BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF040J07

Length=838
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011098156.1|  PREDICTED: fatty-acid-binding protein 3            348   1e-116   Sesamum indicum [beniseed]
ref|XP_008226205.1|  PREDICTED: fatty-acid-binding protein 3            348   2e-116   Prunus mume [ume]
ref|XP_007212009.1|  hypothetical protein PRUPE_ppa011189mg             340   2e-114   
ref|XP_011009097.1|  PREDICTED: fatty-acid-binding protein 3            333   9e-111   Populus euphratica
ref|XP_004146009.1|  PREDICTED: chalcone--flavonone isomerase 2-like    332   3e-110   Cucumis sativus [cucumbers]
ref|XP_007022087.1|  Chalcone-flavanone isomerase family protein ...    330   3e-110   
ref|XP_002283758.2|  PREDICTED: fatty-acid-binding protein 3            331   1e-109   Vitis vinifera
ref|XP_006348346.1|  PREDICTED: fatty-acid-binding protein 3-like       329   3e-109   Solanum tuberosum [potatoes]
emb|CDP06071.1|  unnamed protein product                                330   3e-109   Coffea canephora [robusta coffee]
ref|XP_009769181.1|  PREDICTED: fatty-acid-binding protein 3            328   2e-108   Nicotiana sylvestris
ref|XP_004244307.1|  PREDICTED: fatty-acid-binding protein 3            327   2e-108   Solanum lycopersicum
ref|XP_006377696.1|  hypothetical protein POPTR_0011s10330g             327   2e-108   
ref|XP_009339359.1|  PREDICTED: fatty-acid-binding protein 3-like...    327   4e-108   
gb|EYU26288.1|  hypothetical protein MIMGU_mgv1a0115041mg               323   7e-108   Erythranthe guttata [common monkey flower]
emb|CAN75399.1|  hypothetical protein VITISV_004495                     324   1e-107   Vitis vinifera
ref|XP_010241349.1|  PREDICTED: fatty-acid-binding protein 3            324   6e-107   Nelumbo nucifera [Indian lotus]
gb|KJB82093.1|  hypothetical protein B456_013G176000                    323   8e-107   Gossypium raimondii
ref|XP_009625508.1|  PREDICTED: fatty-acid-binding protein 3            323   9e-107   Nicotiana tomentosiformis
ref|XP_007022085.1|  Chalcone-flavanone isomerase family protein ...    323   1e-106   
ref|XP_009344622.1|  PREDICTED: fatty-acid-binding protein 3-like       322   4e-106   Pyrus x bretschneideri [bai li]
gb|KDO52113.1|  hypothetical protein CISIN_1g023649mg                   322   4e-106   Citrus sinensis [apfelsine]
ref|XP_008363648.1|  PREDICTED: fatty-acid-binding protein 3-like       322   4e-106   
ref|XP_006442319.1|  hypothetical protein CICLE_v10021578mg             321   5e-106   Citrus clementina [clementine]
ref|XP_006477800.1|  PREDICTED: fatty-acid-binding protein 3-like...    320   1e-105   Citrus sinensis [apfelsine]
ref|XP_008452432.1|  PREDICTED: fatty-acid-binding protein 3 isof...    322   1e-105   
gb|KJB82094.1|  hypothetical protein B456_013G176000                    320   2e-105   Gossypium raimondii
ref|XP_008346589.1|  PREDICTED: LOW QUALITY PROTEIN: fatty-acid-b...    318   3e-105   
ref|XP_008368445.1|  PREDICTED: fatty-acid-binding protein 3            316   8e-104   
gb|KFK35722.1|  hypothetical protein AALP_AA4G028300                    315   1e-103   Arabis alpina [alpine rockcress]
ref|XP_004294183.1|  PREDICTED: fatty-acid-binding protein 3            315   2e-103   Fragaria vesca subsp. vesca
gb|KJB82095.1|  hypothetical protein B456_013G176000                    314   3e-103   Gossypium raimondii
ref|XP_009339358.1|  PREDICTED: fatty-acid-binding protein 3-like...    314   3e-103   
ref|XP_009147594.1|  PREDICTED: fatty-acid-binding protein 3            314   3e-103   Brassica rapa
ref|XP_010694734.1|  PREDICTED: fatty-acid-binding protein 3 isof...    314   5e-103   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP39780.1|  hypothetical protein JCGZ_04939                         312   1e-102   Jatropha curcas
gb|KEH38484.1|  chalcone-flavanone isomerase family protein             312   2e-102   Medicago truncatula
ref|XP_008452433.1|  PREDICTED: fatty-acid-binding protein 3 isof...    313   3e-102   
ref|XP_004488681.1|  PREDICTED: chalcone--flavonone isomerase-like      311   3e-102   Cicer arietinum [garbanzo]
gb|AFK39093.1|  unknown                                                 311   4e-102   Medicago truncatula
ref|XP_002894446.1|  hypothetical protein ARALYDRAFT_474480             311   6e-102   
emb|CDY24090.1|  BnaA06g00880D                                          311   7e-102   Brassica napus [oilseed rape]
ref|XP_010060770.1|  PREDICTED: fatty-acid-binding protein 3 isof...    310   1e-101   Eucalyptus grandis [rose gum]
ref|XP_010501004.1|  PREDICTED: fatty-acid-binding protein 3-like       310   2e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010462251.1|  PREDICTED: fatty-acid-binding protein 3-like       310   3e-101   Camelina sativa [gold-of-pleasure]
emb|CDY45118.1|  BnaC06g06390D                                          310   3e-101   Brassica napus [oilseed rape]
ref|XP_010479918.1|  PREDICTED: fatty-acid-binding protein 3-like...    306   4e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006305475.1|  hypothetical protein CARUB_v10009906mg             305   1e-99    Capsella rubella
gb|AAM61303.1|  chalcone isomerase, putative                            305   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010535016.1|  PREDICTED: fatty-acid-binding protein 3            305   2e-99    Tarenaya hassleriana [spider flower]
