BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF040L11

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794987.1|  PREDICTED: mitochondrial chaperone BCS1-like       158   7e-42   Nicotiana sylvestris
ref|XP_009596448.1|  PREDICTED: mitochondrial chaperone BCS1-like       154   1e-40   Nicotiana tomentosiformis
ref|XP_004230008.1|  PREDICTED: probable mitochondrial chaperone ...    145   2e-37   Solanum lycopersicum
ref|XP_011093096.1|  PREDICTED: probable mitochondrial chaperone ...    140   2e-35   Sesamum indicum [beniseed]
ref|XP_011094241.1|  PREDICTED: probable mitochondrial chaperone ...    139   4e-35   Sesamum indicum [beniseed]
ref|XP_010267472.1|  PREDICTED: mitochondrial chaperone BCS1-like       139   5e-35   Nelumbo nucifera [Indian lotus]
emb|CBI38680.3|  unnamed protein product                                135   5e-34   Vitis vinifera
ref|XP_002262724.1|  PREDICTED: probable mitochondrial chaperone ...    135   9e-34   Vitis vinifera
ref|XP_010252452.1|  PREDICTED: probable mitochondrial chaperone ...    129   2e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010054126.1|  PREDICTED: probable mitochondrial chaperone ...    128   3e-31   Eucalyptus grandis [rose gum]
gb|EYU38871.1|  hypothetical protein MIMGU_mgv1a005433mg                128   5e-31   Erythranthe guttata [common monkey flower]
ref|XP_002320886.1|  AAA-type ATPase family protein                     127   8e-31   Populus trichocarpa [western balsam poplar]
gb|KDP28443.1|  hypothetical protein JCGZ_14214                         126   9e-31   Jatropha curcas
gb|KJB09610.1|  hypothetical protein B456_001G152500                    127   1e-30   Gossypium raimondii
ref|XP_011038785.1|  PREDICTED: probable mitochondrial chaperone ...    127   1e-30   Populus euphratica
ref|XP_008234685.1|  PREDICTED: probable mitochondrial chaperone ...    127   1e-30   Prunus mume [ume]
gb|AAD20172.1|  hypothetical protein                                    125   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002301424.2|  AAA-type ATPase family protein                     125   3e-30   
ref|NP_182185.2|  P-loop containing nucleoside triphosphate hydro...    125   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882079.1|  hypothetical protein ARALYDRAFT_346472             124   5e-30   
ref|XP_006397194.1|  hypothetical protein EUTSA_v10028615mg             125   5e-30   Eutrema salsugineum [saltwater cress]
ref|XP_004155177.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    125   5e-30   
ref|XP_004133798.1|  PREDICTED: ATP-dependent zinc metalloproteas...    125   5e-30   Cucumis sativus [cucumbers]
ref|XP_002533329.1|  ATP binding protein, putative                      125   6e-30   Ricinus communis
ref|XP_008437854.1|  PREDICTED: ATP-dependent zinc metalloproteas...    125   6e-30   Cucumis melo [Oriental melon]
ref|XP_007039156.1|  P-loop containing nucleoside triphosphate hy...    125   6e-30   
emb|CDY41542.1|  BnaC04g00800D                                          124   6e-30   Brassica napus [oilseed rape]
ref|XP_002515676.1|  ATP binding protein, putative                      124   8e-30   Ricinus communis
ref|XP_006294099.1|  hypothetical protein CARUB_v10023091mg             124   9e-30   Capsella rubella
ref|XP_010518339.1|  PREDICTED: probable mitochondrial chaperone ...    124   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010559141.1|  PREDICTED: probable mitochondrial chaperone ...    124   1e-29   Tarenaya hassleriana [spider flower]
gb|AAV92898.1|  Avr9/Cf-9 rapidly elicited protein 102                  121   1e-29   Nicotiana tabacum [American tobacco]
ref|XP_011023131.1|  PREDICTED: putative cell division cycle ATPase     123   2e-29   Populus euphratica
ref|XP_010506675.1|  PREDICTED: probable mitochondrial chaperone ...    123   2e-29   Camelina sativa [gold-of-pleasure]
gb|KFK37429.1|  hypothetical protein AALP_AA4G255900                    123   2e-29   Arabis alpina [alpine rockcress]
ref|XP_006444778.1|  hypothetical protein CICLE_v10019936mg             122   3e-29   Citrus clementina [clementine]
ref|XP_010507993.1|  PREDICTED: 26S protease regulatory subunit 8...    122   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_009588603.1|  PREDICTED: mitochondrial chaperone BCS1-like       122   4e-29   Nicotiana tomentosiformis
ref|XP_007051474.1|  P-loop containing nucleoside triphosphate hy...    121   1e-28   
gb|AFP55581.1|  ATP binding protein                                     121   1e-28   Rosa rugosa [Japanese rose]
ref|XP_010544865.1|  PREDICTED: probable mitochondrial chaperone ...    120   1e-28   Tarenaya hassleriana [spider flower]
ref|XP_004306636.1|  PREDICTED: uncharacterized protein LOC101302781    120   2e-28   Fragaria vesca subsp. vesca
ref|XP_009761416.1|  PREDICTED: mitochondrial chaperone BCS1-like       120   2e-28   Nicotiana sylvestris
ref|XP_007136478.1|  hypothetical protein PHAVU_009G048600g             120   3e-28   Phaseolus vulgaris [French bean]
ref|XP_009142622.1|  PREDICTED: mitochondrial chaperone BCS1            119   5e-28   Brassica rapa
ref|XP_006350498.1|  PREDICTED: mitochondrial chaperone BCS1-like       119   7e-28   Solanum tuberosum [potatoes]
ref|XP_009116854.1|  PREDICTED: probable mitochondrial chaperone ...    119   8e-28   Brassica rapa
ref|XP_008381389.1|  PREDICTED: mitochondrial chaperone BCS1-like       119   8e-28   
emb|CDX71701.1|  BnaC08g31730D                                          119   9e-28   
ref|XP_003523343.1|  PREDICTED: mitochondrial chaperone BCS1-like...    118   9e-28   Glycine max [soybeans]
ref|XP_004234999.1|  PREDICTED: mitochondrial chaperone BCS1-like       118   1e-27   Solanum lycopersicum
ref|XP_010100693.1|  putative mitochondrial chaperone bcs1              118   1e-27   Morus notabilis
gb|KDP30317.1|  hypothetical protein JCGZ_18154                         117   2e-27   Jatropha curcas
ref|XP_004510634.1|  PREDICTED: uncharacterized protein LOC101511087    117   3e-27   Cicer arietinum [garbanzo]
gb|EPS72484.1|  hypothetical protein M569_02272                         117   3e-27   Genlisea aurea
gb|KJB24545.1|  hypothetical protein B456_004G150200                    117   3e-27   Gossypium raimondii
ref|XP_004502706.1|  PREDICTED: mitochondrial chaperone BCS1-like       117   4e-27   Cicer arietinum [garbanzo]
emb|CDY57874.1|  BnaA09g55560D                                          118   6e-27   Brassica napus [oilseed rape]
ref|XP_009361315.1|  PREDICTED: probable mitochondrial chaperone ...    116   6e-27   Pyrus x bretschneideri [bai li]
ref|XP_010109213.1|  putative mitochondrial chaperone bcs1              116   6e-27   Morus notabilis
ref|XP_003527995.2|  PREDICTED: mitochondrial chaperone BCS1-like       116   7e-27   Glycine max [soybeans]
gb|KJB41595.1|  hypothetical protein B456_007G110900                    116   7e-27   Gossypium raimondii
gb|KHN23332.1|  Putative mitochondrial chaperone bcs1                   115   8e-27   Glycine soja [wild soybean]
ref|XP_006339806.1|  PREDICTED: mitochondrial chaperone BCS1-like       115   9e-27   
ref|XP_009351948.1|  PREDICTED: probable mitochondrial chaperone ...    115   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_009351947.1|  PREDICTED: probable mitochondrial chaperone ...    115   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_004307905.1|  PREDICTED: cell division control protein 48-...    115   1e-26   Fragaria vesca subsp. vesca
ref|XP_008376774.1|  PREDICTED: probable mitochondrial chaperone ...    115   2e-26   Malus domestica [apple tree]
ref|XP_003520880.1|  PREDICTED: uncharacterized protein LOC100776680    114   2e-26   Glycine max [soybeans]
emb|CDX80032.1|  BnaA05g01240D                                          116   3e-26   
ref|XP_008376180.1|  PREDICTED: mitochondrial chaperone BCS1            114   3e-26   Malus domestica [apple tree]
gb|AET02010.2|  P-loop nucleoside triphosphate hydrolase superfam...    113   6e-26   Medicago truncatula
ref|XP_009334380.1|  PREDICTED: 26S protease regulatory subunit 8...    113   8e-26   Pyrus x bretschneideri [bai li]
ref|XP_003627534.1|  Cell division cycle protein-like protein           113   8e-26   
ref|XP_003553796.1|  PREDICTED: mitochondrial chaperone BCS1-like       112   1e-25   Glycine max [soybeans]
gb|AES72562.2|  P-loop nucleoside triphosphate hydrolase superfam...    112   2e-25   Medicago truncatula
emb|CDP05017.1|  unnamed protein product                                111   3e-25   Coffea canephora [robusta coffee]
ref|XP_003602311.1|  Mitochondrial chaperone BCS1                       112   3e-25   
ref|XP_007147339.1|  hypothetical protein PHAVU_006G115600g             111   4e-25   Phaseolus vulgaris [French bean]
ref|XP_007217940.1|  hypothetical protein PRUPE_ppa005000mg             111   5e-25   Prunus persica
gb|KJB19872.1|  hypothetical protein B456_003G122600                    110   6e-25   Gossypium raimondii
ref|XP_003626582.1|  Mitochondrial chaperone BCS1                       110   7e-25   Medicago truncatula
ref|XP_011084544.1|  PREDICTED: mitochondrial chaperone BCS1-like       110   7e-25   Sesamum indicum [beniseed]
ref|XP_010662911.1|  PREDICTED: 26S protease regulatory subunit 6...    110   9e-25   Vitis vinifera
ref|XP_009375440.1|  PREDICTED: mitochondrial chaperone BCS1-like       109   2e-24   Pyrus x bretschneideri [bai li]
gb|KCW46602.1|  hypothetical protein EUGRSUZ_K00412                     108   2e-24   Eucalyptus grandis [rose gum]
ref|XP_008233091.1|  PREDICTED: mitochondrial chaperone BCS1            109   2e-24   Prunus mume [ume]
ref|XP_008362649.1|  PREDICTED: mitochondrial chaperone BCS1-like       109   2e-24   
emb|CBI23057.3|  unnamed protein product                                110   5e-24   Vitis vinifera
ref|XP_010035300.1|  PREDICTED: uncharacterized protein LOC104424536    108   6e-24   Eucalyptus grandis [rose gum]
ref|XP_009382317.1|  PREDICTED: uncharacterized protein LOC103970312    105   6e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007221060.1|  hypothetical protein PRUPE_ppa016223mg             104   8e-23   
gb|EYU19673.1|  hypothetical protein MIMGU_mgv1a027053mg                103   3e-22   Erythranthe guttata [common monkey flower]
ref|XP_003529879.1|  PREDICTED: cell division cycle protein 48 ho...    103   4e-22   Glycine max [soybeans]
ref|XP_010693170.1|  PREDICTED: probable mitochondrial chaperone ...    102   4e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008437620.1|  PREDICTED: mitochondrial chaperone BCS1-like       102   5e-22   Cucumis melo [Oriental melon]
ref|XP_010919325.1|  PREDICTED: uncharacterized protein LOC105043468    102   6e-22   Elaeis guineensis
ref|XP_010933795.1|  PREDICTED: probable mitochondrial chaperone ...    102   9e-22   Elaeis guineensis
ref|XP_008803962.1|  PREDICTED: uncharacterized protein LOC103717381    101   2e-21   
ref|XP_002321380.2|  hypothetical protein POPTR_0015s01020g             101   2e-21   
ref|XP_002318453.2|  hypothetical protein POPTR_0012s02770g             100   3e-21   
ref|XP_011075926.1|  PREDICTED: uncharacterized protein LOC105160305    100   3e-21   Sesamum indicum [beniseed]
gb|KDO59683.1|  hypothetical protein CISIN_1g044297mg                 99.8    5e-21   Citrus sinensis [apfelsine]
ref|XP_011043686.1|  PREDICTED: ATP-dependent zinc metalloproteas...    100   5e-21   Populus euphratica
ref|XP_004160408.1|  PREDICTED: mitochondrial chaperone BCS1-like     99.8    8e-21   
ref|XP_004145938.1|  PREDICTED: uncharacterized protein LOC101204309  99.8    1e-20   
gb|KGN49849.1|  hypothetical protein Csa_5G139270                     99.4    1e-20   Cucumis sativus [cucumbers]
ref|XP_006441187.1|  hypothetical protein CICLE_v10023517mg           99.0    1e-20   Citrus clementina [clementine]
ref|XP_008790554.1|  PREDICTED: nuclear valosin-containing protei...  99.4    1e-20   Phoenix dactylifera
gb|KHN35399.1|  Putative mitochondrial chaperone bcs1                 97.8    1e-20   Glycine soja [wild soybean]
ref|XP_006491957.1|  PREDICTED: mitochondrial chaperone BCS1-like     99.0    1e-20   Citrus sinensis [apfelsine]
ref|XP_006849190.1|  hypothetical protein AMTR_s00027p00211720        98.6    1e-20   
ref|XP_011044701.1|  PREDICTED: uncharacterized protein LOC105139793  98.6    2e-20   Populus euphratica
ref|XP_009411477.1|  PREDICTED: uncharacterized protein LOC103993224  97.8    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007135287.1|  hypothetical protein PHAVU_010G116600g           97.4    5e-20   Phaseolus vulgaris [French bean]
gb|KHN19527.1|  Mitochondrial chaperone BCS1                          93.6    1e-19   Glycine soja [wild soybean]
ref|XP_009775982.1|  PREDICTED: uncharacterized protein LOC104225813  96.7    1e-19   Nicotiana sylvestris
ref|XP_006367360.1|  PREDICTED: uncharacterized protein LOC102582634  95.9    2e-19   Solanum tuberosum [potatoes]
ref|XP_010322229.1|  PREDICTED: uncharacterized protein LOC101262523  95.1    3e-19   Solanum lycopersicum
ref|XP_008664748.1|  PREDICTED: transitional endoplasmic reticulu...  94.0    1e-18   Zea mays [maize]
ref|XP_006649262.1|  PREDICTED: uncharacterized protein LOC102709999  93.2    2e-18   
gb|ABR16249.1|  unknown                                               92.8    3e-18   Picea sitchensis
gb|EPS71797.1|  hypothetical protein M569_02959                       90.9    7e-18   Genlisea aurea
dbj|BAJ87142.1|  predicted protein                                    91.3    7e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002464362.1|  hypothetical protein SORBIDRAFT_01g016970        89.7    3e-17   Sorghum bicolor [broomcorn]
ref|XP_004982590.1|  PREDICTED: uncharacterized protein LOC101755261  89.4    4e-17   Setaria italica
ref|XP_009599055.1|  PREDICTED: uncharacterized protein LOC104094765  88.6    6e-17   Nicotiana tomentosiformis
gb|EAY88267.1|  hypothetical protein OsI_09720                        88.2    1e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001048744.1|  Os03g0114400                                     88.2    1e-16   
gb|EAZ25345.1|  hypothetical protein OsJ_09159                        88.2    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008644692.1|  PREDICTED: ATP-dependent zinc metalloproteas...  87.8    1e-16   Zea mays [maize]
ref|XP_004986004.1|  PREDICTED: uncharacterized protein LOC101775542  87.4    2e-16   Setaria italica
ref|XP_010671395.1|  PREDICTED: uncharacterized protein LOC104888200  86.7    3e-16   
ref|XP_003574206.1|  PREDICTED: uncharacterized protein LOC100834121  85.9    6e-16   Brachypodium distachyon [annual false brome]
ref|XP_002465991.1|  hypothetical protein SORBIDRAFT_01g049680        85.1    1e-15   Sorghum bicolor [broomcorn]
gb|EEE51276.1|  hypothetical protein OsJ_32176                        84.7    1e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EAY79221.1|  hypothetical protein OsI_34338                        85.1    1e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001065078.2|  Os10g0519300                                     84.7    1e-15   
ref|NP_001150338.1|  ATP binding protein                              82.8    6e-15   Zea mays [maize]
gb|KHN06336.1|  Putative mitochondrial chaperone bcs1                 78.6    5e-14   Glycine soja [wild soybean]
ref|XP_009391570.1|  PREDICTED: mitochondrial chaperone BCS1-like     79.7    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003562201.1|  PREDICTED: uncharacterized protein LOC100825790  72.0    2e-11   Brachypodium distachyon [annual false brome]
ref|XP_001782247.1|  predicted protein                                59.7    2e-07   
ref|XP_010257525.1|  PREDICTED: uncharacterized protein LOC104597594  57.8    1e-06   Nelumbo nucifera [Indian lotus]
emb|CBI32158.3|  unnamed protein product                              57.0    2e-06   Vitis vinifera
ref|XP_002267624.1|  PREDICTED: uncharacterized protein LOC100263212  57.0    2e-06   Vitis vinifera
ref|XP_001781345.1|  predicted protein                                55.8    5e-06   
gb|ABK27085.1|  unknown                                               55.1    8e-06   Picea sitchensis
gb|AFG50104.1|  hypothetical protein 0_5015_01                        52.8    1e-05   Pinus taeda
gb|AFG50105.1|  hypothetical protein 0_5015_01                        52.8    1e-05   Pinus taeda
ref|XP_001768974.1|  predicted protein                                54.7    1e-05   
gb|KDP20377.1|  hypothetical protein JCGZ_05260                       54.7    1e-05   Jatropha curcas
ref|XP_002512196.1|  ATP binding protein, putative                    54.3    2e-05   Ricinus communis
ref|XP_009617194.1|  PREDICTED: ATPase family gene 2 protein-like     54.3    2e-05   Nicotiana tomentosiformis
ref|XP_009791983.1|  PREDICTED: ATPase family gene 2 protein-like     54.3    2e-05   Nicotiana sylvestris
ref|XP_006359141.1|  PREDICTED: putative cell division cycle ATPa...  54.3    2e-05   Solanum tuberosum [potatoes]
ref|XP_004229339.1|  PREDICTED: putative cell division cycle ATPase   53.9    2e-05   Solanum lycopersicum
ref|XP_010243399.1|  PREDICTED: ATPase family gene 2 protein-like     53.9    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_006387712.1|  hypothetical protein POPTR_0650s00220g           52.8    3e-05   
ref|XP_001780786.1|  predicted protein                                52.4    4e-05   
ref|XP_007149116.1|  hypothetical protein PHAVU_005G042400g           53.1    5e-05   Phaseolus vulgaris [French bean]
ref|XP_003531459.1|  PREDICTED: uncharacterized protein LOC100783574  52.8    6e-05   Glycine max [soybeans]
ref|XP_007014067.1|  ATP binding protein, putative                    52.0    1e-04   Theobroma cacao [chocolate]
ref|XP_002313465.2|  hypothetical protein POPTR_0009s02930g           52.0    1e-04   
gb|ADE76156.1|  unknown                                               51.6    1e-04   Picea sitchensis
ref|XP_011093400.1|  PREDICTED: mitochondrial chaperone BCS1-like     51.6    2e-04   Sesamum indicum [beniseed]
ref|XP_006439008.1|  hypothetical protein CICLE_v10031208mg           51.2    2e-04   Citrus clementina [clementine]
ref|XP_008231398.1|  PREDICTED: uncharacterized protein LOC103330578  51.2    2e-04   Prunus mume [ume]
ref|XP_006482802.1|  PREDICTED: uncharacterized protein LOC102622284  51.2    2e-04   
ref|XP_006849577.1|  hypothetical protein AMTR_s00024p00191310        50.4    4e-04   
ref|XP_006662517.1|  PREDICTED: probable mitochondrial chaperone ...  50.1    4e-04   
ref|XP_007218964.1|  hypothetical protein PRUPE_ppa003630mg           50.1    5e-04   Prunus persica
ref|XP_009365053.1|  PREDICTED: uncharacterized protein LOC103954926  49.7    7e-04   Pyrus x bretschneideri [bai li]



>ref|XP_009794987.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana sylvestris]
Length=492

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 103/155 (66%), Gaps = 6/155 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DFNSF+ LAN+YLGVK   LFP V  IFQ+GAT+SPA  GELM+V
Sbjct  338  LRPGRIDVHIHFPLCDFNSFRSLANNYLGVKEHKLFPQVEEIFQSGATMSPAAIGELMMV  397

