct  567  KGIEPNIIICNCLIKGYCRHGDPGKALEFLKKMKPRGIFPDCISYNTLIHGFMKEENIDT  626

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               + K M++  +VPD V+Y  +++ + +   ++     Y+     G   DR+    ++ 
Sbjct  627  AFDLVKRMEKEDLVPDLVTYNVILAQFCRLGRMQEANTIYRKMIEKGVNPDRSTYTSLIN  686

Query  455  VFSKMNKVDELVKL  414
             +     + +  KL
Sbjct  687  GYVSQENLKQAFKL  700



>gb|AIU48580.1| tetratricopeptide repeat-like superfamily protein, partial [Houttuynia 
cordata]
Length=470

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 94/170 (55%), Gaps = 0/170 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++N YGK  R +EA  +  +M + G  P    YNTLLD    +  +++ 
Sbjct  269  GLQPDVVSYTLLINAYGKARREEEALAVFEEMLDAGVRPTRKAYNTLLDAFAISGMVEKA  328

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R K  PD  SYT++ISAY  A ++E   K+++  + +G + +    G ++  
Sbjct  329  RTVFKSMRRDKCTPDLCSYTTMISAYVNAADMEGAEKFFRRVRQDGFEPNVVTYGALLKG  388

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  303
            ++K++ V++++K+ +D++    K ++ ++ + ++A           W +E
Sbjct  389  YAKIDDVEKIMKIYEDMRIQGIKPNQTIFTTIMDAHGKNDFGCAVTWYKE  438


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 76/152 (50%), Gaps = 3/152 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ M+ K G + +A  L  +M +RG       YN+L+      SN K+V  V+ +M+
Sbjct  210  FHMMIYMHKKAGSYAQARELFKEMAKRGIPQTTVTYNSLMSFE---SNYKEVSSVYDQMQ  266

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSYT +I+AY KA+  E  +  +++    G +  R     ++  F+    V+
Sbjct  267  RAGLQPDVVSYTLLINAYGKARREEEALAVFEEMLDAGVRPTRKAYNTLLDAFAISGMVE  326

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            +   + + ++ D+   D   Y + ++A  +A 
Sbjct  327  KARTVFKSMRRDKCTPDLCSYTTMISAYVNAA  358



>gb|AHC02098.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
polygalifolia]
Length=436

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  150  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  209

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S+I  Y K  E E      Q+ +  G + +      ++ +
Sbjct  210  IHLFRLMQRKNIVQNVVTYNSMIMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  269

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  270  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  317


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMIMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  304

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  305  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  337


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  50   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  254  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  313

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  314  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  369

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  370  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  405



>ref|XP_010936410.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic [Elaeis guineensis]
Length=719

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 105/199 (53%), Gaps = 11/199 (6%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V +++++ +Y  +G    A  +  +MK  G +PNV IYNTLLD  GRA    QV+ ++KE
Sbjct  299  VTFATVIRVYSHSGNFDGALNVYEEMKALGVKPNVVIYNTLLDAMGRAGRPWQVKTIFKE  358

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M ++ VVP+R +Y +++ +Y KA+  E  +  Y+  K  G + +  +  +++ + + +  
Sbjct  359  MDKKGVVPNRATYAALLRSYCKARYAEDALSVYRQMKEKGMEMNVILYNMLMSMCADIGC  418

Query  434  VDELVKLLQDLK--TDETKLDERLYRSALNALRDAGLEIRAKWL---------QESFAVA  288
            VDE  ++  ++K   D+ K D   Y + + A   +G  + A+ L         Q +  V 
Sbjct  419  VDEAAEIFAEMKGLPDDCKPDSWSYSALITAYSCSGKVLEAEGLLNEMLEAGYQPNIFVL  478

Query  287  T*IISCNSAKKKPKNIVNT  231
            T II C    ++  ++V +
Sbjct  479  TSIIQCYGKARQTDDVVRS  497


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG     V +S++++  G     ++A     KM E  C P+   Y+ ++D +GR+ N+++
Sbjct  222  RGVKPDNVTFSTIISCAGFCNLPEKAVEWFEKMPEFACSPDYVTYSAMIDAYGRSGNIEK  281

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  483
               ++   ++ K   D V++ +VI  YS +   +  +  Y++ K  G K +
Sbjct  282  ALGLYDRARQEKWRLDPVTFATVIRVYSHSGNFDGALNVYEEMKALGVKPN  332


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 69/147 (47%), Gaps = 3/147 (2%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMK--ERGCEPNVWIYNTLLDIHGRASNM  642
            +G +  ++ Y+ +++M    G   EA  + A+MK     C+P+ W Y+ L+  +  +  +
Sbjct  397  KGMEMNVILYNMLMSMCADIGCVDEAAEIFAEMKGLPDDCKPDSWSYSALITAYSCSGKV  456

Query  641  KQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIM  462
             + E +  EM      P+    TS+I  Y KA++ +  V+ +          D    G +
Sbjct  457  LEAEGLLNEMLEAGYQPNIFVLTSIIQCYGKARQTDDVVRSFDKLLELRITPDDRFCGCL  516

Query  461  VGVFSKMNKVDELVKLLQDLKTDETKL  381
            + V ++  + +EL K++  ++    KL
Sbjct  517  LNVLTQ-TQTEELGKVINCIERANVKL  542



>gb|AHC02090.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
gratissima]
Length=363

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  105  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  164

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  165  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  224

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  225  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  272


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 81/165 (49%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  140  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  199

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  200  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  259

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL  LK+ +            N  RD  + I A
Sbjct  260  YERAGLVAHAKRLLHXLKSPD------------NIPRDTAIHILA  292


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  5    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  64

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  65   EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  124

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  125  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  160



>gb|AHC02101.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
scorodonioides]
Length=377

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  88   KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  147

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  148  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  207

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  208  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  255


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  123  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  182

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  183  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  242

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  243  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  275


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/140 (20%), Positives = 67/140 (48%), Gaps = 0/140 (0%)
 Frame = -2

Query  749  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  570
            + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  SY++
Sbjct  4    YSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASYST  63

Query  569  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  390
            +++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++   
Sbjct  64   LLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMG  123

Query  389  TKLDERLYRSALNALRDAGL  330
             + +   Y + L    DA L
Sbjct  124  IEPNVVSYNTLLRVYGDAEL  143


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  192  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  251

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  252  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  307

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   ++++   ++      D  +    LNA
Sbjct  308  LFSKYKKYANVIEVFDKMRGLGYFPDSNVIALVLNA  343



>gb|AHC02095.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
looseri]
Length=377

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  104  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  163

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  164  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  223

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  224  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  271


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  139  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  198

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  199  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  258

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  259  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  291


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  63

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  208  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  267

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  268  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  323

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  324  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  359



>gb|AHC02079.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
peruviana]
Length=388

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  120  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  179

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  180  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  239

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  240  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  287


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  155  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  214

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  215  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  274

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  275  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  307


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  20   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  79

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K     +  + + +      D     IM+ V+ ++ 
Sbjct  80   EMRSAGVMPNTASYSTLLTMYVENKXFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  139

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  140  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  175


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  224  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  283

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  284  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  339

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  340  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  375



>gb|AHC02094.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
hatschbachii]
Length=382

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  105  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  164

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  165  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  224

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  225  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  272


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  140  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  199

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  200  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  259

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  260  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  292


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  5    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  64

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  65   EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMRDIKCLLDLTTCNIMIDVYGQLG  124

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  125  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  160


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  209  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  268

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  269  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  324

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  325  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  360



>gb|AHC02092.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
pulchra]
Length=346

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  88   KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  147

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  148  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNIGIEPNSITYSTIISI  207

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  208  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  255


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 81/165 (49%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  123  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  182

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+   + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  183  NNLIQEMQNIGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  242

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  243  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  275


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/140 (20%), Positives = 67/140 (48%), Gaps = 0/140 (0%)
 Frame = -2

Query  749  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  570
            + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  SY++
Sbjct  4    YSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASYST  63

Query  569  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  390
            +++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++   
Sbjct  64   LLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMG  123

Query  389  TKLDERLYRSALNALRDAGL  330
             + +   Y + L    DA L
Sbjct  124  IEPNVVSYNTLLRVYGDAEL  143



>gb|AHC02080.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
axillaris]
Length=393

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  104  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  163

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  164  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  223

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  224  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  271


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  139  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  198

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  199  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  258

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  259  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  291


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  63

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  208  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  267

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  268  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  323

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  324  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  359



>gb|AHC02103.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
scorodonioides]
Length=393

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  104  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  163

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  164  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  223

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  224  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  271


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  139  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  198

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  199  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  258

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  259  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  291


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  63

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  208  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  267

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  268  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  323

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  324  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  359



>gb|AHC02085.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
chamaedryfolia]
Length=408

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  150  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  209

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  210  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  269

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  270  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  317


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  304

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  305  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  337


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  50   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205



>gb|AHC02097.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
macrostachya]
Length=420

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  130  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  189

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  190  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  249

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  250  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  297


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  165  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  224

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  225  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  284

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  285  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  317


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  30   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  89

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  90   EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  149

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  150  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  185


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  234  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  293

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  294  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYXFRQAIDAGEVKDIXVFERMIH  349

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  350  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  385



>gb|ACU25763.1| pentatricopeptide repeat-containing protein [Aloysia virgata]
Length=426

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  299  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  331


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  248  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  307

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  308  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  363

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   L+++   ++      D  +    LNA
Sbjct  364  LFSKYKKYANLIEVFDKMRGLGYFPDSNVIALVLNA  399



>gb|AHC02105.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
scorodonioides]
Length=433

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  147  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  206

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  207  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  266

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  267  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  314


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  182  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  241

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  242  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  301

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  302  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  334


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/156 (20%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  Y  ++++ G+A   ++   +  
Sbjct  47   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYXAMINVFGKAKLFREARSLIS  106

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  107  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  166

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  167  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  202


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  251  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  310

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  311  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  366

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  367  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  402



>gb|AHC02100.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
pulchra]
Length=431

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  148  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  207

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  208  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  267

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  268  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  315


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  183  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  242

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  243  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  302

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  303  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  335


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  48   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  107

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  108  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  167

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  168  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  203


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  252  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  311

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  312  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  367

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  368  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  403



>gb|AFV61114.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
lycioides]
Length=429

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  146  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  205

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  206  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  265

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  266  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  313


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  181  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  240

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  241  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  300

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  301  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  333


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  46   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  105

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  106  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  165

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  166  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  201


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  250  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  309

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  310  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  365

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  366  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  401



>gb|AHC02096.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
lycioides]
Length=426

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  146  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  205

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  206  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  265

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  266  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  313


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  181  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  240

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  241  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  300

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  301  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  333


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  46   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  105

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  106  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  165

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  166  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  201



>gb|AHC02087.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
dusenii]
Length=440

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  150  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  209

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  210  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  269

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  270  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  317


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  304

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  305  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  337


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  50   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVXGKAKLFREARSLIS  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  254  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  313

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  314  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  369

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  370  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  405



>gb|AHC02084.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
chamaedryfolia]
Length=433

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  151  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  210

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  211  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  270

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  271  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  318


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  186  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  245

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  246  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  305

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  306  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  338


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  51   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  110

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  111  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  170

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  171  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  206


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  255  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  314

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  315  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  370

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  371  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  406



>gb|AHC02107.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
wrightii]
Length=430

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  150  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  209

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  210  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  269

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  270  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  317


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  304

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  305  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  337


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  50   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  254  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  313

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  314  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  369

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  370  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  405



>gb|AHC02091.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
gratissima]
Length=438

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  150  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  209

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  210  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  269

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  270  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  317


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 81/165 (49%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  304

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL  LK+ +            N  RD  + I A
Sbjct  305  YERAGLVAHAKRLLHXLKSPD------------NIPRDTAIHILA  337


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  50   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205



>gb|AHC02088.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
dusenii]
Length=432

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  147  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  206

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  207  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  266

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  267  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  314


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  182  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  241

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  242  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  301

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  302  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  334


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  47   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVXGKAKLFREARSLIS  106

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  107  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  166

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  167  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  202


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  251  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  310

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  311  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEXKDITVFERMIH  366

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  367  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  402



>gb|AHC02106.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
wrightii]
Length=440

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  150  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  209

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  210  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  269

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  270  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  317


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  304

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  305  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  337


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  50   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  254  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  313

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  314  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  369

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  370  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  405



>gb|AHC02102.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
virgata]
Length=425

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  138  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  197

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  198  IHLFRLMQRKDIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  257

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  258  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  305


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  173  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKDIVQNVVTYNSMMMIYGKTLEHEKA  232

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  233  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  292

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  293  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  325


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  38   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  97

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  98   EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  157

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  158  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  193


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  242  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  301

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  302  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  357

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  358  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  393



>ref|XP_008790326.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic-like [Phoenix dactylifera]
 ref|XP_008790327.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic-like [Phoenix dactylifera]
 ref|XP_008790328.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic-like [Phoenix dactylifera]
Length=634

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 104/199 (52%), Gaps = 11/199 (6%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V +++++ +Y  +G    A  +  +MK  G +PNV IYNTL D  GRA    QV+ ++KE
Sbjct  214  VTFATVIRVYSHSGNFDGALNVYEEMKALGVKPNVVIYNTLFDAMGRAGRPWQVKTIFKE  273

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M ++ +VP+R +Y +++ +Y KA+  E  +  Y+  K  G + +  +  +++ + + +  
Sbjct  274  MDKKGLVPNRATYAALLRSYCKARYAEDALSVYRQMKEKGMEMNVILYNMLLSMCADIGC  333

Query  434  VDELVKLLQDLK--TDETKLDERLYRSALNALRDAGLEIRAKWL---------QESFAVA  288
            VDE  ++  ++K   D+ K D   Y + + A   +G  + A+ L         Q +  V 
Sbjct  334  VDEAAEIFAEMKGLPDDCKPDSWSYSALITAYSCSGQVLEAEGLLNEMLEAGYQPNIFVL  393

Query  287  T*IISCNSAKKKPKNIVNT  231
            T II C    ++  ++V +
Sbjct  394  TSIIQCYGKARQTDDVVRS  412


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 65/137 (47%), Gaps = 3/137 (2%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMK--ERGCEPNVWIYNTLLDIHGRASNM  642
            +G +  ++ Y+ +++M    G   EA  + A+MK     C+P+ W Y+ L+  +  +  +
Sbjct  312  KGMEMNVILYNMLLSMCADIGCVDEAAEIFAEMKGLPDDCKPDSWSYSALITAYSCSGQV  371

Query  641  KQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIM  462
             + E +  EM      P+    TS+I  Y KA++ +  V+ +      G   D    G +
Sbjct  372  LEAEGLLNEMLEAGYQPNIFVLTSIIQCYGKARQTDDVVRSFDKLLELGITPDDRFCGCL  431

Query  461  VGVFSKMNKVDELVKLL  411
            + V ++    +EL K++
Sbjct  432  LNVLTQ-TPTEELGKVI  447



>gb|ACU25762.1| pentatricopeptide repeat-containing protein [Xeroaloysia ovatifolia]
Length=426

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K  K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  264  WGKAGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYEKAGLVAHAKRL  311


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 83/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + KA +L+     +Q  + +G + D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKAGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + K   V    +LL +LK+ +            N  RD  + I A
Sbjct  299  YEKAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  331


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SYT++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVMPNTASYTTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|AFV61154.1| pentatricopeptide repeat-containing protein 123, partial [Xeroaloysia 
ovatifolia]
Length=431

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  147  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  206

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  207  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  266

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K  K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  267  WGKAGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYEKAGLVAHAKRL  314


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 83/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  182  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  241

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + KA +L+     +Q  + +G + D+ +   M+  
Sbjct  242  NNLIQEMQNRGIEPNSITYSTIISIWGKAGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  301

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + K   V    +LL +LK+ +            N  RD  + I A
Sbjct  302  YEKAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  334


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  47   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  106

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SYT++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  107  EMRTAGVMPNTASYTTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  166

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  167  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  202



>gb|ACU25764.1| pentatricopeptide repeat-containing protein [Dipyrena glaberrima]
Length=426

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            +SK+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  264  WSKIGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 88/169 (52%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS +SK  +L+     +Q  + +G + D+ +   M+  
Sbjct  239  NNLIQEMQSRGIEPNSITYSTIISIWSKIGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D     +A++ L  +G    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGSGRIEEATWV  342


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I  +   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWSKIGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D+V Y ++I AY +A
Sbjct  273  AAMLFQKLRSSGVEIDQVLYQTMIVAYERA  302


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 77/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFSPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+ VSY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVMPNTVSYSTLLTMYVENKKFLEALTVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>ref|XP_006338777.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Solanum tuberosum]
Length=730

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 84/157 (54%), Gaps = 1/157 (1%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEA-TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            G   C++ Y+S++N   K G++  A   L+ +M+E G  P+   YN LL    +  N+ +
Sbjct  302  GLRPCLLTYNSILNGLCKNGQYGRARDLLLVEMEESGLSPDTASYNALLAECCKTGNVLE  361

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             E V+KEM  R ++PD VSY+S+I  +S+   L+  + YY+  K  G K D  +  I++G
Sbjct  362  AESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLDRSLAYYEHMKHKGLKPDNVVYTILIG  421

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
             F +   + E +K+  ++      +D   Y + LN L
Sbjct  422  GFCRNGSMKEAMKMRDEMLEQSLVMDVVTYNTILNGL  458


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/155 (23%), Positives = 70/155 (45%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V+YSS++ ++ +TGR   +      MK +G +P+  +Y  L+    R  +MK+  K+  
Sbjct  378  LVSYSSLIGLFSRTGRLDRSLAYYEHMKHKGLKPDNVVYTILIGGFCRNGSMKEAMKMRD  437

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM  + +V D V+Y ++++   K K L    + + +        D      ++  + K  
Sbjct  438  EMLEQSLVMDVVTYNTILNGLCKGKMLHEADELFNEMLERDVNPDFYTLTTLINGYCKCG  497

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             +D+   L + +     K D   Y S ++     G
Sbjct  498  NMDKAQTLFEAMLLRNLKPDVVTYNSLIDGFCKVG  532


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    IV  +S++  Y ++G    A +   KM+ +G  P+   YNTLLD   R  NM + 
Sbjct  583  GIKPTIVTCNSIIKGYCRSGDASRAAKFRNKMQSQGLFPDSITYNTLLDGFIREENMAKA  642

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRA  477
              +  EM  + + PD +SY +++  + K   ++     Y+     G   DR+
Sbjct  643  LDLVNEMGNQGLSPDVISYNTILDGFCKFGRMQEANMLYRKMVERGINPDRS  694


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            + Y+++++ + +     +A  LV +M  +G  P+V  YNT+LD   +   M++   ++++
Sbjct  624  ITYNTLLDGFIREENMAKALDLVNEMGNQGLSPDVISYNTILDGFCKFGRMQEANMLYRK  683

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQD  510
            M  R + PDR +YTS+I+ +     L+    ++ +
Sbjct  684  MVERGINPDRSTYTSLINGHVSQDNLKEAFHFHDE  718



>gb|KDP42575.1| hypothetical protein JCGZ_24349 [Jatropha curcas]
Length=500

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 82/161 (51%), Gaps = 0/161 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG    +V Y+S++N Y    +  +A  +   M  +GC PNV  YN ++D + R   + +
Sbjct  214  RGIKPDVVTYNSLMNGYCLLNKMDQAREIFDMMLSKGCTPNVVTYNIMIDCYCRRKRINE  273

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
              ++  EM R+ ++PD V+Y S+I   S AK  ++  K+++D   +G   D     I++ 
Sbjct  274  AMRLLDEMPRKGLIPDHVTYNSLIHGLSNAKSAQAAYKFFKDLCASGHSPDAVTHNILID  333

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             F K + +D  + L  +++    K D  +Y   +  + +AG
Sbjct  334  GFCKHHCLDVALSLFHEMQKSSLKPDIIVYNILIVGMFNAG  374


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 81/161 (50%), Gaps = 2/161 (1%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG    +V Y+S++     +GR +EA+  + +M E    PN++ +N L+D   +   + +
Sbjct  144  RGIKPDVVTYNSLIYGLCNSGRLEEASVQLNEMLEANIAPNLFTFNILVDGLCKEGRVAK  203

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMA-GIMV  459
                 K M +R + PD V+Y S+++ Y    +++   + + D  L+ G T   +   IM+
Sbjct  204  AHATVKWMIQRGIKPDVVTYNSLMNGYCLLNKMDQAREIF-DMMLSKGCTPNVVTYNIMI  262

Query  458  GVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDA  336
              + +  +++E ++LL ++       D   Y S ++ L +A
Sbjct  263  DCYCRRKRINEAMRLLDEMPRKGLIPDHVTYNSLIHGLSNA  303


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 86/177 (49%), Gaps = 14/177 (8%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G    +V Y+ M++ Y +  R  EA RL+ +M  +G  P+   YN+L  IHG  SN K 
Sbjct  249  KGCTPNVVTYNIMIDCYCRRKRINEAMRLLDEMPRKGLIPDHVTYNSL--IHG-LSNAKS  305

Query  635  VE---KVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGI  465
             +   K +K++      PD V++  +I  + K   L+  +  + + + +  K D  +  I
Sbjct  306  AQAAYKFFKDLCASGHSPDAVTHNILIDGFCKHHCLDVALSLFHEMQKSSLKPDIIVYNI  365

Query  464  M-VGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            + VG+F+   KV +  +L+  L  +  + +   Y + +N L   GL      L E+F
Sbjct  366  LIVGMFNA-GKVKDAKELVSRLSIEGLQPEVYTYNTMINGLCKEGL------LDEAF  415



>gb|AFV61115.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
macrostachya]
Length=437

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  147  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  206

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              ++  M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  207  IHLFXLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  266

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  267  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  314


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  182  GIEPNVVSYNTLLRVYGDAELFGEAIHLFXLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  241

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  242  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  301

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  302  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  334


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  47   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  106

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  107  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  166

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  167  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  202


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  251  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  310

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  311  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDIMVFERMIH  366

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  367  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  402



>gb|AHC02093.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
oblanceolata]
Length=377

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M ++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  88   KCLLDLTTCNIMXDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  147

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  148  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  207

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  208  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  255


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  123  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  182

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  183  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  242

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  243  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  275


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  192  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  251

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  252  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQXIDAGEVKDITVFERMIH  307

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  308  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  343


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/140 (20%), Positives = 66/140 (47%), Gaps = 0/140 (0%)
 Frame = -2

Query  749  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  570
            + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  SY++
Sbjct  4    YSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASYST  63

Query  569  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  390
            +++ Y + K+    +  + + +      D     IM  V+ ++    E  KL   ++   
Sbjct  64   LLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMXDVYGQLGMAKEADKLFWGMRKMG  123

Query  389  TKLDERLYRSALNALRDAGL  330
             + +   Y + L    DA L
Sbjct  124  IEPNVVSYNTLLRVYGDAEL  143



>gb|AFV61116.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
virgata]
Length=424

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  151  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  210

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  211  IHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  270

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++   A   AGL   AK L
Sbjct  271  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMXVAYERAGLVAHAKRL  318


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 81/165 (49%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YN+++ I+G+    ++ 
Sbjct  186  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKA  245

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M   
Sbjct  246  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMXVA  305

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  306  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  338


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  51   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  110

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  111  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  170

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  171  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  206



>gb|AFV61146.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
rhodocnemis]
Length=345

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  87   KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  146

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ +
Sbjct  147  IHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  206

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  207  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  254


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  122  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKA  181

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  182  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  241

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  242  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  277


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  156  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  215

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  216  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  245


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/140 (21%), Positives = 67/140 (48%), Gaps = 0/140 (0%)
 Frame = -2

Query  749  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  570
            + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EMK   V+P+  SY++
Sbjct  3    YSKAISIFSRLKRLGFMPDLVAYNAMINVFGKAKLFREARSLISEMKTAGVMPNTTSYST  62

Query  569  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  390
            +++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++   
Sbjct  63   LLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMG  122

Query  389  TKLDERLYRSALNALRDAGL  330
             + +   Y + L    DA L
Sbjct  123  IEPNVVSYNTLLRVYGDAEL  142



>gb|ACU25737.1| pentatricopeptide repeat-containing protein [Verbena macdougalii]
Length=426

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            +SK+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WSKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYEKAGLVAHAKRL  311


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 86/169 (51%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS +SK  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWSKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YEKAGLVAHAKRLLHELKRPDNIPRD-----IAIHILVGAGRIEEATWV  342


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I  +   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWSKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D+V Y ++I AY KA
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYEKA  302


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDIVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|AFV61121.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
cujabensis]
Length=359

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  104  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  163

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ +
Sbjct  164  IHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  223

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  224  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  271


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  139  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKA  198

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  199  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  258

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  259  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  294


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  173  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  232

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  233  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  262


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  63

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMKTXGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  ++ T++  + RA  +  
Sbjct  208  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAH  267

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  268  AKRLLHELKR----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  323

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            + SK  K   +V++   ++      D  +    LNA
Sbjct  324  LLSKYKKYSNVVEVFDKMRGLGYFPDSNVIAVVLNA  359



>gb|AIU48553.1| tetratricopeptide repeat-like superfamily protein, partial [Chimonanthus 
praecox]
Length=470

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 89/155 (57%), Gaps = 0/155 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++N YGK  R +EA  +  +M + G  P    YN LLD    +  +++ 
Sbjct  269  GLQPDVVSYTLLINAYGKARREEEALAVFEEMLDAGIRPTRKAYNILLDAFAISGMVEEA  328

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R K  PD  SYT+++SAY  A ++E   K+++  K +G + +    G ++  
Sbjct  329  RTVFKSMRRDKFSPDLCSYTTMLSAYVNASDMEGAEKFFRRIKQDGFEPNIVTYGTLMKG  388

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            ++KMN +++++ + Q+++    K ++ ++ + ++A
Sbjct  389  YAKMNNLEKMMGVYQEMRMKGIKANQTIFTTIMDA  423


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 79/151 (52%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G +++A  + AKM ERG       +N+L+      +N K+V  ++ +M+
Sbjct  210  FHMMIYMYKKAGSYEQARSIFAKMAERGIPQTTVTFNSLMSFE---TNYKEVSSIYDQMQ  266

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSYT +I+AY KA+  E  +  +++    G +  R    I++  F+    V+
Sbjct  267  RAGLQPDVVSYTLLINAYGKARREEEALAVFEEMLDAGIRPTRKAYNILLDAFAISGMVE  326

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            E   + + ++ D+   D   Y + L+A  +A
Sbjct  327  EARTVFKSMRRDKFSPDLCSYTTMLSAYVNA  357


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 67/117 (57%), Gaps = 1/117 (1%)
 Frame = -2

Query  809  FDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVE  630
            F   + +Y++M++ Y      + A +   ++K+ G EPN+  Y TL+  + + +N++++ 
Sbjct  340  FSPDLCSYTTMLSAYVNASDMEGAEKFFRRIKQDGFEPNIVTYGTLMKGYAKMNNLEKMM  399

Query  629  KVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  459
             V++EM+ + +  ++  +T+++ A+ K  +  S V ++++ + +G   D+    I++
Sbjct  400  GVYQEMRMKGIKANQTIFTTIMDAHGK-NDFGSAVIWFKEMESSGFPPDQKAKNILL  455



>gb|AIU48560.1| tetratricopeptide repeat-like superfamily protein, partial [Erythranthe 
guttata]
Length=470

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 103/198 (52%), Gaps = 11/198 (6%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V+Y+ ++N YGK  R +EA  +  +M + G  P    YN LLD    +  ++Q   V+K
Sbjct  274  VVSYALLINAYGKARREEEALAVFEEMLDAGVRPTQKAYNILLDAFAISGMVEQARVVFK  333

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
             M+R +  PD  SYT+++SAY  A +++   K+++  K +G + +    G ++  ++K N
Sbjct  334  SMRRDRCTPDLFSYTTMLSAYVNASDMDGAEKFFKRIKTDGFEPNVVTHGTLIKGYAKAN  393

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCNSAK  258
             ++++++  + ++ D  K +  ++ + ++A           W  E       + S  S  
Sbjct  394  DLEKMLEKYESMRVDGIKPNPTIFTTIMDAFGKNDFGSAVIWFNEM------VSSGVSPD  447

Query  257  KKPKNIVNTRWRISLSET  204
            +K KNI+     +SL++T
Sbjct  448  QKAKNIL-----LSLAKT  460


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 77/151 (51%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G +++A ++ + M ERG       YN+L+      ++ K+V  ++ +M+
Sbjct  210  FHMMIYMYKKAGNYEKARKIFSMMPERGAPQTTVTYNSLMSFE---TSYKEVANIYDQMQ  266

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  E  +  +++    G +  +    I++  F+    V+
Sbjct  267  RADIRPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTQKAYNILLDAFAISGMVE  326

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +   + + ++ D    D   Y + L+A  +A
Sbjct  327  QARVVFKSMRRDRCTPDLFSYTTMLSAYVNA  357



>gb|AFV61120.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
camara]
Length=381

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  104  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  163

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ +
Sbjct  164  IHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  223

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  224  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  271


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  139  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKA  198

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  199  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  258

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  259  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  294


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  173  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  232

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  233  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  262


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  63

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMKTAGVXPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  ++ T++  + RA  +  
Sbjct  208  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAH  267

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  268  AKRLLHELKR----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  323

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            + SK  K   +V++   ++      D  +    LNA
Sbjct  324  LLSKYKKYSNVVEVFDKMRGLGYFPDSNVITVVLNA  359



>gb|AFV61133.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
brasiliensis]
Length=382

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  105  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  164

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ +
Sbjct  165  IHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  224

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  225  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  272


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  140  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKA  199

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  200  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  259

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  260  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  295


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  174  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  233

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  234  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  263


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  5    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  64

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  65   EMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  124

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  125  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  160



>gb|ACU25758.1| pentatricopeptide repeat-containing protein [Mulguraea scoparia]
Length=352

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 86/169 (51%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSXKLCDYSKAISIFSRLKRSGFMPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|AFV61118.1| pentatricopeptide repeat-containing protein 123, partial [Coelocarpum 
swinglei]
Length=440

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  150  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  209

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  210  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  269

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L+T   ++D+ L+++ + A   AGL   AK L
Sbjct  270  WGKIGKLDRAAMLFQKLRTSGVEIDQILFQTMIXAYERAGLVAHAKRL  317


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQNRGIEPNSITYSTIISIWGKIGKLDRAAMLFQKLRTSGVEIDQILFQTMIXA  304

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  305  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  340


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  219  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKIGKLDR  278

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  279  AAMLFQKLRTSGVEIDQILFQTMIXAYERA  308


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   +    +  
Sbjct  50   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFRDARSLIS  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMRTAGVMPNASSYSALLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/135 (23%), Positives = 65/135 (48%), Gaps = 4/135 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  ++ T++  + RA  +  
Sbjct  254  RGIEPNSITYSTIISIWGKIGKLDRAAMLFQKLRTSGVEIDQILFQTMIXAYERAGLVAH  313

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  314  AKRLLHELKR----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  369

Query  455  VFSKMNKVDELVKLL  411
            +FSK  K   +V++ 
Sbjct  370  LFSKYKKYANVVEVF  384



>gb|AFV61141.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
macrophylla]
Length=381

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  104  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  163

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ +
Sbjct  164  IHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  223

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  224  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  271


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  139  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKA  198

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  199  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  258

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  259  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  294


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  173  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  232

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  233  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  262


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  63

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  ++ T++  + RA  +  
Sbjct  208  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAH  267

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  268  AKRLLHELKR----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  323

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            + SK  K   +V++   ++      D  +    LNA
Sbjct  324  LLSKXKKYSNVVEVFNKMRGLGYFPDSDVIAXVLNA  359



>gb|AIU48544.1| tetratricopeptide repeat-like superfamily protein, partial [Carica 
papaya]
Length=402

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 90/170 (53%), Gaps = 0/170 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++N YGK  R +EA  +  +M +    P +  YN LLD    +  ++Q 
Sbjct  201  GLQPDVVSYALLINAYGKARREEEALAVFEEMLDADVRPTLKAYNILLDAFAISGMIEQA  260

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V++ MKR +  PD  SYT+++SAY  A ++E   K+ +  K +G K +    G ++  
Sbjct  261  RTVFRSMKRDRCTPDLCSYTTMLSAYVNASDMEGAEKFLKRMKQDGFKPNIVTYGTLIKG  320

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  303
            ++K+N + +++++   ++    K+++ ++ + ++A           W +E
Sbjct  321  YAKLNNLQKMMEIYDQIRVSGLKVNQTVFTTIMDAFGKNDFASAVVWYKE  370


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 77/152 (51%), Gaps = 3/152 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G + +A ++ A M E+G + +   YN+L+      +N K+V K++ +M+
Sbjct  142  FHMMIYMYKKAGNYDKARKVFALMAEKGVQQSTVTYNSLMSFE---TNYKEVSKIYDQMQ  198

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  E  +  +++      +       I++  F+    ++
Sbjct  199  RAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDADVRPTLKAYNILLDAFAISGMIE  258

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            +   + + +K D    D   Y + L+A  +A 
Sbjct  259  QARTVFRSMKRDRCTPDLCSYTTMLSAYVNAS  290



>gb|AFV61125.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
micrantha]
Length=406

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  116  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  175

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ +
Sbjct  176  IHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  235

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  236  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  283


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  151  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKA  210

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  211  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  270

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  271  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  306


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  185  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  244

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  245  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  274


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  16   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  75

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  76   EMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  135

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  136  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  171


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  ++ T++  + RA  +  
Sbjct  220  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAH  279

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  280  AKRLLHELKR----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEAKDITVFERMIH  335

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            + SK  K   +V++   ++      D  +    LNA
Sbjct  336  LLSKYKKYSNVVEVFDKMRGLGYFPDSNVIAVVLNA  371



>gb|AFV61123.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
urticoides]
Length=423

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  134  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  193

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ +
Sbjct  194  IHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  253

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  254  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  301


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  169  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKA  228

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  229  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  288

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  289  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  324


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  203  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  262

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  263  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  292


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  34   LVLYSNLIELSRKLCDYSKAISIFSRLKSSGFTPDLVAYNAMINVFGKAKLFREARSLIS  93

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  94   EMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  153

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  154  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  189


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  ++ T++  + RA  +  
Sbjct  238  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAH  297

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  298  AKRLLHELKR----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  353

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            + SK  K   +V++   ++      D  +    LNA
Sbjct  354  LLSKYKKYSNVVEVFDKMRGLGYFPDSNVIAVVLNA  389



>gb|EYU42850.1| hypothetical protein MIMGU_mgv1a0029291mg, partial [Erythranthe 
guttata]
Length=424

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 107/201 (53%), Gaps = 16/201 (8%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V+Y+ ++N YGK  R +EA  +  +M + G  P    YN LLD    +  ++Q   V+K
Sbjct  122  VVSYALLINAYGKARREEEALAVFEEMLDAGVRPTQKAYNILLDAFAISGMVEQARVVFK  181