ref|NP_175757.1|  fatty-acid-binding protein 3                          305   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479919.1|  PREDICTED: fatty-acid-binding protein 3-like...    305   2e-99    Camelina sativa [gold-of-pleasure]
pdb|4DOL|A  Chain A, Crystal Structure Of Arabidopsis Thaliana Fa...    301   4e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010060771.1|  PREDICTED: fatty-acid-binding protein 3 isof...    303   1e-98    Eucalyptus grandis [rose gum]
ref|XP_007149369.1|  hypothetical protein PHAVU_005G0645000g            300   7e-98    Phaseolus vulgaris [French bean]
ref|NP_001238390.1|  chalcone isomerase 3-like                          301   7e-98    Glycine max [soybeans]
ref|XP_006392782.1|  hypothetical protein EUTSA_v10011696mg             300   1e-97    Eutrema salsugineum [saltwater cress]
ref|XP_006593488.1|  PREDICTED: chalcone isomerase 3-like isoform X1    300   2e-97    Glycine max [soybeans]
ref|XP_010106740.1|  Chalcone--flavonone isomerase                      298   6e-97    Morus notabilis
gb|ACU19407.1|  unknown                                                 298   8e-97    Glycine max [soybeans]
ref|XP_008784378.1|  PREDICTED: fatty-acid-binding protein 3 isof...    296   2e-96    Phoenix dactylifera
ref|XP_009413396.1|  PREDICTED: fatty-acid-binding protein 3            292   9e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784382.1|  PREDICTED: fatty-acid-binding protein 3 isof...    290   1e-94    
ref|XP_003546743.1|  PREDICTED: fatty-acid-binding protein 3-like       290   8e-94    
ref|XP_007149370.1|  hypothetical protein PHAVU_005G064600g             289   2e-93    Phaseolus vulgaris [French bean]
ref|XP_010916104.1|  PREDICTED: fatty-acid-binding protein 3 isof...    281   2e-90    Elaeis guineensis
ref|XP_007149371.1|  hypothetical protein PHAVU_005G064600g             274   4e-88    Phaseolus vulgaris [French bean]
ref|XP_006370052.1|  hypothetical protein POPTR_0001s38970g             269   7e-87    
gb|AAF78437.1|AC018748_16  Contains a weak similarity to chalcone...    271   2e-86    Arabidopsis thaliana [mouse-ear cress]
gb|KCW67630.1|  hypothetical protein EUGRSUZ_F01378                     264   1e-83    Eucalyptus grandis [rose gum]
ref|XP_010694735.1|  PREDICTED: fatty-acid-binding protein 3 isof...    255   2e-81    
gb|EYU26287.1|  hypothetical protein MIMGU_mgv1a0115041mg               251   2e-80    Erythranthe guttata [common monkey flower]
gb|KCW67632.1|  hypothetical protein EUGRSUZ_F01378                     246   8e-77    Eucalyptus grandis [rose gum]
ref|XP_008366525.1|  PREDICTED: fatty-acid-binding protein 3-like       245   1e-76    
ref|XP_008784381.1|  PREDICTED: fatty-acid-binding protein 3 isof...    244   2e-76    
ref|XP_010916109.1|  PREDICTED: fatty-acid-binding protein 3 isof...    238   4e-74    
gb|ADE76284.1|  unknown                                                 236   1e-72    Picea sitchensis
emb|CDP12481.1|  unnamed protein product                                222   1e-68    Coffea canephora [robusta coffee]
ref|XP_007022086.1|  Chalcone-flavanone isomerase family protein ...    218   3e-66    
gb|AFQ92050.1|  chalcone isomerase                                      212   4e-65    Pyrus pyrifolia [sha li]
ref|XP_010234161.1|  PREDICTED: fatty-acid-binding protein 3            211   3e-63    Brachypodium distachyon [annual false brome]
dbj|BAJ85871.1|  predicted protein                                      209   1e-62    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008386421.1|  PREDICTED: fatty-acid-binding protein 3-like       204   4e-62    
ref|NP_001046684.1|  Os02g0320300                                       209   4e-62    
ref|XP_002451868.1|  hypothetical protein SORBIDRAFT_04g008910          205   2e-60    Sorghum bicolor [broomcorn]
gb|EEE56854.1|  hypothetical protein OsJ_06472                          201   7e-59    Oryza sativa Japonica Group [Japonica rice]
gb|EMT25778.1|  Chalcone--flavonone isomerase 1B-1                      198   4e-58    
ref|XP_002528487.1|  conserved hypothetical protein                     189   2e-56    
gb|EMS65822.1|  Chalcone--flavonone isomerase 1B-1                      191   1e-55    Triticum urartu
gb|AFW71098.1|  hypothetical protein ZEAMMB73_950090                    187   6e-54    
gb|AFW71097.1|  hypothetical protein ZEAMMB73_950090                    185   1e-53    
ref|XP_001764300.1|  predicted protein                                  177   9e-51    
ref|XP_006665045.1|  PREDICTED: fatty-acid-binding protein 3-like       169   6e-47    Oryza brachyantha
ref|NP_001151850.1|  LOC100285485                                       153   5e-41    Zea mays [maize]
gb|AIE16842.1|  chalcone isomerase                                      142   2e-38    Glycine max [soybeans]
gb|AIE16850.1|  chalcone isomerase                                      142   2e-38    Glycine soja [wild soybean]
gb|AIE16846.1|  chalcone isomerase                                      140   1e-37    Glycine max [soybeans]
gb|AIE16847.1|  chalcone isomerase                                      139   4e-37    Glycine soja [wild soybean]
gb|EMT21809.1|  hypothetical protein F775_33111                         127   3e-32    
ref|XP_002993360.1|  hypothetical protein SELMODRAFT_136990             122   2e-30    
gb|EEC73031.1|  hypothetical protein OsI_06969                          105   2e-24    Oryza sativa Indica Group [Indian rice]