Query  438  XRSXPSRAXKTVIXALXTDGRPG---GRWRRLTEXXXLXTPPRPI---SADEQGCAPXKD  277
             RS PSRA K+VI AL ++G  G   GR +RL++       P P     A+E G    KD
Sbjct  398  NRSSPSRALKSVITALQSNGTEGKIAGRGKRLSDSASSPALPFPSPSPQAEETGGVNWKD  457

Query  276  TVPVAXEFRKLXGLLRMKSAXRFEPLDXDLESIQR  172
            +VPVA EFRKL GLLRMKS  + +  D D E I+R
Sbjct  458  SVPVAKEFRKLYGLLRMKSCKKPDSFDQDSEMIER  492



>ref|XP_009596448.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana tomentosiformis]
Length=492

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 102/155 (66%), Gaps = 6/155 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DFNSF+ LAN+YLGVK   LFP V  IFQ+GAT+SPA  GELM+V
Sbjct  338  LRPGRIDVHIHFPLCDFNSFRSLANNYLGVKEHKLFPQVEEIFQSGATMSPAAIGELMMV  397

Query  438  XRSXPSRAXKTVIXALXTDGRPG---GRWRRLTEXXXLXTPPRPI---SADEQGCAPXKD  277
             RS PSRA K+VI AL ++G  G   GR +RL++       P P     A+E G    KD
Sbjct  398  NRSSPSRALKSVITALQSNGTEGKVAGRGKRLSDSASSPGLPFPSPSPQAEETGGVNWKD  457

Query  276  TVPVAXEFRKLXGLLRMKSAXRFEPLDXDLESIQR  172
            +VPVA EFRKL GLLR+KS  +    D D E I+R
Sbjct  458  SVPVAKEFRKLYGLLRLKSCKKPGSFDHDSEMIER  492



>ref|XP_004230008.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Solanum lycopersicum]
Length=491

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 100/155 (65%), Gaps = 8/155 (5%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FP  DFNSFK LAN+YLGVK   LFP V  IF +GAT+SPA  GELM+V
Sbjct  339  LRPGRIDVHIHFPYCDFNSFKYLANNYLGVKEHKLFPQVEEIFHSGATMSPAAIGELMIV  398

Query  438  XRSXPSRAXKTVIXALX---TDGRPGGRWRRLTEXXXLXTPPR---PISADEQGCAPXKD  277
             RS PSRA K+VI AL    T+G+ GG+ +RL++     +P R   P  A+E G A  KD
Sbjct  399  NRSSPSRAMKSVITALQSSGTEGKIGGKGKRLSDSA--SSPLRLEPPPHAEETGGANWKD  456

Query  276  TVPVAXEFRKLXGLLRMKSAXRFEPLDXDLESIQR  172
            +VP A E RKL GLLR+KS       D D   I+R
Sbjct  457  SVPGAKEVRKLYGLLRLKSCKSPSSFDHDPGMIER  491



>ref|XP_011093096.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Sesamum indicum]
Length=468

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 98/153 (64%), Gaps = 12/153 (8%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR D+ I FP+ DFNSFK LAN+YLGVK   LFP V  I Q+GA +SPAE  ELMLV
Sbjct  324  LRPGRIDMHIHFPMCDFNSFKNLANNYLGVKEHKLFPQVEEIIQSGARMSPAEISELMLV  383

Query  438  XRSXPSRAXKTVIXALXTD----GRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTV  271
             RS PSRA K+VI AL ++    G+ GG   R++E     T P P  ++E G    K+TV
Sbjct  384  NRSSPSRALKSVISALQSNSKHVGKVGG---RMSE----STAPSPAMSEESGGVDWKETV  436

Query  270  PVAXEFRKLXGLLRMKSAXRFEPLDXDLESIQR  172
             V  EFRKL GLLR+KS  R   LD D E  +R
Sbjct  437  -VPKEFRKLYGLLRLKSCRRAGSLDHDSEISER  468



>ref|XP_011094241.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Sesamum indicum]
Length=478

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 98/150 (65%), Gaps = 4/150 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FP+ DFNSFK LA++YLGVK   LFP V  +FQ+GAT+SPAE  ELMLV
Sbjct  332  LRPGRIDVHIYFPMCDFNSFKSLASNYLGVKEHKLFPQVEEMFQSGATMSPAEISELMLV  391

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPIS-ADEQGCAPXKDTVPVA  262
             RS PSRA K+VI AL    R  G+   +     + +PP P S A++ G    K+T+P  
Sbjct  392  NRSSPSRALKSVISALQLSSRTAGKVVPMVCESAV-SPPTPRSMAEDAGGTAWKETMP--  448

Query  261  XEFRKLXGLLRMKSAXRFEPLDXDLESIQR  172
             EFRKL GLLR+KS  R   +D D E I+R
Sbjct  449  KEFRKLYGLLRLKSCKRPVSIDDDCEMIER  478



>ref|XP_010267472.1| PREDICTED: mitochondrial chaperone BCS1-like [Nelumbo nucifera]
Length=485

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 93/140 (66%), Gaps = 8/140 (6%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LANSYLG+K   LFP V  IFQ GATLSPAE GE+M+V
Sbjct  335  LRPGRIDVHIYFPLCDFSAFKTLANSYLGLKDHKLFPQVEEIFQGGATLSPAEIGEIMIV  394

Query  438  XRSXPSRAXKTVIXALXTDGRP-GGRW---RRLTEXXXLXTPPRPISADEQGCAPXKDTV  271
             RS PSRA K+VI AL T+G   GG     RRL+E   +   P    ADE G    +++V
Sbjct  395  NRSSPSRALKSVITALQTNGEGRGGSMKVGRRLSENASVNGRP----ADESGGVICRESV  450

Query  270  PVAXEFRKLXGLLRMKSAXR  211
                EFRKL GLLR+KS+ +
Sbjct  451  HTVREFRKLYGLLRIKSSRK  470



>emb|CBI38680.3| unnamed protein product [Vitis vinifera]
Length=387

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 96/154 (62%), Gaps = 10/154 (6%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR D+ I FPL DFN+FK LANSYLGVK   LFP +  IFQ+GATLSPAE GE+M+V
Sbjct  239  LRPGRVDLHIYFPLCDFNAFKTLANSYLGVKDHKLFPQLEEIFQSGATLSPAEIGEIMIV  298

Query  438  XRSXPSRAXKTVIXALXTDG---RPGGRWRRLTEXXXLXTPPRPI--SADEQGCAPXKDT  274
             RS PSRA K+VI AL  +G    P    +R  +      PPRP+  + D+ G    +++
Sbjct  299  NRSSPSRALKSVITALQINGDSRSPAKIGQRSAD-----KPPRPVEEAGDQGGGFLCRES  353

Query  273  VPVAXEFRKLXGLLRMKSAXRFEPLDXDLESIQR  172
            V    EFRKL G LR+KS+ +    D D    +R
Sbjct  354  VHTVREFRKLYGFLRLKSSRKSGSFDLDSNQNER  387



>ref|XP_002262724.1| PREDICTED: probable mitochondrial chaperone bcs1 [Vitis vinifera]
Length=462

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 96/154 (62%), Gaps = 10/154 (6%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR D+ I FPL DFN+FK LANSYLGVK   LFP +  IFQ+GATLSPAE GE+M+V
Sbjct  314  LRPGRVDLHIYFPLCDFNAFKTLANSYLGVKDHKLFPQLEEIFQSGATLSPAEIGEIMIV  373

Query  438  XRSXPSRAXKTVIXALXTDG---RPGGRWRRLTEXXXLXTPPRPI--SADEQGCAPXKDT  274
             RS PSRA K+VI AL  +G    P    +R  +      PPRP+  + D+ G    +++
Sbjct  374  NRSSPSRALKSVITALQINGDSRSPAKIGQRSAD-----KPPRPVEEAGDQGGGFLCRES  428

Query  273  VPVAXEFRKLXGLLRMKSAXRFEPLDXDLESIQR  172
            V    EFRKL G LR+KS+ +    D D    +R
Sbjct  429  VHTVREFRKLYGFLRLKSSRKSGSFDLDSNQNER  462



>ref|XP_010252452.1| PREDICTED: probable mitochondrial chaperone bcs1 [Nelumbo nucifera]
Length=486

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 93/145 (64%), Gaps = 4/145 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LANSYLG+K   LFP V  IFQ GATLSPAE GE+M+V
Sbjct  334  LRPGRIDVHIHFPLCDFSAFKTLANSYLGLKDHKLFPQVEEIFQGGATLSPAEIGEIMIV  393

Query  438  XRSXPSRAXKTVIXALXT--DGRPGGRW-RRLTEXXXLXTPPRPISA-DEQGCAPXKDTV  271
             RS PSRA K+V+ AL T  DG+  G+  ++L+E   +    + +    E G    +++V
Sbjct  394  NRSSPSRALKSVMTALQTNSDGKGYGKIGQQLSESRSVNGRIQSVDELGESGGVICRESV  453

Query  270  PVAXEFRKLXGLLRMKSAXRFEPLD  196
                EFR L G LR+KS+ +  P D
Sbjct  454  HTVREFRNLYGFLRLKSSRKSGPFD  478



>ref|XP_010054126.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
 gb|KCW78500.1| hypothetical protein EUGRSUZ_D02641 [Eucalyptus grandis]
Length=472

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 88/143 (62%), Gaps = 4/143 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV I FPL DF++FK LANSYLGVK   LFP V  IFQ GA+LSPAE GELM+ 
Sbjct  331  MRPGRVDVHIHFPLCDFSAFKNLANSYLGVKDHKLFPQVEEIFQGGASLSPAEIGELMIA  390

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ PSRA K+VI AL TDG      RRL+        P   SAD  G    KD+  +  
Sbjct  391  NRNSPSRALKSVITALQTDGSAAKIGRRLSHDG--LRKPGDESADSSGVF-LKDSNAMK-  446

Query  258  EFRKLXGLLRMKSAXRFEPLDXD  190
            + RKL GLLRMKS  +    D D
Sbjct  447  DLRKLYGLLRMKSTRKTPSFDED  469



>gb|EYU38871.1| hypothetical protein MIMGU_mgv1a005433mg [Erythranthe guttata]
Length=484

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 96/153 (63%), Gaps = 7/153 (5%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR D+ I FP+ DFNSFK LAN+YLGVK   LF  V  IFQ+GAT+SPAE  ELMLV
Sbjct  335  LRPGRIDMHIHFPMCDFNSFKNLANNYLGVKEHKLFTQVEGIFQSGATMSPAEISELMLV  394

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWR---RLTEXXXLXTPPRPISADEQGCAPXKDTVP  268
             RS PSRA KTVI AL ++ R GG  +   R ++       P  +S +  G A  K+ VP
Sbjct  395  NRSSPSRALKTVISALQSNSRNGGGGKVAARASDSTASSPAPGSVSEEGGGGA-WKEAVP  453

Query  267  VAXEFRKLXGLLRMKSAXRFEPLD-XDLESIQR  172
               EFRKL GLLR+KS      LD  D E IQR
Sbjct  454  --KEFRKLYGLLRLKSCRTPGSLDQHDSEMIQR  484



>ref|XP_002320886.1| AAA-type ATPase family protein [Populus trichocarpa]
 gb|EEE99201.1| AAA-type ATPase family protein [Populus trichocarpa]
Length=488

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 81/141 (57%), Gaps = 0/141 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LANSYLGVK   LFP V  IF TGA+LSPAE GELML 
Sbjct  335  LRPGRIDVHIHFPLCDFAAFKTLANSYLGVKDHKLFPQVEEIFLTGASLSPAEIGELMLA  394

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ PSRA K+VI AL TDG   G      +     +      + E      K+ V    
Sbjct  395  NRNSPSRALKSVITALQTDGDGRGSLNIRRQWTDNSSRKSTEDSGEHSGVFSKEGVHAMK  454

Query  258  EFRKLXGLLRMKSAXRFEPLD  196
            +FRKL GLLR KS    E  D
Sbjct  455  DFRKLYGLLRFKSNKTSESFD  475



>gb|KDP28443.1| hypothetical protein JCGZ_14214 [Jatropha curcas]
Length=412

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF+SFK LANSYLGVK   LFP V  IFQTGA+LSPAE GELM+ 
Sbjct  264  LRPGRIDVHIHFPLCDFSSFKTLANSYLGVKDHKLFPQVEEIFQTGASLSPAEIGELMIA  323

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRW---RRLTEXXXLXTPPRPISADEQGCAPXKDTVP  268
             R+ PSRA K+VI AL T+G   G     RRL +     +     S D  G    +++V 
Sbjct  324  NRNSPSRALKSVITALQTEGDRRGSVNIGRRLLDSGSRSSVEE--SGDHSGIFS-RESVN  380

Query  267  VAXEFRKLXGLLRMKSAXRFEPLD  196
               + +KL GLLR++S  + +  D
Sbjct  381  AMKDIKKLYGLLRLRSNRKEQSFD  404



>gb|KJB09610.1| hypothetical protein B456_001G152500 [Gossypium raimondii]
Length=453

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 90/148 (61%), Gaps = 10/148 (7%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LANSYLG+K   LFP V  IFQ G++LSPAE GELM+ 
Sbjct  304  LRPGRIDVHIHFPLCDFTAFKTLANSYLGLKDHKLFPQVEEIFQNGSSLSPAEIGELMIA  363

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRW---RRLTEXXXLXTPPRPISAD--EQGCAPXKDT  274
             R+ PSRA K+VI AL TDG   G     RR TE       PR +S +  E      K+ 
Sbjct  364  NRNSPSRALKSVIHALQTDGDGRGGLNIGRRSTE-----NGPRKLSGEMGEGSGVFGKEG  418

Query  273  VPVAXEFRKLXGLLRMKSAXRFEPLDXD  190
                 EF+KL GLLR+KS+ + +  D +
Sbjct  419  ANAVKEFKKLYGLLRVKSSRKSQSSDLN  446



>ref|XP_011038785.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Populus euphratica]
Length=488

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 81/141 (57%), Gaps = 0/141 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LANSYLGVK   LFP V  IF TGA+LSPAE GELML 
Sbjct  335  LRPGRIDVHIHFPLCDFAAFKTLANSYLGVKDHKLFPQVEEIFLTGASLSPAEIGELMLA  394

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ PSRA K+VI AL TDG   G      +     +      + E      K+ V    
Sbjct  395  NRNSPSRALKSVITALQTDGDGRGSLNIRRQWTDNCSRKSTEDSGEHSGVFSKEGVHAMK  454

Query  258  EFRKLXGLLRMKSAXRFEPLD  196
            +FRKL GLLR KS    E  D
Sbjct  455  DFRKLYGLLRFKSNKTSESFD  475



>ref|XP_008234685.1| PREDICTED: probable mitochondrial chaperone bcs1 [Prunus mume]
Length=488

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 89/142 (63%), Gaps = 1/142 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV I FPL DF++FK LA++YLGVK   LFP V  IFQ+G +LSPAE GE+M+ 
Sbjct  332  MRPGRVDVHIQFPLCDFSAFKSLASTYLGVKEHKLFPQVEEIFQSGGSLSPAEIGEIMIS  391

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPI-SADEQGCAPXKDTVPVA  262
             RS PSRA K+VI AL T+        ++ +     +  R +  + E G    +++V   
Sbjct  392  NRSSPSRALKSVISALQTNAESVKGVNKVAQALTNSSSGRSVDESGEPGAVFCRESVHTV  451

Query  261  XEFRKLXGLLRMKSAXRFEPLD  196
             EFRKL GLLR+ S  + EPLD
Sbjct  452  REFRKLYGLLRLGSRRKEEPLD  473



>gb|AAD20172.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL77654.1| At2g46620/F13A10.15 [Arabidopsis thaliana]
 gb|AAN28905.1| At2g46620/F13A10.15 [Arabidopsis thaliana]
Length=459

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 85/144 (59%), Gaps = 3/144 (2%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LAN+YLGVK   LF  V  IFQ GA+LSPAE GELM+ 
Sbjct  308  LRPGRVDVHIHFPLCDFTAFKTLANNYLGVKEHKLFSQVEGIFQNGASLSPAEIGELMIA  367

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRR-LTEXXXLXTPPRPISAD--EQGCAPXKDTVP  268
             R+ P+RA K VI AL TDG   G  RR L E     +    +S D     C     + P
Sbjct  368  NRNSPTRALKHVINALQTDGDRRGTGRRLLLENGSRKSTSEDVSDDMSGSLCGGGGGSSP  427

Query  267  VAXEFRKLXGLLRMKSAXRFEPLD  196
               EFRKL GLLR+KS+ +    D
Sbjct  428  AVKEFRKLYGLLRIKSSRKSGSFD  451



>ref|XP_002301424.2| AAA-type ATPase family protein [Populus trichocarpa]
 gb|EEE80697.2| AAA-type ATPase family protein [Populus trichocarpa]
Length=488

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 83/141 (59%), Gaps = 0/141 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LAN+YLGVK   LFP V   FQTGA+LSPAE GELM+ 
Sbjct  335  LRPGRIDVHIHFPLCDFSAFKTLANNYLGVKDHKLFPQVEEFFQTGASLSPAEIGELMIA  394

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ PSRA K+V+ AL TDG   G      +     +      + EQ     K+ V    
Sbjct  395  NRNSPSRALKSVVTALQTDGDGRGSLNIRRQWTDNSSRKSTEDSGEQSGVFSKEGVNAMK  454

Query  258  EFRKLXGLLRMKSAXRFEPLD  196
            + RKL GLLR++S    E  D
Sbjct  455  DIRKLYGLLRLRSRKNSESFD  475



>ref|NP_182185.2| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 gb|AEC10730.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=491

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 85/144 (59%), Gaps = 3/144 (2%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LAN+YLGVK   LF  V  IFQ GA+LSPAE GELM+ 
Sbjct  340  LRPGRVDVHIHFPLCDFTAFKTLANNYLGVKEHKLFSQVEGIFQNGASLSPAEIGELMIA  399

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRR-LTEXXXLXTPPRPISAD--EQGCAPXKDTVP  268
             R+ P+RA K VI AL TDG   G  RR L E     +    +S D     C     + P
Sbjct  400  NRNSPTRALKHVINALQTDGDRRGTGRRLLLENGSRKSTSEDVSDDMSGSLCGGGGGSSP  459

Query  267  VAXEFRKLXGLLRMKSAXRFEPLD  196
               EFRKL GLLR+KS+ +    D
Sbjct  460  AVKEFRKLYGLLRIKSSRKSGSFD  483



>ref|XP_002882079.1| hypothetical protein ARALYDRAFT_346472 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58338.1| hypothetical protein ARALYDRAFT_346472 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 84/145 (58%), Gaps = 4/145 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LAN+YLG+K   LF  V  IFQ GA+LSPAE GELM+ 
Sbjct  219  LRPGRVDVHIHFPLCDFTAFKTLANNYLGLKEHKLFSQVEGIFQNGASLSPAEIGELMIA  278

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRR-LTEXXXLXTPPRPISAD---EQGCAPXKDTV  271
             RS P+RA K VI AL TDG   G  RR L E     +    +S D            + 
Sbjct  279  NRSSPTRALKYVINALQTDGDRRGTGRRLLLESGSRKSTSEDVSDDMSGLLCGGGGGGSS  338

Query  270  PVAXEFRKLXGLLRMKSAXRFEPLD  196
            P   EFRKL GLLR+KS+ +    D
Sbjct  339  PAVKEFRKLYGLLRIKSSRKSGSFD  363



>ref|XP_006397194.1| hypothetical protein EUTSA_v10028615mg [Eutrema salsugineum]
 gb|ESQ38647.1| hypothetical protein EUTSA_v10028615mg [Eutrema salsugineum]
Length=488

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 87/147 (59%), Gaps = 11/147 (7%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LAN+YLGVK   LFP V  IFQ GA+LSPAE GELM+ 
Sbjct  339  LRPGRVDVHIHFPLCDFTAFKTLANNYLGVKEHKLFPQVEGIFQNGASLSPAEIGELMIA  398

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQG------CAPXKD  277
             R+ P+RA K VI AL TDG   G  RR      L +  R   +++ G      C     
Sbjct  399  NRNSPTRALKYVISALQTDGDRRGTGRR----SLLDSGSRRSISEDAGDMSSPLCGGGGS  454

Query  276  TVPVAXEFRKLXGLLRMKSAXRFEPLD  196
            + P   EFRKL GLLR+KS+ +    D
Sbjct  455  S-PAVKEFRKLYGLLRIKSSRKSGSFD  480



>ref|XP_004155177.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FtsH-like [Cucumis sativus]
Length=481

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 84/144 (58%), Gaps = 6/144 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA +YLGVK   LFP V  IFQTGA+LSPAE  ELM+ 
Sbjct  333  LRPGRIDVHIHFPLCDFSAFKNLAINYLGVKDHKLFPQVEEIFQTGASLSPAEISELMIA  392