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
             M+R +  PD  SYT+++SAY  A +++   K+++  K +G + +    G ++  ++K N
Sbjct  182  SMRRDRCTPDLFSYTTMLSAYVNASDMDGAEKFFKRIKTDGFEPNVVTHGTLIKGYAKAN  241

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNAL---RDAGLEIRAKWLQESFAVAT*IISCN  267
             ++++++  + ++ D  K +  ++ + ++A    +D G  +   W  E       + S  
Sbjct  242  DLEKMLEKYESMRVDGIKPNPTIFTTIMDAFGKNKDFGSAVI--WFNEM------VSSGV  293

Query  266  SAKKKPKNIVNTRWRISLSET  204
            S  +K KNI+     +SL++T
Sbjct  294  SPDQKAKNIL-----LSLAKT  309


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 77/151 (51%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G +++A ++ + M ERG       YN+L+      ++ K+V  ++ +M+
Sbjct  58   FHMMIYMYKKAGNYEKARKIFSMMPERGAPQTTVTYNSLMSFE---TSYKEVANIYDQMQ  114

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  E  +  +++    G +  +    I++  F+    V+
Sbjct  115  RADIRPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTQKAYNILLDAFAISGMVE  174

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +   + + ++ D    D   Y + L+A  +A
Sbjct  175  QARVVFKSMRRDRCTPDLFSYTTMLSAYVNA  205



>gb|AFV61110.1| pentatricopeptide repeat-containing protein 123, partial [Acantholippia 
seriphioides]
Length=416

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  146  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  205

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ +
Sbjct  206  IHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  265

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  266  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  313


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  181  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKA  240

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  241  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  300

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  301  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  336


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  215  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  274

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  275  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  304


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  46   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  105

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  106  EMKXSGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREVKCLLDLTTCNIMIDVYGQLG  165

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  166  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  201



>gb|AHC02089.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
herrerae]
Length=393

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  104  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  163

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  164  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  223

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  224  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  271


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/165 (24%), Positives = 83/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  139  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  198

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  199  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  258

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  259  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  291


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  173  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  232

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D+V Y ++I AY +A
Sbjct  233  AAMLFQKLRSSGVEIDQVLYQTMIVAYERA  262


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARALIS  63

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMKTAGVMPNTASYSTLLTMYVENKKFIEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  208  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  267

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  268  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  323

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  324  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  359



>ref|XP_004486551.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic-like [Cicer arietinum]
Length=891

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 104/197 (53%), Gaps = 10/197 (5%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            VA+SS++ M+G  G +     +   MK  G  PN+ +YN LL   GRA   +  + +++E
Sbjct  264  VAFSSLIKMHGMLGNYDGCLNVYNDMKVLGVRPNMVMYNALLYAMGRAKRGRDAKGIYQE  323

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M+     P+  +Y++++ AYS+A+  +  +  Y++ K  G   ++ + G+++ + + +  
Sbjct  324  MRNNGFSPNWATYSALLEAYSRARLSKEALSVYKEMKEKGMTMNKVLYGMLLDMCADVGY  383

Query  434  VDELVKLLQDLKTDET-KLDERLYRSALNALRDAG--LEIRA-------KWLQESFAVAT  285
             +E V+L +++K  ET + D  +Y S +N    +G  LE  A       + L+ +  V T
Sbjct  384  AEEAVELFEEMKRSETCQPDNFIYSSLINMYSCSGNVLEAEAMLNEMISRGLEPNILVLT  443

Query  284  *IISCNSAKKKPKNIVN  234
              + C    K+P ++VN
Sbjct  444  MFVHCYGKAKRPDDVVN  460


 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/121 (26%), Positives = 61/121 (50%), Gaps = 1/121 (1%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMK-ERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            V Y  +++M    G  +EA  L  +MK    C+P+ +IY++L++++  + N+ + E +  
Sbjct  369  VLYGMLLDMCADVGYAEEAVELFEEMKRSETCQPDNFIYSSLINMYSCSGNVLEAEAMLN  428

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM  R + P+ +  T  +  Y KAK  +  V  +  F   G   D  +   ++ V +++ 
Sbjct  429  EMISRGLEPNILVLTMFVHCYGKAKRPDDVVNIFNRFWDLGITPDDRLCDCLLYVMTQIP  488

Query  437  K  435
            K
Sbjct  489  K  489


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 68/149 (46%), Gaps = 1/149 (1%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            GF      YS+++  Y +    KEA  +  +MKE+G   N  +Y  LLD+       ++ 
Sbjct  328  GFSPNWATYSALLEAYSRARLSKEALSVYKEMKEKGMTMNKVLYGMLLDMCADVGYAEEA  387

Query  632  EKVWKEMKRRKVV-PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             ++++EMKR +   PD   Y+S+I+ YS +  +        +    G + +  +  + V 
Sbjct  388  VELFEEMKRSETCQPDNFIYSSLINMYSCSGNVLEAEAMLNEMISRGLEPNILVLTMFVH  447

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERL  369
             + K  + D++V +           D+RL
Sbjct  448  CYGKAKRPDDVVNIFNRFWDLGITPDDRL  476



>gb|ACU25760.1| pentatricopeptide repeat-containing protein [Phyla dulcis]
Length=426

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  311


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  239  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  334


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  273  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  302


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++ + G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKNSGYTPDLVAYNAMIIVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMKTAGVIPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>ref|XP_004173911.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040-like, 
partial [Cucumis sativus]
Length=299

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/207 (27%), Positives = 111/207 (54%), Gaps = 18/207 (9%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ +++ YGK  R +EA  +  +M + G  P    YN LLD    +  ++Q 
Sbjct  27   GLQPDVVSYALLISAYGKARREEEALAVFEEMLDAGIRPTHKAYNILLDAFAISGMVEQA  86

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            + V+K MKR +  PD  SYT+++SAY  A ++E    +++  K +G + +    G ++  
Sbjct  87   KIVFKSMKRDRCSPDICSYTTMLSAYVNASDMEGAEIFFRRLKQDGFRPNVVTYGTLIKG  146

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL---RDAGLEIRAKWLQESFAVAT*  282
            ++K+N +++++K  +++K +  ++++ +  + ++A    +D G  +   W  E       
Sbjct  147  YAKINNLEKMIKRYEEMKVNGIRVNQTILTTIMDAYGKNKDFGSAV--IWFNE-------  197

Query  281  IISCN-SAKKKPKNIVNTRWRISLSET  204
            I SC     +K KNI+     +SL++T
Sbjct  198  IESCGLRPDQKAKNIL-----LSLAKT  219


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 73/135 (54%), Gaps = 3/135 (2%)
 Frame = -2

Query  806  DKC---IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            D+C   I +Y++M++ Y      + A     ++K+ G  PNV  Y TL+  + + +N+++
Sbjct  96   DRCSPDICSYTTMLSAYVNASDMEGAEIFFRRLKQDGFRPNVVTYGTLIKGYAKINNLEK  155

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            + K ++EMK   +  ++   T+++ AY K K+  S V ++ + +  G + D+    I++ 
Sbjct  156  MIKRYEEMKVNGIRVNQTILTTIMDAYGKNKDFGSAVIWFNEIESCGLRPDQKAKNILLS  215

Query  455  VFSKMNKVDELVKLL  411
            +     ++DE  +L+
Sbjct  216  LAKTAEELDEANQLV  230


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 66/131 (50%), Gaps = 7/131 (5%)
 Frame = -2

Query  683  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  504
            YN+L+      +N K+V K++ +M+R  + PD VSY  +ISAY KA+  E  +  +++  
Sbjct  3    YNSLMSFE---TNYKEVSKIYDQMQRAGLQPDVVSYALLISAYGKARREEEALAVFEEML  59

Query  503  LNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDA----  336
              G +       I++  F+    V++   + + +K D    D   Y + L+A  +A    
Sbjct  60   DAGIRPTHKAYNILLDAFAISGMVEQAKIVFKSMKRDRCSPDICSYTTMLSAYVNASDME  119

Query  335  GLEIRAKWLQE  303
            G EI  + L++
Sbjct  120  GAEIFFRRLKQ  130



>ref|XP_001777347.1| predicted protein [Physcomitrella patens]
 gb|EDQ57877.1| predicted protein [Physcomitrella patens]
Length=621

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 85/166 (51%), Gaps = 1/166 (1%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V+YS ++N  G+ G+ + A  +VA+M+ +GC+PN+W YNTL+D  G+A    +  ++  
Sbjct  44   VVSYSCLINSLGRAGKWEAALEVVAEMQAKGCKPNLWTYNTLVDCLGKAGQFDEALRLLA  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+    VPD  +Y  +IS   KA  L      + + +  G   D      ++    K+ 
Sbjct  104  EMRDNGCVPDVRTYNCLISTLGKAGRLSEAFTLFAEMRERGCVPDTFTYNSLIYGLGKVG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA-KWLQE  303
            +  + ++LL++++      D   Y S +  L   G  ++A K  QE
Sbjct  164  RSQKAMELLEEMERHGCPPDVMTYSSLITGLGKDGETVKAFKLFQE  209


 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 73/130 (56%), Gaps = 0/130 (0%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            Y+ +++  GK GR  EA  L A+M+ERGC P+ + YN+L+   G+    ++  ++ +EM+
Sbjct  117  YNCLISTLGKAGRLSEAFTLFAEMRERGCVPDTFTYNSLIYGLGKVGRSQKAMELLEEME  176

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R    PD ++Y+S+I+   K  E     K +Q+ K  G K D      ++    K  +VD
Sbjct  177  RHGCPPDVMTYSSLITGLGKDGETVKAFKLFQEMKRRGRKPDSITFTALMDALGKAGRVD  236

Query  428  ELVKLLQDLK  399
            + ++LL ++K
Sbjct  237  DALELLDEMK  246


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 79/152 (52%), Gaps = 0/152 (0%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            Y+++V+  GK G+  EA RL+A+M++ GC P+V  YN L+   G+A  + +   ++ EM+
Sbjct  82   YNTLVDCLGKAGQFDEALRLLAEMRDNGCVPDVRTYNCLISTLGKAGRLSEAFTLFAEMR  141

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
             R  VPD  +Y S+I    K    +  ++  ++ + +G   D      ++    K  +  
Sbjct  142  ERGCVPDTFTYNSLIYGLGKVGRSQKAMELLEEMERHGCPPDVMTYSSLITGLGKDGETV  201

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            +  KL Q++K    K D   + + ++AL  AG
Sbjct  202  KAFKLFQEMKRRGRKPDSITFTALMDALGKAG  233


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 79/156 (51%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            ++ YSS++   GK G   +A +L  +MK RG +P+   +  L+D  G+A  +    ++  
Sbjct  184  VMTYSSLITGLGKDGETVKAFKLFQEMKRRGRKPDSITFTALMDALGKAGRVDDALELLD  243

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK R V P  V+Y ++I+ + K  +L        + K NG K D      ++    K +
Sbjct  244  EMKERGVKPGVVTYNALIAGFGKVGDLVEAYNLLDEMKRNGCKPDVVTYSCLITGLIKAS  303

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
            ++DE  ++L+ ++ +    D   Y + +N L  AGL
Sbjct  304  QLDEACQVLKKMEKEGCPPDTITYNTLINGLGKAGL  339


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 81/155 (52%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS ++    K  +  EA +++ KM++ GC P+   YNTL++  G+A  +    +++ 
Sbjct  289  VVTYSCLITGLIKASQLDEACQVLKKMEKEGCPPDTITYNTLINGLGKAGLLNDAGRLFD  348

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
             MK +   PD V+Y+++I+A  KA  +ES    +++ +  G + D      ++ V  K  
Sbjct  349  RMKSKGCNPDVVTYSTLITALGKAARVESACVLFEEMESVGIQPDLFTYCSIITVLGKAG  408

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            +VD+  +L  +++      D   Y + LN+L   G
Sbjct  409  QVDDADRLFSEMRGKGLSPDVITYNAFLNSLGRGG  443


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 86/175 (49%), Gaps = 6/175 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG       Y+S++   GK GR ++A  L+ +M+  GC P+V  Y++L+   G+     +
Sbjct  143  RGCVPDTFTYNSLIYGLGKVGRSQKAMELLEEMERHGCPPDVMTYSSLITGLGKDGETVK  202

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
              K+++EMKRR   PD +++T+++ A  KA  ++  ++   + K  G K        ++ 
Sbjct  203  AFKLFQEMKRRGRKPDSITFTALMDALGKAGRVDDALELLDEMKERGVKPGVVTYNALIA  262

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  291
             F K+  + E   LL ++K +  K D   Y   +  L      I+A  L E+  V
Sbjct  263  GFGKVGDLVEAYNLLDEMKRNGCKPDVVTYSCLITGL------IKASQLDEACQV  311


 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 79/161 (49%), Gaps = 0/161 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG    +V Y++++  +GK G   EA  L+ +MK  GC+P+V  Y+ L+    +AS + +
Sbjct  248  RGVKPGVVTYNALIAGFGKVGDLVEAYNLLDEMKRNGCKPDVVTYSCLITGLIKASQLDE  307

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
              +V K+M++    PD ++Y ++I+   KA  L    + +   K  G   D      ++ 
Sbjct  308  ACQVLKKMEKEGCPPDTITYNTLINGLGKAGLLNDAGRLFDRMKSKGCNPDVVTYSTLIT  367

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
               K  +V+    L +++++   + D   Y S +  L  AG
Sbjct  368  ALGKAARVESACVLFEEMESVGIQPDLFTYCSIITVLGKAG  408


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 77/160 (48%), Gaps = 0/160 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +  Y S++ + GK G+  +A RL ++M+ +G  P+V  YN  L+  GR    K+ 
Sbjct  389  GIQPDLFTYCSIITVLGKAGQVDDADRLFSEMRGKGLSPDVITYNAFLNSLGRGGRFKEA  448

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             K++++MK   ++PD  +Y +++   SK KE++      ++    G   D       + +
Sbjct  449  RKIFEDMKESGLLPDVATYDALLLGLSKTKEVDDACGLLKELIEQGCAFDSLKFDECLEI  508

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             +    VDE  +LLQ   +         Y + ++AL  AG
Sbjct  509  LTSWGNVDEAHELLQFANSKGLWPGASSYNALIDALAKAG  548


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 75/150 (50%), Gaps = 0/150 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            + Y++++N  GK G   +A RL  +MK +GC P+V  Y+TL+   G+A+ ++    +++E
Sbjct  325  ITYNTLINGLGKAGLLNDAGRLFDRMKSKGCNPDVVTYSTLITALGKAARVESACVLFEE  384

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M+   + PD  +Y S+I+   KA +++   + + + +  G   D       +    +  +
Sbjct  385  MESVGIQPDLFTYCSIITVLGKAGQVDDADRLFSEMRGKGLSPDVITYNAFLNSLGRGGR  444

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNAL  345
              E  K+ +D+K      D   Y + L  L
Sbjct  445  FKEARKIFEDMKESGLLPDVATYDALLLGL  474


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 75/153 (49%), Gaps = 0/153 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            + ++++++  GK GR  +A  L+ +MKERG +P V  YN L+   G+  ++ +   +  E
Sbjct  220  ITFTALMDALGKAGRVDDALELLDEMKERGVKPGVVTYNALIAGFGKVGDLVEAYNLLDE  279

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            MKR    PD V+Y+ +I+   KA +L+   +  +  +  G   D      ++    K   
Sbjct  280  MKRNGCKPDVVTYSCLITGLIKASQLDEACQVLKKMEKEGCPPDTITYNTLINGLGKAGL  339

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +++  +L   +K+     D   Y + + AL  A
Sbjct  340  LNDAGRLFDRMKSKGCNPDVVTYSTLITALGKA  372


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 81/154 (53%), Gaps = 5/154 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G +  +V YS+++   GK  R + A  L  +M+  G +P+++ Y +++ + G+A  +  
Sbjct  353  KGCNPDVVTYSTLITALGKAARVESACVLFEEMESVGIQPDLFTYCSIITVLGKAGQVDD  412

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             ++++ EM+ + + PD ++Y + +++  +    +   K ++D K +G   D A    ++ 
Sbjct  413  ADRLFSEMRGKGLSPDVITYNAFLNSLGRGGRFKEARKIFEDMKESGLLPDVATYDALLL  472

Query  455  VFSKMNKVDELVKLLQDL-----KTDETKLDERL  369
              SK  +VD+   LL++L       D  K DE L
Sbjct  473  GLSKTKEVDDACGLLKELIEQGCAFDSLKFDECL  506


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 0/122 (0%)
 Frame = -2

Query  698  PNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKY  519
            PNV  YN+LL+   +A   ++ + +++E+K  K  PD VSY+ +I++  +A + E+ ++ 
Sbjct  7    PNVVTYNSLLNALAKAGQCEEAQLLFEELKAAKWTPDVVSYSCLINSLGRAGKWEAALEV  66

Query  518  YQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRD  339
              + +  G K +      +V    K  + DE ++LL +++ +    D R Y   ++ L  
Sbjct  67   VAEMQAKGCKPNLWTYNTLVDCLGKAGQFDEALRLLAEMRDNGCVPDVRTYNCLISTLGK  126

Query  338  AG  333
            AG
Sbjct  127  AG  128



>gb|ACU25753.1| pentatricopeptide repeat-containing protein [Glandularia incisa]
Length=352

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTTSYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|ACU25757.1| pentatricopeptide repeat-containing protein [Mulguraea asparagoides]
Length=426

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQHRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAVLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 86/169 (51%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  239  NNLIQEMQHRGIEPNSITYSTIISIWGKVGKLDRAAVLFQKLRSSGVEIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQHRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAVLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFMPDLVAYNAMINVFGXAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>ref|XP_003538631.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860-like 
[Glycine max]
Length=804

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 81/157 (52%), Gaps = 1/157 (1%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRAS-NMKQVEKVW  621
            + AY+ ++N Y  +GR+++A  L  KM++ GC P +  YN +L+++G+       V  + 
Sbjct  193  VYAYTCLINAYSSSGRYRDAVNLFNKMQQDGCNPTLITYNVVLNVYGKMGMPWSNVTALV  252

Query  620  KEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKM  441
            + M+ R V PD  +Y ++IS   +    E  V  +Q  KL G   D+     ++ VF K 
Sbjct  253  EAMRSRGVAPDLYTYNTLISCCRRGSLYEEAVHLFQQMKLEGFTPDKVTYNALLDVFGKS  312

Query  440  NKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
             +  E +K+LQ+++ +        Y S ++A    GL
Sbjct  313  RRPQEAMKVLQEMEANGFSPTSVTYNSLISAYAKGGL  349


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 85/175 (49%), Gaps = 10/175 (6%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRH-KEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            G +  ++ Y+ ++N+YGK G      T LV  M+ RG  P+++ YNTL+    R S  ++
Sbjct  223  GCNPTLITYNVVLNVYGKMGMPWSNVTALVEAMRSRGVAPDLYTYNTLISCCRRGSLYEE  282

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++MK     PD+V+Y +++  + K++  +  +K  Q+ + NG          ++ 
Sbjct  283  AVHLFQQMKLEGFTPDKVTYNALLDVFGKSRRPQEAMKVLQEMEANGFSPTSVTYNSLIS  342

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG---------LEIRA  318
             ++K   ++E + L   +     K D   Y + L+    AG         LE+RA
Sbjct  343  AYAKGGLLEEALDLKTQMVHKGIKPDVFTYTTLLSGFEKAGKDDFAIQVFLEMRA  397


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 78/155 (50%), Gaps = 0/155 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    I  +++++ M+G  G+  E  ++   +K   C P++  +NTLL + G+     QV
Sbjct  399  GCKPNICTFNALIKMHGNRGKFAEMMKVFDDIKLCNCSPDIVTWNTLLAVFGQNGMDSQV  458

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              ++KEMKR   V +R ++ ++ISAYS+    +  +  Y+     G   D +    ++  
Sbjct  459  SGIFKEMKRAGFVAERDTFNTLISAYSRCGSFDQAMAVYKSMLEAGVVPDLSTYNAVLAA  518

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
             ++    ++  K+L +++    K +E  Y S L+A
Sbjct  519  LARGGLWEQSEKVLAEMEDGRCKPNELSYSSLLHA  553


 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 82/162 (51%), Gaps = 0/162 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            GF    V Y+++++++GK+ R +EA +++ +M+  G  P    YN+L+  + +   +++ 
Sbjct  294  GFTPDKVTYNALLDVFGKSRRPQEAMKVLQEMEANGFSPTSVTYNSLISAYAKGGLLEEA  353

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +  +M  + + PD  +YT+++S + KA + +  ++ + + +  G K +      ++ +
Sbjct  354  LDLKTQMVHKGIKPDVFTYTTLLSGFEKAGKDDFAIQVFLEMRAVGCKPNICTFNALIKM  413

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLE  327
                 K  E++K+  D+K      D   + + L      G++
Sbjct  414  HGNRGKFAEMMKVFDDIKLCNCSPDIVTWNTLLAVFGQNGMD  455


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 68/139 (49%), Gaps = 0/139 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG    +  Y+++++   +   ++EA  L  +MK  G  P+   YN LLD+ G++   ++
Sbjct  258  RGVAPDLYTYNTLISCCRRGSLYEEAVHLFQQMKLEGFTPDKVTYNALLDVFGKSRRPQE  317

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
              KV +EM+     P  V+Y S+ISAY+K   LE  +         G K D      ++ 
Sbjct  318  AMKVLQEMEANGFSPTSVTYNSLISAYAKGGLLEEALDLKTQMVHKGIKPDVFTYTTLLS  377

Query  455  VFSKMNKVDELVKLLQDLK  399
             F K  K D  +++  +++
Sbjct  378  GFEKAGKDDFAIQVFLEMR  396


 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/162 (20%), Positives = 77/162 (48%), Gaps = 0/162 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G    +  Y+++++ + K G+   A ++  +M+  GC+PN+  +N L+ +HG      +
Sbjct  363  KGIKPDVFTYTTLLSGFEKAGKDDFAIQVFLEMRAVGCKPNICTFNALIKMHGNRGKFAE  422

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            + KV+ ++K     PD V++ ++++ + +          +++ K  G   +R     ++ 
Sbjct  423  MMKVFDDIKLCNCSPDIVTWNTLLAVFGQNGMDSQVSGIFKEMKRAGFVAERDTFNTLIS  482

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
             +S+    D+ + + + +       D   Y + L AL   GL
Sbjct  483  AYSRCGSFDQAMAVYKSMLEAGVVPDLSTYNAVLAALARGGL  524


 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/155 (25%), Positives = 80/155 (52%), Gaps = 8/155 (5%)
 Frame = -2

Query  809  FDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVE  630
            F   +  Y+S++ MY ++   +++  ++ ++ E+G +P+   YNT++  + R   MK+  
Sbjct  645  FTPSLTTYNSLMYMYSRSENFQKSEEILREVLEKGMKPDRISYNTVIYAYCRNGRMKEAS  704

Query  629  KVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVF  450
            +++ EMK   +VPD V+Y + I+ Y+        +   +     G K D+     +V  +
Sbjct  705  RIFSEMKDSALVPDVVTYNTFIATYAADSMFAEAIDVVRYMIKQGCKPDQNTYNSIVDWY  764

Query  449  SKMNK---VDELVKLLQDL-----KTDETKLDERL  369
             K+++    +  VK L +L     K +E++L ER+
Sbjct  765  CKLDQRHEANSFVKNLSNLDPHVSKEEESRLLERI  799


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 78/155 (50%), Gaps = 0/155 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG    I   ++M+++YG+     +A  ++  M E    P++  YN+L+ ++ R+ N ++
Sbjct  608  RGISPDITTLNAMLSIYGRKQMVAKAHEILNFMHETRFTPSLTTYNSLMYMYSRSENFQK  667

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             E++ +E+  + + PDR+SY +VI AY +   ++   + + + K +    D       + 
Sbjct  668  SEEILREVLEKGMKPDRISYNTVIYAYCRNGRMKEASRIFSEMKDSALVPDVVTYNTFIA  727

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALN  351
             ++  +   E + +++ +     K D+  Y S ++
Sbjct  728  TYAADSMFAEAIDVVRYMIKQGCKPDQNTYNSIVD  762


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 66/130 (51%), Gaps = 0/130 (0%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            ++++++ Y + G   +A  +   M E G  P++  YN +L    R    +Q EKV  EM+
Sbjct  477  FNTLISAYSRCGSFDQAMAVYKSMLEAGVVPDLSTYNAVLAALARGGLWEQSEKVLAEME  536

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
              +  P+ +SY+S++ AY+  KE+E    + ++      +T   +   +V V SK + + 
Sbjct  537  DGRCKPNELSYSSLLHAYANGKEIERMNAFAEEIYSGSVETHAVLLKTLVLVNSKSDLLI  596

Query  428  ELVKLLQDLK  399
            E  +   +L+
Sbjct  597  ETERAFLELR  606


 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 65/138 (47%), Gaps = 0/138 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            GF    V Y+S+++ Y K G  +EA  L  +M  +G +P+V+ Y TLL    +A      
Sbjct  329  GFSPTSVTYNSLISAYAKGGLLEEALDLKTQMVHKGIKPDVFTYTTLLSGFEKAGKDDFA  388

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             +V+ EM+     P+  ++ ++I  +    +    +K + D KL     D      ++ V
Sbjct  389  IQVFLEMRAVGCKPNICTFNALIKMHGNRGKFAEMMKVFDDIKLCNCSPDIVTWNTLLAV  448

Query  452  FSKMNKVDELVKLLQDLK  399
            F +     ++  + +++K
Sbjct  449  FGQNGMDSQVSGIFKEMK  466



>gb|AFV61128.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
rugosa]
Length=348

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  87   KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  146

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  147  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  206

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  207  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  254


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  122  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  181

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  182  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  241

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  242  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  277


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  156  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  215

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  216  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  245


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/140 (21%), Positives = 67/140 (48%), Gaps = 0/140 (0%)
 Frame = -2

Query  749  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  570
            + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EMK   V+P+  SY++
Sbjct  3    YSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIGEMKAAGVMPNTXSYST  62

Query  569  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  390
            +++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++   
Sbjct  63   LLTMYVENKKFLEALSVFXEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMG  122

Query  389  TKLDERLYRSALNALRDAGL  330
             + +   Y + L    DA L
Sbjct  123  IEPNVVSYNTLLRVYGDAEL  142



>gb|AFV61130.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
viburnoides]
Length=337

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  87   KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  146

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  147  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  206

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  207  WGKVGKLDRAAMLFQKLRSSGXEIDQILFQTMIVAYERAGLVAHAKRL  254


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  122  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  181

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  182  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGXEIDQILFQTMIVA  241

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  242  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  277


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  156  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  215

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++      D++ + ++I AY +A
Sbjct  216  AAMLFQKLRSSGXEIDQILFQTMIVAYERA  245


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/140 (21%), Positives = 67/140 (48%), Gaps = 0/140 (0%)
 Frame = -2

Query  749  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  570
            + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EMK   V+P+  SY++
Sbjct  3    YSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIGEMKAAGVMPNTASYST  62

Query  569  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  390
            +++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++   
Sbjct  63   LLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMG  122

Query  389  TKLDERLYRSALNALRDAGL  330
             + +   Y + L    DA L
Sbjct  123  IEPNVVSYNTLLRVYGDAEL  142



>gb|AFV61113.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
herrerae]
Length=433

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  147  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  206

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  207  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  266

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  267  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  314


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/165 (24%), Positives = 83/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  182  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  241

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  242  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  301

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  302  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  334


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  216  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  275

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D+V Y ++I AY +A
Sbjct  276  AAMLFQKLRSSGVEIDQVLYQTMIVAYERA  305


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  47   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFMPDLVAYNAMINVFGKAKLFREARALIS  106

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  107  EMKTAGVMPNTASYSTLLTMYVENKKFIEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  166

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  167  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  202


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  251  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAH  310

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  311  AKRLLHELKS----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  366

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  367  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  402



>gb|AFV61119.1| pentatricopeptide repeat-containing protein 123, partial [Junellia 
succulentifolia]
Length=382

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  105  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  164

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  165  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  224

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  225  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  272


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  140  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  199

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  200  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  259

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  260  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  303


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  174  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  233

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  234  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  289

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  290  ILAGAGRIEE  299


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 74/156 (47%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   +    +  
Sbjct  5    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFMPDLVAYNAMINVFGKAKLFRDARSLIS  64

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  65   EMRTAGVTPNTASYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  124

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  125  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  160



>gb|AIU48547.1| tetratricopeptide repeat-like superfamily protein, partial [Eucalyptus 
grandis]
Length=470

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 94/170 (55%), Gaps = 0/170 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++N YGK  R +EA  +  +M   G  P    YN LLD    +  ++Q 
Sbjct  269  GLRPDVVSYALLINAYGKARREEEALAVFEEMLSAGVRPTHKAYNILLDAFAISGMVEQA  328

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R + +PD  SYT+++SAY  A +++   K+++  K +G   +    G M+  
Sbjct  329  RIVFKSMRRDRYMPDLCSYTTMLSAYVNASDMDGAEKFFRRLKQDGFDPNVVTYGTMIKG  388

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  303
            ++++NK+++++++ ++++    K ++ ++ + ++A      +    W +E
Sbjct  389  YARVNKLEKMMEVYEEMRLRGIKANQTVFTTIMDAYGKNDFDSALVWFKE  438


 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 79/152 (52%), Gaps = 3/152 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ M+ K G +++A ++ + M ERG + +   YN+L+      SN K+V K++ +M+
Sbjct  210  FHMMIYMHKKAGNYEKARQMFSLMAERGVQQSTVTYNSLMSFE---SNYKEVSKIYDQMQ  266

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  E  +  +++    G +       I++  F+    V+
Sbjct  267  RAGLRPDVVSYALLINAYGKARREEEALAVFEEMLSAGVRPTHKAYNILLDAFAISGMVE  326

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            +   + + ++ D    D   Y + L+A  +A 
Sbjct  327  QARIVFKSMRRDRYMPDLCSYTTMLSAYVNAS  358



>emb|CBI24234.3| unnamed protein product [Vitis vinifera]
Length=589

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 83/157 (53%), Gaps = 0/157 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G   C+  Y++++N   KTG++  A  ++ +M + G  P+   YN LL    R  NM  
Sbjct  161  KGLKPCVFTYNAIINGLCKTGKYLRAKGVLDEMLKIGMSPDTATYNILLVECCRNDNMMD  220

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             E+++ EM  + VVPD VS++++I   SK   L+  +KY++D K  G   D  +  I++G
Sbjct  221  AERIFDEMPSQGVVPDLVSFSALIGLLSKNGCLDQALKYFRDMKNAGLAPDNVIYTILIG  280

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
             F +   + E +K+  ++      LD   Y + LN L
Sbjct  281  GFCRNGVMSEALKVRDEMLEQGCVLDVVTYNTILNGL  317


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG       +++++N Y K G   +A  L   M +R  +P+V  YNTL+D   + S M++
Sbjct  336  RGVFPDFYTFTTLINGYSKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSEMEK  395

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAY  555
            V ++W +M  R++ P+ +SY  +I+ Y
Sbjct  396  VNELWNDMISRRIYPNHISYGILINGY  422


 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 66/132 (50%), Gaps = 0/132 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V Y++++N   K     EA  L  +M ERG  P+ + + TL++ + +  NM +   +++
Sbjct  307  VVTYNTILNGLCKEKMLSEADELFTEMTERGVFPDFYTFTTLINGYSKDGNMNKAVTLFE  366

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
             M +R + PD V+Y ++I  + K  E+E   + + D        +    GI++  +  M 
Sbjct  367  MMIQRNLKPDVVTYNTLIDGFCKGSEMEKVNELWNDMISRRIYPNHISYGILINGYCNMG  426

Query  437  KVDELVKLLQDL  402
             V E  +L  ++
Sbjct  427  CVSEAFRLWDEM  438


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/185 (23%), Positives = 89/185 (48%), Gaps = 7/185 (4%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V Y+ ++  + + G   EA ++  +M E+GC  +V  YNT+L+   +   + + ++++ E
Sbjct  273  VIYTILIGGFCRNGVMSEALKVRDEMLEQGCVLDVVTYNTILNGLCKEKMLSEADELFTE  332

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  R V PD  ++T++I+ YSK   +   V  ++       K D      ++  F K ++
Sbjct  333  MTERGVFPDFYTFTTLINGYSKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSE  392

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA-----KWLQESFAVAT*IISC  270
            ++++ +L  D+ +     +   Y   +N   + G    A     + +++ F     II+C
Sbjct  393  MEKVNELWNDMISRRIYPNHISYGILINGYCNMGCVSEAFRLWDEMVEKGFEAT--IITC  450

Query  269  NSAKK  255
            N+  K
Sbjct  451  NTIVK  455


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 76/168 (45%), Gaps = 6/168 (4%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            ++Y  ++N Y   G   EA RL  +M E+G E  +   NT++  + RA N  + ++    
Sbjct  413  ISYGILINGYCNMGCVSEAFRLWDEMVEKGFEATIITCNTIVKGYCRAGNAVKADEFLSN  472

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  + +VPD ++Y ++I+ + K + ++         + +G   D     +++  FS+  +
Sbjct  473  MLLKGIVPDGITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVITYNVILNGFSRQGR  532

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  291
            + E   ++  +       D   Y S +N        +    L+E+F V
Sbjct  533  MQEAELIMLKMIERGVNPDRSTYTSLING------HVTQNNLKEAFRV  574


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 52/104 (50%), Gaps = 0/104 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            + Y++++N + K      A  LV KM+  G  P+V  YN +L+   R   M++ E +  +
Sbjct  483  ITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVITYNVILNGFSRQGRMQEAELIMLK  542

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  483
            M  R V PDR +YTS+I+ +     L+   + + +    G   D
Sbjct  543  MIERGVNPDRSTYTSLINGHVTQNNLKEAFRVHDEMLQRGFVPD  586


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            ++ Y+ ++N + + GR +EA  ++ KM ERG  P+   Y +L++ H   +N+K+  +V  
Sbjct  517  VITYNVILNGFSRQGRMQEAELIMLKMIERGVNPDRSTYTSLINGHVTQNNLKEAFRVHD  576

Query  617  EMKRRKVVPD  588
            EM +R  VPD
Sbjct  577  EMLQRGFVPD  586



>gb|KJB75396.1| hypothetical protein B456_012G039700 [Gossypium raimondii]
Length=586

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 91/163 (56%), Gaps = 3/163 (2%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++N YGK  R +EA  +  +M + G  P    YN LLD    +  ++Q 
Sbjct  348  GLHPDVVSYALLINAYGKARREEEALAVFEEMLDAGIRPTRKSYNILLDAFAISGMVEQA  407

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R +  PD  SYT+++SAY  A ++E   K++   K +G K +    G ++  
Sbjct  408  RTVFKSMRRDRYTPDICSYTTMLSAYVNASDMEGAEKFFTRLKRDGLKPNIVTYGTLMKG  467