ref|XP_002972746.1|  hypothetical protein SELMODRAFT_97953              103   1e-23    
ref|XP_002504118.1|  predicted protein                                  103   1e-22    Micromonas commoda
ref|XP_003059642.1|  predicted protein                                95.9    1e-19    Micromonas pusilla CCMP1545
emb|CBJ30273.1|  Chalcone Isomerase                                   94.0    4e-19    Ectocarpus siliculosus
ref|XP_001769093.1|  predicted protein                                92.8    6e-19    
ref|XP_002503292.1|  predicted protein                                93.2    8e-19    Micromonas commoda
ref|XP_001773128.1|  predicted protein                                90.1    5e-18    
ref|XP_005855968.1|  hypothetical protein NGA_0361402                 89.7    6e-18    Nannochloropsis gaditana CCMP526
gb|EWM23313.1|  Chalcone isomerase, subgroup                          89.0    2e-17    Nannochloropsis gaditana
ref|XP_001420321.1|  predicted protein                                89.7    2e-17    Ostreococcus lucimarinus CCE9901
ref|XP_005644192.1|  chalcone isomerase                               87.4    9e-17    Coccomyxa subellipsoidea C-169
ref|XP_005845646.1|  hypothetical protein CHLNCDRAFT_136673           85.5    4e-16    Chlorella variabilis
ref|XP_003058444.1|  predicted protein                                83.6    5e-16    Micromonas pusilla CCMP1545
dbj|BAJ10401.1|  enhancer of flavonoid production                     82.8    2e-15    Torenia hybrid cultivar
ref|XP_009627241.1|  PREDICTED: probable chalcone--flavonone isom...  82.8    2e-15    Nicotiana tomentosiformis
ref|XP_006435919.1|  hypothetical protein CICLE_v10032749mg           82.8    2e-15    Citrus clementina [clementine]
ref|XP_007509430.1|  predicted protein                                83.2    2e-15    Bathycoccus prasinos
ref|XP_004171055.1|  PREDICTED: chalcone--flavonone isomerase-like    82.4    2e-15    
gb|KGN50734.1|  hypothetical protein Csa_5G221960                     82.4    3e-15    Cucumis sativus [cucumbers]
emb|CCM80406.1|  chalcone isomerase 2                                 82.0    3e-15    Lupinus angustifolius
ref|XP_004146474.1|  PREDICTED: chalcone--flavonone isomerase-like    82.8    4e-15    
ref|XP_010253088.1|  PREDICTED: probable chalcone--flavonone isom...  81.3    5e-15    Nelumbo nucifera [Indian lotus]
gb|AHL83555.1|  chalcone isomerase type 4                             80.9    6e-15    Iris x hollandica [Dutch iris]
ref|XP_006435917.1|  hypothetical protein CICLE_v10032749mg           80.5    9e-15    
gb|AFK43525.1|  unknown                                               80.5    1e-14    Lotus japonicus
gb|KIZ04906.1|  hypothetical protein MNEG_3049                        81.3    1e-14    Monoraphidium neglectum
emb|CCM80407.1|  chalcone isomerase 1                                 80.1    1e-14    Lupinus angustifolius
ref|XP_001700277.1|  predicted protein                                80.9    1e-14    Chlamydomonas reinhardtii
gb|AHC07954.1|  CHI                                                   80.1    1e-14    Indosasa hispida
ref|XP_008792229.1|  PREDICTED: probable chalcone--flavonone isom...  79.7    2e-14    
gb|AHL83557.1|  chalcone isomerase type 4                             80.1    2e-14    Iris x hollandica [Dutch iris]
ref|XP_008456952.1|  PREDICTED: probable chalcone--flavonone isom...  80.5    2e-14    Cucumis melo [Oriental melon]
gb|AFK36813.1|  unknown                                               79.3    3e-14    Medicago truncatula
dbj|BAJ10402.1|  enhancer of flavonoid production                     79.3    3e-14    Torenia hybrid cultivar
ref|XP_009804396.1|  PREDICTED: probable chalcone--flavonone isom...  79.3    3e-14    Nicotiana sylvestris
ref|XP_004307734.1|  PREDICTED: probable chalcone--flavonone isom...  78.6    4e-14    Fragaria vesca subsp. vesca
gb|KEH35544.1|  chalcone-flavanone isomerase family protein           78.6    5e-14    Medicago truncatula
gb|AIU39024.1|  chalcone isomerase 2                                  78.2    6e-14    Narcissus tazetta subsp. chinensis
ref|XP_010922741.1|  PREDICTED: probable chalcone--flavonone isom...  78.2    6e-14    Elaeis guineensis
ref|XP_009363797.1|  PREDICTED: probable chalcone--flavonone isom...  78.2    6e-14    Pyrus x bretschneideri [bai li]
gb|AHY20030.1|  chalcone isomerase                                    78.2    7e-14    Tulipa fosteriana
ref|XP_009349076.1|  PREDICTED: probable chalcone--flavonone isom...  78.2    8e-14    Pyrus x bretschneideri [bai li]
ref|XP_009349075.1|  PREDICTED: probable chalcone--flavonone isom...  78.2    8e-14    Pyrus x bretschneideri [bai li]
ref|XP_004502829.1|  PREDICTED: chalcone--flavonone isomerase-like    77.4    1e-13    Cicer arietinum [garbanzo]
ref|XP_008369367.1|  PREDICTED: probable chalcone--flavonone isom...  77.4    1e-13    Malus domestica [apple tree]
gb|AFK33841.1|  unknown                                               77.0    2e-13    Medicago truncatula
ref|XP_008366803.1|  PREDICTED: probable chalcone--flavonone isom...  76.6    2e-13    Malus domestica [apple tree]
ref|XP_007218407.1|  hypothetical protein PRUPE_ppa011476mg           76.6    2e-13    Prunus persica
gb|ACN40662.1|  unknown                                               76.6    2e-13    Picea sitchensis
ref|XP_006842472.1|  hypothetical protein AMTR_s00077p00075600        76.6    2e-13    