Query  438  XRSXPSRAXKTVIXALXTDG---RPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVP  268
             R+ PSRA K+VI AL TDG   R     RRL++     +    I   E G     +   
Sbjct  393  NRNSPSRAIKSVISALQTDGDRRRVSNIGRRLSDCGSRKSVAESI---ESGGVVCSENTQ  449

Query  267  VAXEFRKLXGLLRMKSAXRFEPLD  196
               EFRKL G LRMKS    +  D
Sbjct  450  TGKEFRKLYGFLRMKSNKISQSFD  473



>ref|XP_004133798.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like [Cucumis 
sativus]
 gb|KGN56399.1| hypothetical protein Csa_3G119330 [Cucumis sativus]
Length=481

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 84/144 (58%), Gaps = 6/144 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA +YLGVK   LFP V  IFQTGA+LSPAE  ELM+ 
Sbjct  333  LRPGRIDVHIHFPLCDFSAFKNLAINYLGVKDHKLFPQVEEIFQTGASLSPAEISELMIA  392

Query  438  XRSXPSRAXKTVIXALXTDG---RPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVP  268
             R+ PSRA K+VI AL TDG   R     RRL++     +    I   E G     +   
Sbjct  393  NRNSPSRAIKSVISALQTDGDRRRVSNIGRRLSDCGSRKSVAESI---ESGGVVCSENTQ  449

Query  267  VAXEFRKLXGLLRMKSAXRFEPLD  196
               EFRKL G LRMKS    +  D
Sbjct  450  TGKEFRKLYGFLRMKSNKISQSFD  473



>ref|XP_002533329.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF29050.1| ATP binding protein, putative [Ricinus communis]
Length=480

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 88/144 (61%), Gaps = 4/144 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FP  DF++FK LANSYLGVK   LFP V  IFQ GA+LSPAE GELM+ 
Sbjct  330  LRPGRIDVHIHFPTCDFSAFKSLANSYLGVKEHKLFPQVEEIFQAGASLSPAEIGELMIA  389

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRW---RRLTEXXXLXTPPRPISADEQGCAPXKDTVP  268
             R+ PSRA K+VI AL T+G   G     RRL E     +     S +  G    +++V 
Sbjct  390  NRNSPSRALKSVITALQTEGDCRGSVNIGRRLVESGSKGSFVEVESGENSGIFS-RESVN  448

Query  267  VAXEFRKLXGLLRMKSAXRFEPLD  196
               + RKL GLLR++S  + + LD
Sbjct  449  AIKDIRKLYGLLRLRSNRKEQSLD  472



>ref|XP_008437854.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, chloroplastic 
[Cucumis melo]
Length=481

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 84/144 (58%), Gaps = 6/144 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA +YLGVK   LFP V  IFQTGA+LSPAE  ELM+ 
Sbjct  333  LRPGRIDVHIHFPLCDFSAFKNLAINYLGVKDHKLFPQVEEIFQTGASLSPAEISELMIA  392

Query  438  XRSXPSRAXKTVIXALXTDG---RPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVP  268
             R+ PSRA K+VI AL TDG   R     RRL++     +    I   E G     +   
Sbjct  393  NRNSPSRAIKSVISALQTDGDRRRVSNIGRRLSDCGSRKSVAESI---ESGGVLCSENTQ  449

Query  267  VAXEFRKLXGLLRMKSAXRFEPLD  196
               EFRKL G LRMKS    +  D
Sbjct  450  TGKEFRKLYGFLRMKSNKISQSFD  473



>ref|XP_007039156.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein, putative [Theobroma cacao]
 gb|EOY23657.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein, putative [Theobroma cacao]
Length=479

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 87/142 (61%), Gaps = 6/142 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LANSYLGVK   LFP V  IFQ GA+LSPAE GE+M+ 
Sbjct  330  LRPGRIDVHIQFPLCDFSAFKSLANSYLGVKEHKLFPHVEEIFQGGASLSPAEIGEIMIS  389

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRW-RRLTEXXXLXTPPRPISADEQGCAPXKDTVPVA  262
             RS P+RA K+VI AL T      +  +RL++   +          +QG    +D     
Sbjct  390  NRSSPTRALKSVITALQTTASNAKKVSKRLSDSESVRNSD---DTGDQGNLLSRDN--SV  444

Query  261  XEFRKLXGLLRMKSAXRFEPLD  196
             EFRKL GLL+M S  + EPLD
Sbjct  445  REFRKLYGLLKMGSRRKEEPLD  466



>emb|CDY41542.1| BnaC04g00800D [Brassica napus]
Length=470

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 82/143 (57%), Gaps = 2/143 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LANSYLGVK   LFP V  IFQ GATLSPAE GELM+ 
Sbjct  324  LRPGRVDVHIHFPLCDFAAFKTLANSYLGVKEHKLFPQVEGIFQNGATLSPAEIGELMIA  383

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRR--LTEXXXLXTPPRPISADEQGCAPXKDTVPV  265
             RS P+RA K VI AL TDG   G  RR  L              +          + P 
Sbjct  384  NRSSPTRALKYVINALQTDGDRRGNARRSFLESGSRRSEDASSEMSGPLCGGGGGGSSPG  443

Query  264  AXEFRKLXGLLRMKSAXRFEPLD  196
              EFRKL GLLR+KS+ + E  D
Sbjct  444  VKEFRKLYGLLRIKSSRKSESYD  466



>ref|XP_002515676.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46728.1| ATP binding protein, putative [Ricinus communis]
Length=487

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 89/142 (63%), Gaps = 3/142 (2%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGA-TLSPAEXGELML  442
            +RPGR DV + FPL DF++FK LANSYLG+K   LF  V  IFQ G  +LSPAE GE+M+
Sbjct  335  MRPGRIDVHVQFPLCDFSAFKNLANSYLGLKEHKLFSQVEEIFQAGGQSLSPAEIGEIMI  394

Query  441  VXRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVA  262
              RS PSRA K+VI A+  + + G   +RL+E   + +     + + +G    +++V   
Sbjct  395  SNRSSPSRALKSVISAMQNNSKVGA--QRLSESRSVRSGDHQETGEAEGGVFCRESVHTV  452

Query  261  XEFRKLXGLLRMKSAXRFEPLD  196
             EFRKL GLLRM S  + E LD
Sbjct  453  REFRKLYGLLRMGSRRKEEVLD  474



>ref|XP_006294099.1| hypothetical protein CARUB_v10023091mg [Capsella rubella]
 gb|EOA26997.1| hypothetical protein CARUB_v10023091mg [Capsella rubella]
Length=489

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 83/145 (57%), Gaps = 4/145 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LAN+YLGVK   LF  V  IFQ GA+LSPAE GELM+ 
Sbjct  337  LRPGRVDVHIHFPLCDFTAFKTLANNYLGVKEHKLFSQVEGIFQNGASLSPAEIGELMIA  396

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRR-LTEXXXLXTPPRPISAD---EQGCAPXKDTV  271
             R+ P+RA K VI AL TDG   G  RR L E          +S D            + 
Sbjct  397  NRNSPTRALKYVINALQTDGDRRGTGRRLLLESGSRRATTEEVSEDMSGSLCGGGGGGSS  456

Query  270  PVAXEFRKLXGLLRMKSAXRFEPLD  196
            P   EFRKL GLLR+KS+ +    D
Sbjct  457  PAVKEFRKLYGLLRIKSSRKSGSFD  481



>ref|XP_010518339.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=483

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 84/144 (58%), Gaps = 3/144 (2%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LAN+YLGVK   LF  V  IFQ GA+LSPAE GELM+ 
Sbjct  336  LRPGRVDVHIHFPLCDFTAFKTLANNYLGVKDHKLFSQVEGIFQNGASLSPAEIGELMIA  395

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRR-LTEXXXLXTPPRPISAD--EQGCAPXKDTVP  268
             R+ P+RA K VI AL TDG   G  RR L E          +S D     C     + P
Sbjct  396  NRNSPTRALKYVINALQTDGDRRGTGRRLLLESGSRRGTTEEVSQDMSGLLCGGGGGSSP  455

Query  267  VAXEFRKLXGLLRMKSAXRFEPLD  196
               EFRKL GLLR+KS+ +    D
Sbjct  456  AVKEFRKLYGLLRIKSSRKSGSFD  479



>ref|XP_010559141.1| PREDICTED: probable mitochondrial chaperone bcs1 [Tarenaya hassleriana]
Length=483

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 82/141 (58%), Gaps = 1/141 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LAN+YLGVK   LFP V  IFQ GATLSPAE  ELM+ 
Sbjct  340  LRPGRVDVHIHFPLCDFTAFKTLANNYLGVKEHKLFPQVEEIFQNGATLSPAEIAELMIA  399

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ PSRA K VI AL TDG   G  RRL            +  + +G      + P   
Sbjct  400  NRNSPSRAVKAVISALQTDGDRRGSGRRLNMDKGGRRSAGEV-GEMRGPLCGGGSSPAVK  458

Query  258  EFRKLXGLLRMKSAXRFEPLD  196
            E RKL GLLR+KS  + +  D
Sbjct  459  ELRKLYGLLRIKSNRKSQSFD  479



>gb|AAV92898.1| Avr9/Cf-9 rapidly elicited protein 102, partial [Nicotiana tabacum]
Length=258

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 92/148 (62%), Gaps = 14/148 (9%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DFN+FK LANS+LG+K   LFP V  IFQTGA LSPAE  E+M+ 
Sbjct  109  LRPGRIDVHIHFPLCDFNAFKSLANSHLGLKDHKLFPQVEEIFQTGAVLSPAEISEIMIS  168

Query  438  XRSXPSRAXKTVIXALX--TDGRPGGRW-RRLTEXXXLXTPPRPISADEQGCAPX--KDT  274
             RS P+RA K+VI AL   T+ R   R  RRL+E   + T       +E G +    KD+
Sbjct  169  NRSSPTRALKSVISALHINTESRAATRHARRLSESGSVRT------VEETGDSGIFCKDS  222

Query  273  VPVAXEFRKLXGLLRMKSAXRFEPLDXD  190
            V    EF+KL GLLR++S+ +    + D
Sbjct  223  V---REFKKLYGLLRIRSSRKDSSFEFD  247



>ref|XP_011023131.1| PREDICTED: putative cell division cycle ATPase [Populus euphratica]
Length=488

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 83/141 (59%), Gaps = 0/141 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA++YLGVK   LFP V   FQTGA+LS AE GELM+ 
Sbjct  335  LRPGRVDVHIHFPLCDFSAFKTLAHNYLGVKDHKLFPQVEEFFQTGASLSAAEIGELMIA  394

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ PSRA K+V+ AL TDG   G      +     +      + EQ     K+ V    
Sbjct  395  NRNSPSRALKSVVAALQTDGDRRGSLNIRRQWTDNSSRKSTDDSGEQSGVFSKEGVNATK  454

Query  258  EFRKLXGLLRMKSAXRFEPLD  196
            + RKL GLLR+KS  + E  D
Sbjct  455  DIRKLYGLLRLKSRKKSESFD  475



>ref|XP_010506675.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=486

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 85/149 (57%), Gaps = 12/149 (8%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LAN+YLGVK   LF  V  IFQ GA+LSPAE GELM+ 
Sbjct  334  LRPGRVDVHIHFPLCDFTAFKTLANNYLGVKDHKLFSQVEGIFQNGASLSPAEIGELMIA  393

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADE--------QGCAPX  283
             R+ P+RA K VI AL TDG   G  RRL     L +  R  + +E              
Sbjct  394  NRNSPTRALKYVINALQTDGDRRGTGRRL----LLESGSRRATTEEVSENMSGLLCGGGG  449

Query  282  KDTVPVAXEFRKLXGLLRMKSAXRFEPLD  196
              + P   EFRKL GLLR+KS+ +    D
Sbjct  450  GGSSPAVKEFRKLYGLLRIKSSRKSGSFD  478



>gb|KFK37429.1| hypothetical protein AALP_AA4G255900 [Arabis alpina]
Length=451

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA++YLGVK   LF  V  IFQ GA+LS AE GELM+ 
Sbjct  306  LRPGRVDVHIHFPLCDFTAFKTLASNYLGVKEHKLFSQVEGIFQNGASLSAAEIGELMIA  365

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRR-LTEXXXLXTPPRPISADEQGCAPXKDTVPVA  262
             R+ P+RA K VI AL  DG   G  RR L E     +    +  D  G        PV 
Sbjct  366  NRNSPTRALKYVINALQIDGDRRGNGRRLLLENGSRRSMSEEVGGDMSGPLCGGGGSPVV  425

Query  261  XEFRKLXGLLRMKSAXRFEPLD  196
             E RKL GLLR+KS+ + E  D
Sbjct  426  KEVRKLYGLLRIKSSRKSESYD  447



>ref|XP_006444778.1| hypothetical protein CICLE_v10019936mg [Citrus clementina]
 ref|XP_006491333.1| PREDICTED: ATP-dependent zinc metalloprotease YME1 homolog [Citrus 
sinensis]
 gb|ESR58018.1| hypothetical protein CICLE_v10019936mg [Citrus clementina]
 gb|KDO86558.1| hypothetical protein CISIN_1g011664mg [Citrus sinensis]
Length=480

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 89/144 (62%), Gaps = 7/144 (5%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF+SFK LA+SYLG+K   LFP V  IFQ G++LSPAE GELM+ 
Sbjct  333  LRPGRIDVHIHFPLCDFSSFKTLASSYLGLKDHKLFPQVEEIFQNGSSLSPAEIGELMIA  392

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRW---RRLTEXXXLXTPPRPISADEQGCAPXKDTVP  268
             R+ PSRA K+VI AL TDG   G     RRL +     +     S +  G    ++TV 
Sbjct  393  NRNSPSRALKSVITALQTDGEGRGAANAGRRLDKSGSKKSTDAD-SGEHGGVFSRENTVK  451

Query  267  VAXEFRKLXGLLRMKSAXRFEPLD  196
               EFRKL GLL +K++ + +  D
Sbjct  452  ---EFRKLYGLLTLKNSRKSQSFD  472



>ref|XP_010507993.1| PREDICTED: 26S protease regulatory subunit 8 homolog [Camelina 
sativa]
Length=487

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 84/146 (58%), Gaps = 5/146 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LAN+YLGVK   LF  V  IFQ GA+LSPAE GELM+ 
Sbjct  334  LRPGRVDVHIHFPLCDFTAFKTLANNYLGVKDHKLFSQVEGIFQNGASLSPAEIGELMIA  393

Query  438  XRSXPSRAXKTVIXALXTDG-RPGGRWRR-LTEXXXLXTPPRPISAD---EQGCAPXKDT  274
             R+ P+RA K VI AL TDG R G   RR L E          +S D            +
Sbjct  394  NRNSPTRALKYVINALQTDGDRRGTAGRRLLLESGSRRATTEEVSEDMSGLLCGGGGGGS  453

Query  273  VPVAXEFRKLXGLLRMKSAXRFEPLD  196
             P   EFRKL GLLR+KS+ +    D
Sbjct  454  SPAVKEFRKLYGLLRIKSSRKSGSFD  479



>ref|XP_009588603.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana tomentosiformis]
Length=476

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 93/148 (63%), Gaps = 14/148 (9%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DFN+FK LANS+LG+K   LFP V  IFQTGA LSPAE GE+M+ 
Sbjct  327  LRPGRIDVHIHFPLCDFNAFKSLANSHLGLKDHKLFPQVEEIFQTGAVLSPAEIGEIMIS  386

Query  438  XRSXPSRAXKTVIXALX--TDGRPGGRW-RRLTEXXXLXTPPRPISADEQGCAPX--KDT  274
             RS P+RA K+VI AL   T+ R   R  RRL+E   + T       +E G +    KD+
Sbjct  387  NRSSPTRALKSVISALHINTESRAATRHARRLSESGSVRT------VEETGDSGIFCKDS  440

Query  273  VPVAXEFRKLXGLLRMKSAXRFEPLDXD  190
            V    EF+KL GLLR++S+ +    + D
Sbjct  441  V---REFKKLYGLLRIRSSRKDSSFEFD  465



>ref|XP_007051474.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOX95631.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=479

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 86/149 (58%), Gaps = 15/149 (10%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LANSYLG+K   LFP V  IFQ GA+LSPAE GELM+ 
Sbjct  330  LRPGRIDVHIHFPLCDFTAFKTLANSYLGLKDHKLFPQVEEIFQNGASLSPAEIGELMIA  389

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRW---RRLTEXXXLXT-----PPRPISADEQGCAPX  283
             R+ PSRA K+VI AL TDG   G     RRL E     +      P  +   E G    
Sbjct  390  NRNSPSRALKSVINALQTDGDGRGALNIGRRLGENGSRKSVEEIGEPSGVFCKEGGAHAV  449

Query  282  KDTVPVAXEFRKLXGLLRMKSAXRFEPLD  196
            +       EF+K  GLLR+KS+ + +  D
Sbjct  450  R-------EFKKWYGLLRVKSSRKSQSFD  471



>gb|AFP55581.1| ATP binding protein [Rosa rugosa]
Length=490

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 85/142 (60%), Gaps = 6/142 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV I FPL DF++FK LAN+YLGVK   LFP V  IFQ+G +LSPAE GE+M+ 
Sbjct  330  MRPGRVDVHIHFPLCDFSAFKSLANTYLGVKEHKLFPQVEEIFQSGGSLSPAEIGEIMIS  389

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQ---GCAPXKDTVP  268
             RS PSRA K+VI AL TD         +     L +     S DE    G    +++V 
Sbjct  390  NRSSPSRALKSVISALQTDVDNKT---TVKVAQALTSSGSGRSVDESGEPGTVFCRESVH  446

Query  267  VAXEFRKLXGLLRMKSAXRFEP  202
               EFRKL GLLR+ S  + EP
Sbjct  447  TVREFRKLYGLLRLGSRRKEEP  468



>ref|XP_010544865.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Tarenaya 
hassleriana]
Length=486

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 83/144 (58%), Gaps = 3/144 (2%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA++YLGVK   LFP V  IFQ G++LSPAE  ELM+ 
Sbjct  340  LRPGRVDVHIHFPLCDFTAFKTLASNYLGVKDHKLFPQVEEIFQNGSSLSPAEISELMIA  399

Query  438  XRSXPSRAXKTVIXALXTDGRPGG---RWRRLTEXXXLXTPPRPISADEQGCAPXKDTVP  268
             R+ PSRA K VI AL TDG   G     RRL       +P      +  G        P
Sbjct  400  NRNSPSRAVKAVISALQTDGDRRGIMAMGRRLFLDNGSSSPTAEELGETSGLLCGGGGSP  459

Query  267  VAXEFRKLXGLLRMKSAXRFEPLD  196
               EFRKL GLLR+KS+ + +  D
Sbjct  460  AVKEFRKLYGLLRIKSSRKSQSFD  483



>ref|XP_004306636.1| PREDICTED: uncharacterized protein LOC101302781 [Fragaria vesca 
subsp. vesca]
Length=491

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 89/159 (56%), Gaps = 26/159 (16%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +F+ LA SYLGVK   LFP V  IFQ+G++LSPAE GELM+ 
Sbjct  341  LRPGRIDVHIHFPLCDFTAFRNLATSYLGVKEHKLFPQVEEIFQSGSSLSPAEIGELMIA  400

Query  438  XRSXPSRAXKTVIXALXT--DGRPGGRWRRLTEXXXLXTPPRPI------SADEQG----  295
             R+ PSRA K+VI AL T  DGR  G+  R         PPR        S DE G    
Sbjct  401  NRTSPSRAIKSVITALQTDGDGRGAGKIGR---------PPRGFETGSRKSGDESGEPGV  451

Query  294  --CAPXKDTVPVAXEFRKLXGLLRMKSAXRFEPLDXDLE  184
              C    +TV    +FRKL G LRM+ +   +  D   E
Sbjct  452  TFCGEGVNTV---RDFRKLYGFLRMRGSKNSQSFDAGSE  487



>ref|XP_009761416.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana sylvestris]
Length=476

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 92/148 (62%), Gaps = 14/148 (9%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DFN+FK LANS+LG+K   LFP V  IFQTGA LSPAE  E+M+ 
Sbjct  327  LRPGRIDVHIHFPLCDFNAFKSLANSHLGLKDHKLFPQVEEIFQTGAVLSPAEISEIMIS  386

Query  438  XRSXPSRAXKTVIXALX--TDGRPGGRW-RRLTEXXXLXTPPRPISADEQGCAPX--KDT  274
             RS P+RA K+VI AL   T+ R   R  RRL+E   + T       +E G +    KD+
Sbjct  387  NRSSPTRALKSVISALHINTESRAATRHARRLSESGSVRT------VEETGDSGIFCKDS  440