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL---RDAG  333
            ++K+N ++++++  ++++    K ++ ++ + ++A    RD G
Sbjct  468  YAKVNSLEKMMETYEEMRLSSIKANQTIFTTLMDAYGKNRDFG  510


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 80/151 (53%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G +++A +L A M ERG + +   YN+L+      +N K+V K++ +M+
Sbjct  289  FHMMIYMYKKAGSYEKARKLFALMAERGVKQSTVTYNSLMSFE---TNYKEVSKIYDQMQ  345

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  E  +  +++    G +  R    I++  F+    V+
Sbjct  346  RAGLHPDVVSYALLINAYGKARREEEALAVFEEMLDAGIRPTRKSYNILLDAFAISGMVE  405

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +   + + ++ D    D   Y + L+A  +A
Sbjct  406  QARTVFKSMRRDRYTPDICSYTTMLSAYVNA  436


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/134 (20%), Positives = 74/134 (55%), Gaps = 0/134 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            I +Y++M++ Y      + A +   ++K  G +PN+  Y TL+  + + ++++++ + ++
Sbjct  423  ICSYTTMLSAYVNASDMEGAEKFFTRLKRDGLKPNIVTYGTLMKGYAKVNSLEKMMETYE  482

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   +  ++  +T+++ AY K ++  S V +Y++    G   D+    I++ + +  +
Sbjct  483  EMRLSSIKANQTIFTTLMDAYGKNRDFGSAVVWYKEMGSYGVPPDQKAKNILLSLATTAD  542

Query  437  KVDELVKLLQDLKT  396
            +  E  +L+  ++T
Sbjct  543  EQKEAKQLVGCMET  556



>gb|AFV61135.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
duartei]
Length=381

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  104  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  163

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  164  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  223

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  224  WGKVGKLDRAAXLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  271


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  139  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  198

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  199  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAXLFQKLRSSGVEIDQILFQTMIVA  258

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  259  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  294


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  173  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  232

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  233  AAXLFQKLRSSGVEIDQILFQTMIVAYERA  262


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRLGFXPDLVAYNAMINVFGKAKLFREARSLIG  63

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  ++ T++  + RA  +  
Sbjct  208  RGIEPNSITYSTIISIWGKVGKLDRAAXLFQKLRSSGVEIDQILFQTMIVAYERAGLVAH  267

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  268  AKRLLHELKR----PDNIPRDTAIHILAGAGRIEEATYVFRQXIDAGEVKDITVFERMIH  323

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            + SK  K   +V++   ++      D  +    LNA
Sbjct  324  LLSKYKKYSNVVEVFDKMRGLGYFPDSDVIAIVLNA  359



>ref|XP_010275891.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 
[Nelumbo nucifera]
Length=586

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 90/150 (60%), Gaps = 0/150 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V+Y+ ++N YGK  R +EA  +  +M + G +P    YN LLD    +  +++   ++K
Sbjct  311  VVSYALLINAYGKARREEEALAVFEEMLDAGVKPTRKAYNILLDAFAISGMVEEARTIFK  370

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
             M+R K +PD  SYT+++SAY  A ++E   K+++  K +G + +    G ++  ++KMN
Sbjct  371  SMRRDKCMPDLCSYTTMLSAYVNASDMEGAEKFFRRLKQDGFEPNVVTYGTLIKGYAKMN  430

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNA  348
             +D++++  ++++    + ++ ++ + ++A
Sbjct  431  NLDKMMEKYEEMRIQGIEANQTIFTTIMDA  460


 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 81/151 (54%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G++++A ++ AKM ERG   +   YN+L+      +N K+V  ++ +M+
Sbjct  247  FHMMIYMYRKAGKYEKARKIFAKMSERGVPQSTVTYNSLMSFE---TNYKEVSSIYDQMQ  303

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  E  +  +++    G K  R    I++  F+    V+
Sbjct  304  RANIQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVKPTRKAYNILLDAFAISGMVE  363

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            E   + + ++ D+   D   Y + L+A  +A
Sbjct  364  EARTIFKSMRRDKCMPDLCSYTTMLSAYVNA  394


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 65/116 (56%), Gaps = 0/116 (0%)
 Frame = -2

Query  791  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  612
            AY+ +++ +  +G  +EA  +   M+   C P++  Y T+L  +  AS+M+  EK ++ +
Sbjct  348  AYNILLDAFAISGMVEEARTIFKSMRRDKCMPDLCSYTTMLSAYVNASDMEGAEKFFRRL  407

Query  611  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSK  444
            K+    P+ V+Y ++I  Y+K   L+  ++ Y++ ++ G + ++ +   ++  + K
Sbjct  408  KQDGFEPNVVTYGTLIKGYAKMNNLDKMMEKYEEMRIQGIEANQTIFTTIMDAYGK  463


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/126 (24%), Positives = 65/126 (52%), Gaps = 3/126 (2%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            ++  YGK G   +A RL++ M ++G  P+V  +  L++ +GR     + E +++ M+   
Sbjct  142  LITAYGKQGEFNKAERLLSYMNKKGYPPSVISHTALMEAYGRGGQYNKAETMFRRMQTSG  201

Query  599  VVPDRVSYTSVISAY---SKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
              P  ++Y  ++  +    K +E E+  +   D K++  K D+ M  +M+ ++ K  K +
Sbjct  202  PEPSALTYQIILKIFVEGDKFREAEAIFETLLDDKISPLKPDQKMFHMMIYMYRKAGKYE  261

Query  428  ELVKLL  411
            +  K+ 
Sbjct  262  KARKIF  267


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 67/121 (55%), Gaps = 3/121 (2%)
 Frame = -2

Query  806  DKC---IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            DKC   + +Y++M++ Y      + A +   ++K+ G EPNV  Y TL+  + + +N+ +
Sbjct  375  DKCMPDLCSYTTMLSAYVNASDMEGAEKFFRRLKQDGFEPNVVTYGTLIKGYAKMNNLDK  434

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            + + ++EM+ + +  ++  +T+++ AY K  +  S + ++++    G   D+    I++ 
Sbjct  435  MMEKYEEMRIQGIEANQTIFTTIMDAYGKNTDFGSALIWFKEMGNCGFPPDQKAKNILLS  494

Query  455  V  453
            +
Sbjct  495  L  495



>ref|XP_008464651.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 
isoform X2 [Cucumis melo]
Length=500

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/205 (26%), Positives = 111/205 (54%), Gaps = 14/205 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ +++ YGK  R +EA  +  +M + G  P    YN LLD    +  ++Q 
Sbjct  228  GLKPDVVSYALLISAYGKARREEEALAVFEEMLDAGIRPTHKAYNILLDAFAISGLVEQA  287

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            + V+K MKR +  PD  SYT+++SAY  A ++E    +++  K +G + +    G ++  
Sbjct  288  KTVFKSMKRDRCNPDICSYTTMLSAYVNASDMEGAETFFRRLKQDGFRPNVVTYGTLIKG  347

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL-RDAGLEIRAKWLQESFAVAT*II  276
            ++K+N +++++K  +++K +  ++++ +  + ++A  ++   +    W +E       I 
Sbjct  348  YAKINNLEKMIKRYEEMKVNGIRVNQTILTTIMDAYGKNKDFDSAVIWFKE-------IE  400

Query  275  SCN-SAKKKPKNIVNTRWRISLSET  204
            SC     +K KNI+     +SL++T
Sbjct  401  SCGLRPDQKAKNIL-----LSLAKT  420


 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 77/151 (51%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  ++ M+ K G +++A ++ A+M  RG       YN+L+      +N K+V K++ +M+
Sbjct  169  FHMIIYMFKKAGNYEKARKVFAEMAARGVPQTTVTYNSLMSFE---TNYKEVSKIYDQMQ  225

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +ISAY KA+  E  +  +++    G +       I++  F+    V+
Sbjct  226  RAGLKPDVVSYALLISAYGKARREEEALAVFEEMLDAGIRPTHKAYNILLDAFAISGLVE  285

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +   + + +K D    D   Y + L+A  +A
Sbjct  286  QAKTVFKSMKRDRCNPDICSYTTMLSAYVNA  316


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/135 (24%), Positives = 75/135 (56%), Gaps = 3/135 (2%)
 Frame = -2

Query  806  DKC---IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            D+C   I +Y++M++ Y      + A     ++K+ G  PNV  Y TL+  + + +N+++
Sbjct  297  DRCNPDICSYTTMLSAYVNASDMEGAETFFRRLKQDGFRPNVVTYGTLIKGYAKINNLEK  356

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            + K ++EMK   +  ++   T+++ AY K K+ +S V ++++ +  G + D+    I++ 
Sbjct  357  MIKRYEEMKVNGIRVNQTILTTIMDAYGKNKDFDSAVIWFKEIESCGLRPDQKAKNILLS  416

Query  455  VFSKMNKVDELVKLL  411
            +     +++E  +L+
Sbjct  417  LAKTAEELEEANQLV  431


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 82/205 (40%), Gaps = 41/205 (20%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G+   +V++++++  YG+ GR+  A  +  +M+  G EP+   Y  +L      S  K+
Sbjct  87   KGYAPNVVSHTALMEAYGRGGRYNNAEAIFRRMQSGGPEPSALTYQIMLKTFVEGSKFKE  146

Query  635  VE--------------------------------------KVWKEMKRRKVVPDRVSYTS  570
             E                                      KV+ EM  R V    V+Y S
Sbjct  147  AEELFDSLLNKEKPVLKPDQKMFHMIIYMFKKAGNYEKARKVFAEMAARGVPQTTVTYNS  206

Query  569  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  390
            ++S  +  KE+    K Y   +  G K D     +++  + K  + +E + + +++    
Sbjct  207  LMSFETNYKEVS---KIYDQMQRAGLKPDVVSYALLISAYGKARREEEALAVFEEMLDAG  263

Query  389  TKLDERLYRSALNALRDAGLEIRAK  315
             +   + Y   L+A   +GL  +AK
Sbjct  264  IRPTHKAYNILLDAFAISGLVEQAK  288



>gb|AFV61117.1| pentatricopeptide repeat-containing protein 123, partial [Burroughsia 
fastigiata]
Length=348

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTL+ ++G A    + 
Sbjct  87   KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLVRVYGDAELFGEA  146

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ +
Sbjct  147  IHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  206

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  207  WGKVGKLDRAAMLFQKLRSSGXEIDQILFQTMIVAYERAGLVAHAKRL  254


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y+++V +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  122  GIEPNVVSYNTLVRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKA  181

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  182  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGXEIDQILFQTMIVA  241

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  242  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  277


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  156  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  215

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++      D++ + ++I AY +A
Sbjct  216  AAMLFQKLRSSGXEIDQILFQTMIVAYERA  245


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 56/113 (50%), Gaps = 0/113 (0%)
 Frame = -2

Query  749  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  570
            + +A  + +++K  G  P++  YNT++ + G+A   ++   +  EMK   V P+  SY++
Sbjct  3    YSKAISIFSRLKSSGYXPDLVAYNTMIIVFGKAKLFREARSLISEMKTAGVTPNTTSYST  62

Query  569  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  411
            +++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL 
Sbjct  63   LLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLF  115



>gb|KHG20151.1| hypothetical protein F383_02209 [Gossypium arboreum]
Length=584

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 91/163 (56%), Gaps = 3/163 (2%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++N YGK  R +EA  +  +M + G  P    YN LLD    +  ++Q 
Sbjct  348  GLHPDVVSYALLINAYGKARREEEALAVFEEMLDAGIRPTHKSYNILLDAFAISGMLEQA  407

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R +  PD  SYT+++SAY  A ++E   K++   K +G K +    G ++  
Sbjct  408  RTVFKSMRRDRYTPDICSYTTMLSAYVNASDMEGAEKFFTRLKRDGLKPNIVTYGTLMKG  467

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL---RDAG  333
            ++K+N ++++++  ++++    K ++ ++ + ++A    RD G
Sbjct  468  YAKVNNLEKMMETYEEMRLSGIKANQTIFTTLMDAYGKNRDFG  510


 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 79/151 (52%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G +++A +L A M ERG + +   YN+L+      +N K+V K++ +M+
Sbjct  289  FHMMIYMYKKAGSYEKARKLFALMAERGVKQSTVTYNSLMSFE---TNYKEVSKIYDQMQ  345

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  E  +  +++    G +       I++  F+    ++
Sbjct  346  RAGLHPDVVSYALLINAYGKARREEEALAVFEEMLDAGIRPTHKSYNILLDAFAISGMLE  405

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +   + + ++ D    D   Y + L+A  +A
Sbjct  406  QARTVFKSMRRDRYTPDICSYTTMLSAYVNA  436


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/134 (21%), Positives = 74/134 (55%), Gaps = 0/134 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            I +Y++M++ Y      + A +   ++K  G +PN+  Y TL+  + + +N++++ + ++
Sbjct  423  ICSYTTMLSAYVNASDMEGAEKFFTRLKRDGLKPNIVTYGTLMKGYAKVNNLEKMMETYE  482

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   +  ++  +T+++ AY K ++  S V +Y++    G   D+    I++ + +  +
Sbjct  483  EMRLSGIKANQTIFTTLMDAYGKNRDFGSAVVWYKEMGSYGVPPDQKAKKILLSLATTAD  542

Query  437  KVDELVKLLQDLKT  396
            +  E  +L+  ++T
Sbjct  543  EQKEAKQLVGCMET  556



>gb|ACU25749.1| pentatricopeptide repeat-containing protein [Glandularia araucana]
Length=426

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D+   L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDKAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDKAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDK  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|AFV61137.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
hederifolia]
Length=364

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  87   KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  146

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  147  IHLFRLMQRKSIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  206

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  207  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  254


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  122  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKSIEQNVVTYNSMMMIYGKTLEHEKA  181

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  182  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  241

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  242  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  277


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  156  KSIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  215

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  216  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  245


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/140 (21%), Positives = 67/140 (48%), Gaps = 0/140 (0%)
 Frame = -2

Query  749  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  570
            + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EMK   V+P+  SY++
Sbjct  3    YSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMKTAGVMPNTTSYST  62

Query  569  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  390
            +++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++   
Sbjct  63   LLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMG  122

Query  389  TKLDERLYRSALNALRDAGL  330
             + +   Y + L    DA L
Sbjct  123  IEPNVVSYNTLLRVYGDAEL  142



>gb|AFV61149.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
salviifolia]
Length=378

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  88   KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  147

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  148  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  207

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  208  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  255


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  123  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  182

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  183  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  242

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  243  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  278


 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  157  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  216

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  217  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  246


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 67/140 (48%), Gaps = 0/140 (0%)
 Frame = -2

Query  749  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  570
            + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EMK   V+P+  SY++
Sbjct  4    YSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMKTAGVMPNTTSYST  63

Query  569  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  390
            ++S Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++   
Sbjct  64   LLSMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMG  123

Query  389  TKLDERLYRSALNALRDAGL  330
             + +   Y + L    DA L
Sbjct  124  IEPNVVSYNTLLRVYGDAEL  143



>gb|AFV61111.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
barbata]
Length=364

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  87   KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  146

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  147  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  206

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  207  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  254


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  122  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  181

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  182  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  241

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  242  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  277


 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  156  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  215

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  216  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  245


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/140 (21%), Positives = 67/140 (48%), Gaps = 0/140 (0%)
 Frame = -2

Query  749  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  570
            + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EMK   V+P+  SY++
Sbjct  3    YSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMKXAGVMPNTTSYST  62

Query  569  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  390
            +++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++   
Sbjct  63   LLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMG  122

Query  389  TKLDERLYRSALNALRDAGL  330
             + +   Y + L    DA L
Sbjct  123  IEPNVVSYNTLLRVYGDAEL  142



>gb|AIU48543.1| tetratricopeptide repeat-like superfamily protein, partial [Gossypium 
raimondii]
Length=470

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 88/155 (57%), Gaps = 0/155 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++N YGK  R +EA  +  +M + G  P    YN LLD    +  ++Q 
Sbjct  269  GLHPDVVSYALLINAYGKARREEEALAVFEEMLDAGIRPTRKSYNILLDAFAISGMVEQA  328

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R +  PD  SYT+++SAY  A ++E   K++   K +G K +    G ++  
Sbjct  329  RTVFKSMRRDRYTPDICSYTTMLSAYVNASDMEGAEKFFTRLKRDGLKPNIVTYGTLMKG  388

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            ++K+N ++++++  ++++    K ++ ++ + ++A
Sbjct  389  YAKVNSLEKMMETYEEMRLSSIKANQTIFTTLMDA  423


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 80/152 (53%), Gaps = 3/152 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G +++A +L A M ERG + +   YN+L+      +N K+V K++ +M+
Sbjct  210  FHMMIYMYKKAGSYEKARKLFALMAERGVKQSTVTYNSLMSFE---TNYKEVSKIYDQMQ  266

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  E  +  +++    G +  R    I++  F+    V+
Sbjct  267  RAGLHPDVVSYALLINAYGKARREEEALAVFEEMLDAGIRPTRKSYNILLDAFAISGMVE  326

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            +   + + ++ D    D   Y + L+A  +A 
Sbjct  327  QARTVFKSMRRDRYTPDICSYTTMLSAYVNAS  358



>emb|CAN63985.1| hypothetical protein VITISV_001389 [Vitis vinifera]
Length=850

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 83/157 (53%), Gaps = 0/157 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G   C+  Y++++N   KTG++  A  ++ +M + G  P+   YN LL    R  NM  
Sbjct  422  KGLKPCVFTYNAIINGLCKTGKYLRAKGVLDEMLKIGMSPDTATYNILLVECCRNDNMMD  481

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             E+++ EM  + VVPD VS++++I   SK   L+  +KY++D K  G   D  +  I++G
Sbjct  482  AERIFDEMPSQGVVPDLVSFSALIGLLSKNGCLDQALKYFRDMKNAGLAPDNVIYTILIG  541

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
             F +   + E +K+  ++      LD   Y + LN L
Sbjct  542  GFCRNGVMSEALKVRDEMLEQGCXLDVVTYNTILNGL  578


 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG       +++++N Y K G   +A  L   M +R  +P+V  YNTL+D   + S M++
Sbjct  597  RGVFPDFYTFTTLINGYXKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSEMEK  656

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAY  555
            V ++W +M  R++ P+ +SY  +I+ Y
Sbjct  657  VNELWNDMISRRIYPNHISYGILINGY  683


 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 66/132 (50%), Gaps = 0/132 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V Y++++N   K     EA  L  +M ERG  P+ + + TL++ + +  NM +   +++
Sbjct  568  VVTYNTILNGLCKEKMLSEADELFTEMTERGVFPDFYTFTTLINGYXKDGNMNKAVTLFE  627

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
             M +R + PD V+Y ++I  + K  E+E   + + D        +    GI++  +  M 
Sbjct  628  MMIQRNLKPDVVTYNTLIDGFCKGSEMEKVNELWNDMISRRIYPNHISYGILINGYCNMG  687

Query  437  KVDELVKLLQDL  402
             V E  +L  ++
Sbjct  688  CVSEAFRLWDEM  699


 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 88/185 (48%), Gaps = 7/185 (4%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V Y+ ++  + + G   EA ++  +M E+GC  +V  YNT+L+   +   + + ++++ E
Sbjct  534  VIYTILIGGFCRNGVMSEALKVRDEMLEQGCXLDVVTYNTILNGLCKEKMLSEADELFTE  593

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  R V PD  ++T++I+ Y K   +   V  ++       K D      ++  F K ++
Sbjct  594  MTERGVFPDFYTFTTLINGYXKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSE  653

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA-----KWLQESFAVAT*IISC  270
            ++++ +L  D+ +     +   Y   +N   + G    A     + +++ F     II+C
Sbjct  654  MEKVNELWNDMISRRIYPNHISYGILINGYCNMGCVSEAFRLWDEMVEKGFEAT--IITC  711

Query  269  NSAKK  255
            N+  K
Sbjct  712  NTIVK  716


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 76/168 (45%), Gaps = 6/168 (4%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            ++Y  ++N Y   G   EA RL  +M E+G E  +   NT++  + RA N  + ++    
Sbjct  674  ISYGILINGYCNMGCVSEAFRLWDEMVEKGFEATIITCNTIVKGYCRAGNAVKADEFLSN  733

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  + +VPD ++Y ++I+ + K + ++         + +G   D     +++  FS+  +
Sbjct  734  MLLKGIVPDGITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVITYNVILNGFSRQGR  793

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  291
            + E   ++  +       D   Y S +N        +    L+E+F V
Sbjct  794  MQEAELIMLKMIERGVNPDRSTYTSLING------HVTQNNLKEAFRV  835


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 52/104 (50%), Gaps = 0/104 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            + Y++++N + K      A  LV KM+  G  P+V  YN +L+   R   M++ E +  +
Sbjct  744  ITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVITYNVILNGFSRQGRMQEAELIMLK  803

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  483
            M  R V PDR +YTS+I+ +     L+   + + +    G   D
Sbjct  804  MIERGVNPDRSTYTSLINGHVTQNNLKEAFRVHDEMLQRGFVPD  847


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            ++ Y+ ++N + + GR +EA  ++ KM ERG  P+   Y +L++ H   +N+K+  +V  
Sbjct  778  VITYNVILNGFSRQGRMQEAELIMLKMIERGVNPDRSTYTSLINGHVTQNNLKEAFRVHD  837

Query  617  EMKRRKVVPD  588
            EM +R  VPD
Sbjct  838  EMLQRGFVPD  847



>gb|ACU25759.1| pentatricopeptide repeat-containing protein [Mulguraea aspera]
Length=426

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC +  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCFLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 86/169 (51%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 77/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K+ G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKKSGFMPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFAEMREIKCFLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|AFV61145.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
rehmannii]
Length=379

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  105  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  164

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  165  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  224

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  225  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  272


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  140  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  199

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  200  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  259

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  260  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  295


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  174  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  233

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  234  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  263


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  5    LVLYSNLIELSRKLCDYSKAIAIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIG  64

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  65   EMKTAGVMPNTSSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  124

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  125  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  160



>gb|ACU25741.1| pentatricopeptide repeat-containing protein [Verbena hastata]
Length=426

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFMPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|AFV61151.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
velutina]
Length=382

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  105  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  164

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  165  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  224

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  225  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  272


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  140  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  199

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  200  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  259

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  260  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  295


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  174  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  233

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  234  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  263


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  5    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  64

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  65   EMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  124

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  125  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  160



>gb|ACU25744.1| pentatricopeptide repeat-containing protein [Verbena montevidensis]
 gb|ACU25745.1| pentatricopeptide repeat-containing protein [Verbena litoralis]
Length=426

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V PD  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMKTAGVTPDTASYSTLLTMYVENKKFLEALSIFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/138 (20%), Positives = 65/138 (47%), Gaps = 0/138 (0%)
 Frame = -2

Query  791  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  612
             YS+++  +GK G    A   + KM++     ++ +Y+ L+++  +  +  +   ++  +
Sbjct  11   TYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKLCDYSKAISIFSRL  70

Query  611  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  432
            KR    PD V+Y ++I+ + KAK          + K  G   D A    ++ ++ +  K 
Sbjct  71   KRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMKTAGVTPDTASYSTLLTMYVENKKF  130

Query  431  DELVKLLQDLKTDETKLD  378
             E + +  +++  +  LD
Sbjct  131  LEALSIFAEMREIKCLLD  148



>gb|ACU25743.1| pentatricopeptide repeat-containing protein [Verbena bonariensis]
Length=425

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENKKFLEALSIFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|AFV61153.1| pentatricopeptide repeat-containing protein 123, partial [Phyla 
nodiflora]
Length=419

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 86/157 (55%), Gaps = 0/157 (0%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R+ 
Sbjct  140  MIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKN  199

Query  599  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  420
            +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D   
Sbjct  200  IEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAA  259

Query  419  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
             L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  260  MLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  296


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  164  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKA  223

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  224  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  283

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  284  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  319


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  198  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  257

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  258  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  287


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/156 (20%), Positives = 73/156 (47%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V  S+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  29   LVLXSNLIELSRKLCDYSKAISIFSRLKXSGXXPDLXAYNAMINVFGKAKLFREARSLIX  88

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P   SY+++++ Y +  +    +  + + +      D     IM+ V+ ++ 
Sbjct  89   EMKTAGVMPXTTSYSTLLTMYVENXKFLEALSVFSEMREXKCLXDLXTCNIMIDVYGQLG  148

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  149  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  184


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 72/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  ++ T++  + RA  +  
Sbjct  233  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAH  292

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A  +E     ++    +G   D  +   M+ 
Sbjct  293  AKRLLHELKR----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDSGEVKDITVFERMIH  348

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            + SK  K   +V++   ++      D  +    LNA
Sbjct  349  LLSKYKKYMNVVEVFDKMRGLGYFPDSNVIAVVLNA  384



>gb|ACU25740.1| pentatricopeptide repeat-containing protein [Verbena canescens]
Length=426

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 74/156 (47%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P   SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPTTASYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|ACU25735.1| pentatricopeptide repeat-containing protein [Verbena perennis]
Length=426

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/156 (20%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + ++    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENRKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|AFV61122.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
fucata]
Length=382

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  105  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  164

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  165  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  224

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  225  WGKVGKLDRAAMLFQKLRSSGIEIDQILFQTMIVAYERAGLVAHAKRL  272


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  140  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  199

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  200  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGIEIDQILFQTMIVA  259

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  260  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  295


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  174  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  233

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   +  D++ + ++I AY +A
Sbjct  234  AAMLFQKLRSSGIEIDQILFQTMIVAYERA  263


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  5    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIG  64

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  65   EMKAAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  124

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  125  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  160



>gb|ACU25751.1| pentatricopeptide repeat-containing protein [Glandularia subincana]
Length=426

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENKKFLEALSXFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|ACU25754.1| pentatricopeptide repeat-containing protein [Junellia spathulata]
Length=426

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|AFV61132.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
aristata]
Length=382

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  105  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  164

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  165  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  224

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  225  WGKVGKLDRAAMLFQKLRSSGIEIDQILFQTMIVAYERAGLVAHAKRL  272


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  140  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  199

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  200  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGIEIDQILFQTMIVA  259

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  260  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  295


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  174  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  233

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   +  D++ + ++I AY +A
Sbjct  234  AAMLFQKLRSSGIEIDQILFQTMIVAYERA  263


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  5    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIG  64

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  65   EMKAAGVMPNTXSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  124

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  125  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  160



>gb|ACU25756.1| pentatricopeptide repeat-containing protein [Junellia uniflora]
Length=426

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V PD  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPDTASYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/138 (20%), Positives = 65/138 (47%), Gaps = 0/138 (0%)
 Frame = -2

Query  791  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  612
             YS+++  +GK G    A   + KM++     ++ +Y+ L+++  +  +  +   ++  +
Sbjct  11   TYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKLCDYSKAISIFSRL  70

Query  611  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  432
            KR    PD V+Y ++I+ + KAK          + +  G   D A    ++ ++ +  K 
Sbjct  71   KRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVTPDTASYSTLLTMYVENKKF  130

Query  431  DELVKLLQDLKTDETKLD  378
             E + +  +++  +  LD
Sbjct  131  LEALSVFAEMREIKCLLD  148



>gb|ACU25750.1| pentatricopeptide repeat-containing protein [Glandularia flava]
Length=426

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRXEEATWV  342


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D+V Y ++I AY +A
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERA  302


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|ACU25742.1| pentatricopeptide repeat-containing protein [Verbena hispida]
Length=426

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENKKFLEALSIFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|ACU25736.1| pentatricopeptide repeat-containing protein [Verbena bracteata]
 gb|ACU25738.1| pentatricopeptide repeat-containing protein [Verbena halei]
 gb|ACU25739.1| pentatricopeptide repeat-containing protein [Verbena officinalis]
Length=426

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|AFV61131.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
alba]
Length=419

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  150  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  209

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  210  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  269

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  270  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  317


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  304

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  305  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  340


 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  219  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  278

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  279  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  308


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  50   LVLYSNLIELSRKLCDYSKAIAIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIG  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMKTAGVMPNTSSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  ++ T++  + RA  +  
Sbjct  254  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAH  313

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  314  AKRLLHELKR----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  369

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            + SK  K   +V++   ++      D  +    LNA
Sbjct  370  LLSKYKKYXNVVEVFDKMRGLGYFPDSNVIAVVLNA  405



>gb|AHC02104.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
sonorensis]
Length=393

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  104  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  163

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  164  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  223

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  224  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  271


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  139  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  198

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  199  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  258

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  259  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  294


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  173  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  232

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  233  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  262


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  63

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  ++ T++  + RA  +  
Sbjct  208  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAH  267

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  268  AKRLLHELKR----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  323

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            + SK  K   +V++   ++      D  +    LNA
Sbjct  324  LLSKYKKYSNVVEVFDKMRGLGYFPDSNVIAVVLNA  359



>gb|ACU25748.1| pentatricopeptide repeat-containing protein [Glandularia microphylla]
Length=426

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>ref|XP_010687511.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860 
[Beta vulgaris subsp. vulgaris]
Length=836

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 88/162 (54%), Gaps = 1/162 (1%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRAS-NMKQ  636
            GFD  + AY++MV+     GR++EA  +  KM++ GC+P +  YN +L+++G+      +
Sbjct  213  GFDIDVYAYTAMVSACASNGRYREAVSVFRKMEDVGCKPTLVTYNVILNVYGKMGMPWSK  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            V +V  +MKR  +  D  +Y ++IS   +    E   K +++ KL+G   D+    +++ 
Sbjct  273  VAEVMDKMKRDGIAADLYTYNTLISCCRRGSLFEEAAKVFEEMKLDGFVPDKVTYNVLLD  332

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
            V+ K  +  E  ++LQ+++T      +  Y S ++A    GL
Sbjct  333  VYGKSRRYKEATEVLQEMETHGFSPSDVTYNSLISAYARGGL  374


 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 88/168 (52%), Gaps = 0/168 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            GF    V Y+ ++++YGK+ R+KEAT ++ +M+  G  P+   YN+L+  + R   +++ 
Sbjct  319  GFVPDKVTYNVLLDVYGKSRRYKEATEVLQEMETHGFSPSDVTYNSLISAYARGGLLEEA  378

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             ++  +M ++ + PD  +YTS+ S + KA + E  +K +++ K  G K + A    ++ +
Sbjct  379  MELKAQMVKKGIKPDVFTYTSLFSGFEKAGKDECAMKVFEEMKKAGCKPNIATFNALIKM  438

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
                 K  E+++  ++LK      D   + + L      G++I    L
Sbjct  439  HGNRKKFSEMMRTFEELKRCNCPPDIVTWNTLLAVFGQNGMDIEVSGL  486


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/150 (25%), Positives = 75/150 (50%), Gaps = 0/150 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            I  +++++ M+G   +  E  R   ++K   C P++  +NTLL + G+     +V  +++
Sbjct  429  IATFNALIKMHGNRKKFSEMMRTFEELKRCNCPPDIVTWNTLLAVFGQNGMDIEVSGLFR  488

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMKR   VP+R ++ ++I AYS+       +  Y+     G   D +    ++   ++  
Sbjct  489  EMKRAGFVPERDTFNTLIGAYSRCGSFNQSMAVYKMMLEAGVIPDLSTYNAVLAALARGG  548

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNA  348
              +E  K+L ++K  + K +E  Y   L+A
Sbjct  549  LWEESEKVLTEMKGGQCKPNELSYSCLLHA  578


 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/162 (21%), Positives = 80/162 (49%), Gaps = 0/162 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G    +  Y+S+ + + K G+ + A ++  +MK+ GC+PN+  +N L+ +HG      +
Sbjct  388  KGIKPDVFTYTSLFSGFEKAGKDECAMKVFEEMKKAGCKPNIATFNALIKMHGNRKKFSE  447

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            + + ++E+KR    PD V++ ++++ + +          +++ K  G   +R     ++G
Sbjct  448  MMRTFEELKRCNCPPDIVTWNTLLAVFGQNGMDIEVSGLFREMKRAGFVPERDTFNTLIG  507

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
             +S+    ++ + + + +       D   Y + L AL   GL
Sbjct  508  AYSRCGSFNQSMAVYKMMLEAGVIPDLSTYNAVLAALARGGL  549


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/139 (24%), Positives = 70/139 (50%), Gaps = 0/139 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
             GF    V Y+S+++ Y + G  +EA  L A+M ++G +P+V+ Y +L     +A   + 
Sbjct  353  HGFSPSDVTYNSLISAYARGGLLEEAMELKAQMVKKGIKPDVFTYTSLFSGFEKAGKDEC  412

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
              KV++EMK+    P+  ++ ++I  +   K+    ++ +++ K      D      ++ 
Sbjct  413  AMKVFEEMKKAGCKPNIATFNALIKMHGNRKKFSEMMRTFEELKRCNCPPDIVTWNTLLA  472

Query  455  VFSKMNKVDELVKLLQDLK  399
            VF +     E+  L +++K
Sbjct  473  VFGQNGMDIEVSGLFREMK  491


 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 68/133 (51%), Gaps = 0/133 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +  Y+++++   +    +EA ++  +MK  G  P+   YN LLD++G++   K+  +V +
Sbjct  289  LYTYNTLISCCRRGSLFEEAAKVFEEMKLDGFVPDKVTYNVLLDVYGKSRRYKEATEVLQ  348

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+     P  V+Y S+ISAY++   LE  ++        G K D      +   F K  
Sbjct  349  EMETHGFSPSDVTYNSLISAYARGGLLEEAMELKAQMVKKGIKPDVFTYTSLFSGFEKAG  408

Query  437  KVDELVKLLQDLK  399
            K +  +K+ +++K
Sbjct  409  KDECAMKVFEEMK  421


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/155 (19%), Positives = 80/155 (52%), Gaps = 0/155 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG+   +   ++M+++YG+    ++A  ++  MKE    P++  YN+L+ ++  + +  +
Sbjct  633  RGYSVDLTTLNAMISIYGRRQMVRKANEILDFMKESEYTPSLTTYNSLMYMYSLSGSFLR  692

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             E+  KE+  + + PD +SY +V+ AY +   L    + + + + +G   D     I++ 
Sbjct  693  AEEALKEIVGKGLQPDIISYNTVLYAYCRNGRLSDASRIFSEMRCSGIIPDVITYNIIIA  752

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALN  351
             ++  +   E + +++ +   + + ++  Y S ++
Sbjct  753  CYAANDMFLEAIDMVRCMINHDCRPNQNTYNSIVD  787


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/146 (22%), Positives = 69/146 (47%), Gaps = 0/146 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            IV +++++ ++G+ G   E + L  +MK  G  P    +NTL+  + R  +  Q   V+K
Sbjct  464  IVTWNTLLAVFGQNGMDIEVSGLFREMKRAGFVPERDTFNTLIGAYSRCGSFNQSMAVYK  523