ref|XP_006850621.1|  hypothetical protein AMTR_s00034p00169430        76.6    2e-13    Amborella trichopoda
dbj|BAO32071.1|  chalcone isomerase Type4                             76.3    3e-13    Antirrhinum majus [garden snapdragon]
ref|XP_009384766.1|  PREDICTED: probable chalcone--flavonone isom...  75.9    3e-13    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACM62743.1|  chalcone isomerase                                    75.9    3e-13    Garcinia mangostana [mangosteen]
ref|XP_009384767.1|  PREDICTED: probable chalcone--flavonone isom...  75.9    4e-13    Musa acuminata subsp. malaccensis [pisang utan]
gb|ADV71377.1|  chalcone isomerase 2                                  76.3    4e-13    Pueraria montana var. lobata [kudzu]
gb|AGE10598.1|  chalcone isomerase                                    75.9    4e-13    Lonicera japonica [Japanese honeysuckle]
gb|ABK23299.1|  unknown                                               75.9    4e-13    Picea sitchensis
ref|XP_008233882.1|  PREDICTED: probable chalcone--flavonone isom...  75.9    4e-13    Prunus mume [ume]
gb|AFQ92051.1|  chalcone isomerase                                    75.5    4e-13    Pyrus pyrifolia [sha li]
gb|AHZ08832.1|  CHI-ACAD                                              75.5    5e-13    Allium cepa
ref|XP_002948067.1|  hypothetical protein VOLCADRAFT_103700           75.9    8e-13    Volvox carteri f. nagariensis
ref|XP_010481171.1|  PREDICTED: fatty-acid-binding protein 3-like     73.6    8e-13    Camelina sativa [gold-of-pleasure]
gb|ACB37367.1|  chalcone isomerase 2                                  75.1    8e-13    Glycine max [soybeans]
ref|XP_010063418.1|  PREDICTED: chalcone--flavonone isomerase-like    75.5    9e-13    Eucalyptus grandis [rose gum]
dbj|BAJ10400.1|  enhancer of flavonoid production                     74.7    9e-13    Petunia x hybrida [garden petunia]
ref|XP_010321455.1|  PREDICTED: probable chalcone--flavonone isom...  74.7    9e-13    Solanum lycopersicum
ref|NP_001236755.1|  chalcone--flavonone isomerase 1B-1               74.7    1e-12    Glycine max [soybeans]
sp|A7ISP5.1|CFI2B_SOYBN  RecName: Full=Chalcone--flavonone isomer...  74.3    2e-12    Glycine max [soybeans]
ref|XP_011027080.1|  PREDICTED: chalcone--flavonone isomerase-like    73.9    2e-12    Populus euphratica
ref|XP_004497328.1|  PREDICTED: chalcone--flavonone isomerase 2-like  73.9    2e-12    Cicer arietinum [garbanzo]
ref|XP_002980623.1|  hypothetical protein SELMODRAFT_444624           73.9    2e-12    Selaginella moellendorffii
ref|XP_010252061.1|  PREDICTED: probable chalcone--flavonone isom...  73.6    2e-12    Nelumbo nucifera [Indian lotus]
ref|XP_005704170.1|  chalcone isomerase                               75.1    3e-12    Galdieria sulphuraria
ref|XP_006348611.1|  PREDICTED: chalcone--flavonone isomerase-lik...  73.9    3e-12    Solanum tuberosum [potatoes]
ref|XP_007159893.1|  hypothetical protein PHAVU_002G276500g           73.9    3e-12    Phaseolus vulgaris [French bean]
gb|KDP21650.1|  hypothetical protein JCGZ_03321                       73.2    3e-12    Jatropha curcas
gb|ACN60401.1|  chalcone isomerase                                    73.2    4e-12    Capsicum annuum
ref|XP_005843375.1|  hypothetical protein CHLNCDRAFT_55230            73.6    4e-12    Chlorella variabilis
emb|CDP13908.1|  unnamed protein product                              73.2    5e-12    Coffea canephora [robusta coffee]
ref|XP_002325926.1|  hypothetical protein POPTR_0019s08610g           72.4    6e-12    Populus trichocarpa [western balsam poplar]
ref|XP_010670602.1|  PREDICTED: probable chalcone--flavonone isom...  72.4    6e-12    Beta vulgaris subsp. vulgaris [field beet]
emb|CBJ33403.1|  Similar to Chalcone Isomerase                        72.4    7e-12    Ectocarpus siliculosus
gb|AHA61355.1|  chalcone isomerase                                    72.0    8e-12    Phyllanthus emblica [amla]
emb|CBI25366.3|  unnamed protein product                              72.4    8e-12    Vitis vinifera
emb|CAN70349.1|  hypothetical protein VITISV_012581                   72.0    8e-12    Vitis vinifera
ref|XP_002280158.1|  PREDICTED: probable chalcone--flavonone isom...  72.0    9e-12    Vitis vinifera
ref|XP_011084819.1|  PREDICTED: probable chalcone--flavonone isom...  72.0    1e-11    Sesamum indicum [beniseed]
sp|Q3Y4F4.1|CFI_CANGE  RecName: Full=Chalcone--flavonone isomeras...  71.6    1e-11    Canna x generalis
gb|AGV53050.1|  chalcone isomerase                                    71.6    1e-11    Actinidia chinensis
ref|XP_008809461.1|  PREDICTED: probable chalcone--flavonone isom...  71.2    1e-11    Phoenix dactylifera
ref|XP_006365329.1|  PREDICTED: probable chalcone--flavonone isom...  71.2    2e-11    Solanum tuberosum [potatoes]
ref|XP_010103648.1|  Chalcone--flavonone isomerase                    71.6    2e-11    
gb|KHN37310.1|  Chalcone--flavonone isomerase 1B-2                    71.6    2e-11    Glycine soja [wild soybean]
ref|XP_001419318.1|  predicted protein                                70.5    2e-11    Ostreococcus lucimarinus CCE9901
gb|ADT63063.1|  chalcone isomerase                                    72.0    2e-11    Fagopyrum esculentum
gb|AIY53017.1|  chalcone isomerase                                    71.2    2e-11    Actinidia chrysantha
gb|AAZ80911.1|  chalcone isomerase                                    71.2    2e-11    Canna x generalis