Query  273  VPVAXEFRKLXGLLRMKSAXRFEPLDXD  190
            V    EF+KL GLLR++S+ +    + D
Sbjct  441  V---REFKKLYGLLRIRSSRKDSSFEFD  465



>ref|XP_007136478.1| hypothetical protein PHAVU_009G048600g [Phaseolus vulgaris]
 gb|ESW08472.1| hypothetical protein PHAVU_009G048600g [Phaseolus vulgaris]
Length=482

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 86/147 (59%), Gaps = 8/147 (5%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA+SYLG+K   LFP V  +FQTGA LSPAE GE+M+ 
Sbjct  331  LRPGRVDVHIHFPLCDFSTFKILASSYLGLKEHKLFPQVEEVFQTGARLSPAEVGEIMIS  390

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ PSRA KTVI AL          +RL+         R    +E G    K+ +    
Sbjct  391  NRNSPSRALKTVISALQAHSNAPREGQRLSHSG----SGRNGDDNEPGAVICKENLHTVK  446

Query  258  EFRKLXGLLRMKSAXRFE----PLDXD  190
            EFRKL GLLR+ S  + E    P+D +
Sbjct  447  EFRKLYGLLRLGSRRKEESYSGPMDKE  473



>ref|XP_009142622.1| PREDICTED: mitochondrial chaperone BCS1 [Brassica rapa]
Length=468

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 82/149 (55%), Gaps = 15/149 (10%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LANSYLGVK   LFP V  IFQ GA+LSPAE GELM+ 
Sbjct  323  LRPGRVDVHIHFPLCDFTAFKTLANSYLGVKEHKLFPQVEGIFQNGASLSPAEIGELMIA  382

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAP--------X  283
             RS P+RA K VI AL  DG      R   E        R   A  +   P         
Sbjct  383  NRSSPTRALKYVINALQRDGNVR---RSFLENG----SRRSEDASSEMSGPLCGGGGGGG  435

Query  282  KDTVPVAXEFRKLXGLLRMKSAXRFEPLD  196
              + P   EFRKL GLLR+KS+ + E  D
Sbjct  436  GGSSPGVKEFRKLYGLLRIKSSRKSESYD  464



>ref|XP_006350498.1| PREDICTED: mitochondrial chaperone BCS1-like [Solanum tuberosum]
Length=476

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 86/139 (62%), Gaps = 10/139 (7%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL +FNSFK LANS+LG+K   LFP V  IFQTGA LSPAE GE+M+ 
Sbjct  327  LRPGRIDVHIHFPLCNFNSFKTLANSHLGLKDHKLFPQVEEIFQTGAALSPAEIGEIMIS  386

Query  438  XRSXPSRAXKTVIXALX--TDGRPGGRW-RRLTEXXXLXTPPRPISADEQGCAPXKDTVP  268
             RS P+RA KTVI AL   T+ R   R  RRL+E   + T        E G    ++   
Sbjct  387  NRSSPTRALKTVISALQINTESRAATRHARRLSESGSVRTAEE---TGESGIFCREN---  440

Query  267  VAXEFRKLXGLLRMKSAXR  211
               EF+KL GLLR++S  +
Sbjct  441  -LREFKKLYGLLRVRSCRK  458



>ref|XP_009116854.1| PREDICTED: probable mitochondrial chaperone bcs1 [Brassica rapa]
Length=483

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 83/144 (58%), Gaps = 6/144 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA+SYLG+K   LFP V  IF+ GA+LSPAE GELM+ 
Sbjct  334  LRPGRVDVHIHFPLCDFTAFKALASSYLGLKEHKLFPQVEGIFRDGASLSPAEIGELMIA  393

Query  438  XRSXPSRAXKTVIXALXTDGRPGG---RWRRLTEXXXLXTPPRPISADEQGCAPXKDTVP  268
             R+ PSRA K+VI AL TDG   G     RRL               D  G      + P
Sbjct  394  NRNSPSRALKSVINALQTDGDRRGTPASTRRLFHE---RASSEDYEGDTSGPLCGGGSSP  450

Query  267  VAXEFRKLXGLLRMKSAXRFEPLD  196
               EF+KL GLLR+KS  + +  +
Sbjct  451  AVKEFKKLYGLLRLKSNRKSQSFN  474



>ref|XP_008381389.1| PREDICTED: mitochondrial chaperone BCS1-like [Malus domestica]
Length=479

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 86/142 (61%), Gaps = 5/142 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA++YLG+K   LFP V  IF +GA+LSPAE GE+M+ 
Sbjct  331  LRPGRVDVHIHFPLCDFFAFKSLASTYLGLKEHKLFPQVEEIFHSGASLSPAEIGEIMIS  390

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQG---CAPXKDTVP  268
             RS PSRA K+VI AL T+        ++ +     +  R  S DE G       +++V 
Sbjct  391  NRSSPSRALKSVISALQTNVDSMKGANKVGQTLSNSSSGR--SVDESGEPSAVFCRESVH  448

Query  267  VAXEFRKLXGLLRMKSAXRFEP  202
               EFRKL GLLRM S  + EP
Sbjct  449  TVREFRKLYGLLRMGSRRKEEP  470



>emb|CDX71701.1| BnaC08g31730D [Brassica napus]
Length=483

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 83/144 (58%), Gaps = 6/144 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA+SYLG+K   LFP V  IF+ GA+LSPAE GELM+ 
Sbjct  334  LRPGRVDVHIHFPLCDFTAFKALASSYLGLKEHKLFPQVEGIFRDGASLSPAEIGELMIA  393

Query  438  XRSXPSRAXKTVIXALXTDGRPGG---RWRRLTEXXXLXTPPRPISADEQGCAPXKDTVP  268
             R+ PSRA K+VI AL TDG   G     RRL               D  G      + P
Sbjct  394  NRNSPSRALKSVINALQTDGDRRGTPATTRRLFHE---RASSEDYEGDTSGPLCGGGSSP  450

Query  267  VAXEFRKLXGLLRMKSAXRFEPLD  196
               EF+KL GLLR+KS  + +  +
Sbjct  451  AVKEFKKLYGLLRLKSNRKSQSFN  474



>ref|XP_003523343.1| PREDICTED: mitochondrial chaperone BCS1-like isoform 1 [Glycine 
max]
Length=480

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 85/145 (59%), Gaps = 4/145 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA+SYLG+K   LFP V  +FQTGA LSPAE GE+M+ 
Sbjct  327  LRPGRIDVHIHFPLCDFSTFKILASSYLGLKEHKLFPQVEEVFQTGARLSPAELGEIMIS  386

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ P+RA KTVI AL          +RL+         R    +E G    +++V    
Sbjct  387  NRNSPTRALKTVISALQVQSNGPREGQRLSHSG----SGRNSDDNEPGAVICRESVHTVR  442

Query  258  EFRKLXGLLRMKSAXRFEPLDXDLE  184
            EFRKL GLLR+ S  + E     +E
Sbjct  443  EFRKLYGLLRLGSRRKEESYSGPIE  467



>ref|XP_004234999.1| PREDICTED: mitochondrial chaperone BCS1-like [Solanum lycopersicum]
Length=474

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 92/148 (62%), Gaps = 14/148 (9%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL +FNSFK LANS+LG+K   LFP V  IFQTGA LSPAE GE+M+ 
Sbjct  327  LRPGRIDVHIHFPLCNFNSFKTLANSHLGLKDHKLFPQVEEIFQTGAALSPAEIGEIMIS  386

Query  438  XRSXPSRAXKTVIXALX--TDGRPGGRW-RRLTEXXXLXTPPRPISADEQGCAPX--KDT  274
             RS P+RA KTVI AL   T+ R   R  RRL+E   +       +A+E G +    K+ 
Sbjct  387  NRSSPTRALKTVISALQINTESRAATRHARRLSESGSVR------AAEETGESGIFCKEN  440

Query  273  VPVAXEFRKLXGLLRMKSAXRFEPLDXD  190
            +    EF+KL GLLR++S  +    + D
Sbjct  441  L---REFKKLYGLLRVRSCRKDSSYEFD  465



>ref|XP_010100693.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
 gb|EXB83855.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
Length=485

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 83/139 (60%), Gaps = 13/139 (9%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LANSYLG+K   LFP V  IFQ+G++LSPAE GELM+ 
Sbjct  339  LRPGRVDVHIHFPLCDFVAFKNLANSYLGLKEHKLFPQVEEIFQSGSSLSPAEIGELMMA  398

Query  438  XRSXPSRAXKTVIXALXTDGR---PGGRWRRLTEXXXLX---TPPRPISADEQGCAPXKD  277
             R+ PSRA K+VI AL TDG     G   RRL +   +     P  P  A   G  P KD
Sbjct  399  NRNSPSRAIKSVISALQTDGDGRGVGKIGRRLCDNGPMSFSEEPGSPAGAFFDGVHPVKD  458

Query  276  TVPVAXEFRKLXGLLRMKS  220
                    RKL G LR+KS
Sbjct  459  -------IRKLYGFLRVKS  470



>gb|KDP30317.1| hypothetical protein JCGZ_18154 [Jatropha curcas]
Length=482

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 89/147 (61%), Gaps = 17/147 (12%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQT-GATLSPAEXGELML  442
            +RPGR DV + FPL DF++FK LAN+YLGVK   LFP V  IF + G ++S AE GE+M+
Sbjct  334  MRPGRIDVHVNFPLCDFSAFKSLANNYLGVKEHKLFPQVEEIFHSGGVSVSAAEIGEIMI  393

Query  441  VXRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPX-----KD  277
              R+ PSRA K+VI AL T+       RRL+E   +       S DE G  P      ++
Sbjct  394  SNRNSPSRALKSVISALQTNNN-----RRLSESRSVR------SGDETGEQPEGGVYCRE  442

Query  276  TVPVAXEFRKLXGLLRMKSAXRFEPLD  196
            +V    EFRKL GLL+M S  + EP++
Sbjct  443  SVHTVREFRKLYGLLKMGSRRKEEPIE  469



>ref|XP_004510634.1| PREDICTED: uncharacterized protein LOC101511087 [Cicer arietinum]
Length=483

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 78/136 (57%), Gaps = 4/136 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FP+ DF+SFK LANSYLGVK   LFP V  IF+ GA+LSPAE GELM+ 
Sbjct  340  LRPGRVDVHIHFPVCDFSSFKTLANSYLGVKEHKLFPQVEEIFRHGASLSPAEIGELMIA  399

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ PSRA K+VI AL TDG   G    +            +   + G     D      
Sbjct  400  NRNSPSRAIKSVIGALQTDGDGRGYGDMIVR----QIEDGDVDEVQNGVLCGVDGFSTVK  455

Query  258  EFRKLXGLLRMKSAXR  211
            + RKL GL R+++  R
Sbjct  456  DIRKLYGLFRLRNVKR  471



>gb|EPS72484.1| hypothetical protein M569_02272 [Genlisea aurea]
Length=482

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 87/139 (63%), Gaps = 5/139 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DFNSFK LA++YLGVK   L+  V  IFQ+GAT+SPAE  ELMLV
Sbjct  332  LRPGRIDVHIYFPLCDFNSFKNLASNYLGVKEHKLYSQVEEIFQSGATMSPAEISELMLV  391

Query  438  XRSXPSRAXKTVIXALXTDGRPGGR-WRRLTEXXXLXTPPRPIS-ADEQGCAPXKDTVPV  265
             RS PSRA ++VI AL ++ +   +   R+ E          +S A++ GC   KD  P 
Sbjct  392  NRSSPSRALRSVISALRSNSKKSMKSLSRIGETAASSPTTSHLSGAEDGGCIGWKD--PT  449

Query  264  AX-EFRKLXGLLRMKSAXR  211
            A  +FR+L GLL +K   R
Sbjct  450  AKDQFRRLYGLLGLKGHKR  468



>gb|KJB24545.1| hypothetical protein B456_004G150200 [Gossypium raimondii]
Length=467

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 87/150 (58%), Gaps = 15/150 (10%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LANSYLG+K   LFP V  IFQ G++LSPAE GELM+ 
Sbjct  327  LRPGRIDVHIHFPLCDFTAFKTLANSYLGLKDHKLFPQVEEIFQNGSSLSPAEIGELMIA  386

Query  438  XRSXPSRAXKTVIXALXTDGR-PGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVA  262
             R  PSRA K+VI AL T+G   GGR  R  +       P  +   E   A         
Sbjct  387  NRGSPSRALKSVINALQTEGDGKGGRCGR--KAVEESGEPSGVFCTEGANA--------V  436

Query  261  XEFRKLXGLLRMKSAXRFEP---LDXDLES  181
             EF+KL GL R+KS  R  P   LD DL+S
Sbjct  437  KEFKKLYGLFRVKS-NRKSPSFNLDNDLKS  465



>ref|XP_004502706.1| PREDICTED: mitochondrial chaperone BCS1-like [Cicer arietinum]
Length=488

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 89/153 (58%), Gaps = 10/153 (7%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA+SYLG+K   LFP V  +FQTGA LSPAE GE+M+ 
Sbjct  337  LRPGRVDVHIHFPLCDFSTFKILASSYLGLKEHKLFPQVEEVFQTGARLSPAEVGEIMIS  396

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ PSRA KTVI A+       G  +RL+      +       +   C   +++V    
Sbjct  397  NRNSPSRALKTVITAMQVQSNVQG--QRLSNSGSGRSSEEVNDTNGVIC---RESVHTVR  451

Query  258  EFRKLXGLLRMKSAXRFE-----PLDXDLESIQ  175
            EFRKL GLLR+ S  + E     P+D +   I+
Sbjct  452  EFRKLYGLLRLGSRRKEESVHSGPIDKEASRIE  484



>emb|CDY57874.1| BnaA09g55560D [Brassica napus]
Length=708

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 83/144 (58%), Gaps = 6/144 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA+SYLG+K   LFP V  IF+ GA+LSPAE GELM+ 
Sbjct  334  LRPGRVDVHIHFPLCDFTAFKALASSYLGLKEHKLFPQVEGIFRDGASLSPAEIGELMIA  393

Query  438  XRSXPSRAXKTVIXALXTDGRPGG---RWRRLTEXXXLXTPPRPISADEQGCAPXKDTVP  268
             R+ PSRA K+VI AL TDG   G     RRL               D  G      + P
Sbjct  394  NRNSPSRALKSVINALQTDGDRRGTPASTRRLFHE---RASSEDYEGDTSGPLCGGGSSP  450

Query  267  VAXEFRKLXGLLRMKSAXRFEPLD  196
               EF+KL GLLR+KS  + +  +
Sbjct  451  AVKEFKKLYGLLRLKSNRKSQSFN  474



>ref|XP_009361315.1| PREDICTED: probable mitochondrial chaperone bcs1 [Pyrus x bretschneideri]
Length=490

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 83/140 (59%), Gaps = 1/140 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA++YLG+K   LFP V  IF  GA+LSPAE GE+M+ 
Sbjct  331  LRPGRVDVHIHFPLCDFSAFKSLASTYLGLKEHKLFPQVEEIFHGGASLSPAEIGEIMIS  390

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPIS-ADEQGCAPXKDTVPVA  262
             RS PSRA K+VI AL T         +  +     +  R +  + E G    +++V   
Sbjct  391  NRSSPSRALKSVISALQTHVDSKKDANKAAQALTNSSSGRSVDESGEPGGVFCRESVHTV  450

Query  261  XEFRKLXGLLRMKSAXRFEP  202
             EF+KL GL RM S  + EP
Sbjct  451  REFKKLYGLFRMGSRRKEEP  470



>ref|XP_010109213.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
 gb|EXC21393.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
Length=486

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 89/152 (59%), Gaps = 26/152 (17%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV + FPL DF++FK LAN+YLG+K   LFP V  IFQTGA+LSPAE GE+M+ 
Sbjct  331  MRPGRIDVHVNFPLCDFSAFKSLANNYLGLKEHKLFPQVEEIFQTGASLSPAEIGEIMIS  390

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPR------PISADEQG------  295
             R+ PSRA K+VI AL T     G  R+L        PPR        S DE G      
Sbjct  391  NRTSPSRALKSVISALQT---SAGEGRKL--------PPRLSKSGSDRSGDESGEPGGML  439

Query  294  CAPXKDTVPVAXEFRKLXGLLRMKSAXRFEPL  199
            C   ++++    EFRKL GL R+ S  + + L
Sbjct  440  C---RESIHTVREFRKLYGLFRLGSRRKEDSL  468



>ref|XP_003527995.2| PREDICTED: mitochondrial chaperone BCS1-like [Glycine max]
Length=475

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 85/145 (59%), Gaps = 8/145 (6%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA+SYLG+K   LFP V  +FQTGA LSPAE GE+M+ 
Sbjct  333  LRPGRVDVHIHFPLCDFSTFKILASSYLGLKEHKLFPQVEEVFQTGARLSPAEVGEIMIS  392

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ P+RA KTVI  L          +RL++        R    +E G    +++V    
Sbjct  393  NRNSPTRALKTVISVLQVHSEG----QRLSQSG----SGRNSDDNEPGAVICRESVHTVR  444

Query  258  EFRKLXGLLRMKSAXRFEPLDXDLE  184
            EFRKL GLLR+ S  + E     +E
Sbjct  445  EFRKLYGLLRLGSRRKEESYSGPIE  469



>gb|KJB41595.1| hypothetical protein B456_007G110900 [Gossypium raimondii]
Length=481

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 82/144 (57%), Gaps = 2/144 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL +F +FK LANSYLG+K   LFP V  IFQ GA+LSPAE GELM+ 
Sbjct  333  LRPGRIDVHIHFPLCNFTAFKTLANSYLGLKDHKLFPQVEEIFQKGASLSPAEIGELMIA  392

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISA-DEQGCAPXKDTVPVA  262
             R+ PSRA KTVI AL TDG   G    L          +P+    E      K+     
Sbjct  393  NRNSPSRALKTVINALQTDGDGRGAL-NLGRGSCENGSRKPVEEIGEPSGVFCKEGANAV  451

Query  261  XEFRKLXGLLRMKSAXRFEPLDXD  190
             E +KL G LR+KS  + +  D +
Sbjct  452  KELKKLYGFLRVKSCRKSQSFDLN  475



>gb|KHN23332.1| Putative mitochondrial chaperone bcs1 [Glycine soja]
Length=463

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 85/145 (59%), Gaps = 8/145 (6%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA+SYLG+K   LFP V  +FQTGA LSPAE GE+M+ 
Sbjct  321  LRPGRVDVHIHFPLCDFSTFKILASSYLGLKEHKLFPQVEEVFQTGARLSPAEVGEIMIS  380

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ P+RA KTVI  L          +RL++        R    +E G    +++V    
Sbjct  381  NRNSPTRALKTVISVLQVHSEG----QRLSQSG----SGRNSDDNEPGAVICRESVHTVR  432

Query  258  EFRKLXGLLRMKSAXRFEPLDXDLE  184
            EFRKL GLLR+ S  + E     +E
Sbjct  433  EFRKLYGLLRLGSRRKEESYSGPIE  457



>ref|XP_006339806.1| PREDICTED: mitochondrial chaperone BCS1-like [Solanum tuberosum]
Length=449

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 69/94 (73%), Gaps = 3/94 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FP  DFNSFK LAN+YLGVK   LFP V  IF +GAT+SPA  GELM+V
Sbjct  339  LRPGRIDVHIHFPFCDFNSFKYLANNYLGVKEHKLFPQVEEIFHSGATMSPAAIGELMIV  398

Query  438  XRSXPSRAXKTVIXALX---TDGRPGGRWRRLTE  346
             RS PSRA K+VI AL    T+G+ GG+ +RL++
Sbjct  399  NRSSPSRALKSVITALQSNGTEGKIGGKGKRLSD  432



>ref|XP_009351948.1| PREDICTED: probable mitochondrial chaperone bcs1 isoform X2 [Pyrus 
x bretschneideri]
Length=479

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 85/142 (60%), Gaps = 5/142 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA++YLG+K   LFP V  IF  GA+LSPA  GE+M+ 
Sbjct  331  LRPGRVDVHIHFPLCDFSAFKSLASAYLGLKEHKLFPQVEEIFHGGASLSPAAIGEIMIS  390

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQG---CAPXKDTVP  268
             RS PSRA K+VI AL T+        ++ +     +  R  S DE G       ++++ 
Sbjct  391  NRSSPSRALKSVISALQTNVDSMKGANKVGQTLSNSSSGR--SVDESGEPSAVFCQESIH  448

Query  267  VAXEFRKLXGLLRMKSAXRFEP  202
               EFRKL GLLRM S  + EP
Sbjct  449  TVREFRKLYGLLRMGSRRKEEP  470



>ref|XP_009351947.1| PREDICTED: probable mitochondrial chaperone bcs1 isoform X1 [Pyrus 
x bretschneideri]
Length=490