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
             M    V+PD  +Y +V++A ++    E   K   + K    K +      ++  ++   
Sbjct  524  MMLEAGVIPDLSTYNAVLAALARGGLWEESEKVLTEMKGGQCKPNELSYSCLLHAYANGK  583

Query  437  KVDELVKLLQDLKTDETKLDERLYRS  360
            +++ +  L + + + E  L   L ++
Sbjct  584  QIEHMCTLAEKVYSGEIALHPVLLKT  609



>ref|XP_002275790.2| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Vitis vinifera]
 ref|XP_010651510.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Vitis vinifera]
 ref|XP_010651511.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Vitis vinifera]
 ref|XP_010651512.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Vitis vinifera]
Length=746

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 83/157 (53%), Gaps = 0/157 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G   C+  Y++++N   KTG++  A  ++ +M + G  P+   YN LL    R  NM  
Sbjct  318  KGLKPCVFTYNAIINGLCKTGKYLRAKGVLDEMLKIGMSPDTATYNILLVECCRNDNMMD  377

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             E+++ EM  + VVPD VS++++I   SK   L+  +KY++D K  G   D  +  I++G
Sbjct  378  AERIFDEMPSQGVVPDLVSFSALIGLLSKNGCLDQALKYFRDMKNAGLAPDNVIYTILIG  437

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
             F +   + E +K+  ++      LD   Y + LN L
Sbjct  438  GFCRNGVMSEALKVRDEMLEQGCVLDVVTYNTILNGL  474


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG       +++++N Y K G   +A  L   M +R  +P+V  YNTL+D   + S M++
Sbjct  493  RGVFPDFYTFTTLINGYSKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSEMEK  552

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAY  555
            V ++W +M  R++ P+ +SY  +I+ Y
Sbjct  553  VNELWNDMISRRIYPNHISYGILINGY  579


 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/128 (26%), Positives = 64/128 (50%), Gaps = 0/128 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V Y++++N   K     EA  L  +M ERG  P+ + + TL++ + +  NM +   +++
Sbjct  464  VVTYNTILNGLCKEKMLSEADELFTEMTERGVFPDFYTFTTLINGYSKDGNMNKAVTLFE  523

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
             M +R + PD V+Y ++I  + K  E+E   + + D        +    GI++  +  M 
Sbjct  524  MMIQRNLKPDVVTYNTLIDGFCKGSEMEKVNELWNDMISRRIYPNHISYGILINGYCNMG  583

Query  437  KVDELVKL  414
             V E  +L
Sbjct  584  CVSEAFRL  591


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/185 (23%), Positives = 89/185 (48%), Gaps = 7/185 (4%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V Y+ ++  + + G   EA ++  +M E+GC  +V  YNT+L+   +   + + ++++ E
Sbjct  430  VIYTILIGGFCRNGVMSEALKVRDEMLEQGCVLDVVTYNTILNGLCKEKMLSEADELFTE  489

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  R V PD  ++T++I+ YSK   +   V  ++       K D      ++  F K ++
Sbjct  490  MTERGVFPDFYTFTTLINGYSKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSE  549

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA-----KWLQESFAVAT*IISC  270
            ++++ +L  D+ +     +   Y   +N   + G    A     + +++ F     II+C
Sbjct  550  MEKVNELWNDMISRRIYPNHISYGILINGYCNMGCVSEAFRLWDEMVEKGFEAT--IITC  607

Query  269  NSAKK  255
            N+  K
Sbjct  608  NTIVK  612


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 76/168 (45%), Gaps = 6/168 (4%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            ++Y  ++N Y   G   EA RL  +M E+G E  +   NT++  + RA N  + ++    
Sbjct  570  ISYGILINGYCNMGCVSEAFRLWDEMVEKGFEATIITCNTIVKGYCRAGNAVKADEFLSN  629

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  + +VPD ++Y ++I+ + K + ++         + +G   D     +++  FS+  +
Sbjct  630  MLLKGIVPDGITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVITYNVILNGFSRQGR  689

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  291
            + E   ++  +       D   Y S +N        +    L+E+F V
Sbjct  690  MQEAELIMLKMIERGVNPDRSTYTSLING------HVTQNNLKEAFRV  731


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 52/104 (50%), Gaps = 0/104 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            + Y++++N + K      A  LV KM+  G  P+V  YN +L+   R   M++ E +  +
Sbjct  640  ITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVITYNVILNGFSRQGRMQEAELIMLK  699

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  483
            M  R V PDR +YTS+I+ +     L+   + + +    G   D
Sbjct  700  MIERGVNPDRSTYTSLINGHVTQNNLKEAFRVHDEMLQRGFVPD  743


 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            ++ Y+ ++N + + GR +EA  ++ KM ERG  P+   Y +L++ H   +N+K+  +V  
Sbjct  674  VITYNVILNGFSRQGRMQEAELIMLKMIERGVNPDRSTYTSLINGHVTQNNLKEAFRVHD  733

Query  617  EMKRRKVVPD  588
            EM +R  VPD
Sbjct  734  EMLQRGFVPD  743



>gb|EMS45043.1| hypothetical protein TRIUR3_16364 [Triticum urartu]
Length=483

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 93/168 (55%), Gaps = 0/168 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +  YS+++     +GR ++AT++  +M+ERG +PN  ++ TL+D H +A ++K  
Sbjct  179  GITPDVYTYSALIKGLSSSGRIEDATKMFDEMRERGVKPNAIVFTTLIDAHCKAGDVKAG  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             +++++M+ R V+PD V+Y ++++   +A+  E+     ++ +  G K D+     ++  
Sbjct  239  MELYQDMRARGVMPDLVAYNALLNGLCRARNFEAAECIVEEMRGTGLKPDKVTYTTLIDG  298

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
              K  K+D  + + Q +  +E  LDE  Y + ++ L  A   + A+ +
Sbjct  299  CCKDGKLDTAMDIKQKMADEEVALDEVTYTALISGLSKAQRPVDAERI  346


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG     + ++++++ + K G  K    L   M+ RG  P++  YN LL+   RA N + 
Sbjct  213  RGVKPNAIVFTTLIDAHCKAGDVKAGMELYQDMRARGVMPDLVAYNALLNGLCRARNFEA  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQ  513
             E + +EM+   + PD+V+YT++I    K  +L++ +   Q
Sbjct  273  AECIVEEMRGTGLKPDKVTYTTLIDGCCKDGKLDTAMDIKQ  313


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/198 (20%), Positives = 93/198 (47%), Gaps = 9/198 (5%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            R     +V+++++++   +      A  L   M + G  P+V+ Y+ L+     +  ++ 
Sbjct  143  RSVQPTVVSFNTLISGMCRARDLDGADELYKGMAQMGITPDVYTYSALIKGLSSSGRIED  202

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
              K++ EM+ R V P+ + +T++I A+ KA ++++ ++ YQD +  G   D      ++ 
Sbjct  203  ATKMFDEMRERGVKPNAIVFTTLIDAHCKAGDVKAGMELYQDMRARGVMPDLVAYNALLN  262

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL-----RDAGLEIRAKWLQESFAV  291
               +    +    ++++++    K D+  Y + ++        D  ++I+ K   E  A+
Sbjct  263  GLCRARNFEAAECIVEEMRGTGLKPDKVTYTTLIDGCCKDGKLDTAMDIKQKMADEEVAL  322

Query  290  A----T*IISCNSAKKKP  249
                 T +IS  S  ++P
Sbjct  323  DEVTYTALISGLSKAQRP  340


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/148 (22%), Positives = 71/148 (48%), Gaps = 0/148 (0%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            ++ ++  + + G    A ++  +M+ R  +P V  +NTL+    RA ++   ++++K M 
Sbjct  117  FNVLMRDFVRFGDLASARKVFDEMRTRSVQPTVVSFNTLISGMCRARDLDGADELYKGMA  176

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            +  + PD  +Y+++I   S +  +E   K + + +  G K +  +   ++    K   V 
Sbjct  177  QMGITPDVYTYSALIKGLSSSGRIEDATKMFDEMRERGVKPNAIVFTTLIDAHCKAGDVK  236

Query  428  ELVKLLQDLKTDETKLDERLYRSALNAL  345
              ++L QD++      D   Y + LN L
Sbjct  237  AGMELYQDMRARGVMPDLVAYNALLNGL  264



>ref|XP_008464650.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 
isoform X1 [Cucumis melo]
Length=580

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/205 (26%), Positives = 111/205 (54%), Gaps = 14/205 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ +++ YGK  R +EA  +  +M + G  P    YN LLD    +  ++Q 
Sbjct  308  GLKPDVVSYALLISAYGKARREEEALAVFEEMLDAGIRPTHKAYNILLDAFAISGLVEQA  367

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            + V+K MKR +  PD  SYT+++SAY  A ++E    +++  K +G + +    G ++  
Sbjct  368  KTVFKSMKRDRCNPDICSYTTMLSAYVNASDMEGAETFFRRLKQDGFRPNVVTYGTLIKG  427

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL-RDAGLEIRAKWLQESFAVAT*II  276
            ++K+N +++++K  +++K +  ++++ +  + ++A  ++   +    W +E       I 
Sbjct  428  YAKINNLEKMIKRYEEMKVNGIRVNQTILTTIMDAYGKNKDFDSAVIWFKE-------IE  480

Query  275  SCN-SAKKKPKNIVNTRWRISLSET  204
            SC     +K KNI+     +SL++T
Sbjct  481  SCGLRPDQKAKNIL-----LSLAKT  500


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 77/151 (51%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  ++ M+ K G +++A ++ A+M  RG       YN+L+      +N K+V K++ +M+
Sbjct  249  FHMIIYMFKKAGNYEKARKVFAEMAARGVPQTTVTYNSLMSFE---TNYKEVSKIYDQMQ  305

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +ISAY KA+  E  +  +++    G +       I++  F+    V+
Sbjct  306  RAGLKPDVVSYALLISAYGKARREEEALAVFEEMLDAGIRPTHKAYNILLDAFAISGLVE  365

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +   + + +K D    D   Y + L+A  +A
Sbjct  366  QAKTVFKSMKRDRCNPDICSYTTMLSAYVNA  396


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/135 (24%), Positives = 75/135 (56%), Gaps = 3/135 (2%)
 Frame = -2

Query  806  DKC---IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            D+C   I +Y++M++ Y      + A     ++K+ G  PNV  Y TL+  + + +N+++
Sbjct  377  DRCNPDICSYTTMLSAYVNASDMEGAETFFRRLKQDGFRPNVVTYGTLIKGYAKINNLEK  436

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            + K ++EMK   +  ++   T+++ AY K K+ +S V ++++ +  G + D+    I++ 
Sbjct  437  MIKRYEEMKVNGIRVNQTILTTIMDAYGKNKDFDSAVIWFKEIESCGLRPDQKAKNILLS  496

Query  455  VFSKMNKVDELVKLL  411
            +     +++E  +L+
Sbjct  497  LAKTAEELEEANQLV  511


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 82/205 (40%), Gaps = 41/205 (20%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G+   +V++++++  YG+ GR+  A  +  +M+  G EP+   Y  +L      S  K+
Sbjct  167  KGYAPNVVSHTALMEAYGRGGRYNNAEAIFRRMQSGGPEPSALTYQIMLKTFVEGSKFKE  226

Query  635  VE--------------------------------------KVWKEMKRRKVVPDRVSYTS  570
             E                                      KV+ EM  R V    V+Y S
Sbjct  227  AEELFDSLLNKEKPVLKPDQKMFHMIIYMFKKAGNYEKARKVFAEMAARGVPQTTVTYNS  286

Query  569  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  390
            ++S  +  KE+    K Y   +  G K D     +++  + K  + +E + + +++    
Sbjct  287  LMSFETNYKEVS---KIYDQMQRAGLKPDVVSYALLISAYGKARREEEALAVFEEMLDAG  343

Query  389  TKLDERLYRSALNALRDAGLEIRAK  315
             +   + Y   L+A   +GL  +AK
Sbjct  344  IRPTHKAYNILLDAFAISGLVEQAK  368



>gb|AFV61150.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
turbinata]
Length=441

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  151  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  210

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  211  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGVEPNSITYSTIISI  270

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  271  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  318


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  186  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  245

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R V P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  246  NNLIQEMQSRGVEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  305

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  306  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  341


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  220  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGVEPNSITYSTIISIWGKVGKLDR  279

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  280  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  309


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  51   LVLYSNLIELSRKLCDYSKAISIFSRLKXSGFXPDLVAYNAMINVFGKAKLFREARSLIS  110

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  111  EMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  170

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  171  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  206



>gb|ACU25746.1| pentatricopeptide repeat-containing protein [Verbena intermedia]
Length=426

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSXGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 84/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  +  G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSXGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSXGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYXKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENKKFLEALSIFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|AFV61147.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
rotundifolia]
Length=440

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  151  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  210

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  211  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  270

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  271  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  318


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  186  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  245

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  246  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  305

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  306  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  341


 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  220  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  279

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  280  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  309


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  51   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  110

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  111  EMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  170

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  171  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  206



>gb|AFV61138.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
hermannioides]
Length=382

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  105  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  164

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  165  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  224

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K  K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  225  WGKXGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  272


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  140  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  199

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  200  NNLIQEMQSRGIEPNSITYSTIISIWGKXGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  259

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  260  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  295


 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  174  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKXGKLDR  233

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  234  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  263


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  5    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  64

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  65   EMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  124

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  125  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  160



>gb|AFV61136.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
filifolia]
Length=439

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  150  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  209

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  210  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  269

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  270  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  317


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  304

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  305  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  340


 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  219  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  278

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  279  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  308


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  50   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205



>gb|ACU25761.1| pentatricopeptide repeat-containing protein [Lantana canescens]
Length=426

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGIEIDQILFQTMIVAYERAGLVAHAKRL  311


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  239  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGIEIDQILFQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  334


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   +  D++ + ++I AY +A
Sbjct  273  AAMLFQKLRSSGIEIDQILFQTMIVAYERA  302


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIG  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMKAAGVMPNTXSYSTLLTMYVENKKFLEALSVFSEMREJKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|AFV61127.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
montevidensis]
Length=418

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  134  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  193

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  194  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  253

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  254  WGKVGKLDRAAMLFQKLRSSGXEIDQILFQTMIVAYERAGLVAHAKRL  301


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  169  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  228

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  229  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGXEIDQILFQTMIVA  288

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  289  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  324


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  203  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  262

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++      D++ + ++I AY +A
Sbjct  263  AAMLFQKLRSSGXEIDQILFQTMIVAYERA  292


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  34   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIG  93

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  94   EMKAAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  153

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  154  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  189



>gb|EMT18607.1| hypothetical protein F775_09904 [Aegilops tauschii]
Length=483

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/158 (27%), Positives = 88/158 (56%), Gaps = 0/158 (0%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            YS+++     +GR ++AT +  +M+ERG +PN  ++ TL+D H +  ++K    ++++M+
Sbjct  187  YSALIKGLSSSGRMEDATMMFGEMRERGVKPNAIVFTTLIDAHCKDGDVKAGMDLYQDMR  246

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
             R V+PD V+Y ++++   +A+  E+     ++ +  G K D+     ++    K  K+D
Sbjct  247  ARGVMPDLVAYNALVNGLCRARNFEAAECIVEEMRGTGLKPDKMTYTTLIDGSCKDGKLD  306

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  315
              + + Q +  +E  LDE  Y + ++ L  AG  + A+
Sbjct  307  TAMDIKQKMAEEEVALDEVTYTALISGLSKAGRPVDAE  344


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/148 (22%), Positives = 70/148 (47%), Gaps = 0/148 (0%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            ++ ++  + + G    A ++  +M+ RG +P V  +NTL+    RA ++  V+ ++K M 
Sbjct  117  FNVLMRDFVRLGDLASARKVFDEMRTRGVQPTVVSFNTLISGMCRARDLDGVDGLYKGMA  176

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            +  + PD  +Y+++I   S +  +E     + + +  G K +  +   ++    K   V 
Sbjct  177  QMGITPDAYTYSALIKGLSSSGRMEDATMMFGEMRERGVKPNAIVFTTLIDAHCKDGDVK  236

Query  428  ELVKLLQDLKTDETKLDERLYRSALNAL  345
              + L QD++      D   Y + +N L
Sbjct  237  AGMDLYQDMRARGVMPDLVAYNALVNGL  264


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/101 (27%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG     + ++++++ + K G  K    L   M+ RG  P++  YN L++   RA N + 
Sbjct  213  RGVKPNAIVFTTLIDAHCKDGDVKAGMDLYQDMRARGVMPDLVAYNALVNGLCRARNFEA  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQ  513
             E + +EM+   + PD+++YT++I    K  +L++ +   Q
Sbjct  273  AECIVEEMRGTGLKPDKMTYTTLIDGSCKDGKLDTAMDIKQ  313


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/180 (18%), Positives = 82/180 (46%), Gaps = 5/180 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG    +V+++++++   +         L   M + G  P+ + Y+ L+     +  M+ 
Sbjct  143  RGVQPTVVSFNTLISGMCRARDLDGVDGLYKGMAQMGITPDAYTYSALIKGLSSSGRMED  202

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++ EM+ R V P+ + +T++I A+ K  ++++ +  YQD +  G   D      +V 
Sbjct  203  ATMMFGEMRERGVKPNAIVFTTLIDAHCKDGDVKAGMDLYQDMRARGVMPDLVAYNALVN  262

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL-----RDAGLEIRAKWLQESFAV  291
               +    +    ++++++    K D+  Y + ++        D  ++I+ K  +E  A+
Sbjct  263  GLCRARNFEAAECIVEEMRGTGLKPDKMTYTTLIDGSCKDGKLDTAMDIKQKMAEEEVAL  322


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V Y+++++   K GR  +A R++ +M E G EP+   Y  ++D   R  ++K   K+ KE
Sbjct  325  VTYTALISGLSKAGRPVDAERVLVEMMEAGLEPDNTTYTMVIDAFCRKGDVKTGFKLLKE  384

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELES  531
            M+ +   P  V+Y  ++S   K  +L++
Sbjct  385  MQNKGRKPGVVTYNVIMSGLCKLGQLKN  412


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 66/139 (47%), Gaps = 0/139 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG    +VAY+++VN   +    + A  +V +M+  G +P+   Y TL+D   +   +  
Sbjct  248  RGVMPDLVAYNALVNGLCRARNFEAAECIVEEMRGTGLKPDKMTYTTLIDGSCKDGKLDT  307

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               + ++M   +V  D V+YT++IS  SKA       +   +    G + D     +++ 
Sbjct  308  AMDIKQKMAEEEVALDEVTYTALISGLSKAGRPVDAERVLVEMMEAGLEPDNTTYTMVID  367

Query  455  VFSKMNKVDELVKLLQDLK  399
             F +   V    KLL++++
Sbjct  368  AFCRKGDVKTGFKLLKEMQ  386



>ref|XP_008451469.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic [Cucumis melo]
Length=867

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 89/156 (57%), Gaps = 2/156 (1%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G D+  V+Y++++++Y K GR ++A ++  +M   G + +V  YN LLD +G+     +V
Sbjct  393  GLDR--VSYNTLLSIYAKLGRFEDALKVCKEMGSSGVKKDVVTYNALLDGYGKQGKFNEV  450

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             +V+KEMK+ +V P+ ++Y+++I  YSK    E  ++ +++FK  G K D  +   ++  
Sbjct  451  TRVFKEMKKDRVFPNLLTYSTLIDVYSKGSLYEEAMEVFREFKQAGLKADVVLYSELINA  510

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
              K   VD  V LL ++  +  + +   Y S ++A 
Sbjct  511  LCKNGLVDSAVLLLDEMTKEGIRPNVVTYNSIIDAF  546


 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/154 (26%), Positives = 82/154 (53%), Gaps = 0/154 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            + Y+S++ +  + G  + A  L  +M +RG + +V+ YNTLLD   +   M    ++  E
Sbjct  292  ITYNSLLAVCSRGGLWEAAQNLFNEMVDRGIDQDVFTYNTLLDAVCKGGQMDLAYEIMLE  351

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  +K++P+ V+Y+++   Y+KA  LE  +  Y D K  G   DR     ++ +++K+ +
Sbjct  352  MPGKKILPNVVTYSTMADGYAKAGRLEDALNLYNDMKFLGIGLDRVSYNTLLSIYAKLGR  411

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             ++ +K+ +++ +   K D   Y + L+     G
Sbjct  412  FEDALKVCKEMGSSGVKKDVVTYNALLDGYGKQG  445


 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 60/102 (59%), Gaps = 1/102 (1%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRAS-NMKQ  636
            G+   + A+S++++ YGK+G   EA ++   MK  G +PN+  YN ++D  G+     K+
Sbjct  215  GYGNTVFAFSALISAYGKSGYFDEAIKVFESMKVSGLKPNLVTYNAVIDACGKGGVEFKR  274

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQD  510
            V ++++EM R  V PDR++Y S+++  S+    E+    + +
Sbjct  275  VVEIFEEMLRNGVQPDRITYNSLLAVCSRGGLWEAAQNLFNE  316


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+M + Y K GR ++A  L   MK  G   +   YNTLL I+ +    +   KV K
Sbjct  361  VVTYSTMADGYAKAGRLEDALNLYNDMKFLGIGLDRVSYNTLLSIYAKLGRFEDALKVCK  420

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM    V  D V+Y +++  Y K  +     + +++ K +    +      ++ V+SK +
Sbjct  421  EMGSSGVKKDVVTYNALLDGYGKQGKFNEVTRVFKEMKKDRVFPNLLTYSTLIDVYSKGS  480

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
              +E +++ ++ K    K D  LY   +NAL   GL
Sbjct  481  LYEEAMEVFREFKQAGLKADVVLYSELINALCKNGL  516


 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/141 (25%), Positives = 75/141 (53%), Gaps = 0/141 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG D+ +  Y+++++   K G+   A  ++ +M  +   PNV  Y+T+ D + +A  ++ 
Sbjct  320  RGIDQDVFTYNTLLDAVCKGGQMDLAYEIMLEMPGKKILPNVVTYSTMADGYAKAGRLED  379

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++ +MK   +  DRVSY +++S Y+K    E  +K  ++   +G K D      ++ 
Sbjct  380  ALNLYNDMKFLGIGLDRVSYNTLLSIYAKLGRFEDALKVCKEMGSSGVKKDVVTYNALLD  439

Query  455  VFSKMNKVDELVKLLQDLKTD  393
             + K  K +E+ ++ +++K D
Sbjct  440  GYGKQGKFNEVTRVFKEMKKD  460


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 72/134 (54%), Gaps = 0/134 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G  K +V Y+++++ YGK G+  E TR+  +MK+    PN+  Y+TL+D++ + S  ++ 
Sbjct  426  GVKKDVVTYNALLDGYGKQGKFNEVTRVFKEMKKDRVFPNLLTYSTLIDVYSKGSLYEEA  485

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             +V++E K+  +  D V Y+ +I+A  K   ++S V    +    G + +      ++  
Sbjct  486  MEVFREFKQAGLKADVVLYSELINALCKNGLVDSAVLLLDEMTKEGIRPNVVTYNSIIDA  545

Query  452  FSKMNKVDELVKLL  411
            F +    + LV ++
Sbjct  546  FGRSTTAESLVDVV  559



>gb|AFV61126.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
microcephala]
Length=440

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  150  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  209

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  210  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  269

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  270  WGKVGKLDRAAMLFQKLRSSGIEIDQILFQTMIVAYERAGLVAHAKRL  317


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGIEIDQILFQTMIVA  304

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  305  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  340


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  219  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  278

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   +  D++ + ++I AY +A
Sbjct  279  AAMLFQKLRSSGIEIDQILFQTMIVAYERA  308


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  50   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIG  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMKAAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205



>ref|XP_004166285.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic-like [Cucumis sativus]
Length=868

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 89/156 (57%), Gaps = 2/156 (1%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G D+  V+Y++++++Y K GR ++A ++  +M   G + +V  YN LLD +G+     +V
Sbjct  395  GLDR--VSYNTLLSIYAKLGRFEDALKVCKEMGSSGVKKDVVTYNALLDGYGKQGKFNEV  452

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             +V+KEMK+ +V P+ ++Y+++I  YSK    E  ++ +++FK  G K D  +   ++  
Sbjct  453  TRVFKEMKKDRVFPNLLTYSTLIDVYSKGSLYEEAMEVFREFKQAGLKADVVLYSELINA  512

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
              K   VD  V LL ++  +  + +   Y S ++A 
Sbjct  513  LCKNGLVDSAVLLLDEMTKEGIRPNVVTYNSIIDAF  548


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 82/154 (53%), Gaps = 0/154 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            + Y+S++ +  + G  + A  L  +M +RG + +V+ YNTLLD   +   M    ++  E
Sbjct  294  ITYNSLLAVCSRGGLWEAARNLFNEMIDRGIDQDVFTYNTLLDAVCKGGQMDLAYEIMLE  353

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  +K++P+ V+Y+++   Y+KA  LE  +  Y + K  G   DR     ++ +++K+ +
Sbjct  354  MPGKKILPNVVTYSTMADGYAKAGRLEDALNLYNEMKFLGIGLDRVSYNTLLSIYAKLGR  413

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             ++ +K+ +++ +   K D   Y + L+     G
Sbjct  414  FEDALKVCKEMGSSGVKKDVVTYNALLDGYGKQG  447


 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 60/102 (59%), Gaps = 1/102 (1%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRAS-NMKQ  636
            G+   + A+S++++ YGK+G   EA ++   MK  G +PN+  YN ++D  G+     K+
Sbjct  217  GYGNTVFAFSALISAYGKSGYFDEAIKVFESMKVSGLKPNLVTYNAVIDACGKGGVEFKR  276

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQD  510
            V ++++EM R  V PDR++Y S+++  S+    E+    + +
Sbjct  277  VVEIFEEMLRNGVQPDRITYNSLLAVCSRGGLWEAARNLFNE  318


 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 77/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+M + Y K GR ++A  L  +MK  G   +   YNTLL I+ +    +   KV K
Sbjct  363  VVTYSTMADGYAKAGRLEDALNLYNEMKFLGIGLDRVSYNTLLSIYAKLGRFEDALKVCK  422

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM    V  D V+Y +++  Y K  +     + +++ K +    +      ++ V+SK +
Sbjct  423  EMGSSGVKKDVVTYNALLDGYGKQGKFNEVTRVFKEMKKDRVFPNLLTYSTLIDVYSKGS  482

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
              +E +++ ++ K    K D  LY   +NAL   GL
Sbjct  483  LYEEAMEVFREFKQAGLKADVVLYSELINALCKNGL  518


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/141 (26%), Positives = 75/141 (53%), Gaps = 0/141 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG D+ +  Y+++++   K G+   A  ++ +M  +   PNV  Y+T+ D + +A  ++ 
Sbjct  322  RGIDQDVFTYNTLLDAVCKGGQMDLAYEIMLEMPGKKILPNVVTYSTMADGYAKAGRLED  381

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++ EMK   +  DRVSY +++S Y+K    E  +K  ++   +G K D      ++ 
Sbjct  382  ALNLYNEMKFLGIGLDRVSYNTLLSIYAKLGRFEDALKVCKEMGSSGVKKDVVTYNALLD  441

Query  455  VFSKMNKVDELVKLLQDLKTD  393
             + K  K +E+ ++ +++K D
Sbjct  442  GYGKQGKFNEVTRVFKEMKKD  462


 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/131 (27%), Positives = 70/131 (53%), Gaps = 0/131 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G  K +V Y+++++ YGK G+  E TR+  +MK+    PN+  Y+TL+D++ + S  ++ 
Sbjct  428  GVKKDVVTYNALLDGYGKQGKFNEVTRVFKEMKKDRVFPNLLTYSTLIDVYSKGSLYEEA  487

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             +V++E K+  +  D V Y+ +I+A  K   ++S V    +    G + +      ++  
Sbjct  488  MEVFREFKQAGLKADVVLYSELINALCKNGLVDSAVLLLDEMTKEGIRPNVVTYNSIIDA  547

Query  452  FSKMNKVDELV  420
            F +    + LV
Sbjct  548  FGRSTTAEFLV  558



>ref|XP_004135985.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, 
chloroplastic-like [Cucumis sativus]
 gb|KGN45026.1| Pentatricopeptide repeat-containing protein [Cucumis sativus]
Length=868

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 89/156 (57%), Gaps = 2/156 (1%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G D+  V+Y++++++Y K GR ++A ++  +M   G + +V  YN LLD +G+     +V
Sbjct  395  GLDR--VSYNTLLSIYAKLGRFEDALKVCKEMGSSGVKKDVVTYNALLDGYGKQGKFNEV  452

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             +V+KEMK+ +V P+ ++Y+++I  YSK    E  ++ +++FK  G K D  +   ++  
Sbjct  453  TRVFKEMKKDRVFPNLLTYSTLIDVYSKGSLYEEAMEVFREFKQAGLKADVVLYSELINA  512

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
              K   VD  V LL ++  +  + +   Y S ++A 
Sbjct  513  LCKNGLVDSAVLLLDEMTKEGIRPNVVTYNSIIDAF  548


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 82/154 (53%), Gaps = 0/154 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            + Y+S++ +  + G  + A  L  +M +RG + +V+ YNTLLD   +   M    ++  E
Sbjct  294  ITYNSLLAVCSRGGLWEAARNLFNEMIDRGIDQDVFTYNTLLDAVCKGGQMDLAYEIMLE  353

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  +K++P+ V+Y+++   Y+KA  LE  +  Y + K  G   DR     ++ +++K+ +
Sbjct  354  MPGKKILPNVVTYSTMADGYAKAGRLEDALNLYNEMKFLGIGLDRVSYNTLLSIYAKLGR  413

Query  434  VDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             ++ +K+ +++ +   K D   Y + L+     G
Sbjct  414  FEDALKVCKEMGSSGVKKDVVTYNALLDGYGKQG  447


 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 60/102 (59%), Gaps = 1/102 (1%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRAS-NMKQ  636
            G+   + A+S++++ YGK+G   EA ++   MK  G +PN+  YN ++D  G+     K+
Sbjct  217  GYGNTVFAFSALISAYGKSGYFDEAIKVFESMKVSGLKPNLVTYNAVIDACGKGGVEFKR  276

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQD  510
            V ++++EM R  V PDR++Y S+++  S+    E+    + +
Sbjct  277  VVEIFEEMLRNGVQPDRITYNSLLAVCSRGGLWEAARNLFNE  318


 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 77/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+M + Y K GR ++A  L  +MK  G   +   YNTLL I+ +    +   KV K
Sbjct  363  VVTYSTMADGYAKAGRLEDALNLYNEMKFLGIGLDRVSYNTLLSIYAKLGRFEDALKVCK  422

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM    V  D V+Y +++  Y K  +     + +++ K +    +      ++ V+SK +
Sbjct  423  EMGSSGVKKDVVTYNALLDGYGKQGKFNEVTRVFKEMKKDRVFPNLLTYSTLIDVYSKGS  482

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
              +E +++ ++ K    K D  LY   +NAL   GL
Sbjct  483  LYEEAMEVFREFKQAGLKADVVLYSELINALCKNGL  518


 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/141 (26%), Positives = 75/141 (53%), Gaps = 0/141 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG D+ +  Y+++++   K G+   A  ++ +M  +   PNV  Y+T+ D + +A  ++ 
Sbjct  322  RGIDQDVFTYNTLLDAVCKGGQMDLAYEIMLEMPGKKILPNVVTYSTMADGYAKAGRLED  381

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++ EMK   +  DRVSY +++S Y+K    E  +K  ++   +G K D      ++ 
Sbjct  382  ALNLYNEMKFLGIGLDRVSYNTLLSIYAKLGRFEDALKVCKEMGSSGVKKDVVTYNALLD  441

Query  455  VFSKMNKVDELVKLLQDLKTD  393
             + K  K +E+ ++ +++K D
Sbjct  442  GYGKQGKFNEVTRVFKEMKKD  462


 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/131 (27%), Positives = 70/131 (53%), Gaps = 0/131 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G  K +V Y+++++ YGK G+  E TR+  +MK+    PN+  Y+TL+D++ + S  ++ 
Sbjct  428  GVKKDVVTYNALLDGYGKQGKFNEVTRVFKEMKKDRVFPNLLTYSTLIDVYSKGSLYEEA  487

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             +V++E K+  +  D V Y+ +I+A  K   ++S V    +    G + +      ++  
Sbjct  488  MEVFREFKQAGLKADVVLYSELINALCKNGLVDSAVLLLDEMTKEGIRPNVVTYNSIIDA  547

Query  452  FSKMNKVDELV  420
            F +    + LV
Sbjct  548  FGRSTTAEFLV  558



>gb|ACU25765.1| pentatricopeptide repeat-containing protein [Lampayo castellani]
Length=426

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKIGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L+    ++D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRNSGVEIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 87/169 (51%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRNSGVEIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D     +A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAAAGRJEEATWV  342


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D+V Y ++I AY +A
Sbjct  273  AAMLFQKLRNSGVEIDQVLYQTMIVAYERA  302


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 77/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN+++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFAPDLVAYNSMINVFGKAKLFREARSLIN  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+PD VSYT++++ + + K     +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVMPDTVSYTTLLTMHVENKRFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKIGIEPNVVSYNTLLRVYGDAEL  199


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  248  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRNSGVEIDQVLYQTMIVAYERAGLVAH  307

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A   E     ++     G   D  +   ++ 
Sbjct  308  AKRLLHELKR----PDNIPRDTAIHILAAAGRJEEATWVFRQAIDAGEVKDITVFERLIH  363

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  364  LFSKYKKYXNVVEVFDKMRERRYFPDSNVIALVLNA  399



>gb|AFV61129.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
trifolia]
Length=440

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  150  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  209

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  210  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  269

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  270  WGKVGKLDRAAMLFQKLRSSGXEIDQILFQTMIVAYERAGLVAHAKRL  317


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGXEIDQILFQTMIVA  304

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  305  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  340


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  219  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  278

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++      D++ + ++I AY +A
Sbjct  279  AAMLFQKLRSSGXEIDQILFQTMIVAYERA  308


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  50   LVLYSNLIELSRKXCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIG  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMKXAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205



>ref|XP_010670642.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, 
chloroplastic [Beta vulgaris subsp. vulgaris]
 ref|XP_010670643.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, 
chloroplastic [Beta vulgaris subsp. vulgaris]
 ref|XP_010670644.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, 
chloroplastic [Beta vulgaris subsp. vulgaris]
 ref|XP_010670645.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, 
chloroplastic [Beta vulgaris subsp. vulgaris]
 ref|XP_010670646.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, 
chloroplastic [Beta vulgaris subsp. vulgaris]
 ref|XP_010670647.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=674

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 93/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+    KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  324  KCVLDLTTCNIMIDVYGQLDMAKEADQLFWSMRKMGIEPNVVSYNTLLRVYGEAELFGEA  383