gb|AHH84790.1|  chalcone isomerase                                    71.6    2e-11    Fagopyrum dibotrys [jin qiao]
ref|XP_010931364.1|  PREDICTED: probable chalcone--flavonone isom...  70.9    2e-11    Elaeis guineensis
gb|AGY46120.1|  chalcone isomerase 1                                  70.9    2e-11    Dendrobium hybrid cultivar
ref|NP_001236782.1|  chalcone isomerase 4-like                        70.9    2e-11    Glycine max [soybeans]
ref|NP_001236097.1|  chalcone--flavonone isomerase 1B-2               71.2    2e-11    
gb|AGL50916.1|  chalcone synthase                                     70.9    2e-11    Pyrus communis
gb|ADG27840.1|  chalcone isomerase                                    70.9    2e-11    Gossypium hirsutum [American cotton]
gb|KJB74932.1|  hypothetical protein B456_012G014600                  70.5    3e-11    Gossypium raimondii
gb|AGY46121.1|  chalcone isomerase 2                                  70.5    3e-11    Dendrobium hybrid cultivar
ref|XP_005837532.1|  hypothetical protein GUITHDRAFT_151184           70.5    3e-11    Guillardia theta CCMP2712
gb|KJB74930.1|  hypothetical protein B456_012G014600                  70.5    3e-11    Gossypium raimondii
emb|CEG01417.1|  Chalcone isomerase                                   70.1    3e-11    Ostreococcus tauri
gb|KEH35545.1|  chalcone-flavanone isomerase family protein           69.7    3e-11    Medicago truncatula
ref|XP_011001399.1|  PREDICTED: probable chalcone--flavonone isom...  70.5    3e-11    Populus euphratica
ref|XP_002520870.1|  Chalcone--flavonone isomerase, putative          70.5    3e-11    
ref|XP_002315258.1|  chalcone isomerase family protein                70.5    4e-11    Populus trichocarpa [western balsam poplar]
ref|XP_010543680.1|  PREDICTED: probable chalcone--flavonone isom...  70.1    4e-11    Tarenaya hassleriana [spider flower]
gb|AIS35913.1|  chalcone isomerase                                    70.1    5e-11    Phalaenopsis equestris
sp|A5HBK6.1|CFI_PYRCO  RecName: Full=Chalcone--flavonone isomeras...  70.1    5e-11    Pyrus communis
ref|XP_005854048.1|  chalcone isomerase-like protein                  70.1    5e-11    Nannochloropsis gaditana CCMP526
gb|AFC75728.1|  chalcone isomerase                                    70.5    5e-11    Narcissus tazetta subsp. chinensis
gb|KHN25809.1|  Chalcone--flavonone isomerase                         70.5    6e-11    Glycine soja [wild soybean]
ref|XP_006577878.1|  PREDICTED: chalcone isomerase 4B isoform X1      69.7    6e-11    
gb|ACU16129.1|  unknown                                               69.7    6e-11    Glycine max [soybeans]
dbj|BAO58577.1|  chalcone-flavanone isomerase family protein          69.7    6e-11    Ipomoea nil [qian niu]
ref|XP_005645369.1|  chalcone isomerase                               69.7    6e-11    Coccomyxa subellipsoidea C-169
ref|XP_007011312.1|  Chalcone-flavanone isomerase family protein      70.5    6e-11    
ref|XP_011399347.1|  hypothetical protein F751_0173                   69.3    6e-11    Auxenochlorella protothecoides
ref|XP_005845734.1|  hypothetical protein CHLNCDRAFT_136326           69.7    6e-11    Chlorella variabilis
gb|KEH35546.1|  chalcone-flavanone isomerase family protein           68.6    6e-11    Medicago truncatula
ref|XP_002963874.1|  hypothetical protein SELMODRAFT_227414           69.3    6e-11    
gb|AFC75729.1|  chalcone isomerase                                    70.1    7e-11    Narcissus tazetta subsp. chinensis
gb|AIC33515.1|  CHI                                                   69.3    7e-11    Lycium chinense [Chinese boxthorn]
sp|P11650.1|CFI1_PETHY  RecName: Full=Chalcone--flavonone isomera...  70.1    7e-11    Petunia x hybrida [garden petunia]
ref|XP_006348610.1|  PREDICTED: chalcone--flavonone isomerase-like    69.7    8e-11    Solanum tuberosum [potatoes]
ref|XP_004238994.1|  PREDICTED: chalcone--flavonone isomerase         69.7    8e-11    
gb|AGM46640.1|  chalcone isomerase protein                            69.3    9e-11    Apium graveolens
gb|EYU35208.1|  hypothetical protein MIMGU_mgv1a024098mg              71.2    9e-11    Erythranthe guttata [common monkey flower]
ref|NP_001151452.1|  chalcone--flavonone isomerase                    69.3    1e-10    Zea mays [maize]
gb|AFM36772.1|  chalcone isomerase                                    69.7    1e-10    Narcissus tazetta subsp. chinensis
gb|AIC73814.1|  chalcone isomerase                                    68.9    1e-10    Hibiscus cannabinus [bimli-jute]
ref|XP_006850622.1|  hypothetical protein AMTR_s00034p00169920        68.9    1e-10    
ref|XP_009396862.1|  PREDICTED: chalcone--flavonone isomerase         69.3    1e-10    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFM36773.1|  chalcone isomerase                                    69.3    1e-10    Narcissus tazetta subsp. chinensis
ref|NP_001242041.1|  chalcone isomerase 4B                            68.9    2e-10    
gb|ADQ13184.1|  chalcone isomerase                                    68.6    2e-10    Scutellaria baicalensis [Baikal skullcap]
gb|AJO67964.1|  chalcone isomerase                                    68.9    2e-10    Prunus avium [gean]
gb|KIY97814.1|  chalcone-flavanone isomerase                          68.9    2e-10    Monoraphidium neglectum
dbj|BAJ21533.1|  chalcone isomerase                                   68.6    2e-10    Dahlia pinnata