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 85/142 (60%), Gaps = 5/142 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA++YLG+K   LFP V  IF  GA+LSPA  GE+M+ 
Sbjct  331  LRPGRVDVHIHFPLCDFSAFKSLASAYLGLKEHKLFPQVEEIFHGGASLSPAAIGEIMIS  390

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQG---CAPXKDTVP  268
             RS PSRA K+VI AL T+        ++ +     +  R  S DE G       ++++ 
Sbjct  391  NRSSPSRALKSVISALQTNVDSMKGANKVGQTLSNSSSGR--SVDESGEPSAVFCQESIH  448

Query  267  VAXEFRKLXGLLRMKSAXRFEP  202
               EFRKL GLLRM S  + EP
Sbjct  449  TVREFRKLYGLLRMGSRRKEEP  470



>ref|XP_004307905.1| PREDICTED: cell division control protein 48-like [Fragaria vesca 
subsp. vesca]
Length=493

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 82/139 (59%), Gaps = 1/139 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV I FPL DF++FK LAN+YLGVK   LFP V  IFQ+G +LSPA  GE+M+ 
Sbjct  333  MRPGRIDVHIHFPLCDFSAFKSLANTYLGVKEHKLFPQVEEIFQSGGSLSPAVIGEIMIS  392

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             RS PSRA K+VI AL TD        ++ +        R    +       +++V    
Sbjct  393  NRSSPSRALKSVISALQTDV-DNKTTVKVAQALTSSGSGRSEEGEGGSTVFCRESVHTVR  451

Query  258  EFRKLXGLLRMKSAXRFEP  202
            EFRKL GLLR+ S  + EP
Sbjct  452  EFRKLYGLLRLGSRRKEEP  470



>ref|XP_008376774.1| PREDICTED: probable mitochondrial chaperone bcs1 [Malus domestica]
Length=490

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 85/150 (57%), Gaps = 16/150 (11%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA++YLG+K   LF  V  IF  GA+LSPAE GELM+ 
Sbjct  331  LRPGRIDVHIHFPLCDFSAFKSLASTYLGLKEHKLFQQVEEIFHGGASLSPAEIGELMIS  390

Query  438  XRSXPSRAXKTVIXALXT--DGRPGGRWRRLTEXXXLXTPPRPISADEQG------CAPX  283
             RS PSRA K+VI AL T  D + G           L       S DE G      C   
Sbjct  391  NRSSPSRALKSVISALQTNVDSKKGAN----KAAQALTNSSSGRSVDESGEPGGVFC---  443

Query  282  KDTVPVAXEFRKLXGLLRMKSAXRFE-PLD  196
            +++V    EF+KL GL RM S  + E PLD
Sbjct  444  RESVHTVREFKKLYGLFRMGSRRKEESPLD  473



>ref|XP_003520880.1| PREDICTED: uncharacterized protein LOC100776680 [Glycine max]
Length=462

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 79/138 (57%), Gaps = 11/138 (8%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA+SYLGVK   LFP V  IFQ GA+LSPAE GELM+ 
Sbjct  317  LRPGRVDVHIHFPLCDFSAFKTLASSYLGVKEHKLFPQVQEIFQNGASLSPAEIGELMIA  376

Query  438  XRSXPSRAXKTVIXALXT--DGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPV  265
             R+ PSRA K+VI AL T  DGR  G   R TE   +  P      D   C    +T   
Sbjct  377  NRNSPSRAIKSVITALQTDGDGRGCGLIGRQTEDDEMDEP------DGVVCG---ETFHT  427

Query  264  AXEFRKLXGLLRMKSAXR  211
              + RKL G    +   R
Sbjct  428  VKDLRKLYGFFSFRVTRR  445



>emb|CDX80032.1| BnaA05g01240D [Brassica napus]
Length=715

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 80/146 (55%), Gaps = 15/146 (10%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LANSYLGVK   LFP V  IFQ GA+LSPAE GELM+ 
Sbjct  323  LRPGRVDVHIHFPLCDFTAFKTLANSYLGVKEHKLFPQVEGIFQNGASLSPAEIGELMIA  382

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAP--------X  283
             RS P+RA K VI AL  DG        +          R   A  +   P         
Sbjct  383  NRSSPTRALKYVINALQRDGN-------VRRSFLENGSRRSEDASSEMSGPLCGGGGGGG  435

Query  282  KDTVPVAXEFRKLXGLLRMKSAXRFE  205
              + P   EFRKL GLLR+KS+ + E
Sbjct  436  GGSSPGVKEFRKLYGLLRIKSSRKSE  461



>ref|XP_008376180.1| PREDICTED: mitochondrial chaperone BCS1 [Malus domestica]
Length=482

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 81/135 (60%), Gaps = 6/135 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA SYLGVK   LFP V  IF +G++LSPAE GELM+ 
Sbjct  331  LRPGRIDVHIHFPLCDFGAFKNLATSYLGVKEHKLFPQVEEIFLSGSSLSPAEIGELMIA  390

Query  438  XRSXPSRAXKTVIXALXT--DGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKD-TVP  268
             R+ PSRA K+VI AL T  DGR  G + R        T  R   + E G A   +  VP
Sbjct  391  NRNSPSRAIKSVITALQTDGDGRGAGVFGR---RVGFDTGSRKSESVEPGGAICGEGGVP  447

Query  267  VAXEFRKLXGLLRMK  223
               + RKL G LRMK
Sbjct  448  AVRDIRKLYGFLRMK  462



>gb|AET02010.2| P-loop nucleoside triphosphate hydrolase superfamily protein, 
putative [Medicago truncatula]
Length=457

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 81/142 (57%), Gaps = 15/142 (11%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FP+ DF+SFK LANSYLGVK   LFP V  IF+ GA+LSPAE GELM+ 
Sbjct  312  LRPGRVDVHIHFPVCDFSSFKALANSYLGVKEHKLFPAVDEIFRQGASLSPAEIGELMIA  371

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADE------QGCAPXKD  277
             R+ PSRA K+VI AL  DG   G    +          R I  D+      QG     D
Sbjct  372  NRNSPSRAIKSVIGALQMDGDGRGCGDMIV---------RRIEDDDVEDESNQGGLCGGD  422

Query  276  TVPVAXEFRKLXGLLRMKSAXR  211
                  + +K+ GLLR+++  R
Sbjct  423  GFSTVKDLKKIYGLLRLRNVKR  444



>ref|XP_009334380.1| PREDICTED: 26S protease regulatory subunit 8 homolog [Pyrus x 
bretschneideri]
Length=482

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 81/135 (60%), Gaps = 6/135 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA SYLG+K   LFP V  IF +G++LSPAE GELM+ 
Sbjct  331  LRPGRIDVHIHFPLCDFGAFKNLATSYLGLKEHKLFPQVEEIFLSGSSLSPAEIGELMIT  390

Query  438  XRSXPSRAXKTVIXALXT--DGRPGGRWRRLTEXXXLXTPPRPISADEQGCA-PXKDTVP  268
             R+ PSRA K+VI AL T  DGR  G + R        T  R   + E G A   +  VP
Sbjct  391  NRNSPSRAIKSVITALQTDGDGRGAGLFGR---RVGFDTGSRKSESGEPGGAFCGEGGVP  447

Query  267  VAXEFRKLXGLLRMK  223
               + RKL G LRMK
Sbjct  448  AVRDIRKLYGFLRMK  462



>ref|XP_003627534.1| Cell division cycle protein-like protein [Medicago truncatula]
Length=459

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 81/142 (57%), Gaps = 15/142 (11%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FP+ DF+SFK LANSYLGVK   LFP V  IF+ GA+LSPAE GELM+ 
Sbjct  314  LRPGRVDVHIHFPVCDFSSFKALANSYLGVKEHKLFPAVDEIFRQGASLSPAEIGELMIA  373

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADE------QGCAPXKD  277
             R+ PSRA K+VI AL  DG   G    +          R I  D+      QG     D
Sbjct  374  NRNSPSRAIKSVIGALQMDGDGRGCGDMIV---------RRIEDDDVEDESNQGGLCGGD  424

Query  276  TVPVAXEFRKLXGLLRMKSAXR  211
                  + +K+ GLLR+++  R
Sbjct  425  GFSTVKDLKKIYGLLRLRNVKR  446



>ref|XP_003553796.1| PREDICTED: mitochondrial chaperone BCS1-like [Glycine max]
Length=452

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 79/138 (57%), Gaps = 11/138 (8%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA+SYLGVK   LFP V  IFQ GA+LSPAE GELM+ 
Sbjct  310  LRPGRVDVHIHFPLCDFSAFKTLASSYLGVKEHKLFPQVQEIFQNGASLSPAEIGELMIA  369

Query  438  XRSXPSRAXKTVIXALXT--DGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPV  265
             R+ PSRA K+VI AL T  DGR  G   R T+   +  P      D   C     TV  
Sbjct  370  NRNSPSRAIKSVITALQTDGDGRGCGLIGRQTDDDEMDEP------DGVVCGEGLHTVK-  422

Query  264  AXEFRKLXGLLRMKSAXR  211
              + RKL    R +   R
Sbjct  423  --DLRKLYDFFRFRVTRR  438



>gb|AES72562.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=493

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 81/134 (60%), Gaps = 6/134 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIF-QTGATLSPAEXGELML  442
            LRPGR DV I FPL DF++FK LA+SYLG+K   LFP V  +F QTGA LSPAE GE+M+
Sbjct  337  LRPGRIDVHIHFPLCDFSTFKILASSYLGLKEHKLFPQVEEVFYQTGARLSPAEVGEIMI  396

Query  441  VXRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVA  262
              R+ PSRA KTVI A+       G  +RL+      +       ++      +++V   
Sbjct  397  SNRNSPSRALKTVITAMQVQSNGSG--QRLSHSGSGRSSEE---VNDTSAVICRESVHTV  451

Query  261  XEFRKLXGLLRMKS  220
             EFRKL GLLR+ S
Sbjct  452  REFRKLYGLLRLGS  465



>emb|CDP05017.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 79/135 (59%), Gaps = 14/135 (10%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR D  + FPL DFN+FK LANS+LGVK   LFP V  +FQ+GA+LSPAE GELM+ 
Sbjct  274  LRPGRIDFHLEFPLCDFNAFKSLANSHLGVKEHKLFPQVEEMFQSGASLSPAEIGELMIA  333

Query  438  XRSXPSRAXKTVIXALXT--DGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPX--KDT-  274
             R+ PSRA K+VI AL    D + G R  R              S +E G +    KD  
Sbjct  334  NRASPSRALKSVISALQNNADTKLGARMSRNGSVR---------SGEESGDSGILCKDAG  384

Query  273  VPVAXEFRKLXGLLR  229
            V    EFRKL G LR
Sbjct  385  VSTVKEFRKLYGFLR  399



>ref|XP_003602311.1| Mitochondrial chaperone BCS1 [Medicago truncatula]
Length=507

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 81/134 (60%), Gaps = 6/134 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIF-QTGATLSPAEXGELML  442
            LRPGR DV I FPL DF++FK LA+SYLG+K   LFP V  +F QTGA LSPAE GE+M+
Sbjct  329  LRPGRIDVHIHFPLCDFSTFKILASSYLGLKEHKLFPQVEEVFYQTGARLSPAEVGEIMI  388

Query  441  VXRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVA  262
              R+ PSRA KTVI A+       G  +RL+      +       ++      +++V   
Sbjct  389  SNRNSPSRALKTVITAMQVQSNGSG--QRLSHSGSGRSSEE---VNDTSAVICRESVHTV  443

Query  261  XEFRKLXGLLRMKS  220
             EFRKL GLLR+ S
Sbjct  444  REFRKLYGLLRLGS  457



>ref|XP_007147339.1| hypothetical protein PHAVU_006G115600g [Phaseolus vulgaris]
 gb|ESW19333.1| hypothetical protein PHAVU_006G115600g [Phaseolus vulgaris]
Length=478

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LANSYLGVK   LFP V  IFQ GA+LSPAE GELM+ 
Sbjct  336  LRPGRIDVHIHFPLCDFSAFKTLANSYLGVKEHKLFPQVQEIFQNGASLSPAEIGELMIA  395

Query  438  XRSXPSRAXKTVIXALXTDGRPGG  367
             R+ PSRA ++VI AL TDG   G
Sbjct  396  NRNSPSRAIRSVITALQTDGDGRG  419



>ref|XP_007217940.1| hypothetical protein PRUPE_ppa005000mg [Prunus persica]
 gb|EMJ19139.1| hypothetical protein PRUPE_ppa005000mg [Prunus persica]
Length=482

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 82/154 (53%), Gaps = 9/154 (6%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA SYLGVK   LF  V  IF  G++LSPAE GELM+ 
Sbjct  331  LRPGRIDVHIHFPLCDFGAFKNLATSYLGVKEHKLFSQVEEIFLNGSSLSPAEIGELMIA  390

Query  438  XRSXPSRAXKTVIXALXT--DGRPGGRWRRLTEXXXLXTPPRPISADEQ---GCAPXKDT  274
             R+ PSRA K+VI AL T  DGR  G + R           R  SADE    G     + 
Sbjct  391  NRNSPSRAIKSVITALQTDGDGRGIGMFGR---RVGFDVGSRK-SADEMVEPGGVFCGEG  446

Query  273  VPVAXEFRKLXGLLRMKSAXRFEPLDXDLESIQR  172
                 +FRKL G LRMKS         D  S  R
Sbjct  447  AHTVRDFRKLYGFLRMKSNRSSHSQSFDAGSANR  480



>gb|KJB19872.1| hypothetical protein B456_003G122600 [Gossypium raimondii]
Length=473

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 81/141 (57%), Gaps = 9/141 (6%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF  FK LAN+YLGVK   LFP +  IFQ GA+LSPAE GE+M+ 
Sbjct  332  LRPGRIDVHIQFPLCDFPCFKHLANNYLGVKEHKLFPQLEEIFQGGASLSPAEIGEIMIS  391

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             RS P+RA K+VI A+ T+   G + RR++                      +D      
Sbjct  392  NRSSPTRALKSVISAMQTNA--GAKSRRVSGDGAEEIGGGEQGGLFSREHSVRD------  443

Query  258  EFRKLXGLLRMKSAXRFEPLD  196
             FRKL GLL+M S  + EPLD
Sbjct  444  -FRKLYGLLKMGSRRKDEPLD  463



>ref|XP_003626582.1| Mitochondrial chaperone BCS1 [Medicago truncatula]
 gb|AES82800.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=468

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF+SFK LA++YLGVK   LFP V  IF+ GA+LSPAE GELM+ 
Sbjct  329  LRPGRVDVHIHFPLCDFSSFKTLASNYLGVKDHKLFPQVQEIFENGASLSPAEIGELMIA  388

Query  438  XRSXPSRAXKTVIXALXTDGRPGG  367
             R+ PSRA KTVI AL TDG   G
Sbjct  389  NRNSPSRAIKTVITALKTDGDGRG  412



>ref|XP_011084544.1| PREDICTED: mitochondrial chaperone BCS1-like [Sesamum indicum]
Length=486

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 84/149 (56%), Gaps = 5/149 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA+S+LG+K   LFP V  IFQTGATLSPAE  E+M+ 
Sbjct  332  LRPGRIDVHINFPLCDFTAFKSLASSHLGLKDHKLFPQVEEIFQTGATLSPAEICEIMIS  391

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R  PSRA KTVI AL TD    GR RR           R +   E+     ++ +    
Sbjct  392  NRGSPSRALKTVITALQTD--LAGRVRRRLSGSG---SGRVVDETEESGKEGQNGIHPMK  446

Query  258  EFRKLXGLLRMKSAXRFEPLDXDLESIQR  172
            E +   G L+ +S+ +      D+E ++R
Sbjct  447  EIKNFYGFLKSRSSRKASLDKFDVEPVER  475



>ref|XP_010662911.1| PREDICTED: 26S protease regulatory subunit 6B-like [Vitis vinifera]
Length=475

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 82/141 (58%), Gaps = 7/141 (5%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV + F L DF+SFK LA+S+LG+K   LFP V  IFQTGA+L PAE GE+M  
Sbjct  329  LRPGRIDVHVQFGLCDFSSFKMLADSHLGIKEHRLFPQVEEIFQTGASLCPAEIGEIMTS  388

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+  +RA K+VI AL T+     R  + +          P      G    +++V    
Sbjct  389  NRNSATRALKSVINALQTNTANKIRLTQSSSGRSTEESAEP------GGVICRESVHTVR  442

Query  258  EFRKLXGLLRMKSAXRFEPLD  196
            EFRKL GLLR +S  + EPLD
Sbjct  443  EFRKLYGLLR-RSGRKEEPLD  462



>ref|XP_009375440.1| PREDICTED: mitochondrial chaperone BCS1-like [Pyrus x bretschneideri]
Length=481

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 75/132 (57%), Gaps = 0/132 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA SYLGVK   LF  V  IF +G++LSPAE GELM+ 
Sbjct  330  LRPGRIDVHIHFPLCDFGAFKHLATSYLGVKEHKLFSQVEEIFLSGSSLSPAEIGELMIA  389

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ PSRA K+VI AL TDG   G               +  S +  G    +  VP   
Sbjct  390  NRNSPSRAIKSVITALQTDGDRRGAGVCGKRVGFDVGSTKSESGEPGGMFCREGGVPAVR  449

Query  258  EFRKLXGLLRMK  223
            + RKL G LRMK
Sbjct  450  DIRKLYGFLRMK  461



>gb|KCW46602.1| hypothetical protein EUGRSUZ_K00412 [Eucalyptus grandis]
Length=323

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 78/140 (56%), Gaps = 2/140 (1%)
 Frame = -1

Query  615  RPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLVX  436
            RPGR DV + FPL DF++FK LA++YLG+K   LFP V  IFQ GA LSPA  GE+M+  
Sbjct  171  RPGRIDVHVHFPLCDFSAFKGLASNYLGLKEHKLFPQVEEIFQAGARLSPAHIGEIMIAN  230

Query  435  RSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAXE  256
            RS P+RA KTVI AL +     GR         L        A E      +++V    E
Sbjct  231  RSSPTRALKTVIGALQSSSE--GREVLSKNGATLTGSRSGREAAEPASVFCRESVHTVRE  288

Query  255  FRKLXGLLRMKSAXRFEPLD  196
            F KL GLL+M S  R   +D
Sbjct  289  FGKLYGLLKMGSRRRDNSMD  308



>ref|XP_008233091.1| PREDICTED: mitochondrial chaperone BCS1 [Prunus mume]
Length=482

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 81/154 (53%), Gaps = 9/154 (6%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA SYLGVK   LF  V  IF  G++LSPAE GELM+ 
Sbjct  331  LRPGRIDVHIHFPLCDFGAFKNLATSYLGVKEHKLFSQVEEIFLNGSSLSPAEIGELMIA  390

Query  438  XRSXPSRAXKTVIXALXT--DGRPGGRWRRLTEXXXLXTPPRPISADEQ---GCAPXKDT  274
             R+ PSRA K+VI AL T  DGR  G + R           R  S DE    G     + 
Sbjct  391  NRNSPSRAIKSVITALQTDGDGRGIGMFGR---RVGFDVGSRK-SGDEMVEPGGVFCGEG  446

Query  273  VPVAXEFRKLXGLLRMKSAXRFEPLDXDLESIQR  172
                 +FRKL G LRMKS         D  S  R
Sbjct  447  AHTVRDFRKLYGFLRMKSNRSSHSQSFDAGSANR  480



>ref|XP_008362649.1| PREDICTED: mitochondrial chaperone BCS1-like [Malus domestica]
Length=480

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 75/132 (57%), Gaps = 0/132 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA SYLGVK   LF  V  IF +G++LSPAE GELM+ 
Sbjct  329  LRPGRIDVHIHFPLCDFGAFKHLATSYLGVKEHKLFSQVEEIFLSGSSLSPAEIGELMIA  388

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ PSRA K+VI AL TDG   G               +  S +  G    +  VP   
Sbjct  389  NRNSPSRAIKSVITALQTDGDRRGAGXCGRRVGFDVGSRKCESGEPGGMFCGEGGVPAVR  448

Query  258  EFRKLXGLLRMK  223
            + RKL G LRMK
Sbjct  449  DIRKLYGFLRMK  460



>emb|CBI23057.3| unnamed protein product [Vitis vinifera]
Length=700

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 82/141 (58%), Gaps = 7/141 (5%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV + F L DF+SFK LA+S+LG+K   LFP V  IFQTGA+L PAE GE+M  
Sbjct  554  LRPGRIDVHVQFGLCDFSSFKMLADSHLGIKEHRLFPQVEEIFQTGASLCPAEIGEIMTS  613

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+  +RA K+VI AL T+     R  + +          P      G    +++V    
Sbjct  614  NRNSATRALKSVINALQTNTANKIRLTQSSSGRSTEESAEP------GGVICRESVHTVR  667