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+++ +  + V+Y ++I  Y K+ E E      Q+ +  G + +      ++ +
Sbjct  384  IHLFRLMQKKDIEQNVVTYNTMIKTYGKSLEHEKAGNLVQEMQKRGIQPNAITYSTIISI  443

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            +S+  K+D   KL Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  444  WSRAGKLDRAAKLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  491


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 92/169 (54%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG+     EA  L   M+++  E NV  YNT++  +G++   ++ 
Sbjct  359  GIEPNVVSYNTLLRVYGEAELFGEAIHLFRLMQKKDIEQNVVTYNTMIKTYGKSLEHEKA  418

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM++R + P+ ++Y+++IS +S+A +L+   K +Q  + +G + D+ +   M+  
Sbjct  419  GNLVQEMQKRGIQPNAITYSTIISIWSRAGKLDRAAKLFQKLRSSGVEIDQVLYQTMIVA  478

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D     +A+  L  AG    A W+
Sbjct  479  YERAGLVAHAKRLLHELKCPDNIPRD-----TAITILCRAGRIEEATWV  522


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y++M+  YGK+  H++A  LV +M++RG +PN   Y+T++ I  RA  + +
Sbjct  393  KDIEQNVVTYNTMIKTYGKSLEHEKAGNLVQEMQKRGIQPNAITYSTIISIWSRAGKLDR  452

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
              K++++++   V  D+V Y ++I AY +A
Sbjct  453  AAKLFQKLRSSGVEIDQVLYQTMIVAYERA  482


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 68/133 (51%), Gaps = 0/133 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  L +++K  G  P++  YNT++++ G+A    + + +  
Sbjct  224  LVLYSNLIELSRKLHDYSKAISLFSRLKRSGIRPDLVAYNTMINVFGKAKLFSEAQDLLS  283

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V PD VSY+++++ + +  +    +  + +        D     IM+ V+ +++
Sbjct  284  EMRENGVNPDTVSYSTLLNMFVENHKFVEALSVFSEMNDAKCVLDLTTCNIMIDVYGQLD  343

Query  437  KVDELVKLLQDLK  399
               E  +L   ++
Sbjct  344  MAKEADQLFWSMR  356


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/138 (20%), Positives = 65/138 (47%), Gaps = 0/138 (0%)
 Frame = -2

Query  791  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  612
             YS ++  +GK G    A   + KM++     ++ +Y+ L+++  +  +  +   ++  +
Sbjct  191  TYSMLITGFGKEGLFDYALSWLQKMEQDRVSGDLVLYSNLIELSRKLHDYSKAISLFSRL  250

Query  611  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  432
            KR  + PD V+Y ++I+ + KAK          + + NG   D      ++ +F + +K 
Sbjct  251  KRSGIRPDLVAYNTMINVFGKAKLFSEAQDLLSEMRENGVNPDTVSYSTLLNMFVENHKF  310

Query  431  DELVKLLQDLKTDETKLD  378
             E + +  ++   +  LD
Sbjct  311  VEALSVFSEMNDAKCVLD  328



>gb|AIU48578.1| tetratricopeptide repeat-like superfamily protein, partial [Platanus 
x acerifolia]
Length=470

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/204 (25%), Positives = 105/204 (51%), Gaps = 13/204 (6%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++N YGK  R  EA  +  +M + G  P    YN LLD    +  +++ 
Sbjct  269  GLQPDVVSYALLINAYGKARREDEALAVFEEMLDAGVRPTRKAYNILLDAFAISGMVEEA  328

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R +  PD  SYT+++SAY  A ++E    +++  K +G + +    G ++  
Sbjct  329  RTVFKSMRRDRFTPDLCSYTTMLSAYVNASDMEGAEMFFRRLKQDGFEPNVVTYGTLIKG  388

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IIS  273
            ++K+N ++++++  ++++    K ++ ++ + ++A           W +E       + S
Sbjct  389  YAKVNNLEKMMEKYEEMRVQGIKANQTIFTTIMDAYGKNDFGTAVIWFKE-------MGS  441

Query  272  CN-SAKKKPKNIVNTRWRISLSET  204
            C     +K KNI+     +SL++T
Sbjct  442  CGFPPDQKAKNIL-----LSLAKT  460


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 77/151 (51%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G ++ A ++  KM ERG   +   YN+L+      +N K+V  V+ +M+
Sbjct  210  FHMMIYMYKKAGNYENARKIFNKMAERGVPQSTVTYNSLMSFE---TNYKEVSNVYDQMQ  266

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  +  +  +++    G +  R    I++  F+    V+
Sbjct  267  RAGLQPDVVSYALLINAYGKARREDEALAVFEEMLDAGVRPTRKAYNILLDAFAISGMVE  326

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            E   + + ++ D    D   Y + L+A  +A
Sbjct  327  EARTVFKSMRRDRFTPDLCSYTTMLSAYVNA  357


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/200 (18%), Positives = 82/200 (41%), Gaps = 41/200 (21%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDI---------  663
            +G+   +++Y++++  YGK G++ +A  +  +M+  G EP+   Y  +L I         
Sbjct  128  KGYPPSVISYTALMEAYGKGGQYNKAEAIFRRMQSSGPEPSAVTYQIILKIFVEGDKFKE  187

Query  662  -----------------------------HGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  570
                                         + +A N +   K++ +M  R V    V+Y S
Sbjct  188  AEAVFETLLNDEISPLKPDQKMFHMMIYMYKKAGNYENARKIFNKMAERGVPQSTVTYNS  247

Query  569  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  390
            ++S  +  KE+ +    Y   +  G + D     +++  + K  + DE + + +++    
Sbjct  248  LMSFETNYKEVSNV---YDQMQRAGLQPDVVSYALLINAYGKARREDEALAVFEEMLDAG  304

Query  389  TKLDERLYRSALNALRDAGL  330
             +   + Y   L+A   +G+
Sbjct  305  VRPTRKAYNILLDAFAISGM  324


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/129 (22%), Positives = 62/129 (48%), Gaps = 3/129 (2%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            ++  YGK G    A R++  M ++G  P+V  Y  L++ +G+     + E +++ M+   
Sbjct  105  LITAYGKQGDFNRAGRVLGYMNKKGYPPSVISYTALMEAYGKGGQYNKAEAIFRRMQSSG  164

Query  599  VVPDRVSYTSVISAY---SKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
              P  V+Y  ++  +    K KE E+  +   + +++  K D+ M  +M+ ++ K    +
Sbjct  165  PEPSAVTYQIILKIFVEGDKFKEAEAVFETLLNDEISPLKPDQKMFHMMIYMYKKAGNYE  224

Query  428  ELVKLLQDL  402
               K+   +
Sbjct  225  NARKIFNKM  233



>gb|AIU48542.1| tetratricopeptide repeat-like superfamily protein, partial [Citrus 
clementina]
 gb|AIU48546.1| tetratricopeptide repeat-like superfamily protein, partial [Citrus 
sinensis]
Length=470

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 106/204 (52%), Gaps = 13/204 (6%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++N YGK  R +EA  +  +M + G  P    YN LLD    +  + Q 
Sbjct  269  GLQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQA  328

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R +  PD  SYT+++SAY  A ++E   K+++  K +G   +    G ++  
Sbjct  329  RTVFKCMRRDRCSPDICSYTTMLSAYVNASDMEGAEKFFRRLKQDGFVPNVITYGTLIKG  388

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IIS  273
            ++K+N +++++++   ++ +  K ++ ++ + ++A      +    W +E       + S
Sbjct  389  YAKVNNLEKMMEIYDKMRVNGIKPNQTIFTTIMDAYGKNDFDSAVVWYKE-------MES  441

Query  272  CN-SAKKKPKNIVNTRWRISLSET  204
            C     +K KNI+     +SL++T
Sbjct  442  CGFPPDQKAKNIL-----LSLAKT  460


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 79/151 (52%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G +++A +L A M ERG + +   YN+L+      +N K+V K++ +M+
Sbjct  210  FHMMIYMYKKAGGYEKARKLFALMAERGVQQSTVTYNSLMSFE---TNYKEVSKIYDQMQ  266

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  E  +  +++    G +       I++  F+    VD
Sbjct  267  RAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVD  326

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +   + + ++ D    D   Y + L+A  +A
Sbjct  327  QARTVFKCMRRDRCSPDICSYTTMLSAYVNA  357


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 54/103 (52%), Gaps = 3/103 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G+   +V++++++  YG+ GR+K A  +  +M+  G  P+   Y  +L +   A+  K+
Sbjct  128  KGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPRPSALTYQIILKLFVEANKFKE  187

Query  635  VEKVWKEM---KRRKVVPDRVSYTSVISAYSKAKELESCVKYY  516
             E+V+  +   ++  + PD+  +  +I  Y KA   E   K +
Sbjct  188  AEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKAGGYEKARKLF  230



>gb|AFV61134.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
diamantinensis]
Length=363

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  86   KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGES  145

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  146  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  205

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  206  WGKVGKLDRAAMLFQKLRSTGVEIDQILFQTMIVAYERAGLIAHAKRL  253


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/161 (24%), Positives = 83/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      E+  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  121  GIEPNVVSYNTLLRVYGDAELFGESIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  180

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  +  G + D+ +   M+  
Sbjct  181  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSTGVEIDQILFQTMIVA  240

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   +    +LL +LK  D    D     +A++ L  AG
Sbjct  241  YERAGLIAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  276


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  155  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  214

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  215  AAMLFQKLRSTGVEIDQILFQTMIVAYERA  244


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/140 (21%), Positives = 67/140 (48%), Gaps = 0/140 (0%)
 Frame = -2

Query  749  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  570
            + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EMK   V+P+  SY++
Sbjct  2    YSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMKTAGVMPNTTSYST  61

Query  569  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  390
            +++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++   
Sbjct  62   LLTMYVENKKFLEALXVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMG  121

Query  389  TKLDERLYRSALNALRDAGL  330
             + +   Y + L    DA L
Sbjct  122  IEPNVVSYNTLLRVYGDAEL  141



>gb|AFV61109.1| pentatricopeptide repeat-containing protein 123, partial [Acantholippia 
salsoloides]
Length=433

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  147  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  206

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  207  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQGRGIEPNSITYSTIISI  266

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  267  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  314


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/165 (24%), Positives = 83/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  182  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  241

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  242  NNLIQEMQGRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  301

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  302  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  334


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  216  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQGRGIEPNSITYSTIISIWGKVGKLDR  275

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  276  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  305


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN  +++ G+A   ++   +  
Sbjct  47   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAXINVFGKAKLFREARSLIS  106

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  107  EMRIAGVMPNTASYSTLLTMYVENKKFLEALSVFSELREMKCLLDLTTCNIMIDVYGQLG  166

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  167  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  202



>gb|AHC02083.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
catamarcensis]
Length=439

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  149  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  208

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  209  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  268

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  269  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  316


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  184  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  243

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  244  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  303

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  304  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  339


 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  218  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  277

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  278  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  307


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  49   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  108

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  109  EMKTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  168

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  169  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  204


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 72/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  ++ T++  + RA  +  
Sbjct  253  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAH  312

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  313  AKRLLHELKR----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIH  368

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  369  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  404



>gb|AHC02077.1| pentatricopeptide repeat-containing protein 123, partial [Acantholippia 
salsoloides]
Length=440

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  150  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  209

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  210  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQGRGIEPNSITYSTIISI  269

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  270  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  317


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/165 (24%), Positives = 83/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQGRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  304

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  305  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  337


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  219  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQGRGIEPNSITYSTIISIWGKVGKLDR  278

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  279  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  308


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  50   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMRIAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREMKCLLDLTTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205



>gb|AIU48532.1| tetratricopeptide repeat-like superfamily protein, partial [Arabidopsis 
lyrata]
Length=470

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 89/155 (57%), Gaps = 0/155 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++  YG+  R +EA  +  +M + G  P    YN LLD    +  ++Q 
Sbjct  269  GIQPDVVSYALLIKAYGRARREEEALSVFEEMLDAGVRPTHKAYNILLDAFAISGMVEQA  328

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            + V+K M+R ++ PD  SYT+++SAY  A ++E   K+++  K++G + +    G M+  
Sbjct  329  KTVFKSMRRDRIFPDLWSYTTMLSAYVNASDMEGAEKFFKRIKVDGFEPNIVTYGTMIKG  388

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            ++K N V++++++ + ++    K ++ +  + ++A
Sbjct  389  YAKANDVEKMMEVYEKMRLSGIKANQTILTTIMDA  423


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/129 (25%), Positives = 60/129 (47%), Gaps = 3/129 (2%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            ++  YGK G    A R+++ + + G  PNV  Y  L++ +GR       E +++ M+   
Sbjct  105  LITAYGKLGNFNGAERVLSVLSKMGSSPNVISYTALMESYGRGGKCNNAEAIFRRMQSSG  164

Query  599  VVPDRVSYTSVISAY---SKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
              P  V+Y  ++  +    K KE E   +   D K +  K D+ M  +M+ ++ K    D
Sbjct  165  PEPSAVTYQIILKTFVEGDKFKEAEEVFETLLDEKKSPLKPDQKMYHMMIYMYKKAGNYD  224

Query  428  ELVKLLQDL  402
            +  K+   +
Sbjct  225  KARKVFSSM  233



>gb|AFV61142.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
micromera]
Length=434

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 85/157 (54%), Gaps = 0/157 (0%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R+ 
Sbjct  161  MIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKN  220

Query  599  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  420
            +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ ++ K  K+D   
Sbjct  221  IEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKXGKLDRAA  280

Query  419  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
             L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  281  MLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  317


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQSRGIEPNSITYSTIISIWGKXGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  304

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  305  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  340


 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  219  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKXGKLDR  278

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  279  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  308


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  50   LVLYSNLIELSRKXCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMKTAGVMPNTTSYSTLLTMYXENKKFLEALSVFSEMREIKCXLDLTTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205



>gb|AHC02076.1| pentatricopeptide repeat-containing protein 123, partial [Acantholippia 
salsoloides]
Length=440

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  150  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  209

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  210  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQGRGIEPNSITYSTIISI  269

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  270  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  317


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/165 (24%), Positives = 83/165 (50%), Gaps = 12/165 (7%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQGRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  304

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            + +   V    +LL +LK+ +            N  RD  + I A
Sbjct  305  YERAGLVAHAKRLLHELKSPD------------NIPRDTAIHILA  337


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  219  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQGRGIEPNSITYSTIISIWGKVGKLDR  278

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  279  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  308


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  50   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMRIAGVMPNTASYSTLLTMYVENKKFLEALSVFSEXREMKCLLDLTTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205



>gb|AIU48562.1| tetratricopeptide repeat-like superfamily protein, partial [Solanum 
tuberosum]
Length=470

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/203 (26%), Positives = 105/203 (52%), Gaps = 11/203 (5%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ +++ YGK  R +EA  +  +M + G  P    YN LLD    +  ++Q 
Sbjct  269  GLRPDVVSYALLISAYGKARREEEALAVFEEMLDAGVRPTQKSYNILLDAFAISGMVEQA  328

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R +  PD  SYT+++SAY  A ++E   K+++  K +G + +    G ++  
Sbjct  329  RTVFKSMRRDRCSPDLCSYTTMLSAYINASDMEGAEKFFRRIKQDGLEPNVVTYGTLIKG  388

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IIS  273
            ++K N ++++++  +D++    K ++ ++ + ++A           W  E  +      S
Sbjct  389  YAKTNDLEKMMEKYEDMRVHGIKANQTIFTTIMDAYGRNDFGSAVAWFNEMAS------S  442

Query  272  CNSAKKKPKNIVNTRWRISLSET  204
              S  +K KNI+     +SL++T
Sbjct  443  GVSPDQKAKNIL-----LSLAKT  460


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 78/151 (52%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G++++A  L + M ERG   N   YN+L+      +N K+V  ++ +M+
Sbjct  210  FHMMIYMYKKAGKYEKARHLFSLMAERGIPQNTVTYNSLMSFE---TNYKEVANIYDQMQ  266

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +ISAY KA+  E  +  +++    G +  +    I++  F+    V+
Sbjct  267  RAGLRPDVVSYALLISAYGKARREEEALAVFEEMLDAGVRPTQKSYNILLDAFAISGMVE  326

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +   + + ++ D    D   Y + L+A  +A
Sbjct  327  QARTVFKSMRRDRCSPDLCSYTTMLSAYINA  357



>gb|AFV61143.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
origanoides]
Length=408

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++   +   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  150  KCLLDLXTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  209

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  210  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  269

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  270  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  317


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  185  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  244

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  245  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  304

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  305  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  340


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  219  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  278

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  279  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  308


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  50   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  109

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY++++  Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  110  EMKTAGVMPNTTSYSTLLXMYVENKKFLEALSVFSEMREIKCLLDLXTCNIMIDVYGQLG  169

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  170  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  205


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  ++ T++  + RA  +  
Sbjct  254  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAH  313

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  314  AKRLLHELKR----PDNIPRDTAIHILAGAGRIEEATYVFRQAVDAGEVKDITVFERMIH  369

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            + SK  K   +V++   ++      D  +    LNA
Sbjct  370  LLSKYKKYSNVVEVFDKMRGLGYFPDSNVIAVVLNA  405



>gb|AHC02099.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
polystachya]
Length=381

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++   +   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  104  KCLLDLXTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  163

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  164  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  223

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  224  WGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  271


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  139  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  198

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  199  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVA  258

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  259  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  294


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  173  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  232

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I AY +A
Sbjct  233  AAMLFQKLRSSGVEIDQILFQTMIVAYERA  262


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIG  63

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMKTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLXTCNIMIDVYGQLG  123

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 72/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  ++ T++  + RA  +  
Sbjct  208  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAH  267

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  268  AKRLLHELKR----PDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIX  323

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  324  LFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNA  359



>ref|XP_002517447.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF44989.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=654

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 86/157 (55%), Gaps = 0/157 (0%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            M+++YG+    KEA RL   M++ G EPNV  YNTLL ++G A    +   +++ M+R++
Sbjct  315  MIDVYGQLDMVKEADRLFWSMRKMGIEPNVVSYNTLLKVYGEAELFGEAIHLFRLMQRKE  374

Query  599  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  420
            +  + V+Y ++I  Y K+ E E      Q+ +  G + +      ++ ++ K  K+D   
Sbjct  375  IEQNVVTYNTMIKIYGKSLEHEKATNLVQEMQKRGIEPNAITYSTIISIWGKAGKLDRAA  434

Query  419  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
             L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  435  MLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  471


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 104/201 (52%), Gaps = 13/201 (6%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG+     EA  L   M+ +  E NV  YNT++ I+G++   ++ 
Sbjct  339  GIEPNVVSYNTLLKVYGEAELFGEAIHLFRLMQRKEIEQNVVTYNTMIKIYGKSLEHEKA  398

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM++R + P+ ++Y+++IS + KA +L+     +Q  + +G + D+ +   M+  
Sbjct  399  TNLVQEMQKRGIEPNAITYSTIISIWGKAGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  458

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKW-LQESF-------  297
            + +   V    +LL DLK  +    +    +A+  L  AG    A W  +++F       
Sbjct  459  YERAGLVAHAKRLLHDLKCPDIIPRD----TAIKILARAGRIEEATWVFRQAFDAGEVKD  514

Query  296  -AVAT*IISCNSAKKKPKNIV  237
             +V   +I   S  K+P N+V
Sbjct  515  ISVFRCMIELFSRNKRPANVV  535


 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/133 (22%), Positives = 70/133 (53%), Gaps = 0/133 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  +  ++K  G  P++  YN+++++ G+A   ++   +  
Sbjct  204  LVLYSNLIELSRKLCDYSKAISIFMRLKRSGITPDLVAYNSMINVFGKARLFREARMLVH  263

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+PD VSY++++S Y + ++    +  + +        D     IM+ V+ +++
Sbjct  264  EMREVGVLPDTVSYSTLLSVYVENEKFVEALSVFAEMNEANCSLDLMTCNIMIDVYGQLD  323

Query  437  KVDELVKLLQDLK  399
             V E  +L   ++
Sbjct  324  MVKEADRLFWSMR  336



>ref|XP_004149531.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040-like 
[Cucumis sativus]
 gb|KGN54957.1| hypothetical protein Csa_4G616760 [Cucumis sativus]
Length=580

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/207 (27%), Positives = 111/207 (54%), Gaps = 18/207 (9%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ +++ YGK  R +EA  +  +M + G  P    YN LLD    +  ++Q 
Sbjct  308  GLQPDVVSYALLISAYGKARREEEALAVFEEMLDAGIRPTHKAYNILLDAFAISGMVEQA  367

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            + V+K MKR +  PD  SYT+++SAY  A ++E    +++  K +G + +    G ++  
Sbjct  368  KIVFKSMKRDRCSPDICSYTTMLSAYVNASDMEGAENFFRRLKQDGFRPNVVTYGTLIKG  427

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL---RDAGLEIRAKWLQESFAVAT*  282
            ++K+N +++++K  +++K +  ++++ +  + ++A    +D G  +   W  E       
Sbjct  428  YAKINNLEKMIKRYEEMKVNGIRVNQTILTTIMDAYGKNKDFGSAV--IWFNE-------  478

Query  281  IISCN-SAKKKPKNIVNTRWRISLSET  204
            I SC     +K KNI+     +SL++T
Sbjct  479  IESCGLRPDQKAKNIL-----LSLAKT  500


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 77/151 (51%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  ++ M+ K G +++A ++ A+M  RG       YN+L+      +N K+V K++ +M+
Sbjct  249  FHMIIYMFKKAGNYEKARKVFAEMAARGVPQTTVTYNSLMSFE---TNYKEVSKIYDQMQ  305

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +ISAY KA+  E  +  +++    G +       I++  F+    V+
Sbjct  306  RAGLQPDVVSYALLISAYGKARREEEALAVFEEMLDAGIRPTHKAYNILLDAFAISGMVE  365

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +   + + +K D    D   Y + L+A  +A
Sbjct  366  QAKIVFKSMKRDRCSPDICSYTTMLSAYVNA  396


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 73/135 (54%), Gaps = 3/135 (2%)
 Frame = -2

Query  806  DKC---IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            D+C   I +Y++M++ Y      + A     ++K+ G  PNV  Y TL+  + + +N+++
Sbjct  377  DRCSPDICSYTTMLSAYVNASDMEGAENFFRRLKQDGFRPNVVTYGTLIKGYAKINNLEK  436

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            + K ++EMK   +  ++   T+++ AY K K+  S V ++ + +  G + D+    I++ 
Sbjct  437  MIKRYEEMKVNGIRVNQTILTTIMDAYGKNKDFGSAVIWFNEIESCGLRPDQKAKNILLS  496

Query  455  VFSKMNKVDELVKLL  411
            +     ++DE  +L+
Sbjct  497  LAKTAEELDEANQLV  511



>ref|XP_010035946.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 
isoform X1 [Eucalyptus grandis]
 gb|KCW47455.1| hypothetical protein EUGRSUZ_K01239 [Eucalyptus grandis]
Length=582

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 90/155 (58%), Gaps = 0/155 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++N YGK  R +EA  +  +M   G  P    YN LLD    +  ++Q 
Sbjct  308  GLRPDVVSYALLINAYGKARREEEALAVFEEMLSAGVRPTHKAYNILLDAFAISGMVEQA  367

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R + +PD  SYT+++SAY  A +++   K+++  K +G   +    G M+  
Sbjct  368  RIVFKSMRRDRYMPDLCSYTTMLSAYVNASDMDGAEKFFRRLKQDGFDPNVVTYGTMIKG  427

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            ++++NK+++++++ ++++    K ++ ++ + ++A
Sbjct  428  YARVNKLEKMMEVYEEMRLRGIKANQTVFTTIMDA  462


 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 79/152 (52%), Gaps = 3/152 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ M+ K G +++A ++ + M ERG + +   YN+L+      SN K+V K++ +M+
Sbjct  249  FHMMIYMHKKAGNYEKARQMFSLMAERGVQQSTVTYNSLMSFE---SNYKEVSKIYDQMQ  305

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  E  +  +++    G +       I++  F+    V+
Sbjct  306  RAGLRPDVVSYALLINAYGKARREEEALAVFEEMLSAGVRPTHKAYNILLDAFAISGMVE  365

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            +   + + ++ D    D   Y + L+A  +A 
Sbjct  366  QARIVFKSMRRDRYMPDLCSYTTMLSAYVNAS  397


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/115 (21%), Positives = 68/115 (59%), Gaps = 0/115 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            + +Y++M++ Y        A +   ++K+ G +PNV  Y T++  + R + ++++ +V++
Sbjct  383  LCSYTTMLSAYVNASDMDGAEKFFRRLKQDGFDPNVVTYGTMIKGYARVNKLEKMMEVYE  442

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            EM+ R +  ++  +T+++ AY K K+ +S + ++++ + +G   D+    +++ +
Sbjct  443  EMRLRGIKANQTVFTTIMDAYGKNKDFDSALVWFKEMESSGVHPDKKAKNVLLSL  497



>ref|XP_010035947.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 
isoform X2 [Eucalyptus grandis]
Length=581

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 90/155 (58%), Gaps = 0/155 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++N YGK  R +EA  +  +M   G  P    YN LLD    +  ++Q 
Sbjct  307  GLRPDVVSYALLINAYGKARREEEALAVFEEMLSAGVRPTHKAYNILLDAFAISGMVEQA  366

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R + +PD  SYT+++SAY  A +++   K+++  K +G   +    G M+  
Sbjct  367  RIVFKSMRRDRYMPDLCSYTTMLSAYVNASDMDGAEKFFRRLKQDGFDPNVVTYGTMIKG  426

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            ++++NK+++++++ ++++    K ++ ++ + ++A
Sbjct  427  YARVNKLEKMMEVYEEMRLRGIKANQTVFTTIMDA  461


 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 79/152 (52%), Gaps = 3/152 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ M+ K G +++A ++ + M ERG + +   YN+L+      SN K+V K++ +M+
Sbjct  248  FHMMIYMHKKAGNYEKARQMFSLMAERGVQQSTVTYNSLMSFE---SNYKEVSKIYDQMQ  304

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  E  +  +++    G +       I++  F+    V+
Sbjct  305  RAGLRPDVVSYALLINAYGKARREEEALAVFEEMLSAGVRPTHKAYNILLDAFAISGMVE  364

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            +   + + ++ D    D   Y + L+A  +A 
Sbjct  365  QARIVFKSMRRDRYMPDLCSYTTMLSAYVNAS  396


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/115 (21%), Positives = 68/115 (59%), Gaps = 0/115 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            + +Y++M++ Y        A +   ++K+ G +PNV  Y T++  + R + ++++ +V++
Sbjct  382  LCSYTTMLSAYVNASDMDGAEKFFRRLKQDGFDPNVVTYGTMIKGYARVNKLEKMMEVYE  441

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            EM+ R +  ++  +T+++ AY K K+ +S + ++++ + +G   D+    +++ +
Sbjct  442  EMRLRGIKANQTVFTTIMDAYGKNKDFDSALVWFKEMESSGVHPDKKAKNVLLSL  496



>gb|AIU48545.1| tetratricopeptide repeat-like superfamily protein, partial [Capsella 
rubella]
Length=470

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 89/150 (59%), Gaps = 0/150 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V+Y+ ++  YG+  R +EA  +  +M + G  P    YN LLD    +  ++Q + V+K
Sbjct  274  VVSYALLIKAYGRARREEEALSVFEEMLDAGVRPTHKAYNILLDAFAISGMVEQAKTVFK  333

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
             M+R ++ PD  SYT+++SAY  A ++E   K+++  K++G + +    G M+  ++K+N
Sbjct  334  SMRRDRIFPDLWSYTTMLSAYVNASDMEGAEKFFKRIKVDGFEPNVVTYGTMIKGYAKVN  393

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNA  348
             V++++++ + ++    K ++ +  + ++A
Sbjct  394  DVEKMMEVYEKMRLSGIKANQTILTTIMDA  423


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/129 (25%), Positives = 61/129 (47%), Gaps = 3/129 (2%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            ++  YGK G    A R+++ + + G  PNV  Y  L++ +GR       E +++ M+   
Sbjct  105  LITAYGKLGNFNGAERVLSVLSKMGSSPNVISYTALMESYGRGGKCNNAEAIFRRMQTSG  164

Query  599  VVPDRVSYTSVISAY---SKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
              P  V+Y  ++  +   +K KE E   +   D K +  K D+ M  +M+ ++ K    D
Sbjct  165  PEPSAVTYQIILKTFVEGNKFKEAEEVFETLLDEKKSPLKPDQKMYHMMIYMYKKAGNYD  224

Query  428  ELVKLLQDL  402
            +  K+   +
Sbjct  225  KARKVFASM  233



>gb|ACU25770.1| pentatricopeptide repeat-containing protein [Tamonea boxiana]
Length=426

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 91/180 (51%), Gaps = 13/180 (7%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R+ 
Sbjct  155  MIDVYGQLGMAKEADKLFWSMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKN  214

Query  599  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  420
            +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D   
Sbjct  215  IEQNVVTYNSMMVIYGKTLEHEKANNLIQEMQDRGIEPNAITYSTIISIWGKVGKLDRAA  274

Query  419  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCNSAKKKPKNI  240
             L Q L+    ++D+ LY++ + A   AGL   AK L +               K+P NI
Sbjct  275  MLFQKLRCSGIEIDQVLYQTMIVAYERAGLVAHAKRLLQEL-------------KRPDNI  321


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 88/169 (52%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMVIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  239  NNLIQEMQDRGIEPNAITYSTIISIWGKVGKLDRAAMLFQKLRCSGIEIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LLQ+LK  D    D     +A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLQELKRPDNIPRD-----TAIHILAGAGRIEEATWV  342


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M++RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMVIYGKTLEHEKANNLIQEMQDRGIEPNAITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  504
               ++++++   +  D+V Y ++I AY +A  +    +  Q+ K
Sbjct  273  AAMLFQKLRCSGIEIDQVLYQTMIVAYERAGLVAHAKRLLQELK  316


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   +  A  + +++K  G  P++  YN+++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSRAISIFSRLKRSGIAPDLVAYNSMINVFGKAKLFREARALVS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+PD VSY ++++ Y + ++    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVMPDTVSYCTLLTMYVENQKFLEALSLFSEMREIQCSFDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWSMRKMGIEPNVVSYNTLLRVYGDAEL  199


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/138 (20%), Positives = 65/138 (47%), Gaps = 0/138 (0%)
 Frame = -2

Query  791  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  612
             YS+++  +GK G   +A   + KM+E     ++ +Y+ L+++  +  +  +   ++  +
Sbjct  11   TYSTLITHFGKEGLFDDALSWLQKMEEDRVPGDLVLYSNLIELSRKLCDYSRAISIFSRL  70

Query  611  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  432
            KR  + PD V+Y S+I+ + KAK          + +  G   D      ++ ++ +  K 
Sbjct  71   KRSGIAPDLVAYNSMINVFGKAKLFREARALVSEMRTAGVMPDTVSYCTLLTMYVENQKF  130

Query  431  DELVKLLQDLKTDETKLD  378
             E + L  +++  +   D
Sbjct  131  LEALSLFSEMREIQCSFD  148


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 68/139 (49%), Gaps = 4/139 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  248  RGIEPNAITYSTIISIWGKVGKLDRAAMLFQKLRCSGIEIDQVLYQTMIVAYERAGLVAH  307

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++ +E+KR    PD +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  308  AKRLLQELKR----PDNIPRDTAIHILAGAGRIEEATWVFRQAVEAGEVKDITVFERMIN  363

Query  455  VFSKMNKVDELVKLLQDLK  399
            +FSK  K   +V++   ++
Sbjct  364  LFSKHKKYPNVVEVFDKMR  382



>gb|AIU48574.1| tetratricopeptide repeat-like superfamily protein, partial [Vitis 
vinifera]
Length=465

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 91/170 (54%), Gaps = 0/170 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++N YGK  R +EA  +  +M + G  P    YN LLD    +  + Q 
Sbjct  264  GLRPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQA  323

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R +  PD  SYT+++SAY  A ++E   K+++  K +G + +    G ++  
Sbjct  324  RTVFKSMRRDRCTPDICSYTTMLSAYVNASDMEGAEKFFRRLKQDGFEPNVVTYGTLIKG  383

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  303
            ++K++ ++++++  ++++    K ++ +Y + ++A           W +E
Sbjct  384  YAKISNLEKMMEKYEEMQVHGIKANQAIYTAMMDAYGKNDFGSAVFWFKE  433


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 77/151 (51%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G +++A ++   M+ERG   +   YN+L+      +N K+V K + +M+
Sbjct  205  FHMMIYMYRKAGNYEKARKIFGLMRERGVPQSTVTYNSLMSFE---TNYKEVSKTYDQMQ  261

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  E  +  +++    G +       I++  F+    VD
Sbjct  262  RAGLRPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVD  321

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +   + + ++ D    D   Y + L+A  +A
Sbjct  322  QARTVFKSMRRDRCTPDICSYTTMLSAYVNA  352



>ref|XP_006357891.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040-like 
[Solanum tuberosum]
Length=576

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/204 (26%), Positives = 107/204 (52%), Gaps = 12/204 (6%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ +++ YGK  R +EA  +  +M + G  P    YN LLD    +  ++Q 
Sbjct  311  GLRPDVVSYALLISAYGKARREEEALAVFEEMLDAGVRPTQKSYNILLDAFAISGMVEQA  370

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R +  PD  SYT+++SAY  A ++E   K+++  K +G + +    G ++  
Sbjct  371  RTVFKSMRRDRCSPDLCSYTTMLSAYINASDMEGAEKFFRRIKQDGLEPNVVTYGTLIKG  430

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL-RDAGLEIRAKWLQESFAVAT*II  276
            ++K N ++++++  +D++    K ++ ++ + ++A  R+        W  E  +      
Sbjct  431  YAKTNDLEKMMEKYEDMRVHGIKANQTIFTTIMDAYGRNKDFGSAVAWFNEMAS------  484

Query  275  SCNSAKKKPKNIVNTRWRISLSET  204
            S  S  +K KNI+     +SL++T
Sbjct  485  SGVSPDQKAKNIL-----LSLAKT  503


 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 78/151 (52%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G++++A  L + M ERG   N   YN+L+      +N K+V  ++ +M+
Sbjct  252  FHMMIYMYKKAGKYEKARHLFSLMAERGIPQNTVTYNSLMSFE---TNYKEVANIYDQMQ  308

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +ISAY KA+  E  +  +++    G +  +    I++  F+    V+
Sbjct  309  RAGLRPDVVSYALLISAYGKARREEEALAVFEEMLDAGVRPTQKSYNILLDAFAISGMVE  368

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +   + + ++ D    D   Y + L+A  +A
Sbjct  369  QARTVFKSMRRDRCSPDLCSYTTMLSAYINA  399


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/161 (20%), Positives = 84/161 (52%), Gaps = 0/161 (0%)
 Frame = -2