ref|XP_004977383.1|  PREDICTED: probable chalcone--flavonone isom...  68.2    2e-10    
gb|AJR10104.1|  chalcone flavanone isomerase                          68.2    2e-10    Scutellaria baicalensis [Baikal skullcap]
gb|ABA55017.2|  chalcone isomerase                                    68.2    2e-10    Astragalus mongholicus
prf||1807331A  chalcone flavanone isomerase                           69.7    2e-10 
ref|XP_011079722.1|  PREDICTED: chalcone--flavonone isomerase         68.2    2e-10    Sesamum indicum [beniseed]
emb|CEF99654.1|  Chalcone isomerase                                   68.6    3e-10    Ostreococcus tauri
ref|XP_002871147.1|  chalcone-flavanone isomerase family protein      67.8    3e-10    Arabidopsis lyrata subsp. lyrata
gb|AHG95985.1|  chalcone isomerase                                    67.8    3e-10    Epimedium sagittatum
ref|NP_001150388.1|  chalcone--flavonone isomerase                    68.2    3e-10    
ref|XP_006663745.1|  PREDICTED: probable chalcone--flavonone isom...  67.8    3e-10    Oryza brachyantha
ref|XP_004978529.1|  PREDICTED: probable chalcone--flavonone isom...  67.4    4e-10    
gb|AEO36980.1|  chalcone isomerase                                    67.8    4e-10    Dimocarpus longan [longan]
ref|XP_005714028.1|  Chalcone-flavanone somerase                      68.6    4e-10    Chondrus crispus [carageen]
gb|AHZ31749.1|  chalcone isomerase                                    67.4    4e-10    Viola x wittrockiana
ref|XP_006662674.1|  PREDICTED: probable chalcone--flavonone isom...  67.0    5e-10    Oryza brachyantha
ref|XP_009344896.1|  PREDICTED: chalcone--flavonone isomerase iso...  67.8    5e-10    
ref|XP_006662673.1|  PREDICTED: probable chalcone--flavonone isom...  67.0    5e-10    Oryza brachyantha
gb|ADZ54781.1|  chalcone isomerase                                    67.4    5e-10    Prunus avium [gean]
gb|AEO79980.1|  chalcone isomerase                                    67.4    6e-10    Prunus avium [gean]
ref|XP_010238805.1|  PREDICTED: probable chalcone--flavonone isom...  67.0    6e-10    Brachypodium distachyon [annual false brome]
sp|Q9M5B3.1|CFI3_PETHY  RecName: Full=Chalcone--flavonone isomera...  67.4    7e-10    Petunia x hybrida [garden petunia]
gb|AGL81346.1|  chalcone isomerase                                    67.0    7e-10    Pyrus communis
gb|AEO36936.1|  CHI                                                   67.0    7e-10    Canarium album [Chinese white-olive]
gb|AJO67975.1|  chalcone isomerase                                    67.0    7e-10    Prunus avium [gean]
ref|XP_008233532.1|  PREDICTED: chalcone--flavonone isomerase         67.0    7e-10    Prunus mume [ume]
pdb|4DOK|A  Chain A, Crystal Structure Of Arabidopsis Thaliana Ch...  66.6    7e-10    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009335926.1|  PREDICTED: chalcone--flavonone isomerase-like    68.9    7e-10    Pyrus x bretschneideri [bai li]
ref|NP_568154.1|  Chalcone-flavanone isomerase family protein         66.6    8e-10    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009344895.1|  PREDICTED: chalcone--flavonone isomerase iso...  68.6    9e-10    Pyrus x bretschneideri [bai li]
dbj|BAB09970.1|  unnamed protein product                              66.2    9e-10    Arabidopsis thaliana [mouse-ear cress]
gb|EWM21716.1|  chalcone isomerase-like protein                       68.9    9e-10    Nannochloropsis gaditana
gb|ACP30360.1|  chalcone isomerase protein                            66.6    9e-10    Malus hybrid cultivar
ref|XP_007137637.1|  hypothetical protein PHAVU_009G143100g           66.2    1e-09    
gb|AEN03361.1|  chalcone isomerase                                    66.6    1e-09    
sp|Q42663.1|CFI_CALCH  RecName: Full=Chalcone--flavonone isomeras...  66.6    1e-09    
gb|AEK32592.1|  chalcone isomerase                                    66.2    1e-09    
gb|AFM36771.1|  chalcone isomerase                                    66.6    1e-09    
ref|XP_010917200.1|  PREDICTED: fatty-acid-binding protein 2 isof...  68.2    1e-09    
ref|XP_010917201.1|  PREDICTED: fatty-acid-binding protein 2 isof...  68.2    1e-09    
sp|Q4AE12.1|CFI2_FRAAN  RecName: Full=Chalcone--flavonone isomera...  66.6    1e-09    
ref|XP_003082012.1|  mRNA splicing factor ATP-dependent RNA helic...  68.6    1e-09    
gb|EEE51527.1|  hypothetical protein OsJ_32725                        65.9    1e-09    
ref|NP_001275866.1|  chalcone--flavonone isomerase                    65.9    1e-09    
ref|NP_001065587.1|  Os11g0116300                                     65.9    1e-09    
ref|XP_004239430.1|  PREDICTED: chalcone--flavonone isomerase-like    65.9    2e-09    
sp|Q565D8.1|CFI_GENTR  RecName: Full=Chalcone--flavonone isomeras...  65.9    2e-09    
ref|XP_003592766.1|  Chalcone-flavonone isomerase                     65.9    2e-09    
gb|ADP09377.1|  chalcone isomerase                                    65.9    2e-09    
emb|CDX70163.1|  BnaA10g25120D                                        65.5    2e-09    
gb|KJB78871.1|  hypothetical protein B456_013G023400                  66.2    2e-09    
gb|ADB92596.1|  chalcone isomerase                                    65.9    2e-09    
gb|EEC67544.1|  hypothetical protein OsI_34872                        65.5    2e-09    
ref|XP_009122136.1|  PREDICTED: probable chalcone--flavonone isom...  65.5    2e-09    
ref|XP_008392235.1|  PREDICTED: chalcone--flavonone isomerase-like    65.5    2e-09    