Query  258  EFRKLXGLLRMKSAXRFEPLD  196
            EFRKL GLLR +S  + EPLD
Sbjct  668  EFRKLYGLLR-RSGRKEEPLD  687



>ref|XP_010035300.1| PREDICTED: uncharacterized protein LOC104424536 [Eucalyptus grandis]
Length=489

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 78/140 (56%), Gaps = 2/140 (1%)
 Frame = -1

Query  615  RPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLVX  436
            RPGR DV + FPL DF++FK LA++YLG+K   LFP V  IFQ GA LSPA  GE+M+  
Sbjct  337  RPGRIDVHVHFPLCDFSAFKGLASNYLGLKEHKLFPQVEEIFQAGARLSPAHIGEIMIAN  396

Query  435  RSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAXE  256
            RS P+RA KTVI AL +     GR         L        A E      +++V    E
Sbjct  397  RSSPTRALKTVIGALQSSSE--GREVLSKNGATLTGSRSGREAAEPASVFCRESVHTVRE  454

Query  255  FRKLXGLLRMKSAXRFEPLD  196
            F KL GLL+M S  R   +D
Sbjct  455  FGKLYGLLKMGSRRRDNSMD  474



>ref|XP_009382317.1| PREDICTED: uncharacterized protein LOC103970312 [Musa acuminata 
subsp. malaccensis]
Length=517

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 81/145 (56%), Gaps = 10/145 (7%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA+SYLG+K   L+P V  +FQ GA +SPAE GE+M+ 
Sbjct  348  LRPGRLDVHIHFPLCDFTAFKTLASSYLGLKDHKLYPQVEEVFQGGARISPAEVGEIMIA  407

Query  438  XRSXPSRAXKTVIXALXTDGRPGGR-------WRRLTEXXXLXTPPRPISADEQGCAPXK  280
             R+ PSRA K+VI AL       GR        RR  +            +   G    K
Sbjct  408  NRASPSRALKSVISALHQSSSAAGRRLSESGSGRRWDDAAAGSDCGNGGGSGNGGLGFGK  467

Query  279  DTVPVAXEFRKLXGLLRMKSAXRFE  205
            +++    EF+KL GL++M+S  + E
Sbjct  468  ESIK---EFKKLYGLIKMRSGSKKE  489



>ref|XP_007221060.1| hypothetical protein PRUPE_ppa016223mg, partial [Prunus persica]
 gb|EMJ22259.1| hypothetical protein PRUPE_ppa016223mg, partial [Prunus persica]
Length=396

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV I FPL DF++FK LA++YLGVK   LFP V  IFQ+G +LSPAE GE+M+ 
Sbjct  310  MRPGRVDVHIQFPLCDFSAFKSLASTYLGVKEHKLFPQVEEIFQSGGSLSPAEIGEIMIS  369

Query  438  XRSXPSRAXKTVIXALXTDG  379
             RS PSRA K+VI AL T+ 
Sbjct  370  NRSSPSRALKSVISALQTNA  389



>gb|EYU19673.1| hypothetical protein MIMGU_mgv1a027053mg [Erythranthe guttata]
Length=470

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 79/148 (53%), Gaps = 5/148 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV I FPL DF +FK LA S+LG+K   LF  V  IFQTGATLSPAE  E+M+ 
Sbjct  319  IRPGRIDVHINFPLCDFTAFKSLAGSHLGLKDHKLFHQVEEIFQTGATLSPAEICEIMIS  378

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R  PSRA KTVI AL   G   GR  R        +       DE          P+  
Sbjct  379  NRGSPSRALKTVITAL--QGNLAGRIGRRLSGSGSGSGRYTEETDEHAKEGQSGIHPMK-  435

Query  258  EFRKLXGLLRMKSAXR--FEPLDXDLES  181
            E + L GLLR +S+ +   +  D D E+
Sbjct  436  EIKNLYGLLRARSSRKASLDKFDVDPEN  463



>ref|XP_003529879.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max]
Length=476

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 78/137 (57%), Gaps = 9/137 (7%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FP+ DF++FK LA+SYLGV+   LF  V  IF+ GATLSPAE  ELM+ 
Sbjct  337  LRPGRVDVHIHFPVCDFSAFKTLASSYLGVREHKLFAQVEDIFRHGATLSPAEISELMIA  396

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAP-XKDTVPVA  262
             R+ PSRA K+VI AL +DG   GR           +  R I  D+   AP   D     
Sbjct  397  NRNSPSRAIKSVIGALQSDGE--GR------RSYADSIGRRIEGDDVDEAPCGGDGFSTV  448

Query  261  XEFRKLXGLLRMKSAXR  211
             + RK  G  ++++  R
Sbjct  449  KDLRKFYGFFKLRNPRR  465



>ref|XP_010693170.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Beta vulgaris 
subsp. vulgaris]
Length=476

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 80/143 (56%), Gaps = 5/143 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA++YLGVK   LF  V  +F +G T+S AE GELM+V
Sbjct  333  LRPGRVDVHIYFPLCDFSNFKNLASNYLGVKDHKLFSQVEEMFNSGVTMSQAEIGELMMV  392

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPI--SADEQGCAPXKDTVPV  265
             R+ PSRA K+VI AL T         + T      +    +  S D  G    +D V  
Sbjct  393  NRNSPSRAIKSVIYALQTTSSAVLESCKGTPRNGFKSGRESVDESGDPVGGIGCRDGVK-  451

Query  264  AXEFRKLXGLLRMKSAXRFEPLD  196
              E RKL GLLR KS  + +  D
Sbjct  452  --EIRKLYGLLRRKSGRKSDSFD  472



>ref|XP_008437620.1| PREDICTED: mitochondrial chaperone BCS1-like [Cucumis melo]
Length=447

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV + FP  DF++FK LA SYLGVK   LF  V  IFQ+GAT+SPAE GE+M+ 
Sbjct  303  LRPGRVDVHLQFPACDFSTFKGLAMSYLGVKDHKLFSQVEEIFQSGATMSPAEIGEIMIA  362

Query  438  XRSXPSRAXKTVIXALXTDG  379
             RS PSRA K++I AL  DG
Sbjct  363  NRSSPSRALKSIITALQMDG  382



>ref|XP_010919325.1| PREDICTED: uncharacterized protein LOC105043468 [Elaeis guineensis]
Length=489

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 80/138 (58%), Gaps = 9/138 (7%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA+S LG+K   L+P V   FQ GA LSPAE GE+M+ 
Sbjct  337  LRPGRLDVHIHFPLCDFSAFKTLASSCLGLKDHKLYPQVEEGFQNGAQLSPAEVGEIMIA  396

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R  PSRA K+VI AL      GG  R+L+E                G    KD++ +  
Sbjct  397  NRGSPSRAIKSVIGALQQSTNGGGG-RKLSESWS-------TEGGGGGLGLGKDSMTM-R  447

Query  258  EFRKLXGLLRMKSAXRFE  205
            EFRKL GL++MK   + E
Sbjct  448  EFRKLYGLIKMKYGGKRE  465



>ref|XP_010933795.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
Length=497

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 81/140 (58%), Gaps = 9/140 (6%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FP+ DF++FK LA+SYLG+K   L+P V  +FQ GA LSPAE  E+M+ 
Sbjct  345  LRPGRLDVHIHFPMCDFSAFKTLASSYLGLKDHKLYPQVEEVFQNGAQLSPAEVSEIMIA  404

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPIS--ADEQGCAPXKDTVPV  265
             R  P+RA K+VI AL   G      R+L+E           S  +   G    +D+  +
Sbjct  405  NRGSPTRAIKSVISALQQSG------RKLSESRSGRRTEETGSEWSGGGGLGFGRDSTTM  458

Query  264  AXEFRKLXGLLRMKSAXRFE  205
              EFRKL G ++M+S  + E
Sbjct  459  -REFRKLYGFIKMRSGSKKE  477



>ref|XP_008803962.1| PREDICTED: uncharacterized protein LOC103717381 [Phoenix dactylifera]
Length=499

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 76/138 (55%), Gaps = 9/138 (7%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK +A+ YLG++   L+P V   FQ GA LSPAE GE+M+ 
Sbjct  347  LRPGRLDVHIHFPLCDFSAFKTMASRYLGLEDHKLYPQVEEGFQYGAQLSPAEVGEIMIA  406

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R  PSRA K+VI AL      GG  R+L E                     KD   +  
Sbjct  407  NRVSPSRAIKSVISALQQSTNGGGG-RKLCESW-------STEGGGGELGFGKDFTTM-R  457

Query  258  EFRKLXGLLRMKSAXRFE  205
            EFRKL GLL+MK   R E
Sbjct  458  EFRKLYGLLKMKYGSRKE  475



>ref|XP_002321380.2| hypothetical protein POPTR_0015s01020g [Populus trichocarpa]
 gb|EEF05507.2| hypothetical protein POPTR_0015s01020g [Populus trichocarpa]
Length=496

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 78/146 (53%), Gaps = 6/146 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LAN+YLGVK   LF  V  I Q G++L+PAE GE+M+ 
Sbjct  338  LRPGRVDVHIQFPLCDFSAFKSLANNYLGVKEHKLFSLVEEILQGGSSLTPAEIGEIMIS  397

Query  438  XRSXPSRAXKTVIXAL-----XTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDT  274
             R+ PSRA + VI AL       D R   +  +           R  + +  G    +  
Sbjct  398  NRNSPSRALRLVISALQFQTSSGDARRASKVGQGMSESGSARSSRDETGETGGVFCQESG  457

Query  273  VPVAXEFRKLXGLLRMKSAXRFEPLD  196
                 E +KL GLLRM S  R E +D
Sbjct  458  AHTVKELKKLYGLLRMGS-RRKESVD  482



>ref|XP_002318453.2| hypothetical protein POPTR_0012s02770g [Populus trichocarpa]
 gb|EEE96673.2| hypothetical protein POPTR_0012s02770g [Populus trichocarpa]
Length=488

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 83/148 (56%), Gaps = 9/148 (6%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQT-GATLSPAEXGELML  442
            LRPGR DV I FPL +F++FK LAN+YLGVK   LF  V  I Q  G++LSPAE GE+M+
Sbjct  329  LRPGRVDVHIQFPLCNFSAFKSLANNYLGVKEHKLFSQVEEILQYGGSSLSPAEIGEIMI  388

Query  441  VXRSXPSRAXKTVIXALXTDGRPGGR------WRRLTEXXXLXTPPRPISADEQGCAPXK  280
              R+ P+RA K+VI AL +    G         +R+T      +  R  + +  G    +
Sbjct  389  SNRNSPTRALKSVISALQSQTNSGDLRGPSKVGQRMTGSRSARS-SRDETGETGGVFSQE  447

Query  279  DTVPVAXEFRKLXGLLRMKSAXRFEPLD  196
             +V    EF+ L GL RM S  R E +D
Sbjct  448  SSVHAVREFKTLYGLWRMGS-RRKESMD  474



>ref|XP_011075926.1| PREDICTED: uncharacterized protein LOC105160305 [Sesamum indicum]
Length=489

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 78/136 (57%), Gaps = 4/136 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LANS+LG+K   LFP V  IFQTGA+LS AE  E+M+ 
Sbjct  333  LRPGRIDVHINFPLCDFTAFKSLANSHLGLKDHKLFPQVEEIFQTGASLSQAEICEIMIS  392

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R  PSRA KTVI AL ++    GR  R+     L +        E G        P+  
Sbjct  393  NRGSPSRALKTVIAALQSE--LAGRV-RMRMMKGLGSGRGVEECGEFGREGQNGIHPIK-  448

Query  258  EFRKLXGLLRMKSAXR  211
            E + L GLLR +S+ +
Sbjct  449  EIKNLYGLLRARSSRK  464



>gb|KDO59683.1| hypothetical protein CISIN_1g044297mg, partial [Citrus sinensis]
Length=440

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 87/149 (58%), Gaps = 7/149 (5%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV + FPL DF++FK LA +YLGVK   LF  V   FQ G++LSPA+ GEL++ 
Sbjct  291  MRPGRIDVKVEFPLCDFSTFKNLAGNYLGVKDHKLFGQVEEGFQNGSSLSPAQIGELLIS  350

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ P+RA K+VI AL    +P  +  ++          +P+  D   C   +++V    
Sbjct  351  NRTSPTRAFKSVITALQQH-QPNKQVEKVGAKSSDHGSGQPMD-DGLLC---RESVHTVR  405

Query  258  EFRKLXGLLRMKSAXRFEPLDXDLESIQR  172
            EFRKL GLL  K + R E    DL SI++
Sbjct  406  EFRKLYGLL--KGSRRKEEPPLDLSSIEK  432



>ref|XP_011043686.1| PREDICTED: ATP-dependent zinc metalloprotease YME1 homolog [Populus 
euphratica]
Length=496

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 83/148 (56%), Gaps = 9/148 (6%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQT-GATLSPAEXGELML  442
            LRPGR DV I FPL +F++FK LAN+YLGVK   LF  V  I Q  G++LSPAE GE+M+
Sbjct  337  LRPGRVDVHIQFPLCNFSAFKSLANNYLGVKEHKLFSQVEEILQYGGSSLSPAEIGEIMI  396

Query  441  VXRSXPSRAXKTVIXALXTDGRPGGR------WRRLTEXXXLXTPPRPISADEQGCAPXK  280
              R+ P+RA K+VI AL +    G         +R+T      +  R  + +  G    +
Sbjct  397  SNRNSPTRALKSVISALQSQTNSGDLRGPSKVGQRMTGSRSARS-SRDETGETGGAFNQE  455

Query  279  DTVPVAXEFRKLXGLLRMKSAXRFEPLD  196
             +V    EF+ L GL RM S  R E +D
Sbjct  456  SSVHAVREFKTLYGLWRMGS-RRKESMD  482



>ref|XP_004160408.1| PREDICTED: mitochondrial chaperone BCS1-like [Cucumis sativus]
Length=501

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV + FP  DF++FK LA S+LGVK   LF  V  IFQ G ++SPAE GE+M+ 
Sbjct  360  LRPGRVDVHLQFPACDFSTFKTLAMSHLGVKDHKLFSQVEEIFQNGGSMSPAEIGEIMIA  419

Query  438  XRSXPSRAXKTVIXALXTDGRPGG-RW  361
             RS PSRA K++I AL  DG   G +W
Sbjct  420  NRSSPSRALKSIITALQMDGSGNGFKW  446



>ref|XP_004145938.1| PREDICTED: uncharacterized protein LOC101204309 [Cucumis sativus]
Length=519

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV + FP  DF++FK LA S+LGVK   LF  V  IFQ G ++SPAE GE+M+ 
Sbjct  378  LRPGRVDVHLQFPACDFSTFKTLAMSHLGVKDHKLFSQVEEIFQNGGSMSPAEIGEIMIA  437

Query  438  XRSXPSRAXKTVIXALXTDGRPGG-RW  361
             RS PSRA K++I AL  DG   G +W
Sbjct  438  NRSSPSRALKSIITALQMDGSGNGFKW  464



>gb|KGN49849.1| hypothetical protein Csa_5G139270 [Cucumis sativus]
Length=524

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV + FP  DF++FK LA S+LGVK   LF  V  IFQ G ++SPAE GE+M+ 
Sbjct  383  LRPGRVDVHLQFPACDFSTFKTLAMSHLGVKDHKLFSQVEEIFQNGGSMSPAEIGEIMIA  442

Query  438  XRSXPSRAXKTVIXALXTDGRPGG-RW  361
             RS PSRA K++I AL  DG   G +W
Sbjct  443  NRSSPSRALKSIITALQMDGSGNGFKW  469



>ref|XP_006441187.1| hypothetical protein CICLE_v10023517mg [Citrus clementina]
 gb|ESR54427.1| hypothetical protein CICLE_v10023517mg [Citrus clementina]
Length=480

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 87/149 (58%), Gaps = 7/149 (5%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV + FPL DF++FK LA +YLGVK   LF  V   FQ G++LSPA+ GEL++ 
Sbjct  331  MRPGRIDVKVEFPLCDFSTFKNLAGNYLGVKDHKLFGQVEEGFQNGSSLSPAQIGELLIS  390

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ P+RA K+VI AL    +P  +  ++          +P+  D   C   +++V    
Sbjct  391  NRTSPTRAFKSVITALQQH-QPNKQVEKVGAKSSDHGSGQPMD-DGLLC---RESVHTVR  445

Query  258  EFRKLXGLLRMKSAXRFEPLDXDLESIQR  172
            EFRKL GLL  K + R E    DL SI++
Sbjct  446  EFRKLYGLL--KGSRRKEEPPLDLSSIEK  472



>ref|XP_008790554.1| PREDICTED: nuclear valosin-containing protein-like [Phoenix dactylifera]
Length=511

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 82/145 (57%), Gaps = 9/145 (6%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FP+ DF++FK LA+SYLG+K   L+P V   FQ GA LSPA   E+M+ 
Sbjct  345  LRPGRLDVHIHFPMCDFSAFKTLASSYLGLKDHKLYPQVEEGFQNGAQLSPAVVSEIMIA  404

Query  438  XRSXPSRAXKTVIXALXTDGRPGGR-----WRRLTEXXX--LXTPPRPISADEQGCAPXK  280
             R  P+RA K+VI AL      GGR      R+L+E          R   +   G    K
Sbjct  405  NRGSPTRAIKSVISALQQSA-DGGRVGAAAARKLSESGSGRRTDESRGEWSSGGGLGFGK  463

Query  279  DTVPVAXEFRKLXGLLRMKSAXRFE  205
            D++ +  EFRKL G ++M+S  + E
Sbjct  464  DSMTM-REFRKLYGFIKMRSGSKKE  487



>gb|KHN35399.1| Putative mitochondrial chaperone bcs1 [Glycine soja]
Length=388

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA+SYLGVK   LFP V  IFQ GA+LSPAE GELM+ 
Sbjct  310  LRPGRVDVHIHFPLCDFSAFKTLASSYLGVKEHKLFPQVQEIFQNGASLSPAEIGELMIA  369

Query  438  XRSXPSRAXKT  406
             R+ PSRA K+
Sbjct  370  NRNSPSRAIKS  380



>ref|XP_006491957.1| PREDICTED: mitochondrial chaperone BCS1-like [Citrus sinensis]
Length=482

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 87/149 (58%), Gaps = 7/149 (5%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV + FPL DF++FK LA +YLGVK   LF  V   FQ G++LSPA+ GEL++ 
Sbjct  333  MRPGRIDVKVEFPLCDFSTFKNLAGNYLGVKDHKLFGQVEEGFQNGSSLSPAQIGELLIS  392

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R+ P+RA K+VI AL    +P  +  ++          +P+  D   C   +++V    
Sbjct  393  NRTSPTRAFKSVITALQQH-QPNKQVEKVGAKSSDNGSGQPMD-DGLLC---RESVHTVR  447

Query  258  EFRKLXGLLRMKSAXRFEPLDXDLESIQR  172
            EFRKL GLL  K + R E    DL SI++
Sbjct  448  EFRKLYGLL--KGSRRKEEPPLDLSSIEK  474



>ref|XP_006849190.1| hypothetical protein AMTR_s00027p00211720 [Amborella trichopoda]
 gb|ERN10771.1| hypothetical protein AMTR_s00027p00211720 [Amborella trichopoda]
Length=466

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 75/145 (52%), Gaps = 10/145 (7%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV + FP   F +FK +ANSYLGVK   LFP V   F +G  L+PAE GE+++V
Sbjct  317  LRPGRLDVQVCFPHCTFPAFKAMANSYLGVKDHKLFPHVKESFDSGGVLTPAEIGEILMV  376

Query  438  XRSXPSRAXKTVIXALXTDGRP--------GGRWRRLTEXXXLXTPPRPISADEQGCAPX  283
             +S PSRA K+VI AL +  R         G R  R        + P   S   + C   
Sbjct  377  NKSSPSRAIKSVINALQSSSRSCKLAVNSAGNRAGRGVGFGERQSSPEEGSP--ENCGVI  434

Query  282  KDTVPVAXEFRKLXGLLRMKSAXRF  208
            K  V    E +KL   LR+KS  + 
Sbjct  435  KREVQSVLELKKLYSFLRLKSGRKL  459



>ref|XP_011044701.1| PREDICTED: uncharacterized protein LOC105139793 [Populus euphratica]
Length=496

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 78/146 (53%), Gaps = 6/146 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LAN+YLGVK   LF  V  I Q G++L+PAE GE+M+ 
Sbjct  338  LRPGRVDVHIQFPLCDFSAFKSLANNYLGVKEHKLFSLVEEILQGGSSLTPAEIGEIMIS  397

Query  438  XRSXPSRAXKTVIXALXT-----DGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDT  274
             R+ PSRA + VI AL       D R   +  +           R  + +  G    +  
Sbjct  398  NRNSPSRALRLVISALQFQTSSGDARRASKVGQGMSESRSARSSRDETGETGGVFCQESG  457