Query  791  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  612
            +Y+ +++ +  +G  ++A  +   M+   C P++  Y T+L  +  AS+M+  EK ++ +
Sbjct  353  SYNILLDAFAISGMVEQARTVFKSMRRDRCSPDLCSYTTMLSAYINASDMEGAEKFFRRI  412

Query  611  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  432
            K+  + P+ V+Y ++I  Y+K  +LE  ++ Y+D +++G K ++ +   ++  + +    
Sbjct  413  KQDGLEPNVVTYGTLIKGYAKTNDLEKMMEKYEDMRVHGIKANQTIFTTIMDAYGRNKDF  472

Query  431  DELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
               V    ++ +     D++     L+  + +  ++ AK +
Sbjct  473  GSAVAWFNEMASSGVSPDQKAKNILLSLAKTSEEQMEAKQI  513



>gb|KHN24013.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=498

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 84/157 (54%), Gaps = 0/157 (0%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            M+++YG+    KEA RL   M++ G +PNV  YNTLL ++G A    +   +++ M+ + 
Sbjct  156  MIDVYGQLHMPKEADRLFWSMRKMGIQPNVVSYNTLLRVYGEADLFGEAIHLFRLMQSKD  215

Query  599  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  420
            V  + V+Y ++I+ Y K  E E      Q+ K  G + +      ++ ++ K  K+D   
Sbjct  216  VQQNVVTYNTMINIYGKTLEHEKATNLIQEMKKRGIEPNAITYSTIISIWEKAGKLDRAA  275

Query  419  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
             L Q L++   ++DE LY++ + A   AGL   AK L
Sbjct  276  ILFQKLRSSGVRIDEVLYQTMIVAYERAGLVAHAKRL  312


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 88/169 (52%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y++++ +YG+     EA  L   M+ +  + NV  YNT+++I+G+    ++ 
Sbjct  180  GIQPNVVSYNTLLRVYGEADLFGEAIHLFRLMQSKDVQQNVVTYNTMINIYGKTLEHEKA  239

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EMK+R + P+ ++Y+++IS + KA +L+     +Q  + +G + D  +   M+  
Sbjct  240  TNLIQEMKKRGIEPNAITYSTIISIWEKAGKLDRAAILFQKLRSSGVRIDEVLYQTMIVA  299

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D     +A+  L  AG    A W+
Sbjct  300  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIGILARAGRIEEATWV  343


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 71/131 (54%), Gaps = 4/131 (3%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++++  K   + +A  + +++K     P++  YN+++++ G+A   ++   + +
Sbjct  45   LVLYSNLIDLARKLSDYSKAISIFSRLKASTISPDLIAYNSMINVFGKAKLFREARLLLQ  104

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGK--TDRAMAGIMVGVFSK  444
            EM+   V PD VSY+++++ Y   ++    +  +  F++N  K   D     IM+ V+ +
Sbjct  105  EMRDNAVQPDTVSYSTLLAIYVDNQKFVEALSLF--FEMNEAKCPLDLTTCNIMIDVYGQ  162

Query  443  MNKVDELVKLL  411
            ++   E  +L 
Sbjct  163  LHMPKEADRLF  173


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/138 (20%), Positives = 65/138 (47%), Gaps = 0/138 (0%)
 Frame = -2

Query  791  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  612
             YS+++  +GK G    +   + +M++     ++ +Y+ L+D+  + S+  +   ++  +
Sbjct  12   TYSTLITSFGKHGLFDSSLFWLQQMEQDNVSGDLVLYSNLIDLARKLSDYSKAISIFSRL  71

Query  611  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  432
            K   + PD ++Y S+I+ + KAK         Q+ + N  + D      ++ ++    K 
Sbjct  72   KASTISPDLIAYNSMINVFGKAKLFREARLLLQEMRDNAVQPDTVSYSTLLAIYVDNQKF  131

Query  431  DELVKLLQDLKTDETKLD  378
             E + L  ++   +  LD
Sbjct  132  VEALSLFFEMNEAKCPLD  149


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 75/158 (47%), Gaps = 6/158 (4%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++ K G+   A  L  K++  G   +  +Y T++  + RA  +  
Sbjct  249  RGIEPNAITYSTIISIWEKAGKLDRAAILFQKLRSSGVRIDEVLYQTMIVAYERAGLVAH  308

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV-KYYQDFKLNGGKTDRAMAGIMV  459
             +++  E+KR    PD +   + I   ++A  +E     + Q F     K D ++ G M+
Sbjct  309  AKRLLHELKR----PDNIPRDTAIGILARAGRIEEATWVFRQAFDAREVK-DISVFGCMI  363

Query  458  GVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
             +FSK  K   +V++ + ++      D  +    LNA 
Sbjct  364  NLFSKNKKYGNVVEVFEKMRVVGYFPDSDVIALVLNAF  401



>gb|ACU25755.1| pentatricopeptide repeat-containing protein [Junellia seriphioides]
Length=426

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   +GL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERSGLVAHAKRL  311


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERSGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY ++  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERSGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/156 (20%), Positives = 74/156 (47%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K     P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSRFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>ref|XP_010934958.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Elaeis guineensis]
 ref|XP_010934959.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Elaeis guineensis]
 ref|XP_010934960.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Elaeis guineensis]
Length=741

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 77/155 (50%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +  ++ M++ + K G  K A  L  +MKE GC P+V  YN+L+D HG+   +++ E++  
Sbjct  241  VFTFNIMIDFFCKEGDLKAAKGLFLRMKEMGCSPDVVTYNSLIDGHGKHGELEEAERLLG  300

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK     PD ++Y ++I+ + K  +L     Y  + K N  K +     I +  F K  
Sbjct  301  EMKVAGCKPDVITYNALINCFCKFGKLPKAFGYLSEMKRNDLKPNVVTFSIFIDAFCKEG  360

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             + E VK   D+K      +E  Y S ++    AG
Sbjct  361  MMQEAVKFFVDMKVRGLTPNEFTYTSLIDGNYKAG  395


 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 81/161 (50%), Gaps = 0/161 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG       Y+S+++   K G  KE   LV +M + G E NV  Y  L+D   +A  + +
Sbjct  375  RGLTPNEFTYTSLIDGNYKAGNLKEVLFLVDEMVQEGVELNVVTYTALVDGLCKAEKVVE  434

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             EKV+++M+R  V  +++ YT++I  +  +K +E  V    D K  G K D ++ G ++ 
Sbjct  435  AEKVFQDMERAGVAANQLVYTALIHGHFVSKNMEKAVSLLTDMKGKGIKPDTSLYGTIIW  494

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
               K  K+DE   L+ ++       +  +Y + ++A   AG
Sbjct  495  GLCKDGKIDEAKLLVSEMDEYGLMPNHVIYTTIMDACFKAG  535


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 85/164 (52%), Gaps = 2/164 (1%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V +S  ++ + K G  +EA +    MK RG  PN + Y +L+D + +A N+K+V  +  
Sbjct  346  VVTFSIFIDAFCKEGMMQEAVKFFVDMKVRGLTPNEFTYTSLIDGNYKAGNLKEVLFLVD  405

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAM-AGIMVGVFSKM  441
            EM +  V  + V+YT+++    KA+++    K +QD +  G   ++ +   ++ G F   
Sbjct  406  EMVQEGVELNVVTYTALVDGLCKAEKVVEAEKVFQDMERAGVAANQLVYTALIHGHFVSK  465

Query  440  NKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            N +++ V LL D+K    K D  LY + +  L   G    AK L
Sbjct  466  N-MEKAVSLLTDMKGKGIKPDTSLYGTIIWGLCKDGKIDEAKLL  508


 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 73/160 (46%), Gaps = 0/160 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V Y ++V+   K G  +EAT    KM++ G +PNV  Y  L+D   +   + + 
Sbjct  551  GMLPSVVTYCALVDGLCKQGSVREATYHFDKMRDLGLQPNVLAYTALIDGLCKNGCLGEA  610

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             K++KEM    + PD+V+YTS+I  + K   L+           NG + D       +  
Sbjct  611  IKLFKEMVGNGMAPDKVAYTSLIDGHLKQGNLQEAFDLRNKMAENGLELDLHGYTSFIWG  670

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            F   +++ E   ++ ++  +    D  +Y   ++  R  G
Sbjct  671  FCNRDQMQEARSMMAEMINNGVHPDVAVYNCLISKYRKLG  710


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/150 (23%), Positives = 74/150 (49%), Gaps = 0/150 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            ++ Y++++N + K G+  +A   +++MK    +PNV  ++  +D   +   M++  K + 
Sbjct  311  VITYNALINCFCKFGKLPKAFGYLSEMKRNDLKPNVVTFSIFIDAFCKEGMMQEAVKFFV  370

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            +MK R + P+  +YTS+I    KA  L+  +    +    G + +      +V    K  
Sbjct  371  DMKVRGLTPNEFTYTSLIDGNYKAGNLKEVLFLVDEMVQEGVELNVVTYTALVDGLCKAE  430

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNA  348
            KV E  K+ QD++      ++ +Y + ++ 
Sbjct  431  KVVEAEKVFQDMERAGVAANQLVYTALIHG  460


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 69/152 (45%), Gaps = 0/152 (0%)
 Frame = -2

Query  785  SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  606
            ++++    K+G  + + R    +      P V+ +N ++D   +  ++K  + ++  MK 
Sbjct  210  NNLLERLAKSGNGELSKRFFDDIVRSNMAPTVFTFNIMIDFFCKEGDLKAAKGLFLRMKE  269

Query  605  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  426
                PD V+Y S+I  + K  ELE   +   + K+ G K D      ++  F K  K+ +
Sbjct  270  MGCSPDVVTYNSLIDGHGKHGELEEAERLLGEMKVAGCKPDVITYNALINCFCKFGKLPK  329

Query  425  LVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
                L ++K ++ K +   +   ++A    G+
Sbjct  330  AFGYLSEMKRNDLKPNVVTFSIFIDAFCKEGM  361



>gb|AFV61124.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
macropoda]
Length=427

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  151  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  210

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S+   Y K  E E      Q+ +  G + +      ++ +
Sbjct  211  IHLFRLMQRKNIEQNVVTYNSMXMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  270

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  271  WGKVGKLDRAAMLFQKLRSSGIEIDQILFQTMIVAYERAGLVAHAKRL  318


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 83/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN++  I+G+    ++ 
Sbjct  186  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMXMIYGKTLEHEKA  245

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  246  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGIEIDQILFQTMIVA  305

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   V    +LL +LK  D    D     +A++ L  AG
Sbjct  306  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  341


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM  +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  220  KNIEQNVVTYNSMXMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  279

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   +  D++ + ++I AY +A
Sbjct  280  AAMLFQKLRSSGIEIDQILFQTMIVAYERA  309


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 77/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K+ G  P++  YN ++++ G+A   ++   +  
Sbjct  51   LVLYSNLIELSRKLCDYSKAISIFSRLKKSGFTPDLVAYNAMINVFGKAKLFREARSLIG  110

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  111  EMKAAGVMPNTXSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  170

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  171  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  206



>ref|XP_002878256.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH54515.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=582

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 89/155 (57%), Gaps = 0/155 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++  YG+  R +EA  +  +M + G  P    YN LLD    +  ++Q 
Sbjct  309  GIQPDVVSYALLIKAYGRARREEEALSVFEEMLDAGVRPTHKAYNILLDAFAISGMVEQA  368

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            + V+K M+R ++ PD  SYT+++SAY  A ++E   K+++  K++G + +    G M+  
Sbjct  369  KTVFKSMRRDRIFPDLWSYTTMLSAYVNASDMEGAEKFFKRIKVDGFEPNIVTYGTMIKG  428

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            ++K N V++++++ + ++    K ++ +  + ++A
Sbjct  429  YAKANDVEKMMEVYEKMRLSGIKANQTILTTIMDA  463


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 80/142 (56%), Gaps = 1/142 (1%)
 Frame = -2

Query  791  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  612
            +Y++M++ Y      + A +   ++K  G EPN+  Y T++  + +A++++++ +V+++M
Sbjct  386  SYTTMLSAYVNASDMEGAEKFFKRIKVDGFEPNIVTYGTMIKGYAKANDVEKMMEVYEKM  445

Query  611  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  432
            +   +  ++   T+++ A  + K+  S + +Y++ +  G   D+    +++ ++S  +++
Sbjct  446  RLSGIKANQTILTTIMDASGRCKDFGSALGWYKEMESCGVPPDQKAKNVLLSLYSTQDEL  505

Query  431  DELVKLLQDLKTDETKLDERLY  366
            DE  K L  L+ +   +  R+Y
Sbjct  506  DE-AKELTGLRNETATIVARVY  526


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/129 (25%), Positives = 60/129 (47%), Gaps = 3/129 (2%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            ++  YGK G    A R+++ + + G  PNV  Y  L++ +GR       E +++ M+   
Sbjct  145  LITAYGKLGNFNGAERVLSVLSKMGSSPNVISYTALMESYGRGGKCNNAEAIFRRMQSSG  204

Query  599  VVPDRVSYTSVISAY---SKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
              P  V+Y  ++  +    K KE E   +   D K +  K D+ M  +M+ ++ K    D
Sbjct  205  PEPSAVTYQIILKTFVEGDKFKEAEEVFETLLDEKKSPLKPDQKMYHMMIYMYKKAGNYD  264

Query  428  ELVKLLQDL  402
            +  K+   +
Sbjct  265  KARKVFSSM  273



>ref|XP_010091910.1| hypothetical protein L484_010474 [Morus notabilis]
 gb|EXB47690.1| hypothetical protein L484_010474 [Morus notabilis]
Length=688

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 85/157 (54%), Gaps = 0/157 (0%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            M+++YG+    KEA RL   M++ G EPNV  YNTLL ++G A    +   +++ M+R+ 
Sbjct  347  MIDVYGQLDMAKEADRLFWSMRKMGIEPNVVSYNTLLRVYGEAELFGEAIHLFRLMQRKD  406

Query  599  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  420
            +  + V+Y ++I  Y K+ E E      Q+ +  G + +      ++ ++ K  K+D   
Sbjct  407  IEQNVVTYNTMIKIYGKSLEHEKATNLVQEMQKRGIEPNAITYSTIISIWGKAGKLDRAA  466

Query  419  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
             L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  467  ILFQKLRSSGVEIDQVLYQTMIVAYEKAGLVAHAKRL  503


 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 90/168 (54%), Gaps = 4/168 (2%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG+     EA  L   M+ +  E NV  YNT++ I+G++   ++ 
Sbjct  371  GIEPNVVSYNTLLRVYGEAELFGEAIHLFRLMQRKDIEQNVVTYNTMIKIYGKSLEHEKA  430

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM++R + P+ ++Y+++IS + KA +L+     +Q  + +G + D+ +   M+  
Sbjct  431  TNLVQEMQKRGIEPNAITYSTIISIWGKAGKLDRAAILFQKLRSSGVEIDQVLYQTMIVA  490

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K   V    +LL +LK  +    E    +A+  L  AG    A W+
Sbjct  491  YEKAGLVAHAKRLLHELKRPDNIPRE----TAITILAGAGRLEEATWV  534


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y++M+ +YGK+  H++AT LV +M++RG EPN   Y+T++ I G+A  + +
Sbjct  405  KDIEQNVVTYNTMIKIYGKSLEHEKATNLVQEMQKRGIEPNAITYSTIISIWGKAGKLDR  464

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D+V Y ++I AY KA
Sbjct  465  AAILFQKLRSSGVEIDQVLYQTMIVAYEKA  494


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/133 (20%), Positives = 71/133 (53%), Gaps = 0/133 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN+++++ G+A   ++   +  
Sbjct  236  LVLYSNLIELSRKLCDYSKAISIFSRLKWSGITPDLVAYNSMINVFGKAKLFREARLLIT  295

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+PD VSY+++++ Y + ++    +  + +      + D     IM+ V+ +++
Sbjct  296  EMRAAGVLPDTVSYSTLLTMYVENQKFIEALSVFSEMNEVRCRLDLTTCNIMIDVYGQLD  355

Query  437  KVDELVKLLQDLK  399
               E  +L   ++
Sbjct  356  MAKEADRLFWSMR  368


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 76/162 (47%), Gaps = 7/162 (4%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + +A  +  
Sbjct  440  RGIEPNAITYSTIISIWGKAGKLDRAAILFQKLRSSGVEIDQVLYQTMIVAYEKAGLVAH  499

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I+  + A  LE     ++     G   D ++   M+ 
Sbjct  500  AKRLLHELKR----PDNIPRETAITILAGAGRLEEATWVFRQASDAGEIKDISVFSCMIE  555

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA---LRD  339
            +FSK  K   L ++   ++      D  +    LNA   LRD
Sbjct  556  LFSKNKKYANLTEVFDKMRGVGYFPDSNVIALVLNAYGKLRD  597



>gb|ACU25766.1| pentatricopeptide repeat-containing protein [Neosparton ephedroides]
Length=426

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKIGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L+    ++D+ LY++ + A   AGL   AK L
Sbjct  264  WVKVGKLDRAAMLFQKLRNSGVEIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 87/169 (51%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWVKVGKLDRAAMLFQKLRNSGVEIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D     +A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIHILAAAGRLEEATWV  342


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I  +   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWVKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D+V Y ++I AY +A
Sbjct  273  AAMLFQKLRNSGVEIDQVLYQTMIVAYERA  302


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN+++++  +A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFAPDLVAYNSMINVFXKAKLFREARSLIN  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+PD VSYT++++ + + K     +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVMPDTVSYTTLLTMHVENKRFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKIGIEPNVVSYNTLLRVYGDAEL  199


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (46%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++ K G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  248  RGIEPNSITYSTIISIWVKVGKLDRAAMLFQKLRNSGVEIDQVLYQTMIVAYERAGLVAH  307

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    PD +   + I   + A  LE     ++     G   D  +   ++ 
Sbjct  308  AKRLLHELKR----PDNIPRDTAIHILAAAGRLEEATWVFRQAIDAGEVKDITVFERLIH  363

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++      D  +    LNA
Sbjct  364  LFSKYKKYSNVVEVFDKMRERRYFPDSNVIALVLNA  399



>ref|XP_010244205.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, 
chloroplastic [Nelumbo nucifera]
Length=693

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 86/157 (55%), Gaps = 0/157 (0%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            M+++YG+    KEA RL   M++ G EPNV  YNTLL ++G A    +   +++ M+R+ 
Sbjct  353  MIDVYGQLDMAKEADRLFWSMRKMGIEPNVVSYNTLLRVYGEAELFGEAIHLFRLMQRKD  412

Query  599  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  420
            +  + V+Y ++I  Y K+ E E      Q+ +  G + +      ++ ++ K+ K+D   
Sbjct  413  IEQNVVTYNTMIKIYGKSLEHEKATNLIQEMQSRGIEPNAVTYSTIISIWGKVGKLDRAA  472

Query  419  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
             L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  473  MLFQKLRSSGVEIDQVLYQTMIVAYERAGLIGHAKRL  509


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 88/168 (52%), Gaps = 4/168 (2%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG+     EA  L   M+ +  E NV  YNT++ I+G++   ++ 
Sbjct  377  GIEPNVVSYNTLLRVYGEAELFGEAIHLFRLMQRKDIEQNVVTYNTMIKIYGKSLEHEKA  436

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ V+Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  437  TNLIQEMQSRGIEPNAVTYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  496

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   +    +LL +LK  +    E    +A+  L  AG    A W+
Sbjct  497  YERAGLIGHAKRLLHELKHPDNIPRE----TAITILARAGRIEEATWV  540


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y++M+ +YGK+  H++AT L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  411  KDIEQNVVTYNTMIKIYGKSLEHEKATNLIQEMQSRGIEPNAVTYSTIISIWGKVGKLDR  470

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D+V Y ++I AY +A
Sbjct  471  AAMLFQKLRSSGVEIDQVLYQTMIVAYERA  500


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 71/133 (53%), Gaps = 0/133 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  L +++K  G  P++  +N+++++ G+A   ++   + +
Sbjct  242  LVLYSNLIELSRKLHDYSKAISLFSRLKRSGITPDLIAFNSMINVFGKAKLFREARLLLQ  301

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V PD VSY+++++ + + + L   +  + +    G   D     IM+ V+ +++
Sbjct  302  EMRLASVPPDTVSYSTLLTIFVENRRLVEALSIFSEMNDVGCPLDITTCNIMIDVYGQLD  361

Query  437  KVDELVKLLQDLK  399
               E  +L   ++
Sbjct  362  MAKEADRLFWSMR  374


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/162 (23%), Positives = 76/162 (47%), Gaps = 7/162 (4%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   V YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  446  RGIEPNAVTYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLIGH  505

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I+  ++A  +E     ++     G   D ++   M+ 
Sbjct  506  AKRLLHELKH----PDNIPRETAITILARAGRIEEATWVFRQAYDAGEVKDISVFRCMID  561

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA---LRD  339
            +FS+  K    +++ + ++      D       LNA   LRD
Sbjct  562  LFSRNRKHTNAIEVFEKMRVAGYFPDSNTIALVLNAYGKLRD  603



>ref|XP_003610900.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES93858.1| PPR containing plant-like protein [Medicago truncatula]
Length=1508

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 80/156 (51%), Gaps = 0/156 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            GF K  + Y+++++MYGK GRH EA RL   MK  G  P+   Y  L+D+ G+AS +++ 
Sbjct  436  GFGKDEMTYNTIIHMYGKHGRHDEALRLYRDMKSSGRNPDAVTYTVLIDLLGKASKIEEA  495

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             KV  EM    V P   +Y+++I AY+K        + +   + +G K D     +M+  
Sbjct  496  SKVMSEMLDAGVKPTLHTYSALICAYAKVGRRVEAEETFNRMRESGIKADHLAYSVMLDF  555

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
            F + N++ +   L Q++       D  LY   L AL
Sbjct  556  FLRFNEIKKAAALYQEMIEAGFTPDTGLYEVMLPAL  591


 Score = 72.0 bits (175),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 78/159 (49%), Gaps = 0/159 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    I+ Y+++++   +    KEA  + + M+   C+P++W YN ++ ++GR     + 
Sbjct  331  GLRPDIITYNTLISACSRESNLKEAIGVFSHMESNRCQPDLWTYNAMISVYGRCGFALKA  390

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            E +++++K     PD V+Y S++ A+SK    E      ++    G   D      ++ +
Sbjct  391  EHLFEKLKSNGFSPDAVTYNSLLYAFSKEGNTEKVRDISEEMVKMGFGKDEMTYNTIIHM  450

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            + K  + DE ++L +D+K+     D   Y   ++ L  A
Sbjct  451  YGKHGRHDEALRLYRDMKSSGRNPDAVTYTVLIDLLGKA  489


 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 81/164 (49%), Gaps = 3/164 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            Y++M+++YG+ G   +A  L  K+K  G  P+   YN+LL    +  N ++V  + +EM 
Sbjct  374  YNAMISVYGRCGFALKAEHLFEKLKSNGFSPDAVTYNSLLYAFSKEGNTEKVRDISEEMV  433

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            +     D ++Y ++I  Y K    +  ++ Y+D K +G   D     +++ +  K +K++
Sbjct  434  KMGFGKDEMTYNTIIHMYGKHGRHDEALRLYRDMKSSGRNPDAVTYTVLIDLLGKASKIE  493

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  297
            E  K++ ++     K     Y + + A    G  + A   +E+F
Sbjct  494  EASKVMSEMLDAGVKPTLHTYSALICAYAKVGRRVEA---EETF  534


 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/157 (24%), Positives = 76/157 (48%), Gaps = 2/157 (1%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLD--IHGRASNMKQVEKV  624
            +  Y++M+ +Y + G  ++   +   M+ERGCEP++  +NTL++  +   A+      ++
Sbjct  264  VQVYNAMMGVYARNGNFEKVNEMFNLMRERGCEPDIVSFNTLINAKVKSCATVSGLAIEL  323

Query  623  WKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSK  444
              E+ +  + PD ++Y ++ISA S+   L+  +  +   + N  + D      M+ V+ +
Sbjct  324  LDEVGKFGLRPDIITYNTLISACSRESNLKEAIGVFSHMESNRCQPDLWTYNAMISVYGR  383

Query  443  MNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
                 +   L + LK++    D   Y S L A    G
Sbjct  384  CGFALKAEHLFEKLKSNGFSPDAVTYNSLLYAFSKEG  420


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 82/170 (48%), Gaps = 0/170 (0%)
 Frame = -2

Query  812   GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
             G+   +  Y  M+ +  +  R ++   ++++M E G +P++ I+N++L ++      + +
Sbjct  924   GYFPTMHLYRLMIGLLCRFKRVRDVRVMLSEMGEAGFKPDLQIFNSVLKLYSSIEEFQNM  983

Query  632   EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
               +++ ++   + PD  +Y ++I+ Y +    E  +      K  G +  R     M+  
Sbjct  984   GVIYQMIQDAGLAPDEETYNTLITMYCRDHRPEEGLSLMHKMKSLGLEPKRDTYRSMIAA  1043

Query  452   FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  303
             FSK    D+  +L ++L+++  KLD   Y   +   R +G   +A+ L E
Sbjct  1044  FSKQQLYDQAEELFEELRSNGYKLDRSFYHLMMKMYRTSGDHQKAENLLE  1093


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 69/140 (49%), Gaps = 0/140 (0%)
 Frame = -2

Query  788   YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
             Y  M+ MY  +G H++A  L+  MKE G EPN    + L+  +G++   ++ +++ K ++
Sbjct  1072  YHLMMKMYRTSGDHQKAENLLEIMKEAGIEPNTATMHLLMVSYGKSGQPEEADRILKNLR  1131

Query  608   RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
                 V D + Y+SVI AY K  + ++ ++   + K    + D  +    +   S   +V+
Sbjct  1132  TMGAVLDTLPYSSVIDAYLKKGDAKAGIEKLTEMKEAAIEPDHRIWTCFIRAASLSGEVN  1191

Query  428   ELVKLLQDLKTDETKLDERL  369
             +   LL  L+     L  RL
Sbjct  1192  DANNLLNALQAVGFDLPIRL  1211


 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/132 (20%), Positives = 69/132 (52%), Gaps = 0/132 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V Y+ ++++ GK  + +EA++++++M + G +P +  Y+ L+  + +     + E+ +  
Sbjct  477  VTYTVLIDLLGKASKIEEASKVMSEMLDAGVKPTLHTYSALICAYAKVGRRVEAEETFNR  536

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M+   +  D ++Y+ ++  + +  E++     YQ+    G   D  +  +M+    + N 
Sbjct  537  MRESGIKADHLAYSVMLDFFLRFNEIKKAAALYQEMIEAGFTPDTGLYEVMLPALVRENM  596

Query  434  VDELVKLLQDLK  399
             D + +++QD K
Sbjct  597  GDVIERVVQDTK  608


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 61/126 (48%), Gaps = 2/126 (2%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKE--ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNM  642
            RG +  IV++++++N   K+       A  L+ ++ + G  P++  YNTL+    R SN+
Sbjct  293  RGCEPDIVSFNTLINAKVKSCATVSGLAIELLDEVGKFGLRPDIITYNTLISACSRESNL  352

Query  641  KQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIM  462
            K+   V+  M+  +  PD  +Y ++IS Y +          ++  K NG   D      +
Sbjct  353  KEAIGVFSHMESNRCQPDLWTYNAMISVYGRCGFALKAEHLFEKLKSNGFSPDAVTYNSL  412

Query  461  VGVFSK  444
            +  FSK
Sbjct  413  LYAFSK  418


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 71/147 (48%), Gaps = 0/147 (0%)
 Frame = -2

Query  788   YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
             Y++++ MY +  R +E   L+ KMK  G EP    Y +++    +     Q E++++E++
Sbjct  1002  YNTLITMYCRDHRPEEGLSLMHKMKSLGLEPKRDTYRSMIAAFSKQQLYDQAEELFEELR  1061

Query  608   RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
                   DR  Y  ++  Y  + + +      +  K  G + + A   +++  + K  + +
Sbjct  1062  SNGYKLDRSFYHLMMKMYRTSGDHQKAENLLEIMKEAGIEPNTATMHLLMVSYGKSGQPE  1121

Query  428   ELVKLLQDLKTDETKLDERLYRSALNA  348
             E  ++L++L+T    LD   Y S ++A
Sbjct  1122  EADRILKNLRTMGAVLDTLPYSSVIDA  1148



>ref|XP_008796942.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Phoenix dactylifera]
 ref|XP_008796943.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Phoenix dactylifera]
 ref|XP_008796944.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Phoenix dactylifera]
Length=741

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 77/155 (50%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +  ++ M++ + K G  K A  L  +MKE GC P+V  YN+L+D HG+   +++ E++  
Sbjct  241  VFTFNIMIDFFCKEGDLKAAKGLFLRMKETGCLPDVVTYNSLIDGHGKHGELEEAERLLG  300

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK     PD ++Y ++I+ + K   L     Y  + K N  K +     I +  F K  
Sbjct  301  EMKVAGCKPDVITYNALINCFCKFGNLPKAFGYLSEMKRNDVKPNVVTFSIFIDAFCKEG  360

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             + E VK L D+K      +E  Y S ++    AG
Sbjct  361  MMQEAVKFLVDMKVRGFTPNEFTYTSLIDGNCKAG  395


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 83/161 (52%), Gaps = 0/161 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RGF      Y+S+++   K G  KEA  LV +M + G E NV  Y  L+D   +A  + +
Sbjct  375  RGFTPNEFTYTSLIDGNCKAGNLKEALVLVDEMVQEGVELNVVTYTALVDGLCKAEKVVE  434

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             E+V ++M+R  V  +++ YT++I  +  +K +E  V    + K  G K D ++ G ++ 
Sbjct  435  AEEVLQDMERAGVAANQLVYTALIHGHFASKNMEKAVSLLTEMKGKGIKPDTSLYGTIIW  494

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
               K  ++DE   L+ ++     K +  +Y + ++A   AG
Sbjct  495  GLCKDGRIDEAKHLVSEMDECGLKPNHVIYTTIMDACFKAG  535


 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 76/161 (47%), Gaps = 0/161 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG    IV Y ++V+   K G  +EAT    KM++ G +PNV  Y  L+D   +   + +
Sbjct  550  RGMLPSIVTYCALVDGLCKQGSIREATYHFDKMRDLGLQPNVLAYTALIDGLCKNGCLGE  609

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +K++KEM    + PD+V+YTS+I  + K   L+           NG + D       + 
Sbjct  610  AKKLFKEMAGNGMAPDKVAYTSLIDGHLKQGNLQEAFALKDKMTENGLRLDLHGYTSFIW  669

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             F   +++ E   ++ ++ ++    D  +Y   ++  +  G
Sbjct  670  GFCNHDQMQEARSMMAEMISNGVHPDIAVYNCLISKYQKLG  710


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 78/185 (42%), Gaps = 35/185 (19%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V Y+S+++ +GK G  +EA RL+ +MK  GC+P+V  YN L++   +  N+ +      
Sbjct  276  VVTYNSLIDGHGKHGELEEAERLLGEMKVAGCKPDVITYNALINCFCKFGNLPKAFGYLS  335

Query  617  EMKR-----------------------------------RKVVPDRVSYTSVISAYSKAK  543
            EMKR                                   R   P+  +YTS+I    KA 
Sbjct  336  EMKRNDVKPNVVTFSIFIDAFCKEGMMQEAVKFLVDMKVRGFTPNEFTYTSLIDGNCKAG  395

Query  542  ELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYR  363
             L+  +    +    G + +      +V    K  KV E  ++LQD++      ++ +Y 
Sbjct  396  NLKEALVLVDEMVQEGVELNVVTYTALVDGLCKAEKVVEAEEVLQDMERAGVAANQLVYT  455

Query  362  SALNA  348
            + ++ 
Sbjct  456  ALIHG  460


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/152 (20%), Positives = 68/152 (45%), Gaps = 0/152 (0%)
 Frame = -2

Query  785  SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  606
            ++++    K+G    + R    +      P V+ +N ++D   +  ++K  + ++  MK 
Sbjct  210  NNLLQRLAKSGNGDLSKRFFDDILRSNMAPTVFTFNIMIDFFCKEGDLKAAKGLFLRMKE  269

Query  605  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  426
               +PD V+Y S+I  + K  ELE   +   + K+ G K D      ++  F K   + +
Sbjct  270  TGCLPDVVTYNSLIDGHGKHGELEEAERLLGEMKVAGCKPDVITYNALINCFCKFGNLPK  329

Query  425  LVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
                L ++K ++ K +   +   ++A    G+
Sbjct  330  AFGYLSEMKRNDVKPNVVTFSIFIDAFCKEGM  361


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 75/166 (45%), Gaps = 6/166 (4%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            Y +++    K GR  EA  LV++M E G +PN  IY T++D   +A    +   +  +M 
Sbjct  489  YGTIIWGLCKDGRIDEAKHLVSEMDECGLKPNHVIYTTIMDACFKAGKSSEALGLLHKML  548

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
             R ++P  V+Y +++    K   +     ++   +  G + +      ++    K   + 
Sbjct  549  DRGMLPSIVTYCALVDGLCKQGSIREATYHFDKMRDLGLQPNVLAYTALIDGLCKNGCLG  608

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  291
            E  KL +++  +    D+  Y S ++        ++   LQE+FA+
Sbjct  609  EAKKLFKEMAGNGMAPDKVAYTSLIDG------HLKQGNLQEAFAL  648



>gb|AIU48541.1| tetratricopeptide repeat-like superfamily protein, partial [Sarcandra 
glabra]
Length=470

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 53/205 (26%), Positives = 105/205 (51%), Gaps = 13/205 (6%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++N YGK  R +EA  +  +M +    P    YN LLD    +  ++Q 
Sbjct  269  GLQPDVVSYALLINAYGKARREEEALAVFEEMLDARVRPTRKAYNILLDAFAISGMVEQA  328

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R K  PD  SYT+++SAY  A ++E   K+++  K +G K +    GI++  
Sbjct  329  RTVFKSMRRDKFTPDLCSYTTMLSAYVNAPDMEGAEKFFRRLKQDGFKPNVVTYGILMKG  388

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IIS  273
            ++  N +  L+++ ++++    + +  ++ + ++A           W +E       + +
Sbjct  389  YAMANNLVRLMEIYEEMRMQGIEANLTIFTTIMDAHGKNDFGSAVTWFKE-------MET  441

Query  272  CNSAK-KKPKNIVNTRWRISLSETL  201
            C  A  +K KNI+     +SL++T+
Sbjct  442  CGFAPDQKAKNIL-----LSLAQTV  461


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 77/151 (51%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ M+ K G + +A ++ A+M +RG       +N+L+      +N K+V  ++ +M+
Sbjct  210  FHMMIYMHRKAGNYDQARKIFAQMVDRGILRTTVTFNSLMSFE---TNYKEVSNIYDQMQ  266

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  E  +  +++      +  R    I++  F+    V+
Sbjct  267  RAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDARVRPTRKAYNILLDAFAISGMVE  326