ref|XP_008386466.1|  PREDICTED: chalcone--flavonone isomerase         65.5    2e-09    
gb|AHJ80977.1|  chalcone isomerase                                    65.5    2e-09    
ref|XP_010259992.1|  PREDICTED: chalcone--flavonone isomerase 2-like  67.0    3e-09    
gb|AGJ50586.1|  CHI                                                   65.5    3e-09    
gb|AJF45950.1|  type II chalcone isomerase                            65.1    3e-09    
gb|ADK55061.1|  chalcone isomerase                                    65.1    3e-09    
gb|KDO67822.1|  hypothetical protein CISIN_1g027531mg                 65.1    3e-09    
ref|XP_006371287.1|  hypothetical protein POPTR_0019s08610g           63.9    4e-09    
gb|AEO17326.1|  chalcone isomerase                                    64.7    4e-09    
ref|XP_008370159.1|  PREDICTED: chalcone--flavonone isomerase-lik...  66.6    4e-09    
gb|ADE77594.1|  unknown                                               66.6    4e-09    
ref|XP_003592768.1|  Chalcone-flavonone isomerase                     64.7    4e-09    
gb|AES63019.2|  chalcone-flavanone isomerase family protein           64.7    4e-09    
ref|XP_009804110.1|  PREDICTED: chalcone--flavonone isomerase         65.1    4e-09    
sp|Q33DL3.1|CFI_TOBAC  RecName: Full=Chalcone--flavonone isomeras...  65.1    5e-09    
ref|XP_007155613.1|  hypothetical protein PHAVU_003G216600g           64.7    5e-09    
gb|AIU98511.1|  chalcone isomerase                                    64.7    5e-09    
gb|EAY82043.1|  hypothetical protein OsI_37230                        64.3    5e-09    
gb|AIY22761.1|  chalcone flavanone isomerase                          64.7    5e-09    
gb|EAZ19439.1|  hypothetical protein OsJ_35000                        64.3    5e-09    
gb|AGE10599.1|  chalcone isomerase                                    64.7    5e-09    
gb|AEP37358.1|  chalcone isomerase                                    64.7    6e-09    
ref|XP_009267833.1|  hypothetical protein J056_004357                 65.5    6e-09    
ref|XP_002988277.1|  hypothetical protein SELMODRAFT_447240           64.3    6e-09    
ref|NP_001065990.1|  Os12g0115700                                     64.3    6e-09    
gb|AEK70330.1|  chalcone isomerase                                    64.3    6e-09    
dbj|BAJ95751.1|  predicted protein                                    64.3    7e-09    
emb|CDP00020.1|  unnamed protein product                              64.7    7e-09    
ref|XP_008349840.1|  PREDICTED: LOW QUALITY PROTEIN: chalcone--fl...  65.5    7e-09    
ref|XP_006398990.1|  hypothetical protein EUTSA_v10014675mg           63.9    7e-09    
ref|XP_006398989.1|  hypothetical protein EUTSA_v10014675mg           63.9    7e-09    
ref|XP_008366537.1|  PREDICTED: asparagine--tRNA ligase, cytoplas...  63.9    7e-09    
ref|XP_011084820.1|  PREDICTED: probable chalcone--flavonone isom...  63.9    7e-09    
dbj|BAJ17665.1|  chalcone isomerase                                   64.3    8e-09    
gb|ABS58500.1|  chalcone isomerase                                    63.9    8e-09    
ref|XP_010261872.1|  PREDICTED: fatty-acid-binding protein 2-like...  65.9    8e-09    
sp|A1E260.2|CFI1_CHRMO  RecName: Full=Chalcone--flavonone isomera...  63.9    1e-08    
gb|KHG18033.1|  Chalcone--flavonone isomerase                         63.9    1e-08    
sp|A1E261.1|CFI2_CHRMO  RecName: Full=Chalcone--flavonone isomera...  63.9    1e-08    
emb|CDX98830.1|  BnaC09g50050D                                        63.5    1e-08    
gb|AAT94363.1|  chalcone isomerase 4B                                 62.4    1e-08    
ref|XP_002976903.1|  hypothetical protein SELMODRAFT_151616           63.5    1e-08    
gb|AJO67976.1|  chalcone isomerase                                    63.9    1e-08    
ref|XP_001696959.1|  chalcone-flavanone isomerase                     64.3    1e-08    
ref|XP_004149817.1|  PREDICTED: chalcone--flavonone isomerase-like    63.9    1e-08    
sp|Q2PF16.1|CFI_VERHY  RecName: Full=Chalcone--flavonone isomeras...  63.5    1e-08    
sp|A4F1Q8.1|CFI_CLITE  RecName: Full=Chalcone--flavonone isomeras...  63.5    1e-08    
sp|A2IBF8.1|CFI_GOSHI  RecName: Full=Chalcone--flavonone isomeras...  63.5    1e-08    
gb|AIY22759.1|  chalcone flavanone isomerase                          63.5    1e-08    
gb|AIY22760.1|  chalcone flavanone isomerase                          63.5    1e-08    
gb|ESA17013.1|  hypothetical protein GLOINDRAFT_2402                  63.9    2e-08    
sp|Q8H0G2.1|CFI1_LOTJA  RecName: Full=Chalcone--flavonone isomera...  63.2    2e-08    
gb|AFA55178.1|  chalcone isomerase                                    63.2    2e-08    
ref|XP_007218371.1|  hypothetical protein PRUPE_ppa011276mg           62.8    2e-08    
sp|Q6BEH3.1|CFI_EUSER  RecName: Full=Chalcone--flavonone isomeras...  62.8    2e-08    
ref|XP_009391464.1|  PREDICTED: fatty-acid-binding protein 2          64.3    3e-08    
ref|XP_010253382.1|  PREDICTED: chalcone--flavonone isomerase-like    63.2    3e-08    
ref|NP_001236768.1|  chalcone--flavonone isomerase 2-A                62.4    3e-08    
gb|ACU13680.1|  unknown                                               62.4    3e-08    
gb|AFH02720.1|  chalcone isomerase                                    62.0    3e-08    
dbj|BAO58581.1|  chalcone-flavanone isomerase family protein          62.0    3e-08    