Query  273  VPVAXEFRKLXGLLRMKSAXRFEPLD  196
                 E +KL GLLRM S  R E +D
Sbjct  458  AHTVKELKKLYGLLRMGS-RRKESVD  482



>ref|XP_009411477.1| PREDICTED: uncharacterized protein LOC103993224 [Musa acuminata 
subsp. malaccensis]
Length=498

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 78/138 (57%), Gaps = 4/138 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA+SYLG+K   L+P V   F +GA +SPAE GE+M+ 
Sbjct  343  LRPGRLDVHIHFPLCDFTAFKTLASSYLGLKDHKLYPQVEEGFHSGARISPAEVGEIMMA  402

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTVPVAX  259
             R  P+RA K+VI AL       GR    +        P    +   G    K+++    
Sbjct  403  NRGSPNRALKSVISALQQASSNAGRNPSESGSGRRWEDP-AAGSGGGGLGFGKESI---K  458

Query  258  EFRKLXGLLRMKSAXRFE  205
            EF+KL G+++MKS  + E
Sbjct  459  EFKKLYGMIKMKSGSKKE  476



>ref|XP_007135287.1| hypothetical protein PHAVU_010G116600g [Phaseolus vulgaris]
 gb|ESW07281.1| hypothetical protein PHAVU_010G116600g [Phaseolus vulgaris]
Length=477

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV I FP+ DF++FK LA+SYLGV+   LF  V  IF+ G +LSPAE  ELM+ 
Sbjct  338  MRPGRVDVHIHFPVCDFSAFKTLASSYLGVREHKLFAQVENIFRHGGSLSPAEISELMIA  397

Query  438  XRSXPSRAXKTVIXALXTDG  379
             R+ PSRA K+VI AL +DG
Sbjct  398  NRNSPSRAIKSVIGALQSDG  417



>gb|KHN19527.1| Mitochondrial chaperone BCS1 [Glycine soja]
Length=218

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF++FK LA+SYLG+K   LFP V  +FQTGA LSPAE GE+M+ 
Sbjct  142  LRPGRIDVHIHFPLCDFSTFKILASSYLGLKEHKLFPQVEEVFQTGARLSPAELGEIMIS  201

Query  438  XRSXPSRAXK  409
             R+ P+RA K
Sbjct  202  NRNSPTRALK  211



>ref|XP_009775982.1| PREDICTED: uncharacterized protein LOC104225813 [Nicotiana sylvestris]
Length=512

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 86/177 (49%), Gaps = 35/177 (20%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR D  I FPL DFN+FK LA S+LG+K   LFP V  IFQTG+ LSPAE  E+M+ 
Sbjct  326  LRPGRIDFHIHFPLCDFNTFKSLATSHLGLKDHKLFPQVEEIFQTGSVLSPAEISEIMIS  385

Query  438  XRSXPSRAXKTVIXALXTD-----GRPGGRWRRL----TEXXXLXTPP---------RPI  313
             RS PS A K VI A  ++      R   + + +     E      PP         RP+
Sbjct  386  NRSSPSWALKLVISAHQSNSKLVPSRTSDKIKTILQSNIEADVATKPPLWLSKSRSVRPV  445

Query  312  SADE---QGCAPXKDTVPV-------------AXEFRKLXGLLRMKSAXRFEPLDXD  190
                   QG +  +   PV               E RK  GL+R++S+ R + LD D
Sbjct  446  EESGVFPQGLSKSQSVRPVNELVDSSTFGKESVNELRKFYGLIRIRSS-RKKSLDLD  501



>ref|XP_006367360.1| PREDICTED: uncharacterized protein LOC102582634 [Solanum tuberosum]
Length=509

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 82/176 (47%), Gaps = 34/176 (19%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR D  I FPL DFN+FK LANS+LG+K   LFP V   FQTG+ LSPAE  E+M+ 
Sbjct  331  LRPGRIDHHIHFPLCDFNAFKSLANSHLGLKDHKLFPQVEENFQTGSVLSPAEISEIMIS  390

Query  438  XRSXPSRAXKTVIXALXTD-----GRPGGRWRRLTEXXXLXTPP------------RPIS  310
             RS PSRA K VI    ++      R   +   +         P            RP+ 
Sbjct  391  NRSSPSRALKLVISTHQSNSKLVPSRTSDKIEMIHNNIEADLAPKHPLWLSKSRSVRPVE  450

Query  309  ADE------QGCAPXKDTVPV----------AXEFRKLXGLLRMKSAXRFEPLDXD  190
                     QG    K   P+            + RK  GL+R+KS+ R + LD D
Sbjct  451  ESSESDKYPQGLIKSKSVRPMVESGAFGKESVNDLRKFYGLIRIKSS-RKKSLDFD  505



>ref|XP_010322229.1| PREDICTED: uncharacterized protein LOC101262523 [Solanum lycopersicum]
Length=512

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 83/179 (46%), Gaps = 37/179 (21%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR D  I FPL DFN+FK LANS+LG+K   LFP V   FQTG+ LSPAE  E+M+ 
Sbjct  331  LRPGRIDHHIHFPLCDFNAFKSLANSHLGMKDHKLFPRVEENFQTGSVLSPAEISEIMIS  390

Query  438  XRSXPSRAXKTVIXALXTDG-----RPGGRWRRLTEXXXLXTPP---------RPISADE  301
             RS PSRA K VI +  +       R   +   +         P         R + A E
Sbjct  391  NRSSPSRALKLVISSHQSKSKLITLRTSDKIETINSNIETNVAPKHPLWLSKSRSVRAVE  450

Query  300  ---------QGCAPXKDTVPV-------------AXEFRKLXGLLRMKSAXRFEPLDXD  190
                     QG    K   P+               + RK  GL+R+KS+ R + LD D
Sbjct  451  KSGELDKYPQGLIKSKSVRPMVESGDSGTFGKESVNDLRKFYGLIRIKSS-RKKSLDFD  508



>ref|XP_008664748.1| PREDICTED: transitional endoplasmic reticulum ATPase-like [Zea 
mays]
 tpg|DAA49287.1| TPA: hypothetical protein ZEAMMB73_293837 [Zea mays]
Length=504

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I F + DF +FK LA+SYLG+K   L+P V   FQ GA LSPAE GE+ML 
Sbjct  337  LRPGRLDVHIHFTMCDFEAFKALASSYLGLKDHKLYPQVEEGFQAGARLSPAELGEIMLA  396

Query  438  XRSXPSRAXKTVIXAL  391
             R  PSRA +TVI AL
Sbjct  397  NRGSPSRALRTVISAL  412



>ref|XP_006649262.1| PREDICTED: uncharacterized protein LOC102709999 [Oryza brachyantha]
Length=514

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 79/174 (45%), Gaps = 47/174 (27%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV I F L DF +FK LA++YLG+K   L+P V   F +GA LSPAE GE+ML 
Sbjct  334  VRPGRLDVHIQFTLCDFEAFKALASNYLGLKDHKLYPQVEESFHSGARLSPAELGEIMLA  393

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRP-------------------  316
             RS PSRA + VI              +L        PPRP                   
Sbjct  394  NRSSPSRALRNVIT-------------KLQHVSGAAAPPRPPHRRNTSWSGAGGPWDEQS  440

Query  315  --ISADEQGCAPXKDTVPVA----------XEFRKLXGLLRMKS---AXRFEPL  199
               SAD         T P A           EF+KL GL++++S   A  F PL
Sbjct  441  ARTSADTADAGEEAVTAPAACGVFAKDAPMREFKKLYGLIKIRSRKEAAGFMPL  494



>gb|ABR16249.1| unknown [Picea sitchensis]
Length=550

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR D+ I FP   F++F  LAN+YLG+K   LF  V   FQ+G  ++PAE GE++LV
Sbjct  367  LRPGRMDMHIYFPHCTFSAFNTLANNYLGIKDHKLFSHVQEAFQSGGCMTPAEVGEILLV  426

Query  438  XRSXPSRAXKTVIXALXTDGRPGG  367
             +S PSRA K +I AL +  R GG
Sbjct  427  NKSSPSRALKALISALQSSSRRGG  450



>gb|EPS71797.1| hypothetical protein M569_02959, partial [Genlisea aurea]
Length=455

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 71/136 (52%), Gaps = 13/136 (10%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I FPL DF +FK LA S+LG+K   LFP +  +FQ G TLS AE  E+M+ 
Sbjct  315  LRPGRIDVHIHFPLCDFTAFKALAISHLGLKDHKLFPRLEGMFQKGTTLSQAELCEIMIS  374

Query  438  XRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXKDTV---P  268
             R+ PSRA KTVI AL  +          T         R     E+ C      +   P
Sbjct  375  NRTSPSRALKTVITALQMEDYSAS-----TRAETKLKNHRA----EEDCVDNGMAIHPHP  425

Query  267  VAXEFRKLXGLLRMKS  220
            +  E R L GLLR +S
Sbjct  426  IK-EIRSLYGLLRARS  440



>dbj|BAJ87142.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97442.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 76/152 (50%), Gaps = 22/152 (14%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I F + DF+ FK LA++YLG+K   L+P V   F  GA LSPAE GE+ML 
Sbjct  335  LRPGRLDVHIHFTMCDFDGFKALASNYLGLKDHKLYPQVEEGFHAGARLSPAELGEIMLA  394

Query  438  XRSXPSRAXKTVIXAL-XTDGRPGGRWRRLTEXXXLXTPPRPIS-----ADEQGCAPXKD  277
             R  PSRA +TVI AL      P    R  T       PPR  S      D       + 
Sbjct  395  NRGSPSRALRTVISALQHVVAAPPAHGRTSTTAAR---PPRLTSRLSGHLDGSSSPAAES  451

Query  276  TVPVAX-------------EFRKLXGLLRMKS  220
              PVA              EF+KL GL++++S
Sbjct  452  QSPVAACAGGGFGKDAPMREFKKLYGLIKIRS  483



>ref|XP_002464362.1| hypothetical protein SORBIDRAFT_01g016970 [Sorghum bicolor]
 gb|EER91360.1| hypothetical protein SORBIDRAFT_01g016970 [Sorghum bicolor]
Length=531

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I F + DF  FK LA++YLG+K   L+P V   F  GA LSPAE GE+ML 
Sbjct  349  LRPGRLDVHIHFTMCDFEGFKALASNYLGLKDHKLYPQVEEGFHAGARLSPAELGEIMLA  408

Query  438  XRSXPSRAXKTVIXAL  391
             R  PSRA +TVI AL
Sbjct  409  NRGSPSRALRTVISAL  424



>ref|XP_004982590.1| PREDICTED: uncharacterized protein LOC101755261 [Setaria italica]
Length=523

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I F + DF  FK LA++YLG+K   L+P V   F  GA LSPAE GE+M+ 
Sbjct  336  LRPGRLDVHIHFTMCDFEGFKALASNYLGLKDHKLYPQVEEGFHAGARLSPAELGEIMIA  395

Query  438  XRSXPSRAXKTVIXAL  391
             R  PSRA +TVI AL
Sbjct  396  NRGSPSRALRTVISAL  411



>ref|XP_009599055.1| PREDICTED: uncharacterized protein LOC104094765 [Nicotiana tomentosiformis]
Length=499

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR D  + FPL DFN+FK LA S+LG+K   LFP +  +FQ G+ LS AE  E+M+ 
Sbjct  330  LRPGRIDFHMHFPLCDFNAFKSLATSHLGLKDHKLFPQLEEVFQNGSVLSHAEISEIMIS  389

Query  438  XRSXPSRAXKTVIXA  394
             RS PSRA K VI A
Sbjct  390  NRSSPSRALKLVISA  404



>gb|EAY88267.1| hypothetical protein OsI_09720 [Oryza sativa Indica Group]
Length=521

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV I F L DF +FK LA++YLG+K   L+P V   F  GA LSPAE GE+ML 
Sbjct  340  VRPGRLDVHIHFTLCDFEAFKALASNYLGLKDHKLYPQVEESFHGGARLSPAELGEIMLA  399

Query  438  XRSXPSRAXKTVIXAL  391
             RS PSRA + VI  L
Sbjct  400  NRSSPSRALRNVITKL  415



>ref|NP_001048744.1| Os03g0114400 [Oryza sativa Japonica Group]
 gb|AAO17023.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF93631.1| ATPase, AAA family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10658.1| Os03g0114400 [Oryza sativa Japonica Group]
 dbj|BAG98508.1| unnamed protein product [Oryza sativa Japonica Group]
Length=523

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV I F L DF +FK LA++YLG+K   L+P V   F  GA LSPAE GE+ML 
Sbjct  342  VRPGRLDVHIHFTLCDFEAFKALASNYLGLKDHKLYPQVEESFHGGARLSPAELGEIMLA  401

Query  438  XRSXPSRAXKTVIXAL  391
             RS PSRA + VI  L
Sbjct  402  NRSSPSRALRNVITKL  417



>gb|EAZ25345.1| hypothetical protein OsJ_09159 [Oryza sativa Japonica Group]
Length=523

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV I F L DF +FK LA++YLG+K   L+P V   F  GA LSPAE GE+ML 
Sbjct  342  VRPGRLDVHIHFTLCDFEAFKALASNYLGLKDHKLYPQVEESFHGGARLSPAELGEIMLA  401

Query  438  XRSXPSRAXKTVIXAL  391
             RS PSRA + VI  L
Sbjct  402  NRSSPSRALRNVITKL  417



>ref|XP_008644692.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Zea mays]
 gb|AFW68354.1| hypothetical protein ZEAMMB73_211551 [Zea mays]
Length=513

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR DV I F + DF  FK LA++YLG+K   L+P V   F  GA LSPAE GE+ML 
Sbjct  335  LRPGRLDVHIHFTMCDFEGFKALASNYLGLKDHKLYPQVEEGFHAGARLSPAELGEIMLA  394

Query  438  XRSXPSRAXKTVIXAL  391
             R   SRA +TVI AL
Sbjct  395  NRGSASRALRTVISAL  410



>ref|XP_004986004.1| PREDICTED: uncharacterized protein LOC101775542 [Setaria italica]
Length=515

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 74/151 (49%), Gaps = 19/151 (13%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR DV I F L DF +FK LA++YLG+K   L+P V   F  GA LSPAE GE+ML 
Sbjct  339  VRPGRLDVHIHFTLCDFEAFKALASNYLGLKDHKLYPQVEEGFHAGARLSPAELGEIMLA  398

Query  438  XRSXPSRAXKTVIXALXT---DGRP---------------GGRWRRLTEXXXLXTPPRPI  313
             R+ PSRA + VI  L      G P               G +W          +     
Sbjct  399  NRASPSRALRNVITKLQHVSGGGAPPRHPAHKRNTSWSGAGQQWEEQPARASAESTEADE  458

Query  312  SADEQGCAPXKDTVPVAXEFRKLXGLLRMKS  220
            +A   G        P+  EF+KL GL++++S
Sbjct  459  TAAPAGGGVFGKDAPM-REFKKLYGLIKIRS  488



>ref|XP_010671395.1| PREDICTED: uncharacterized protein LOC104888200 [Beta vulgaris 
subsp. vulgaris]
Length=480

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 77/148 (52%), Gaps = 6/148 (4%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIF-QTGATLSPAEXGELML  442
            LRPGR DV I FP  DFN FK LA S+LGVK   LF  V  +F Q  + +S AE  E+M+
Sbjct  335  LRPGRIDVHIHFPFCDFNGFKALALSHLGVKEHKLFSQVEELFEQNVSQISLAEISEIMI  394

Query  441  VXRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAPXK---DTV  271
              R  P+RA K VI AL  +   G +   +     +    R   ++E G +  K   + +
Sbjct  395  SHRMSPTRAMKKVIKALQHEVIDGKQSNNVGLEKNV--SGRDQVSEELGGSNSKGKREGL  452

Query  270  PVAXEFRKLXGLLRMKSAXRFEPLDXDL  187
                E +K+ G LR+KS+ R +  D  L
Sbjct  453  NAMKEIQKMYGRLRLKSSRRAQSFDLSL  480



>ref|XP_003574206.1| PREDICTED: uncharacterized protein LOC100834121 [Brachypodium 
distachyon]
Length=520

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQT--GATLSPAEXGELM  445
            LRPGR DV I F + DF  FK LA++YLG+K   L+P V   F    GA LSPAE GE+M
Sbjct  340  LRPGRLDVHIHFTMCDFEGFKALASNYLGLKDHKLYPQVEERFHAAGGARLSPAELGEIM  399

Query  444  LVXRSXPSRAXKTVIXAL  391
            L  R+ PSRA +TVI AL
Sbjct  400  LANRASPSRALRTVINAL  417



>ref|XP_002465991.1| hypothetical protein SORBIDRAFT_01g049680 [Sorghum bicolor]
 gb|EER92989.1| hypothetical protein SORBIDRAFT_01g049680 [Sorghum bicolor]
Length=525

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQ-TGATLSPAEXGELML  442
            LRPGR DV I F L DF +FK LA++YLG+K   L+P V   F   GA LSPAE GE+ML
Sbjct  342  LRPGRLDVHIQFTLCDFEAFKALASNYLGLKDHKLYPQVEEGFHAAGARLSPAELGEIML  401

Query  441  VXRSXPSRAXKTVIXALXTDGRPGG  367
              R+ PSRA ++VI  L      GG
Sbjct  402  ANRASPSRALRSVITKLQHVASGGG  426



>gb|EEE51276.1| hypothetical protein OsJ_32176 [Oryza sativa Japonica Group]
Length=486

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQ-TGATLSPAEXGELML  442
            LRPGR DV I F + DF  FK LA++YLG+K   L+P V   F   GA LSPAE GE+ML
Sbjct  306  LRPGRLDVHIHFTMCDFEGFKTLASNYLGLKDHKLYPQVEEGFHAAGARLSPAELGEIML  365

Query  441  VXRSXPSRAXKTVIXAL  391
              R  PSRA +TVI AL
Sbjct  366  ANRGSPSRALRTVINAL  382



>gb|EAY79221.1| hypothetical protein OsI_34338 [Oryza sativa Indica Group]
Length=535

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQ-TGATLSPAEXGELML  442
            LRPGR DV I F + DF  FK LA++YLG+K   L+P V   F   GA LSPAE GE+ML
Sbjct  354  LRPGRLDVHIHFTMCDFEGFKTLASNYLGLKDHKLYPQVEEGFHAAGARLSPAELGEIML  413

Query  441  VXRSXPSRAXKTVIXAL  391
              R  PSRA +TVI AL
Sbjct  414  ANRGSPSRALRTVINAL  430



>ref|NP_001065078.2| Os10g0519300 [Oryza sativa Japonica Group]
 gb|AAG13445.1|AC051634_26 hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP54650.1| ATPase, AAA family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26992.2| Os10g0519300 [Oryza sativa Japonica Group]
Length=532

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQ-TGATLSPAEXGELML  442
            LRPGR DV I F + DF  FK LA++YLG+K   L+P V   F   GA LSPAE GE+ML
Sbjct  352  LRPGRLDVHIHFTMCDFEGFKTLASNYLGLKDHKLYPQVEEGFHAAGARLSPAELGEIML  411

Query  441  VXRSXPSRAXKTVIXAL  391
              R  PSRA +TVI AL
Sbjct  412  ANRGSPSRALRTVINAL  428



>ref|NP_001150338.1| ATP binding protein [Zea mays]
 gb|ACG38730.1| ATP binding protein [Zea mays]
 gb|ACN27703.1| unknown [Zea mays]
 tpg|DAA42904.1| TPA: ATP binding protein [Zea mays]
Length=523

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQ-TGATLSPAEXGELML  442
            +RPGR DV I F L DF +FK LA++YLG+K   L+P V   F   GA LSPAE GE+ML
Sbjct  338  VRPGRLDVHIQFTLCDFEAFKALASNYLGLKDHKLYPQVEEGFHAAGARLSPAELGEIML  397

Query  441  VXRSXPSRAXKTVIXAL  391
              R+ PSRA ++VI  L
Sbjct  398  ANRASPSRALRSVITKL  414



>gb|KHN06336.1| Putative mitochondrial chaperone bcs1 [Glycine soja]
Length=307

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 68/133 (51%), Gaps = 9/133 (7%)
 Frame = -1

Query  606  RXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLVXRSX  427
            R D  + F L +  +   LA+SYLGV+   LF  V  IF+ GATLSPAE  ELM+  R+ 
Sbjct  171  RGDSDLKFLLTETTAKSTLASSYLGVREHKLFAQVEDIFRHGATLSPAEISELMIANRNS  230

Query  426  PSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPISADEQGCAP-XKDTVPVAXEFR  250
            PSRA K+VI AL +DG   GR           +  R I  D+   AP   D      + R
Sbjct  231  PSRAIKSVIGALQSDGE--GR------RSYADSIGRRIEGDDVDEAPCGGDGFSTVKDLR  282