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +   + + ++ D+   D   Y + L+A  +A
Sbjct  327  QARTVFKSMRRDKFTPDLCSYTTMLSAYVNA  357



>gb|ACU25752.1| pentatricopeptide repeat-containing protein [Glandularia dissecta]
Length=426

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 90/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A    GL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERVGLVAHAKRL  311


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 86/169 (51%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + ++  V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERVGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 70/130 (54%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +   +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERVGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>gb|AIU48549.1| tetratricopeptide repeat-like superfamily protein, partial [Buxus 
sinica]
Length=470

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 101/193 (52%), Gaps = 8/193 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ +++ YGK  R +EA  +  +M + G  P    YN LLD    +  +++ 
Sbjct  269  GLQPDVVSYTLLISAYGKARREEEALAVFEEMLDAGVRPTRKAYNILLDAFAISGMVEEA  328

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R K  PD  SYT+++SAY  A +++   ++++  K +G + +    G ++  
Sbjct  329  RTVFKSMRRDKCTPDLCSYTTMLSAYVNASDMDGAEQFFKRLKQDGFQPNVVTYGTLIKG  388

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IIS  273
            ++K+  +++++++ +++  +  K ++ ++ + ++A           W QE       + S
Sbjct  389  YAKLKNLEKMMEIYEEMLAEGIKANQTIFTTIMDAHGKNEFGSAVHWFQE-------MGS  441

Query  272  CN-SAKKKPKNIV  237
            C     +K KNI+
Sbjct  442  CGFPPDQKAKNIL  454


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 82/151 (54%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G +++A ++ AKM ERG + +   YN+L+      +N K+V  ++ +M+
Sbjct  210  FHMMIYMYRKAGSYEKARKIFAKMAERGVQQSTVTYNSLMSFE---TNYKEVSNIYDQMQ  266

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSYT +ISAY KA+  E  +  +++    G +  R    I++  F+    V+
Sbjct  267  RAGLQPDVVSYTLLISAYGKARREEEALAVFEEMLDAGVRPTRKAYNILLDAFAISGMVE  326

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            E   + + ++ D+   D   Y + L+A  +A
Sbjct  327  EARTVFKSMRRDKCTPDLCSYTTMLSAYVNA  357


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 65/126 (52%), Gaps = 3/126 (2%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            ++  YGK G   +A ++++ M ++GC P+V  +  L++ +GR     + E +++ M+   
Sbjct  105  LITAYGKIGDFNKAEKVLSYMNKKGCSPSVISHTALMEAYGRGGQYNKAEAIFRRMQSSG  164

Query  599  VVPDRVSYTSVISAY---SKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
              P  ++Y  ++  +    K KE E+  +   + +++  K D+ M  +M+ ++ K    +
Sbjct  165  PEPSPLTYQIILKTFVEGDKFKEAEAVFETLLNDEISPLKPDQKMFHMMIYMYRKAGSYE  224

Query  428  ELVKLL  411
            +  K+ 
Sbjct  225  KARKIF  230



>ref|XP_011036388.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11900-like 
isoform X2 [Populus euphratica]
Length=375

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 87/156 (56%), Gaps = 1/156 (1%)
 Frame = -2

Query  767  YGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPD  588
            + + G+  +A  +  +M+   CEP++  YNT+LD+ GRA  + ++   +  MK   ++PD
Sbjct  201  FSECGQFDKAILIFEQMENLKCEPDLVTYNTVLDLLGRAGRIDEMLGEFASMKEAGILPD  260

Query  587  RVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQ  408
             +SY ++++  +K   L+ C  Y++D   NG + D      ++  F +   ++E ++L  
Sbjct  261  FISYNTLLNQLTKVGRLDLCSVYFRDMVENGIEPDLLTYTALIWSFGQSGNIEESLRLFN  320

Query  407  DLKTDETKLDERLYRSALNALRDAG-LEIRAKWLQE  303
            ++KT + +    +YRS + +L+  G +E+   +L+E
Sbjct  321  EMKTKQIRPSIYIYRSLIASLKKMGKVELAMTFLEE  356


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/144 (23%), Positives = 72/144 (50%), Gaps = 3/144 (2%)
 Frame = -2

Query  803  KC---IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC   +V Y++++++ G+ GR  E     A MKE G  P+   YNTLL+   +   +   
Sbjct  221  KCEPDLVTYNTVLDLLGRAGRIDEMLGEFASMKEAGILPDFISYNTLLNQLTKVGRLDLC  280

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
               +++M    + PD ++YT++I ++ ++  +E  ++ + + K    +    +   ++  
Sbjct  281  SVYFRDMVENGIEPDLLTYTALIWSFGQSGNIEESLRLFNEMKTKQIRPSIYIYRSLIAS  340

Query  452  FSKMNKVDELVKLLQDLKTDETKL  381
              KM KV+  +  L+++    + L
Sbjct  341  LKKMGKVELAMTFLEEMNASMSNL  364



>gb|ACU25776.1| pentatricopeptide repeat-containing protein [Duranta serratifolia]
Length=426

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 96/191 (50%), Gaps = 16/191 (8%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+    KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLDMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +V + V+Y +++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKDIVQNVVTYNTMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IIS  273
            + K+ K+D    L Q L+    ++D+ LY++ + A   AGL   AK L            
Sbjct  264  WGKVGKLDRAAMLFQKLRVSGIEIDQVLYQTMIVAYERAGLVAHAKRLLHEL--------  315

Query  272  CNSAKKKPKNI  240
                 K+P NI
Sbjct  316  -----KRPNNI  321


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/168 (24%), Positives = 86/168 (51%), Gaps = 4/168 (2%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +    NV  YNT++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKDIVQNVVTYNTMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  +++G + D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRVSGIEIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK       +    +A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPNNIPRD----TAIHILAGAGRIEEATWV  342


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 78/156 (50%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +K+K  G  P++  YN+++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSKLKRSGITPDLVAYNSMINVFGKARLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+P+ VSY+++++ Y + K     +  + + +      D     IM+ V+ +++
Sbjct  104  EMRVAGVMPNTVSYSTLLTMYVENKRFREALSVFAEMREIKCLLDLTTCNIMIDVYGQLD  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 73/156 (47%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  248  RGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRVSGIEIDQVLYQTMIVAYERAGLVAH  307

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+KR    P+ +   + I   + A  +E     ++     G   D  +   M+ 
Sbjct  308  AKRLLHELKR----PNNIPRDTAIHILAGAGRIEEATWVFRQAIDAGEVKDITVFERMIS  363

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++ + ++      D  +    LNA
Sbjct  364  LFSKYKKYTNVVEVFEKMRGLGYFPDSNVIAVVLNA  399



>ref|XP_009411130.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=715

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 85/151 (56%), Gaps = 2/151 (1%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V +++++ +Y  +G    A  +  +MK  G +PNV IYNTLLD  GRA    QV+ +++E
Sbjct  295  VTFATVIRVYSVSGNFDGALNVYEEMKALGVKPNVVIYNTLLDSMGRAGRPWQVKTIYRE  354

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  R +VP R +Y++++ AYSKA+  E  +  Y+     G + +  +  +++ + + +  
Sbjct  355  MSSRGLVPTRATYSALLRAYSKARYAEDALGVYKQMNERGMELNVILYNMLLSMCADIGS  414

Query  434  VDELVKLLQDLK--TDETKLDERLYRSALNA  348
            VDE V++ + +K   D  + D   Y S + A
Sbjct  415  VDEAVEIFRKMKELPDGCRPDIWSYSSLITA  445


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 67/137 (49%), Gaps = 3/137 (2%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKE--RGCEPNVWIYNTLLDIHGRASNM  642
            RG +  ++ Y+ +++M    G   EA  +  KMKE   GC P++W Y++L+  +  +  +
Sbjct  393  RGMELNVILYNMLLSMCADIGSVDEAVEIFRKMKELPDGCRPDIWSYSSLITAYCCSGKV  452

Query  641  KQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIM  462
             + E +  +M      P+    TS+I  Y KA+  +S VK        G + D    G +
Sbjct  453  SEAEGLLDDMLEAGFQPNIFVLTSLIQCYGKAQMTDSVVKSLDKLLELGIRPDDRFCGCL  512

Query  461  VGVFSKMNKVDELVKLL  411
            + V ++    +EL K++
Sbjct  513  LNVATQ-TPAEELGKII  528


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 72/157 (46%), Gaps = 2/157 (1%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG       YS+++  Y K    ++A  +  +M ERG E NV +YN LL +     ++ +
Sbjct  358  RGLVPTRATYSALLRAYSKARYAEDALGVYKQMNERGMELNVILYNMLLSMCADIGSVDE  417

Query  635  VEKVWKEMKRRK--VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIM  462
              +++++MK       PD  SY+S+I+AY  + ++        D    G + +  +   +
Sbjct  418  AVEIFRKMKELPDGCRPDIWSYSSLITAYCCSGKVSEAEGLLDDMLEAGFQPNIFVLTSL  477

Query  461  VGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALN  351
            +  + K    D +VK L  L     + D+R     LN
Sbjct  478  IQCYGKAQMTDSVVKSLDKLLELGIRPDDRFCGCLLN  514



>emb|CDX71917.1| BnaC08g29570D [Brassica napus]
Length=545

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 88/155 (57%), Gaps = 0/155 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++  YG+  R +EA  +  +M + G  P    YN LLD    +  ++Q 
Sbjct  309  GIQPDVVSYALLIKAYGRARREEEALSVFEEMLDAGVRPTHKAYNILLDAFAISGMVEQA  368

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            + V+K M+R +  PD  SYT+++SAY  A ++E   K+++  K++G + +    G M+  
Sbjct  369  KTVFKSMRRDRFYPDLCSYTTMLSAYVNASDMEGAEKFFKRIKVDGFEPNLVTYGTMIKG  428

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            ++K N +D+++++ + ++    K ++ +  + ++A
Sbjct  429  YAKANDLDKVMEVYEKMRLSGIKANQTILTTIMDA  463


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 77/151 (51%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            Y  M+ MY K G +++A ++ A M E+G   +   YN+L+      +N K+V K++ +M+
Sbjct  250  YHMMIYMYKKAGNYEKARKVFASMAEKGVPQSTVTYNSLMSFE---TNYKEVSKIYDQMQ  306

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I AY +A+  E  +  +++    G +       I++  F+    V+
Sbjct  307  RSGIQPDVVSYALLIKAYGRARREEEALSVFEEMLDAGVRPTHKAYNILLDAFAISGMVE  366

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +   + + ++ D    D   Y + L+A  +A
Sbjct  367  QAKTVFKSMRRDRFYPDLCSYTTMLSAYVNA  397


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 62/129 (48%), Gaps = 3/129 (2%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            ++  YGK G    A R+++ + + G  PNV  Y  L++ +GR       E +++ M+   
Sbjct  145  LITAYGKLGNFNGAERVLSVLSKMGSSPNVISYTALMESYGRGGKCNNAEAIFRRMQSSG  204

Query  599  VVPDRVSYTSVISAY---SKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
              P  V+Y  ++  +   +K KE E   +   D K++  K D+ M  +M+ ++ K    +
Sbjct  205  PEPSAVTYQIILKTFVEGNKFKEAEEVFETLLDEKISPLKPDQKMYHMMIYMYKKAGNYE  264

Query  428  ELVKLLQDL  402
            +  K+   +
Sbjct  265  KARKVFASM  273


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/128 (20%), Positives = 71/128 (55%), Gaps = 0/128 (0%)
 Frame = -2

Query  809  FDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVE  630
            F   + +Y++M++ Y      + A +   ++K  G EPN+  Y T++  + +A+++ +V 
Sbjct  380  FYPDLCSYTTMLSAYVNASDMEGAEKFFKRIKVDGFEPNLVTYGTMIKGYAKANDLDKVM  439

Query  629  KVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVF  450
            +V+++M+   +  ++   T+++ A  + K+  S + +Y++ +  G   D+    +++ + 
Sbjct  440  EVYEKMRLSGIKANQTILTTIMDASGRCKDFGSALSWYKEMESCGVPPDQKAKNVLLSLA  499

Query  449  SKMNKVDE  426
            S  ++++E
Sbjct  500  SSQDELEE  507



>ref|XP_011036387.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11900-like 
isoform X1 [Populus euphratica]
Length=382

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 87/156 (56%), Gaps = 1/156 (1%)
 Frame = -2

Query  767  YGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPD  588
            + + G+  +A  +  +M+   CEP++  YNT+LD+ GRA  + ++   +  MK   ++PD
Sbjct  208  FSECGQFDKAILIFEQMENLKCEPDLVTYNTVLDLLGRAGRIDEMLGEFASMKEAGILPD  267

Query  587  RVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQ  408
             +SY ++++  +K   L+ C  Y++D   NG + D      ++  F +   ++E ++L  
Sbjct  268  FISYNTLLNQLTKVGRLDLCSVYFRDMVENGIEPDLLTYTALIWSFGQSGNIEESLRLFN  327

Query  407  DLKTDETKLDERLYRSALNALRDAG-LEIRAKWLQE  303
            ++KT + +    +YRS + +L+  G +E+   +L+E
Sbjct  328  EMKTKQIRPSIYIYRSLIASLKKMGKVELAMTFLEE  363


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/144 (23%), Positives = 72/144 (50%), Gaps = 3/144 (2%)
 Frame = -2

Query  803  KC---IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC   +V Y++++++ G+ GR  E     A MKE G  P+   YNTLL+   +   +   
Sbjct  228  KCEPDLVTYNTVLDLLGRAGRIDEMLGEFASMKEAGILPDFISYNTLLNQLTKVGRLDLC  287

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
               +++M    + PD ++YT++I ++ ++  +E  ++ + + K    +    +   ++  
Sbjct  288  SVYFRDMVENGIEPDLLTYTALIWSFGQSGNIEESLRLFNEMKTKQIRPSIYIYRSLIAS  347

Query  452  FSKMNKVDELVKLLQDLKTDETKL  381
              KM KV+  +  L+++    + L
Sbjct  348  LKKMGKVELAMTFLEEMNASMSNL  371



>gb|ACU25747.1| pentatricopeptide repeat-containing protein [Verbena rigida]
Length=426

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 90/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y  ++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKNIEQNVVTYNXMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 84/169 (50%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN ++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNXMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G   D+ +   M+  
Sbjct  239  NNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D      A++ L  AG    A W+
Sbjct  299  YERAGLVAHAKRLLHELKRPDNIPRD-----IAIHILAGAGRIEEATWV  342


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 70/130 (54%), Gaps = 4/130 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+ M+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KNIEQNVVTYNXMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
               ++++++   V  D+V Y ++I AY +A  +    +   + K    + D     I + 
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYERAGLVAHAKRLLHELK----RPDNIPRDIAIH  328

Query  455  VFSKMNKVDE  426
            + +   +++E
Sbjct  329  ILAGAGRIEE  338


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVTPNTASYSTLLTMYVENKKFLEALSIFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  199



>ref|XP_003552765.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, 
chloroplastic-like [Glycine max]
Length=658

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 84/157 (54%), Gaps = 0/157 (0%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            M+++YG+    KEA RL   M++ G +PNV  YNTLL ++G A    +   +++ M+ + 
Sbjct  316  MIDVYGQLHMPKEADRLFWSMRKMGIQPNVVSYNTLLRVYGEADLFGEAIHLFRLMQSKD  375

Query  599  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  420
            V  + V+Y ++I+ Y K  E E      Q+ K  G + +      ++ ++ K  K+D   
Sbjct  376  VQQNVVTYNTMINIYGKTLEHEKATNLIQEMKKRGIEPNAITYSTIISIWEKAGKLDRAA  435

Query  419  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
             L Q L++   ++DE LY++ + A   AGL   AK L
Sbjct  436  ILFQKLRSSGVRIDEVLYQTMIVAYERAGLVAHAKRL  472


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 88/169 (52%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y++++ +YG+     EA  L   M+ +  + NV  YNT+++I+G+    ++ 
Sbjct  340  GIQPNVVSYNTLLRVYGEADLFGEAIHLFRLMQSKDVQQNVVTYNTMINIYGKTLEHEKA  399

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EMK+R + P+ ++Y+++IS + KA +L+     +Q  + +G + D  +   M+  
Sbjct  400  TNLIQEMKKRGIEPNAITYSTIISIWEKAGKLDRAAILFQKLRSSGVRIDEVLYQTMIVA  459

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  D    D     +A+  L  AG    A W+
Sbjct  460  YERAGLVAHAKRLLHELKRPDNIPRD-----TAIGILARAGRIEEATWV  503


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 73/135 (54%), Gaps = 4/135 (3%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++++  K   + +A  + +++K     P++  YN+++++ G+A   ++   + +
Sbjct  205  LVLYSNLIDLARKLSDYSKAISIFSRLKASTISPDLIAYNSMINVFGKAKLFREARLLLQ  264

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGK--TDRAMAGIMVGVFSK  444
            EM+   V PD VSY+++++ Y   ++    +  +  F++N  K   D     IM+ V+ +
Sbjct  265  EMRDNAVQPDTVSYSTLLAIYVDNQKFVEALSLF--FEMNEAKCPLDLTTCNIMIDVYGQ  322

Query  443  MNKVDELVKLLQDLK  399
            ++   E  +L   ++
Sbjct  323  LHMPKEADRLFWSMR  337


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/137 (20%), Positives = 65/137 (47%), Gaps = 0/137 (0%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            YS+++  +GK G    +   + +M++     ++ +Y+ L+D+  + S+  +   ++  +K
Sbjct  173  YSTLITSFGKHGLFDSSLFWLQQMEQDNVSGDLVLYSNLIDLARKLSDYSKAISIFSRLK  232

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
               + PD ++Y S+I+ + KAK         Q+ + N  + D      ++ ++    K  
Sbjct  233  ASTISPDLIAYNSMINVFGKAKLFREARLLLQEMRDNAVQPDTVSYSTLLAIYVDNQKFV  292

Query  428  ELVKLLQDLKTDETKLD  378
            E + L  ++   +  LD
Sbjct  293  EALSLFFEMNEAKCPLD  309


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 75/158 (47%), Gaps = 6/158 (4%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++ K G+   A  L  K++  G   +  +Y T++  + RA  +  
Sbjct  409  RGIEPNAITYSTIISIWEKAGKLDRAAILFQKLRSSGVRIDEVLYQTMIVAYERAGLVAH  468

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYY-QDFKLNGGKTDRAMAGIMV  459
             +++  E+KR    PD +   + I   ++A  +E     + Q F     K D ++ G M+
Sbjct  469  AKRLLHELKR----PDNIPRDTAIGILARAGRIEEATWVFRQAFDAREVK-DISVFGCMI  523

Query  458  GVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
             +FSK  K   +V++ + ++      D  +    LNA 
Sbjct  524  NLFSKNKKYGNVVEVFEKMRVVGYFPDSDVIALVLNAF  561



>ref|XP_006290805.1| hypothetical protein CARUB_v10016912mg [Capsella rubella]
 gb|EOA23703.1| hypothetical protein CARUB_v10016912mg [Capsella rubella]
Length=586

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 89/150 (59%), Gaps = 0/150 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V+Y+ ++  YG+  R +EA  +  +M + G  P    YN LLD    +  ++Q + V+K
Sbjct  314  VVSYALLIKAYGRARREEEALSVFEEMLDAGVRPTHKAYNILLDAFAISGMVEQAKTVFK  373

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
             M+R ++ PD  SYT+++SAY  A ++E   K+++  K++G + +    G M+  ++K+N
Sbjct  374  SMRRDRIFPDLWSYTTMLSAYVNASDMEGAEKFFKRIKVDGFEPNVVTYGTMIKGYAKVN  433

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNA  348
             V++++++ + ++    K ++ +  + ++A
Sbjct  434  DVEKMMEVYEKMRLSGIKANQTILTTIMDA  463


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 79/142 (56%), Gaps = 1/142 (1%)
 Frame = -2

Query  791  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  612
            +Y++M++ Y      + A +   ++K  G EPNV  Y T++  + + ++++++ +V+++M
Sbjct  386  SYTTMLSAYVNASDMEGAEKFFKRIKVDGFEPNVVTYGTMIKGYAKVNDVEKMMEVYEKM  445

Query  611  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  432
            +   +  ++   T+++ A  + K+  S + +Y++ +  G   D+    +++ + S  +++
Sbjct  446  RLSGIKANQTILTTIMDASGRCKDFGSALDWYKEMESCGVPPDQKAKNVLLSLASTQDEL  505

Query  431  DELVKLLQDLKTDETKLDERLY  366
            +E  K L  L+ + T +  R+Y
Sbjct  506  EE-AKELTGLRNETTTIIARVY  526


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/129 (25%), Positives = 61/129 (47%), Gaps = 3/129 (2%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            ++  YGK G    A R+++ + + G  PNV  Y  L++ +GR       E +++ M+   
Sbjct  145  LITAYGKLGNFNGAERVLSVLSKMGSSPNVISYTALMESYGRGGKCNNAEAIFRRMQTSG  204

Query  599  VVPDRVSYTSVISAY---SKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
              P  V+Y  ++  +   +K KE E   +   D K +  K D+ M  +M+ ++ K    D
Sbjct  205  PEPSAVTYQIILKTFVEGNKFKEAEEVFETLLDEKKSPLKPDQKMYHMMIYMYKKAGNYD  264

Query  428  ELVKLLQDL  402
            +  K+   +
Sbjct  265  KARKVFASM  273



>ref|XP_004147489.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004172035.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, 
chloroplastic-like [Cucumis sativus]
 gb|KGN59598.1| hypothetical protein Csa_3G827400 [Cucumis sativus]
Length=680

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 92/183 (50%), Gaps = 13/183 (7%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            M+++YG+    KEA RL  +M++ G EPNV  YNT+L ++G A    +   +++ M+R++
Sbjct  340  MIDVYGQLDMVKEADRLFWRMRKIGIEPNVVSYNTILRVYGEAELFGEAIHLFRLMQRKE  399

Query  599  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  420
            +  + V+Y ++I  Y K  E E      QD +  G + +      ++ ++ K  K+D   
Sbjct  400  IKQNVVTYNTMIKIYGKTLEHEKATNLVQDMQKRGIEPNAITYSTIISIWGKAGKLDRSA  459

Query  419  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCNSAKKKPKNI  240
             L Q L++   ++D+ LY++ + A   AGL   AK L                 K+P NI
Sbjct  460  MLFQKLRSSGAEIDQVLYQTMIVAYEKAGLVGHAKRLLHEL-------------KQPDNI  506

Query  239  VNT  231
              T
Sbjct  507  PRT  509


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/201 (25%), Positives = 103/201 (51%), Gaps = 13/201 (6%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG+     EA  L   M+ +  + NV  YNT++ I+G+    ++ 
Sbjct  364  GIEPNVVSYNTILRVYGEAELFGEAIHLFRLMQRKEIKQNVVTYNTMIKIYGKTLEHEKA  423

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + ++M++R + P+ ++Y+++IS + KA +L+     +Q  + +G + D+ +   M+  
Sbjct  424  TNLVQDMQKRGIEPNAITYSTIISIWGKAGKLDRSAMLFQKLRSSGAEIDQVLYQTMIVA  483

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKW-LQESF-------  297
            + K   V    +LL +LK    + D     +A+  L  AG    A W  +++F       
Sbjct  484  YEKAGLVGHAKRLLHELK----QPDNIPRTTAITILAKAGRIEEATWVFRQAFDAGELKD  539

Query  296  -AVAT*IISCNSAKKKPKNIV  237
             +V   +I   S  KK KN++
Sbjct  540  ISVFECMIDLFSRNKKHKNVL  560


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 70/129 (54%), Gaps = 0/129 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YNT++++ G+A   ++   + K
Sbjct  229  LVLYSNLIELSRKLCDYSKAISIFSRLKRSGITPDIVAYNTMINVFGKAKLFREARFLLK  288

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+PD VSY+++++ + + ++    +    + K      D     IM+ V+ +++
Sbjct  289  EMRAVDVMPDTVSYSTLLNMFVENEKFLEALSVISEMKEVNCPLDLTTCNIMIDVYGQLD  348

Query  437  KVDELVKLL  411
             V E  +L 
Sbjct  349  MVKEADRLF  357


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/139 (21%), Positives = 72/139 (52%), Gaps = 4/139 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   +  L  K++  G E +  +Y T++  + +A  +  
Sbjct  433  RGIEPNAITYSTIISIWGKAGKLDRSAMLFQKLRSSGAEIDQVLYQTMIVAYEKAGLVGH  492

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K+    PD +  T+ I+  +KA  +E     ++     G   D ++   M+ 
Sbjct  493  AKRLLHELKQ----PDNIPRTTAITILAKAGRIEEATWVFRQAFDAGELKDISVFECMID  548

Query  455  VFSKMNKVDELVKLLQDLK  399
            +FS+  K   ++++ + ++
Sbjct  549  LFSRNKKHKNVLEVFEKMR  567



>gb|ACU25768.1| pentatricopeptide repeat-containing protein [Priva cordifolia]
Length=426

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 92/168 (55%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  144  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWSMRKLGIEPNVVSYNTLLRVYGDAELFGEA  203

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  204  IHLFRLMQRKDIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNAITYSTIISI  263

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L + L++   ++D+ LY++ + A   AGL   AK L
Sbjct  264  WGKVGKLDRAAILFEKLRSSGIEIDQVLYQTMIVAYERAGLVSHAKRL  311


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 88/169 (52%), Gaps = 6/169 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  179  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKDIEQNVVTYNSMMMIYGKTLEHEKA  238

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     ++  + +G + D+ +   M+  
Sbjct  239  NNLIQEMQSRGIEPNAITYSTIISIWGKVGKLDRAAILFEKLRSSGIEIDQVLYQTMIVA  298

Query  452  FSKMNKVDELVKLLQDLKT-DETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LKT D    D     +A++ L  AG    A W+
Sbjct  299  YERAGLVSHAKRLLHELKTPDNIPRD-----TAIHILARAGRIEEATWV  342


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  213  KDIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNAITYSTIISIWGKVGKLDR  272

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   +  D+V Y ++I AY +A
Sbjct  273  AAILFEKLRSSGIEIDQVLYQTMIVAYERA  302


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 79/156 (51%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++ +YN+++++ G+A   ++   +  
Sbjct  44   LVLYSNLIELSRKLCDYSKAISIFSRLKRSGIMPDLVVYNSMINVFGKAKLFREARSLIS  103

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+PD VSYT++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  104  EMRTAGVMPDTVSYTALLTMYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLG  163

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  164  MAKEADKLFWSMRKLGIEPNVVSYNTLLRVYGDAEL  199


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 73/156 (47%), Gaps = 4/156 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG +   + YS++++++GK G+   A  L  K++  G E +  +Y T++  + RA  +  
Sbjct  248  RGIEPNAITYSTIISIWGKVGKLDRAAILFEKLRSSGIEIDQVLYQTMIVAYERAGLVSH  307

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             +++  E+K     PD +   + I   ++A  +E     ++     G   D  +   M+ 
Sbjct  308  AKRLLHELK----TPDNIPRDTAIHILARAGRIEEATWVFRQAIDAGEVKDITVFERMID  363

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +FSK  K   +V++   ++  E   D  +    LNA
Sbjct  364  LFSKYKKYSNIVEVFDKMRGLEYFSDSYVIALVLNA  399



>ref|XP_006446275.1| hypothetical protein CICLE_v10017597mg [Citrus clementina]
 gb|ESR59515.1| hypothetical protein CICLE_v10017597mg [Citrus clementina]
Length=732

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 88/172 (51%), Gaps = 6/172 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G    +  Y+S++N   K GR   A  ++ +M + G  P+   YNTLL    R  NM +
Sbjct  304  KGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSE  363

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             E+++ EM RR V PD VS++++I  +S+  +L+  + Y+++ K  G   D  +  I++ 
Sbjct  364  AEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIIN  423

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQES  300
             + +   V E +K+  ++      +D   Y S LN L       RAK L E+
Sbjct  424  GYCRNGFVLEALKMRDEMLEKGCVMDVVTYNSILNGL------CRAKMLTEA  469


 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 62/128 (48%), Gaps = 0/128 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V Y+S++N   +     EA  L  +M ERG  P+ + + TL+  H +  NM +   ++ 
Sbjct  450  VVTYNSILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFD  509

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
             M ++ + PD V+Y ++I  + K  E+E   K + D        +    GI++  +  M 
Sbjct  510  IMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMG  569

Query  437  KVDELVKL  414
             V E  +L
Sbjct  570  HVTEAFRL  577


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 66/131 (50%), Gaps = 0/131 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V Y+ ++N Y + G   EA ++  +M E+GC  +V  YN++L+   RA  + + + ++ E
Sbjct  416  VLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNSILNGLCRAKMLTEADDLFNE  475

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  R V PD  ++T++I  + K   +   +  +        K D      ++  F K+ +
Sbjct  476  MLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGE  535

Query  434  VDELVKLLQDL  402
            +++  KL  D+
Sbjct  536  MEKANKLWADM  546


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G D   ++Y++++N + +     +A  LV+KM+ +G  P+V  YN +L    R   M   
Sbjct  620  GVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDS  679

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAM  474
            E + + M  +++ PDR +YT++I+ +     L+   +++ +    G   D A 
Sbjct  680  ELILRRMIEKRLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF  732


 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/177 (19%), Positives = 79/177 (45%), Gaps = 6/177 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG       ++++++ + K G   +A  L   M ++  +P++  YNTL+D   +   M++
Sbjct  479  RGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEK  538

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
              K+W +M  RK+ P+ +SY  +I+ Y     +    + + +    G K        ++ 
Sbjct  539  ANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIK  598

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT  285
             + +     +  + L  + ++    D   Y + +N        +R + + ++FA+ +
Sbjct  599  GYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGF------VREENMDKAFALVS  649



>ref|XP_010106170.1| hypothetical protein L484_012715 [Morus notabilis]
 gb|EXC08258.1| hypothetical protein L484_012715 [Morus notabilis]
Length=335

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 87/155 (56%), Gaps = 0/155 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ ++N YGK  R +EA  +  +M +    P    YN LLD    +  ++Q 
Sbjct  61   GLKPDVVSYALLINAYGKARREEEALAVFEEMLDADVRPTHKAYNILLDAFAISGMVEQA  120

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            + V+K M+R +  PD  SYT+++SAY  A ++E   K++   K +G K +      ++  
Sbjct  121  QTVFKSMRRDRYTPDLCSYTTMLSAYVNASDMEGAEKFFTRLKQDGLKPNEITYATLLKG  180

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            +++ N ++++++  +++K +  KL++++    ++A
Sbjct  181  YARTNNLEKMMEKYEEMKVNGIKLNQKILTIIMDA  215


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 77/152 (51%), Gaps = 3/152 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ M+ K G +++A RL A M ERG   +   YN+L+      +N K+V K++ +M+
Sbjct  2    FHMMIYMHKKAGSYEKARRLFALMAERGVPQSTVTYNSLMSFE---TNYKEVSKIYDQMQ  58

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +I+AY KA+  E  +  +++      +       I++  F+    V+
Sbjct  59   RAGLKPDVVSYALLINAYGKARREEEALAVFEEMLDADVRPTHKAYNILLDAFAISGMVE  118

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            +   + + ++ D    D   Y + L+A  +A 
Sbjct  119  QAQTVFKSMRRDRYTPDLCSYTTMLSAYVNAS  150



>gb|AIU48571.1| tetratricopeptide repeat-like superfamily protein, partial [Solanum 
lycopersicum]
Length=470

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 105/203 (52%), Gaps = 11/203 (5%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ +++ YGK  R +EA  +  +M + G  P    YN LLD    +  ++Q 
Sbjct  269  GLQPDVVSYALLISAYGKARREEEALAVFEEMLDAGVRPTQKSYNILLDAFAISGMVEQA  328

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              V+K M+R +  PD  SYT+++SAY  A ++E   K+++  K +G + +    G ++  
Sbjct  329  RTVFKSMRRDRCSPDLCSYTTMLSAYINASDMEGAEKFFRRIKQDGLEPNVVTYGALIKG  388

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IIS  273
            ++K N ++++++  ++++    K ++ ++ + ++A           W  E  +      S
Sbjct  389  YAKTNDLEKMMEKYEEMRVHGIKTNQTIFTTIMDAYGRNDFGSAVAWFNEMAS------S  442

Query  272  CNSAKKKPKNIVNTRWRISLSET  204
              S  +K KNI+     +SL++T
Sbjct  443  GVSPDQKAKNIL-----LSLAKT  460


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 78/151 (52%), Gaps = 3/151 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ MY K G++++A  L + M ERG   N   YN+L+      +N K+V  ++ +M+
Sbjct  210  FHMMIYMYKKAGKYEKARHLFSLMTERGIPQNTVTYNSLMSFE---TNYKEVANIYDQMQ  266

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  + PD VSY  +ISAY KA+  E  +  +++    G +  +    I++  F+    V+
Sbjct  267  RAGLQPDVVSYALLISAYGKARREEEALAVFEEMLDAGVRPTQKSYNILLDAFAISGMVE  326

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDA  336
            +   + + ++ D    D   Y + L+A  +A
Sbjct  327  QARTVFKSMRRDRCSPDLCSYTTMLSAYINA  357



>ref|XP_001765565.1| predicted protein [Physcomitrella patens]
 gb|EDQ69615.1| predicted protein [Physcomitrella patens]
Length=505

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/139 (27%), Positives = 77/139 (55%), Gaps = 0/139 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G +   V Y+ ++N  G+ G+   A  L+ +M+E GC PN+  YNTL+  +G+ SN+  
Sbjct  336  KGLNADTVTYNILINGLGRAGKLDAAGALLLEMEENGCAPNIITYNTLISSYGKWSNLSA  395

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
              +++ EMK R V P+ VSY+S+I  + KA   ++ +  +++ K  G   +     +++ 
Sbjct  396  ATRLFLEMKERGVAPNVVSYSSLIEGFGKAGRTDAAISLFREMKAEGCPPNHVTYNLLID  455

Query  455  VFSKMNKVDELVKLLQDLK  399
               +  +    ++ L++++
Sbjct  456  CLIRAGRFGAAMEYLREMR  474


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 61/113 (54%), Gaps = 0/113 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            I+ Y+++++ YGK      ATRL  +MKERG  PNV  Y++L++  G+A        +++
Sbjct  377  IITYNTLISSYGKWSNLSAATRLFLEMKERGVAPNVVSYSSLIEGFGKAGRTDAAISLFR  436

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  459
            EMK     P+ V+Y  +I    +A    + ++Y ++ +  G +  +    ++V
Sbjct  437  EMKAEGCPPNHVTYNLLIDCLIRAGRFGAAMEYLREMRDAGCQMGKVTKSLLV  489


 Score = 65.9 bits (159),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/153 (21%), Positives = 80/153 (52%), Gaps = 2/153 (1%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +++++++YG+    ++A + +A   + G  P  + Y++++ +  +  +++    ++K+M 
Sbjct  33   FNTLIHIYGEANMMEKALQTLAAFTKEGGRPTAYTYSSMIQVFMKGGDVQNGLLMYKQML  92