Query  249  KLXGLLRMKSAXR  211
            K  G  ++++  R
Sbjct  283  KFYGFFKLRNPRR  295



>ref|XP_009391570.1| PREDICTED: mitochondrial chaperone BCS1-like [Musa acuminata 
subsp. malaccensis]
Length=459

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LR GR DV I FP+ DF +FK LA  YL +    L+P V  +FQ+GA +SPA+ GE+M+ 
Sbjct  333  LREGRLDVHIHFPMCDFQAFKTLARIYLRLNDHKLYPMVEEVFQSGAKMSPAKVGEIMIA  392

Query  438  XRSXPSRAXKTVIXAL  391
             R  P RA K VI  L
Sbjct  393  NRGSPKRALKLVITEL  408



>ref|XP_003562201.1| PREDICTED: uncharacterized protein LOC100825790 [Brachypodium 
distachyon]
Length=500

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 71/142 (50%), Gaps = 17/142 (12%)
 Frame = -1

Query  609  GRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIF-QTGATLSPAEXGELMLVXR  433
            GR DV + F L DF +FK +A+SYLG++   L+P V   F + GA LSPAE G +++  R
Sbjct  331  GRVDVRVGFKLCDFEAFKAMASSYLGLREHKLYPEVEEGFVRGGARLSPAELGGILVAHR  390

Query  432  SXPSRAXKTVIXALXTDGRPGG--------RWRRLTEXX---XLXTPPRPISADEQGCAP  286
              P+RA + VI  L    R  G          RR+T           P P      G   
Sbjct  391  GSPTRALRAVITKLQLQPRVSGPSSVGTKLTHRRVTSWSGPEAAVMAPAPAG----GGVF  446

Query  285  XKDTVPVAXEFRKLXGLLRMKS  220
             KD  P+  E +KL GL++++S
Sbjct  447  AKD-APIRGELKKLYGLMKIRS  467



>ref|XP_001782247.1| predicted protein [Physcomitrella patens]
 gb|EDQ52919.1| predicted protein [Physcomitrella patens]
Length=363

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR D+ I      + +FK L  +YL V    LFP V  + ++GA ++PA+  E+M+ 
Sbjct  269  LRPGRMDLHIHMSFCTYAAFKTLVLNYLMVDSHLLFPKVETLLRSGAKVTPAQVSEIMIQ  328

Query  438  XRSXPSRAXKTVIXAL  391
             R  PS A + ++ +L
Sbjct  329  RRDNPSGALEELVSSL  344



>ref|XP_010257525.1| PREDICTED: uncharacterized protein LOC104597594 [Nelumbo nucifera]
Length=516

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 43/85 (51%), Gaps = 0/85 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR DV +       ++FK LA +YLGV+   LF  V    + G  L+PA+ GE++L 
Sbjct  360  VRCGRMDVHVRLGTCGVHAFKALAKNYLGVESHILFEVVESCIRAGGALTPAQIGEILLR  419

Query  438  XRSXPSRAXKTVIXALXTDGRPGGR  364
             R     A K VI AL      G R
Sbjct  420  NRRDADAAIKAVISALQESILRGDR  444



>emb|CBI32158.3| unnamed protein product [Vitis vinifera]
Length=401

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR DV +       ++FK LA +YLG++   LF  V    ++G TL+PA+ GE++L 
Sbjct  279  VRCGRMDVHVSLGTCGIHAFKALAANYLGLESHPLFDVVESCIRSGGTLTPAQVGEILLR  338

Query  438  XRSXPSRAXKTVIXAL  391
             R     A K VI A+
Sbjct  339  NRRDAEVAIKAVISAM  354



>ref|XP_002267624.1| PREDICTED: uncharacterized protein LOC100263212 [Vitis vinifera]
Length=516

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR DV +       ++FK LA +YLG++   LF  V    ++G TL+PA+ GE++L 
Sbjct  357  VRCGRMDVHVSLGTCGIHAFKALAANYLGLESHPLFDVVESCIRSGGTLTPAQVGEILLR  416

Query  438  XRSXPSRAXKTVIXAL  391
             R     A K VI A+
Sbjct  417  NRRDAEVAIKAVISAM  432



>ref|XP_001781345.1| predicted protein [Physcomitrella patens]
 gb|EDQ53873.1| predicted protein [Physcomitrella patens]
Length=463

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR D+ I      F +FK L  +YLG+    LF  V  + ++   ++PA+  E +  
Sbjct  267  LRPGRMDMHINMSYCQFETFKALVKNYLGIDSHPLFDTVKALLESRKLITPAQVAEHLFE  326

Query  438  XRSXPSRAXKTVIXALXTDGRP  373
             R+ P  A K +I  L  D +P
Sbjct  327  NRADPDAAMKVLIQWLE-DWKP  347



>gb|ABK27085.1| unknown [Picea sitchensis]
Length=341

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 40/76 (53%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR D+ I      F +FKCLA +YL ++   LF  V      GA ++PAE  E+++ 
Sbjct  212  LRPGRMDMRIYLSFCTFPAFKCLAFNYLQIEDHPLFSAVEERMSGGAEMTPAEISEILIE  271

Query  438  XRSXPSRAXKTVIXAL  391
                  +A   VI AL
Sbjct  272  HLDDSLKALNAVISAL  287



>gb|AFG50104.1| hypothetical protein 0_5015_01, partial [Pinus taeda]
 gb|AFG50106.1| hypothetical protein 0_5015_01, partial [Pinus taeda]
 gb|AFG50111.1| hypothetical protein 0_5015_01, partial [Pinus taeda]
Length=158

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR D  I      + +FK LA +YL ++   LFP +  + +T A ++PA+  E +L 
Sbjct  66   VRRGRMDKHILLSFCTYRAFKTLARNYLDIESHELFPEIKCLMET-AQMTPADVTEYLLQ  124

Query  438  XRSXPSRAXKTVIXAL  391
             R  P+ A + +I AL
Sbjct  125  MRDQPTSALQNLIEAL  140



>gb|AFG50105.1| hypothetical protein 0_5015_01, partial [Pinus taeda]
 gb|AFG50107.1| hypothetical protein 0_5015_01, partial [Pinus taeda]
 gb|AFG50108.1| hypothetical protein 0_5015_01, partial [Pinus taeda]
 gb|AFG50109.1| hypothetical protein 0_5015_01, partial [Pinus taeda]
 gb|AFG50110.1| hypothetical protein 0_5015_01, partial [Pinus taeda]
 gb|AFG50112.1| hypothetical protein 0_5015_01, partial [Pinus taeda]
Length=161

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR D  I      + +FK LA +YL ++   LFP +  + +T A ++PA+  E +L 
Sbjct  69   VRRGRMDKHILLSFCTYRAFKTLARNYLDIESHELFPEIKCLMET-AQMTPADVTEYLLQ  127

Query  438  XRSXPSRAXKTVIXAL  391
             R  P+ A + +I AL
Sbjct  128  MRDQPTSALQNLIEAL  143



>ref|XP_001768974.1| predicted protein [Physcomitrella patens]
 gb|EDQ66172.1| predicted protein [Physcomitrella patens]
Length=441

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LRPGR D+ I      +++FK L+ +YL ++   LFP V  + + GA ++PA+  E+++ 
Sbjct  352  LRPGRMDLHIHMSYCTYSAFKTLSLNYLTLENHHLFPKVEKLIRNGAKITPAQVSEILIQ  411

Query  438  XRSXPSRAXKTVIXAL  391
             R     A + ++  L
Sbjct  412  NRDNSDDAMENLVSFL  427



>gb|KDP20377.1| hypothetical protein JCGZ_05260 [Jatropha curcas]
Length=518

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR DV +       ++FK LA +YLG++   L+  V    ++G  L+PA+ GE++L 
Sbjct  362  VRCGRMDVHVSLGNCGIHAFKALAMNYLGIESHSLYDVVESCIRSGGALTPAQIGEILLR  421

Query  438  XRSXPSRAXKTVIXAL  391
             R     A K V+ A+
Sbjct  422  NRRNADLAMKEVVGAM  437



>ref|XP_002512196.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF50230.1| ATP binding protein, putative [Ricinus communis]
Length=517

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (53%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR DV +       ++FK LA +YLG+    LF       ++G  L+PA+ GE++L 
Sbjct  362  VRCGRMDVHVSLGTCGMHAFKALAMNYLGIDSHSLFDVAESCIRSGGALTPAQIGEILLR  421

Query  438  XRSXPSRAXKTVIXAL  391
             R     A K V+ A+
Sbjct  422  NRGNTDVALKEVVSAM  437



>ref|XP_009617194.1| PREDICTED: ATPase family gene 2 protein-like [Nicotiana tomentosiformis]
Length=514

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR D+ +       ++FK L  +YLG+    LF  V    ++G TL+PA  GE++L 
Sbjct  361  VRCGRMDMHVSLGTCGMHAFKVLVKNYLGLDSHALFDVVESCIRSGGTLTPAHIGEILLR  420

Query  438  XRSXPSRAXKTVIXAL  391
             R     A K+V+ A+
Sbjct  421  NRRDADVAVKSVLAAM  436



>ref|XP_009791983.1| PREDICTED: ATPase family gene 2 protein-like [Nicotiana sylvestris]
Length=514

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR D+ +       ++FK L  +YLG+    LF  V    ++G TL+PA  GE++L 
Sbjct  361  VRCGRMDMHVSLGTCGMHAFKVLVKNYLGLDSHALFDVVESCIRSGGTLTPAHIGEILLR  420

Query  438  XRSXPSRAXKTVIXAL  391
             R     A K+V+ A+
Sbjct  421  NRRDADVAVKSVLTAM  436



>ref|XP_006359141.1| PREDICTED: putative cell division cycle ATPase-like [Solanum 
tuberosum]
Length=516

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR D+ +       ++FK L  +YLG+    LF  V    ++G TL+PA  GE++L 
Sbjct  363  VRCGRMDMHVSLGTCGMHAFKVLVKNYLGLDSHVLFDVVESCIRSGGTLTPAHIGEILLR  422

Query  438  XRSXPSRAXKTVIXAL  391
             R     A K+V+ A+
Sbjct  423  NRRDADVAVKSVLTAM  438



>ref|XP_004229339.1| PREDICTED: putative cell division cycle ATPase [Solanum lycopersicum]
Length=512

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR D+ +       ++FK L  +YLG+    LF  V    ++G TL+PA  GE++L 
Sbjct  359  VRCGRMDMHVSLGTCGMHAFKVLVKNYLGLDSHVLFDVVESCIRSGGTLTPAHIGEILLR  418

Query  438  XRSXPSRAXKTVIXAL  391
             R     A K+V+ A+
Sbjct  419  NRRDADVAVKSVLTAM  434



>ref|XP_010243399.1| PREDICTED: ATPase family gene 2 protein-like [Nelumbo nucifera]
Length=524

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR DV +       ++FK LA +YLG++   LF  V    + G  L+PA+ GE++L 
Sbjct  357  VRCGRMDVHVRLGTCGIHAFKALAMNYLGLEWHVLFHVVESCIRAGGALTPAQIGEILLR  416

Query  438  XRSXPSRAXKTVIXAL  391
             R     A K V+ AL
Sbjct  417  NRRDADVAIKAVVSAL  432



>ref|XP_006387712.1| hypothetical protein POPTR_0650s00220g [Populus trichocarpa]
 gb|ERP46626.1| hypothetical protein POPTR_0650s00220g [Populus trichocarpa]
Length=226

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR DV +       ++FK LA +YLG++   LF  V    ++G  L+PA+ GE++L 
Sbjct  75   VRCGRMDVHVSLGPCGMHAFKALAMNYLGIEEHSLFDVVESCIRSGGALTPAQIGEILLR  134

Query  438  XR-SXPSRAXKTVIXALXT  385
             R S    A   V+ A+ T
Sbjct  135  NRGSNADLAMTEVVSAMQT  153



>ref|XP_001780786.1| predicted protein [Physcomitrella patens]
 gb|EDQ54425.1| predicted protein [Physcomitrella patens]
Length=198

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 43/87 (49%), Gaps = 4/87 (5%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +RPGR D+ I     +F S K LA +YL ++    +  +  +   G  ++PA+  E +  
Sbjct  107  IRPGRMDMHIHMSYCNFESIKSLAYTYLSIESHPFYDTIRNLLNEGILITPAQVTEHLYA  166

Query  438  XRSXPSRAXKTVIXALX----TDGRPG  370
             RS P+ A +++   L     T  RPG
Sbjct  167  NRSDPTAAMQSITAELEQLNDTALRPG  193



>ref|XP_007149116.1| hypothetical protein PHAVU_005G042400g [Phaseolus vulgaris]
 gb|ESW21110.1| hypothetical protein PHAVU_005G042400g [Phaseolus vulgaris]
Length=518

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR DV +       ++F+ LA +YLGV    LF  V    ++G +L+PA  GE++L 
Sbjct  367  VRCGRMDVHVSLNTCGVHAFRELARNYLGVDSHVLFEAVEGCIRSGGSLTPAHVGEILLR  426

Query  438  XRSXPSRAXKTVIXAL  391
             R     A + V+ A+
Sbjct  427  NRGDADVAMREVLAAM  442



>ref|XP_003531459.1| PREDICTED: uncharacterized protein LOC100783574 [Glycine max]
Length=516

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LR GR DV +       ++F+ LA +YLGV    LF  V    ++G +L+PA  GE++L 
Sbjct  368  LRCGRMDVHVSLGTCGTHAFRELARNYLGVDSHVLFEAVEGCIRSGGSLTPAHVGEILLR  427

Query  438  XRSXPSRAXKTVIXAL  391
             R     A + V+ A+
Sbjct  428  NRGDVDVAMREVLAAM  443



>ref|XP_007014067.1| ATP binding protein, putative [Theobroma cacao]
 gb|EOY31686.1| ATP binding protein, putative [Theobroma cacao]
Length=519

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR DV +       ++FK LA +YL +    +F  V     +G +L+PA+ GE++L 
Sbjct  360  VRCGRMDVHVSLGRCGMHAFKVLAKNYLNLDSHPMFQLVETCISSGGSLTPAQIGEVLLR  419

Query  438  XRSXPSRAXKTVIXA----LXTDGRPGG  367
             R     A K V+ A    L T    GG
Sbjct  420  NRWNADVAMKEVVSAMQSQLQTQNNQGG  447



>ref|XP_002313465.2| hypothetical protein POPTR_0009s02930g [Populus trichocarpa]
 gb|EEE87420.2| hypothetical protein POPTR_0009s02930g [Populus trichocarpa]
Length=505

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR DV +       ++FK LA +YLG++   LF  V    ++G  L+PA+ GE++L 
Sbjct  374  VRCGRMDVHVSLGPCGMHAFKALAMNYLGIEEHSLFDVVESCIRSGGALTPAQIGEILLR  433

Query  438  XR-SXPSRAXKTVIXALXT  385
             R S    A   V+ A+ T
Sbjct  434  NRGSNADLAMTEVVSAMQT  452



>gb|ADE76156.1| unknown [Picea sitchensis]
Length=478

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 41/76 (54%), Gaps = 1/76 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LR GR D  I      F +FK LA +YL ++   LFP +  + +  A ++PA+  E ++ 
Sbjct  377  LRSGRMDKHILLTFCTFGAFKILARNYLSIEDHELFPDIGDLTE-AAQMTPADVTEHLMK  435

Query  438  XRSXPSRAXKTVIXAL  391
                PSRA + +I AL
Sbjct  436  MADHPSRALENLIQAL  451



>ref|XP_011093400.1| PREDICTED: mitochondrial chaperone BCS1-like [Sesamum indicum]
Length=513

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LR GR DV +       ++FK L  +YLG+    LF       + G  L+PA+ GE++L 
Sbjct  363  LRCGRMDVHVSLGTCGVHAFKQLVKNYLGLDSHMLFDVAESCVRAGGALTPAQIGEILLR  422

Query  438  XRSXPSRAXKTVIXAL  391
             R     A K V+ A+
Sbjct  423  NRRDADVALKAVVSAM  438



>ref|XP_006439008.1| hypothetical protein CICLE_v10031208mg [Citrus clementina]
 gb|ESR52248.1| hypothetical protein CICLE_v10031208mg [Citrus clementina]
Length=530

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 47/103 (46%), Gaps = 1/103 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXX-LFPXVXXIFQTGATLSPAEXGELML  442
            +R GR DV +       ++FK LA +YLG++    LF  V    + G  L+PA+ GE++L
Sbjct  380  IRCGRMDVHVSLGTCGPHAFKVLAKNYLGIESHHALFDVVESCIRAGGALTPAQIGEVLL  439

Query  441  VXRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPI  313
              R     A K V+ A+      GG      E     +P   +
Sbjct  440  RNRGNVDLAMKEVVSAMQAKVLSGGEVMECDELVITRSPESVV  482



>ref|XP_008231398.1| PREDICTED: uncharacterized protein LOC103330578 [Prunus mume]
Length=561

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LR GR DV +       ++F+ +A +YLG+    LF  V    ++G  L+PA+ GE++L 
Sbjct  383  LRCGRMDVHVNLGNCGPHAFRAMAKNYLGLDSHPLFEAVDRCVRSGGALTPAQVGEILLR  442

Query  438  XRSXPSRAXKTVIXAL  391
             R     A K V+ A+
Sbjct  443  NRGDADVAMKDVVSAM  458



>ref|XP_006482802.1| PREDICTED: uncharacterized protein LOC102622284 [Citrus sinensis]
Length=530

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 47/103 (46%), Gaps = 1/103 (1%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXX-LFPXVXXIFQTGATLSPAEXGELML  442
            +R GR DV +       ++FK LA +YLG++    LF  V    + G  L+PA+ GE++L
Sbjct  380  IRCGRMDVHVSLGTCGPHAFKVLAKNYLGIESHHALFDVVESCIRAGGALTPAQIGEVLL  439

Query  441  VXRSXPSRAXKTVIXALXTDGRPGGRWRRLTEXXXLXTPPRPI  313
              R     A K V+ A+      GG      E     +P   +
Sbjct  440  RNRGNVDLAMKEVVSAMQAKILSGGEVMECDELVITRSPESVV  482



>ref|XP_006849577.1| hypothetical protein AMTR_s00024p00191310 [Amborella trichopoda]
 gb|ERN11158.1| hypothetical protein AMTR_s00024p00191310 [Amborella trichopoda]
Length=498

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (53%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            +R GR D+ I      F++FK LA +YLG++   LF  +      G  L+PAE  E+M+ 
Sbjct  358  IRSGRMDMHIRLGPAGFDAFKTLACNYLGLRDHRLFEIIEREISEGGRLTPAEISEIMVR  417

Query  438  XRSXPSRAXKTVIXAL  391
             +     A + V+ AL
Sbjct  418  FKGDVDNALREVVTAL  433



>ref|XP_006662517.1| PREDICTED: probable mitochondrial chaperone bcs1-like, partial 
[Oryza brachyantha]
Length=260

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXV  502
            LRPGR DV I F + DF  FK LA++YLG+K   L+P V
Sbjct  163  LRPGRLDVHIHFTMCDFEGFKTLASNYLGLKDHKLYPQV  201



>ref|XP_007218964.1| hypothetical protein PRUPE_ppa003630mg [Prunus persica]
 gb|EMJ20163.1| hypothetical protein PRUPE_ppa003630mg [Prunus persica]
Length=560

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (53%), Gaps = 0/76 (0%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LR GR DV +       ++F+ +A +YLG+    LF  V    + G  L+PA+ GE++L 
Sbjct  382  LRCGRMDVHVNLGNCGPHAFRAMAKNYLGLDSHPLFEAVDRCVRLGGALTPAQVGEILLR  441

Query  438  XRSXPSRAXKTVIXAL  391
             R     A K V+ A+
Sbjct  442  NRGDADVAMKDVVSAM  457



>ref|XP_009365053.1| PREDICTED: uncharacterized protein LOC103954926 [Pyrus x bretschneideri]
Length=556

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 46/94 (49%), Gaps = 3/94 (3%)
 Frame = -1

Query  618  LRPGRXDVXIXFPLXDFNSFKCLANSYLGVKXXXLFPXVXXIFQTGATLSPAEXGELMLV  439
            LR GR DV +       ++F+ LA +YLG+    LF       ++G  L+PA+ GE++L 
Sbjct  381  LRCGRMDVHVSLGTCGPHAFRQLAKNYLGLDAHPLFEAADGCVRSGGVLTPAQVGEILLR  440

Query  438  XRSXPSRAXKTVIXALXTD---GRPGGRWRRLTE  346
             R     A K V+ A+      G  GG   +L E
Sbjct  441  NRGDADVAMKEVVLAMQARINLGVDGGSRDQLAE  474



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520