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQD-FKLNGGKTDRAMAGIMVGVFSKMNKV  432
            + K VPD  ++  +I + +KA ++E     + D FKLN    D     I++     + ++
Sbjct  93   KAKFVPDHTTFNILIDSLAKADQVEEACNVFGDMFKLN-VSPDVYTYTILIRSLGTIGRI  151

Query  431  DELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            D ++KL + +     + +   Y S ++A   AG
Sbjct  152  DAVMKLFESMTAQGCQPNLFTYHSVMHAFGSAG  184


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 71/155 (46%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            IV  +++++   K GR + A  L   MK +G   +   YN L++  GRA  +     +  
Sbjct  307  IVTINNVLDCLSKAGRVEAAFELFQDMKFKGLNADTVTYNILINGLGRAGKLDAAGALLL  366

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+     P+ ++Y ++IS+Y K   L +  + + + K  G   +      ++  F K  
Sbjct  367  EMEENGCAPNIITYNTLISSYGKWSNLSAATRLFLEMKERGVAPNVVSYSSLIEGFGKAG  426

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            + D  + L +++K +    +   Y   ++ L  AG
Sbjct  427  RTDAAISLFREMKAEGCPPNHVTYNLLIDCLIRAG  461


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/93 (25%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +  Y+ ++   G  GR     +L   M  +GC+PN++ Y++++   G A  + +   +++
Sbjct  135  VYTYTILIRSLGTIGRIDAVMKLFESMTAQGCQPNLFTYHSVMHAFGSAGRVDEACDIFQ  194

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKY  519
            +M ++ + PD V+Y  +I A+ K  +LE    +
Sbjct  195  QMVQKGLQPDAVTYNILIDAFGKTGQLERAFDF  227


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 80/161 (50%), Gaps = 3/161 (2%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G    +  Y S+++ +G  GR  EA  +  +M ++G +P+   YN L+D  G+     Q
Sbjct  164  QGCQPNLFTYHSVMHAFGSAGRVDEACDIFQQMVQKGLQPDAVTYNILIDAFGKTG---Q  220

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            +E+ +  + + +   + V+Y S++S+  +  +++  ++ +   K  G  ++     I++ 
Sbjct  221  LERAFDFVGKSRSFTNEVTYNSLLSSLGRKGDIQGLMELFGQMKAKGLVSNELTYAILIE  280

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
                  +V+++ +L  ++  ++ K D     + L+ L  AG
Sbjct  281  RLGWAGRVEDVWQLYLEMVDNDIKYDIVTINNVLDCLSKAG  321


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 75/161 (47%), Gaps = 3/161 (2%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G     V Y+ +++ +GKTG+ + A   V K +      N   YN+LL   GR  +++ 
Sbjct  199  KGLQPDAVTYNILIDAFGKTGQLERAFDFVGKSRSF---TNEVTYNSLLSSLGRKGDIQG  255

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            + +++ +MK + +V + ++Y  +I     A  +E   + Y +   N  K D      ++ 
Sbjct  256  LMELFGQMKAKGLVSNELTYAILIERLGWAGRVEDVWQLYLEMVDNDIKYDIVTINNVLD  315

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
              SK  +V+   +L QD+K      D   Y   +N L  AG
Sbjct  316  CLSKAGRVEAAFELFQDMKFKGLNADTVTYNILINGLGRAG  356


 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 64/132 (48%), Gaps = 0/132 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V Y+S+++  G+ G  +    L  +MK +G   N   Y  L++  G A  ++ V +++ E
Sbjct  238  VTYNSLLSSLGRKGDIQGLMELFGQMKAKGLVSNELTYAILIERLGWAGRVEDVWQLYLE  297

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M    +  D V+  +V+   SKA  +E+  + +QD K  G   D     I++    +  K
Sbjct  298  MVDNDIKYDIVTINNVLDCLSKAGRVEAAFELFQDMKFKGLNADTVTYNILINGLGRAGK  357

Query  434  VDELVKLLQDLK  399
            +D    LL +++
Sbjct  358  LDAAGALLLEME  369


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 69/157 (44%), Gaps = 0/157 (0%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            YSSM+ ++ K G  +    +  +M +    P+   +N L+D   +A  +++   V+ +M 
Sbjct  68   YSSMIQVFMKGGDVQNGLLMYKQMLKAKFVPDHTTFNILIDSLAKADQVEEACNVFGDMF  127

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            +  V PD  +YT +I +      +++ +K ++     G + +      ++  F    +VD
Sbjct  128  KLNVSPDVYTYTILIRSLGTIGRIDAVMKLFESMTAQGCQPNLFTYHSVMHAFGSAGRVD  187

Query  428  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  318
            E   + Q +     + D   Y   ++A    G   RA
Sbjct  188  EACDIFQQMVQKGLQPDAVTYNILIDAFGKTGQLERA  224



>ref|XP_009602284.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, 
chloroplastic [Nicotiana tomentosiformis]
Length=676

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 85/157 (54%), Gaps = 0/157 (0%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            M+++YG+    KEA RL   M++ G EPNV  YNTLL ++G A    +   +++ M+R+ 
Sbjct  337  MIDVYGQLDMAKEADRLFWSMRKMGIEPNVVSYNTLLRVYGEAELFGEAIHLFRLMQRKS  396

Query  599  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  420
            +  + V+Y ++I  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D   
Sbjct  397  IEQNVVTYNTMIKIYGKTLEHEKANNLIQEMQNRGIEPNAITYSTIISIWGKVGKLDRAA  456

Query  419  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
             L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  457  MLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  493


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 87/168 (52%), Gaps = 4/168 (2%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG+     EA  L   M+ +  E NV  YNT++ I+G+    ++ 
Sbjct  361  GIEPNVVSYNTLLRVYGEAELFGEAIHLFRLMQRKSIEQNVVTYNTMIKIYGKTLEHEKA  420

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  
Sbjct  421  NNLIQEMQNRGIEPNAITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  480

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  +    E    +A+  L  +G    A W+
Sbjct  481  YERAGLVAHAKRLLHELKRPDNIPRE----TAITILARSGRIEEATWV  524


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y++M+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  395  KSIEQNVVTYNTMIKIYGKTLEHEKANNLIQEMQNRGIEPNAITYSTIISIWGKVGKLDR  454

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D+V Y ++I AY +A
Sbjct  455  AAMLFQKLRSSGVEIDQVLYQTMIVAYERA  484


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/133 (22%), Positives = 70/133 (53%), Gaps = 0/133 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YNT++++ G+A   ++   + K
Sbjct  226  LVLYSNLIELSRKLCDYSKAISIFSRLKTSGITPDLVAYNTMINVFGKAKLFREARLLVK  285

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM    V+PD VSY+++++ Y + ++    +  + +        D     IM+ V+ +++
Sbjct  286  EMMSAGVMPDTVSYSTLLTMYVENQKFLEALSVFSEMNEVKCPLDLTTCNIMIDVYGQLD  345

Query  437  KVDELVKLLQDLK  399
               E  +L   ++
Sbjct  346  MAKEADRLFWSMR  358



>gb|AIU48556.1| tetratricopeptide repeat-like superfamily protein, partial [Aristolochia 
tagala]
Length=470

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 90/155 (58%), Gaps = 0/155 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V+Y+ +++ YGK  R +EA  +  +M + G  P    YN LLD    +  +++ 
Sbjct  269  GVRPDVVSYALLISAYGKARREEEALAVFEEMLDAGVRPTRKAYNILLDAFAVSGMVEEA  328

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             KV+K M+R K  PD  SYT+++SAY  A ++E   K+++  K +G + +    G ++  
Sbjct  329  RKVFKSMRRDKCTPDLCSYTTMLSAYVIASDMEGAEKFFKRLKQDGYEPNVVTYGTLLKG  388

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  348
            ++ +N +++++K+  D++    ++++ ++ + ++A
Sbjct  389  YANINDLEKMMKVYDDMRLQGLEVNQTIFTTIMDA  423


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 78/147 (53%), Gaps = 3/147 (2%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            +  M+ M+ K G +++A  L  +M +RG   +   YN+L+      +N K+V K++ +M+
Sbjct  210  FHMMIYMHKKAGNYEQARMLFTEMSDRGIPQSTVTYNSLMSFE---TNYKEVSKIYDQMQ  266

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R  V PD VSY  +ISAY KA+  E  +  +++    G +  R    I++  F+    V+
Sbjct  267  RAGVRPDVVSYALLISAYGKARREEEALAVFEEMLDAGVRPTRKAYNILLDAFAVSGMVE  326

Query  428  ELVKLLQDLKTDETKLDERLYRSALNA  348
            E  K+ + ++ D+   D   Y + L+A
Sbjct  327  EARKVFKSMRRDKCTPDLCSYTTMLSA  353


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/121 (24%), Positives = 68/121 (56%), Gaps = 4/121 (3%)
 Frame = -2

Query  806  DKC---IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            DKC   + +Y++M++ Y      + A +   ++K+ G EPNV  Y TLL  +   +++++
Sbjct  338  DKCTPDLCSYTTMLSAYVIASDMEGAEKFFKRLKQDGYEPNVVTYGTLLKGYANINDLEK  397

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
            + KV+ +M+ + +  ++  +T+++ A+ K  +  S V +Y + + +G   D+    I++ 
Sbjct  398  MMKVYDDMRLQGLEVNQTIFTTIMDAHGK-NDFGSAVIWYNEMESSGLVPDQKAKNILLS  456

Query  455  V  453
            +
Sbjct  457  L  457



>ref|XP_008442691.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g32630-like [Cucumis melo]
Length=592

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 88/162 (54%), Gaps = 0/162 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG    +V++S ++++YGK     EA RL+ +M+++G  P+V  YNT +  + +   M++
Sbjct  431  RGVAPDVVSFSILIDIYGKEENFAEAKRLLKEMEKKGEVPSVVTYNTFIQRYCKKGKMEE  490

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
              K+  EMK R ++PD  +YTS+++    +  ++  ++ + +    G   +     +M+ 
Sbjct  491  AYKLIDEMKERGLMPDTYTYTSLMNWECASGNVDRALELFNEMPQRGLNRNEVTYTVMIS  550

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
              SK  + DE  KL  ++ T     D+R++ S + +L +AG 
Sbjct  551  GLSKAGRADEAFKLYDEMNTQGIIPDDRIFSSLIASLHEAGF  592


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/143 (21%), Positives = 78/143 (55%), Gaps = 0/143 (0%)
 Frame = -2

Query  806  DKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEK  627
            D  +  Y+ ++  Y +  + +E+ +L  +M ++G EP+V++Y +L++ + +  NMK+   
Sbjct  259  DYNVATYTMLIEWYSRISKIEESEKLFDEMLKKGIEPDVYVYTSLINWNCKFGNMKRAFV  318

Query  626  VWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFS  447
            ++ EM  R++VP+  +Y ++++   KA ++E+      D +  G   ++ +   ++  + 
Sbjct  319  LFDEMTERRLVPNAFTYGALVNGACKAGQMEAAEMMVNDMQSKGVDVNQVIFNTLIDGYC  378

Query  446  KMNKVDELVKLLQDLKTDETKLD  378
                +DE ++L   ++    ++D
Sbjct  379  XKGMIDEALRLQNIMQQKGFEID  401


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 70/155 (45%), Gaps = 0/155 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G D   V ++++++ Y   G   EA RL   M+++G E +V+  N +     R    ++
Sbjct  361  KGVDVNQVIFNTLIDGYCXKGMIDEALRLQNIMQQKGFEIDVFTCNIIASGFCRLDRREE  420

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
              ++   M+ R V PD VS++ +I  Y K +      +  ++ +  G           + 
Sbjct  421  ARRLLLTMEERGVAPDVVSFSILIDIYGKEENFAEAKRLLKEMEKKGEVPSVVTYNTFIQ  480

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALN  351
             + K  K++E  KL+ ++K      D   Y S +N
Sbjct  481  RYCKKGKMEEAYKLIDEMKERGLMPDTYTYTSLMN  515


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/135 (23%), Positives = 65/135 (48%), Gaps = 0/135 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G +  +  Y+S++N   K G  K A  L  +M ER   PN + Y  L++   +A  M+ 
Sbjct  291  KGIEPDVYVYTSLINWNCKFGNMKRAFVLFDEMTERRLVPNAFTYGALVNGACKAGQMEA  350

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             E +  +M+ + V  ++V + ++I  Y     ++  ++     +  G + D     I+  
Sbjct  351  AEMMVNDMQSKGVDVNQVIFNTLIDGYCXKGMIDEALRLQNIMQQKGFEIDVFTCNIIAS  410

Query  455  VFSKMNKVDELVKLL  411
             F ++++ +E  +LL
Sbjct  411  GFCRLDRREEARRLL  425



>gb|KDO54847.1| hypothetical protein CISIN_1g004758mg [Citrus sinensis]
Length=487

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 6/172 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G    +  Y+S++N   K GR   A  ++ +M + G  P+   YNTLL    R  NM +
Sbjct  59   KGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSE  118

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
             E+++ EM RR V PD VS++++I  +S+  +L+  + Y+++ K  G   D  +  I++ 
Sbjct  119  AEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIIN  178

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQES  300
             + +   V E +K+  ++      +D   Y + LN L       RAK L E+
Sbjct  179  GYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGL------CRAKMLTEA  224


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/128 (26%), Positives = 62/128 (48%), Gaps = 0/128 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V Y++++N   +     EA  L  +M ERG  P+ + + TL+  H +  NM +   ++ 
Sbjct  205  VVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFD  264

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
             M ++ + PD V+Y ++I  + K  E+E   K + D        +    GI++  +  M 
Sbjct  265  IMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMG  324

Query  437  KVDELVKL  414
             V E  +L
Sbjct  325  HVTEAFRL  332


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/131 (26%), Positives = 66/131 (50%), Gaps = 0/131 (0%)
 Frame = -2

Query  794  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  615
            V Y+ ++N Y + G   EA ++  +M E+GC  +V  YNT+L+   RA  + + + ++ E
Sbjct  171  VLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNE  230

Query  614  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  435
            M  R V PD  ++T++I  + K   +   +  +        K D      ++  F K+ +
Sbjct  231  MLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGE  290

Query  434  VDELVKLLQDL  402
            +++  KL  D+
Sbjct  291  MEKANKLWADM  301


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/177 (19%), Positives = 79/177 (45%), Gaps = 6/177 (3%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            RG       ++++++ + K G   +A  L   M ++  +P++  YNTL+D   +   M++
Sbjct  234  RGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEK  293

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVG  456
              K+W +M  RK+ P+ +SY  +I+ Y     +    + + +    G K        ++ 
Sbjct  294  ANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIK  353

Query  455  VFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT  285
             + +     +  + L  + ++    D   Y + +N        +R + + ++FA+ +
Sbjct  354  GYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGF------VREENMDKAFALVS  404


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 56/113 (50%), Gaps = 0/113 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G D   ++Y++++N + +     +A  LV+KM+ +G  P+V  YN +L    R   M   
Sbjct  375  GVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDS  434

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAM  474
            E +   M  + + PDR +YT++I+ +     L+   +++ +    G   D A 
Sbjct  435  ELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF  487



>ref|XP_004232248.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, 
chloroplastic [Solanum lycopersicum]
Length=665

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 86/157 (55%), Gaps = 0/157 (0%)
 Frame = -2

Query  779  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  600
            M+++YG+    KEA RL   M++ G EPNV  YNTLL ++G A    +   +++ M+R+ 
Sbjct  328  MIDVYGQLDMAKEADRLFWSMRKMGIEPNVVSYNTLLRVYGEAELFGEAIHLFRLMQRKN  387

Query  599  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  420
            +  + V+Y ++I  Y K  E E      Q+ +  G + +      ++ +++K+ K+D   
Sbjct  388  IEQNVVTYNTMIKIYGKTLEHEKANNLIQEMQNIGIEPNAITYSTIISIWAKVGKLDRAA  447

Query  419  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
             L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  448  MLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  484


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/168 (24%), Positives = 87/168 (52%), Gaps = 4/168 (2%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG+     EA  L   M+ +  E NV  YNT++ I+G+    ++ 
Sbjct  352  GIEPNVVSYNTLLRVYGEAELFGEAIHLFRLMQRKNIEQNVVTYNTMIKIYGKTLEHEKA  411

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+   + P+ ++Y+++IS ++K  +L+     +Q  + +G + D+ +   M+  
Sbjct  412  NNLIQEMQNIGIEPNAITYSTIISIWAKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVA  471

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + +   V    +LL +LK  +    E    +A+  L  +G    A W+
Sbjct  472  YERAGLVAHAKRLLHELKRPDNIPRE----TAITILAGSGRIEEATWV  515


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 55/90 (61%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y++M+ +YGKT  H++A  L+ +M+  G EPN   Y+T++ I  +   + +
Sbjct  386  KNIEQNVVTYNTMIKIYGKTLEHEKANNLIQEMQNIGIEPNAITYSTIISIWAKVGKLDR  445

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D+V Y ++I AY +A
Sbjct  446  AAMLFQKLRSSGVEIDQVLYQTMIVAYERA  475


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 71/133 (53%), Gaps = 0/133 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V Y +++ +  K   + +A  + +++K  G  P++  YNT++++ G+A   ++ + + K
Sbjct  217  LVLYCNLIELSRKLCDYTKAISIFSRLKTSGITPDLVAYNTMINVFGKAKLFREAQLLVK  276

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM+   V+PD VSY+++++ Y + ++    +  + +        D     IM+ V+ +++
Sbjct  277  EMRSVGVLPDTVSYSTLLTMYVENQKFLEALSVFSEMNEVKCPLDLTTCNIMIDVYGQLD  336

Query  437  KVDELVKLLQDLK  399
               E  +L   ++
Sbjct  337  MAKEADRLFWSMR  349



>ref|XP_004156125.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At2g02150-like [Cucumis sativus]
Length=822

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 84/160 (53%), Gaps = 0/160 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +  Y+ M++   K G  + + RL  +M+E G  P+V  YN+L+D +G+  ++++V
Sbjct  225  GIAPSVFTYNVMIDYLCKEGDLENSRRLFVQMREMGLSPDVVTYNSLIDGYGKVGSLEEV  284

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              ++ EMK    VPD ++Y  +I+ Y K +++    +Y+ + K NG K +      ++  
Sbjct  285  ASLFNEMKDVGCVPDIITYNGLINCYCKFEKMPRAFEYFSEMKNNGLKPNVVTYSTLIDA  344

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            F K   +   +KLL D++      +E  Y S ++A   AG
Sbjct  345  FCKEGMMQGAIKLLXDMRRTGLLPNEFTYTSLIDANCKAG  384


 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/166 (28%), Positives = 83/166 (50%), Gaps = 0/166 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V Y+S+++ YGK G  +E   L  +MK+ GC P++  YN L++ + +   M + 
Sbjct  260  GLSPDVVTYNSLIDGYGKVGSLEEVASLFNEMKDVGCVPDIITYNGLINCYCKFEKMPRA  319

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             + + EMK   + P+ V+Y+++I A+ K   ++  +K   D +  G   +      ++  
Sbjct  320  FEYFSEMKNNGLKPNVVTYSTLIDAFCKEGMMQGAIKLLXDMRRTGLLPNEFTYTSLIDA  379

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  315
              K   + E  KLL D+     KL+   Y + L+ L  AG  I A+
Sbjct  380  NCKAGNLTEAWKLLNDMLQAGVKLNIVTYTALLDGLCKAGRMIEAE  425


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 85/177 (48%), Gaps = 6/177 (3%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            I+ Y+ ++N Y K  +   A    ++MK  G +PNV  Y+TL+D   +   M+   K+  
Sbjct  300  IITYNGLINCYCKFEKMPRAFEYFSEMKNNGLKPNVVTYSTLIDAFCKEGMMQGAIKLLX  359

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            +M+R  ++P+  +YTS+I A  KA  L    K   D    G K +      ++    K  
Sbjct  360  DMRRTGLLPNEFTYTSLIDANCKAGNLTEAWKLLNDMLQAGVKLNIVTYTALLDGLCKAG  419

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCN  267
            ++ E  ++ + +  D    ++++Y + ++        I+A+ ++++  +   +  CN
Sbjct  420  RMIEAEEVFRSMLKDGISPNQQVYTALVHGY------IKAERMEDAMKILKQMTECN  470


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 77/153 (50%), Gaps = 0/153 (0%)
 Frame = -2

Query  791  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  612
             Y+S+++   K G   EA +L+  M + G + N+  Y  LLD   +A  M + E+V++ M
Sbjct  372  TYTSLIDANCKAGNLTEAWKLLNDMLQAGVKLNIVTYTALLDGLCKAGRMIEAEEVFRSM  431

Query  611  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  432
             +  + P++  YT+++  Y KA+ +E  +K  +       K D  + G ++       K+
Sbjct  432  LKDGISPNQQVYTALVHGYIKAERMEDAMKILKQMTECNIKPDLILYGSIIWGHCSQRKL  491

Query  431  DELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
            +E   +L+++K+     +  +  + ++A   AG
Sbjct  492  EETKLILEEMKSRGISANPVISTTIIDAYFKAG  524


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/153 (23%), Positives = 79/153 (52%), Gaps = 0/153 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V YS++++ + K G  + A +L+  M+  G  PN + Y +L+D + +A N+ + 
Sbjct  330  GLKPNVVTYSTLIDAFCKEGMMQGAIKLLXDMRRTGLLPNEFTYTSLIDANCKAGNLTEA  389

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             K+  +M +  V  + V+YT+++    KA  +    + ++    +G   ++ +   +V  
Sbjct  390  WKLLNDMLQAGVKLNIVTYTALLDGLCKAGRMIEAEEVFRSMLKDGISPNQQVYTALVHG  449

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSAL  354
            + K  ++++ +K+L+ +     K D  LY S +
Sbjct  450  YIKAERMEDAMKILKQMTECNIKPDLILYGSII  482


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 73/156 (47%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            IV Y+++++   K GR  EA  +   M + G  PN  +Y  L+  + +A  M+   K+ K
Sbjct  405  IVTYTALLDGLCKAGRMIEAEEVFRSMLKDGISPNQQVYTALVHGYIKAERMEDAMKILK  464

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            +M    + PD + Y S+I  +   ++LE      ++ K  G   +  ++  ++  + K  
Sbjct  465  QMTECNIKPDLILYGSIIWGHCSQRKLEETKLILEEMKSRGISANPVISTTIIDAYFKAG  524

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
            K  + +   Q+++    +     Y   ++ L +AG+
Sbjct  525  KSSDALNFFQEMQDVGVEATIVTYCVLIDGLCEAGI  560



>ref|XP_010252754.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic [Nelumbo nucifera]
 ref|XP_010252755.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic [Nelumbo nucifera]
Length=715

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 78/137 (57%), Gaps = 0/137 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V +S+++ +YG +G    A  +  +MK  G +PN+ IYNTLLD  GRA    Q + ++K
Sbjct  296  LVTFSTLIRIYGMSGNFDGALNVYEEMKALGVKPNLVIYNTLLDAMGRAKRPWQAKSLYK  355

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EM  +   P+  +Y +++ AY +A+  E  +  Y++ K  G + +  +   ++ + + + 
Sbjct  356  EMTTKGYSPNWTTYAALLRAYGRARYAEDALNVYREMKEKGLELNVVLYNTLLAMCADLG  415

Query  437  KVDELVKLLQDLKTDET  387
              DE V++ +DLK  +T
Sbjct  416  YTDEAVQIFEDLKRSQT  432


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 76/158 (48%), Gaps = 1/158 (1%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +G+      Y++++  YG+    ++A  +  +MKE+G E NV +YNTLL +        +
Sbjct  360  KGYSPNWTTYAALLRAYGRARYAEDALNVYREMKEKGLELNVVLYNTLLAMCADLGYTDE  419

Query  635  VEKVWKEMKRRKVV-PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  459
              ++++++KR +   PD  +++S+I+ YS   ++             G + +  +   ++
Sbjct  420  AVQIFEDLKRSQTCEPDSWTFSSLITIYSCCGKVSEAEGMLNKMLEAGFEPNIYVLTSLI  479

Query  458  GVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
              + K N+ D++V+    L       D+R     LN +
Sbjct  480  QCYGKANRTDDVVRTFDRLLEMGITPDDRFCGCLLNVM  517


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/146 (24%), Positives = 70/146 (48%), Gaps = 2/146 (1%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMK-ERGCEPNVWIYNTLLDIHGRASNMK  639
            +G +  +V Y++++ M    G   EA ++   +K  + CEP+ W +++L+ I+     + 
Sbjct  395  KGLELNVVLYNTLLAMCADLGYTDEAVQIFEDLKRSQTCEPDSWTFSSLITIYSCCGKVS  454

Query  638  QVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  459
            + E +  +M      P+    TS+I  Y KA   +  V+ +      G   D    G ++
Sbjct  455  EAEGMLNKMLEAGFEPNIYVLTSLIQCYGKANRTDDVVRTFDRLLEMGITPDDRFCGCLL  514

Query  458  GVFSKMNKVDELVKLLQDLKTDETKL  381
             V ++  K +EL KL+  ++   +KL
Sbjct  515  NVMTQTPK-EELGKLIGCIERANSKL  539



>gb|AFV61144.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
pusilla]
Length=381

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 91/168 (54%), Gaps = 3/168 (2%)
 Frame = -2

Query  803  KCIVAYSS---MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            KC++  ++   M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    + 
Sbjct  105  KCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEA  164

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M+R+ +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ +
Sbjct  165  IHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISI  224

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  309
            + K+ K+D    L Q L++   ++D+ L+++ +     AGL   AK L
Sbjct  225  WGKVGKLDRAAMLFQKLRSTGVEIDQILFQTMIVXYERAGLIAHAKRL  272


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 83/161 (52%), Gaps = 6/161 (4%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G +  +V+Y++++ +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++ 
Sbjct  140  GIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKA  199

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              + +EM+ R + P+ ++Y+++IS + K  +L+     +Q  +  G + D+ +   M+  
Sbjct  200  NNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSTGVEIDQILFQTMIVX  259

Query  452  FSKMNKVDELVKLLQDLK-TDETKLDERLYRSALNALRDAG  333
            + +   +    +LL +LK  D    D     +A++ L  AG
Sbjct  260  YERAGLIAHAKRLLHELKRPDNIPRD-----TAIHILAGAG  295


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -2

Query  815  RGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ  636
            +  ++ +V Y+SM+ +YGKT  H++A  L+ +M+ RG EPN   Y+T++ I G+   + +
Sbjct  174  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  233

Query  635  VEKVWKEMKRRKVVPDRVSYTSVISAYSKA  546
               ++++++   V  D++ + ++I  Y +A
Sbjct  234  AAMLFQKLRSTGVEIDQILFQTMIVXYERA  263


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  618
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  5    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  64

Query  617  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  438
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  65   EMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  124

Query  437  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  330
               E  KL   ++    + +   Y + L    DA L
Sbjct  125  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  160



>ref|XP_010227899.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, 
chloroplastic [Brachypodium distachyon]
 ref|XP_010227900.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, 
chloroplastic [Brachypodium distachyon]
 ref|XP_010227901.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, 
chloroplastic [Brachypodium distachyon]
 ref|XP_010227902.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, 
chloroplastic [Brachypodium distachyon]
 ref|XP_010227903.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, 
chloroplastic [Brachypodium distachyon]
 ref|XP_010227904.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, 
chloroplastic [Brachypodium distachyon]
Length=1449

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 81/156 (52%), Gaps = 0/156 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            GF K  + Y++M++MYGK GR   A  L  +M+  GC P+   Y  L+D  G+   +   
Sbjct  399  GFKKDGITYNTMIHMYGKMGRLDLALGLYDEMRALGCTPDAVTYTVLIDSLGKMDRISDA  458

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
             KV +EM    + P  V+++++I AY+K    E  V+ +     +G K DR    +M+ +
Sbjct  459  GKVLEEMADAGLKPTLVTFSALICAYAKGGRREEAVRTFSHMVASGVKPDRLAYLVMLDI  518

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
             ++   + +L+ L Q +  D  + D  LY+  L AL
Sbjct  519  IARSGDMRKLMALYQTMMNDGYRPDNALYQVMLAAL  554


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 78/156 (50%), Gaps = 0/156 (0%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    ++ Y+++++   +     +A  +  +M    C P++W YN ++ +HGR    +  
Sbjct  294  GLRPDVITYNTLISACSQGSNLDDAVAVFEEMMASECRPDLWTYNAMVSVHGRCGKAQDA  353

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
            E++++E+  +   PD V+Y S++ A++K  + ++  +  ++    G K D      M+ +
Sbjct  354  ERMFRELVEKGFKPDAVTYNSLLYAFAKEGDADTVERVCEELVRAGFKKDGITYNTMIHM  413

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  345
            + KM ++D  + L  +++      D   Y   +++L
Sbjct  414  YGKMGRLDLALGLYDEMRALGCTPDAVTYTVLIDSL  449


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/129 (25%), Positives = 72/129 (56%), Gaps = 0/129 (0%)
 Frame = -2

Query  788  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
            Y++MV+++G+ G+ ++A R+  ++ E+G +P+   YN+LL    +  +   VE+V +E+ 
Sbjct  337  YNAMVSVHGRCGKAQDAERMFRELVEKGFKPDAVTYNSLLYAFAKEGDADTVERVCEELV  396

Query  608  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
            R     D ++Y ++I  Y K   L+  +  Y + +  G   D     +++    KM+++ 
Sbjct  397  RAGFKKDGITYNTMIHMYGKMGRLDLALGLYDEMRALGCTPDAVTYTVLIDSLGKMDRIS  456

Query  428  ELVKLLQDL  402
            +  K+L+++
Sbjct  457  DAGKVLEEM  465


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/160 (24%), Positives = 74/160 (46%), Gaps = 4/160 (3%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
            G    +V +S+++  Y K GR +EA R  + M   G +P+   Y  +LDI  R+ +M+++
Sbjct  469  GLKPTLVTFSALICAYAKGGRREEAVRTFSHMVASGVKPDRLAYLVMLDIIARSGDMRKL  528

Query  632  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
              +++ M      PD   Y  +++A +K  E +      QD ++      + ++ I++  
Sbjct  529  MALYQTMMNDGYRPDNALYQVMLAALAKGNEYDEIEAVVQDMEVVCQMNPQLVSSILI--  586

Query  452  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
              K   + +  KLL+       + D +   S L+A    G
Sbjct  587  --KAECISQGAKLLKKACLQGHEPDSKSLLSILDAYETTG  624


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/162 (22%), Positives = 78/162 (48%), Gaps = 2/162 (1%)
 Frame = -2

Query  812  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMK--  639
            G    +  +++M+ +Y ++GR  +  +L+  M+ +  EP++  +NTL++   ++  +   
Sbjct  222  GEGATVQVFNAMMGVYARSGRFDDVRQLLDAMRGQELEPDLVSFNTLINARAKSGCLAPG  281

Query  638  QVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  459
                +  E+++  + PD ++Y ++ISA S+   L+  V  +++   +  + D      MV
Sbjct  282  SAFDLLLEVRQVGLRPDVITYNTLISACSQGSNLDDAVAVFEEMMASECRPDLWTYNAMV  341

Query  458  GVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  333
             V  +  K  +  ++ ++L     K D   Y S L A    G
Sbjct  342  SVHGRCGKAQDAERMFRELVEKGFKPDAVTYNSLLYAFAKEG  383


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/140 (26%), Positives = 64/140 (46%), Gaps = 0/140 (0%)
 Frame = -2

Query  788   YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
             Y  ++ +Y     H +A +L+A MKE G EP +   + L+  +G A +  + EKV   +K
Sbjct  1036  YHMLMKIYRDACNHSKAEQLLASMKEDGIEPTIATMHILMTSYGTAGHPDEAEKVLNSLK  1095

Query  608   RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
                +    + Y++V +AY K  +    +    + K +G K D  +    +   S   +  
Sbjct  1096  SSSLEVSTLPYSTVFNAYLKNGDYNLGITKLLEMKADGVKPDHQVWTCFIRAASLCERTA  1155

Query  428   ELVKLLQDLKTDETKLDERL  369
             + + LL  L+  E  L  RL
Sbjct  1156  DAILLLNSLRDCEFDLPIRL  1175


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/140 (23%), Positives = 70/140 (50%), Gaps = 0/140 (0%)
 Frame = -2

Query  812   GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  633
             GF+  +   ++++ MY   G   +   +   + E G EPN   YNTL+ ++ R    ++ 
Sbjct  923   GFEPDLTILNTLLLMYTGNGNFDKTVEVYHSILEAGLEPNEDTYNTLIVMYSRNLRPEEG  982

Query  632   EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  453
               +  EM ++ + P   SY S+++A  KAK  E   + +++ +  G + +R++  +++ +
Sbjct  983   FTLLNEMGKKGLTPKLESYKSLLAASGKAKLWEQAEQLFEEIRSKGYRLNRSLYHMLMKI  1042

Query  452   FSKMNKVDELVKLLQDLKTD  393
             +       +  +LL  +K D
Sbjct  1043  YRDACNHSKAEQLLASMKED  1062


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/134 (22%), Positives = 69/134 (51%), Gaps = 2/134 (1%)
 Frame = -2

Query  797  IVAYSSMVNMYGKTG--RHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKV  624
            +V++++++N   K+G      A  L+ ++++ G  P+V  YNTL+    + SN+     V
Sbjct  262  LVSFNTLINARAKSGCLAPGSAFDLLLEVRQVGLRPDVITYNTLISACSQGSNLDDAVAV  321

Query  623  WKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSK  444
            ++EM   +  PD  +Y +++S + +  + +   + +++    G K D      ++  F+K
Sbjct  322  FEEMMASECRPDLWTYNAMVSVHGRCGKAQDAERMFRELVEKGFKPDAVTYNSLLYAFAK  381

Query  443  MNKVDELVKLLQDL  402
                D + ++ ++L
Sbjct  382  EGDADTVERVCEEL  395


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 69/147 (47%), Gaps = 0/147 (0%)
 Frame = -2

Query  788   YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  609
             Y++++ MY +  R +E   L+ +M ++G  P +  Y +LL   G+A   +Q E++++E++
Sbjct  966   YNTLIVMYSRNLRPEEGFTLLNEMGKKGLTPKLESYKSLLAASGKAKLWEQAEQLFEEIR  1025

Query  608   RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  429
              +    +R  Y  ++  Y  A       +     K +G +   A   I++  +      D
Sbjct  1026  SKGYRLNRSLYHMLMKIYRDACNHSKAEQLLASMKEDGIEPTIATMHILMTSYGTAGHPD  1085

Query  428   ELVKLLQDLKTDETKLDERLYRSALNA  348
             E  K+L  LK+   ++    Y +  NA
Sbjct  1086  EAEKVLNSLKSSSLEVSTLPYSTVFNA  1112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1659957175625