gb|AFM29131.1|  chalcone isomerase                                    62.0    3e-08    
ref|XP_003592763.1|  Chalcone-flavonone isomerase 2-B                 62.4    3e-08    
ref|XP_008370172.1|  PREDICTED: chalcone--flavonone isomerase-lik...  63.5    3e-08    
sp|A7ISP6.1|CFI3_SOYBN  RecName: Full=Chalcone--flavonone isomera...  62.4    4e-08    
sp|Q8H0G1.1|CFI2_LOTJA  RecName: Full=Chalcone--flavonone isomera...  62.0    4e-08    
ref|XP_008370149.1|  PREDICTED: chalcone--flavonone isomerase-lik...  63.5    4e-08    
ref|XP_008786651.1|  PREDICTED: fatty-acid-binding protein 2 isof...  63.5    4e-08    
ref|XP_008385653.1|  PREDICTED: chalcone--flavonone isomerase-like    63.2    4e-08    
ref|XP_008370152.1|  PREDICTED: chalcone--flavonone isomerase-lik...  63.5    4e-08    
ref|XP_008786652.1|  PREDICTED: fatty-acid-binding protein 2 isof...  63.5    4e-08    
gb|AJA79071.1|  chalcone isomerase                                    61.6    5e-08    
ref|XP_008370163.1|  PREDICTED: chalcone--flavonone isomerase-lik...  63.5    5e-08    
ref|XP_008370145.1|  PREDICTED: uncharacterized protein LOC103433...  63.5    5e-08    
ref|XP_004307451.1|  PREDICTED: chalcone--flavonone isomerase 1       62.0    6e-08    
gb|AEV53926.1|  chalcone isomerase                                    62.0    7e-08    
gb|AFK46681.1|  unknown                                               61.2    7e-08    
gb|ADZ28513.1|  chalcone isomerase                                    61.2    8e-08    
ref|XP_008463530.1|  PREDICTED: chalcone--flavonone isomerase-like    61.6    8e-08    
dbj|BAK06820.1|  predicted protein                                    62.8    8e-08    
gb|KCW65781.1|  hypothetical protein EUGRSUZ_G03138                   60.1    9e-08    
gb|AEF30419.1|  chalcone isomerase                                    60.1    1e-07    
gb|AJF45951.1|  type II chalcone isomerase                            60.8    1e-07    
gb|AGH13331.1|  chalcone isomerase                                    61.2    1e-07    
sp|Q4AE11.1|CFI1_FRAAN  RecName: Full=Chalcone--flavonone isomera...  60.8    1e-07    
ref|NP_001268033.1|  chalcone--flavonone isomerase 2                  60.8    1e-07    
dbj|BAK01464.1|  predicted protein                                    62.4    1e-07    
gb|KDP46099.1|  hypothetical protein JCGZ_06610                       61.2    1e-07    
sp|A5ANT9.1|CFI2_VITVI  RecName: Full=Chalcone--flavonone isomera...  60.8    1e-07    
ref|XP_006288659.1|  hypothetical protein CARUB_v10001966mg           60.5    1e-07    
ref|XP_002953784.1|  hypothetical protein VOLCADRAFT_106123           60.8    1e-07    
gb|AFP33452.1|  type I chalcone isomerase                             60.8    1e-07    
gb|ADK97764.1|  chalcone isomerase                                    60.5    2e-07    
sp|Q8LKP9.1|CFI_SAUME  RecName: Full=Chalcone--flavonone isomeras...  60.5    2e-07    
gb|ACS36662.1|  CHI protein                                           60.5    2e-07    
gb|KCW65779.1|  hypothetical protein EUGRSUZ_G03138                   59.7    2e-07    
gb|ACB37366.1|  chalcone isomerase 1                                  60.1    2e-07    
ref|XP_010669790.1|  PREDICTED: chalcone--flavonone isomerase-like    60.5    2e-07    
ref|XP_006850685.1|  hypothetical protein AMTR_s00034p00233920        60.5    2e-07    
ref|XP_002290658.1|  predicted protein                                60.1    2e-07    
ref|XP_010067614.1|  PREDICTED: probable chalcone--flavonone isom...  59.7    2e-07    
ref|XP_010555785.1|  PREDICTED: chalcone--flavonone isomerase-like    60.5    2e-07    
sp|Q45QI7.2|CFI_CAMSI  RecName: Full=Chalcone--flavonone isomeras...  60.1    2e-07    
dbj|BAO50257.1|  chalcone isomerase                                   60.1    3e-07    
gb|AHE41428.1|  chalcone isomerase                                    58.9    3e-07    
gb|AGG40806.1|  chalcone isomerase                                    60.1    3e-07    
ref|NP_001170075.1|  uncharacterized protein LOC100383992             59.7    3e-07    
gb|AHY35310.1|  chalcone isomerase                                    59.3    4e-07    
ref|XP_009587034.1|  PREDICTED: chalcone--flavonone isomerase         59.3    5e-07    
emb|CAD69022.1|  chalcone isomerase                                   58.9    5e-07    
gb|ADA60161.1|  chalcone isomerase                                    58.5    5e-07    
ref|XP_004166149.1|  PREDICTED: LOW QUALITY PROTEIN: chalcone--fl...  59.3    5e-07    
sp|P11651.1|CFI2_PETHY  RecName: Full=Chalcone--flavonone isomera...  58.9    6e-07    
gb|AHI86005.1|  chalcone isomerase                                    59.3    6e-07    
ref|XP_007009589.1|  Chalcone-flavanone isomerase family protein      59.3    8e-07    
ref|XP_010050425.1|  PREDICTED: fatty-acid-binding protein 2          59.7    8e-07    
gb|AGQ53961.1|  chalcone isomerase                                    56.6    9e-07    
ref|XP_005836862.1|  hypothetical protein GUITHDRAFT_161963           58.5    1e-06    
gb|ACA04009.1|  chalcone isomerase                                    57.4    1e-06    
ref|XP_010427266.1|  PREDICTED: chalcone--flavonone isomerase 1-like  58.2    1e-06    
ref|XP_007012441.1|  Chalcone-flavanone isomerase family protein ...  59.3    1e-06    
gb|AHY24650.1|  chalcone isomerase                                    57.0    1e-06    
gb|ABY73742.1|  chalcone isomerase                                    57.0    1e-06    
ref|XP_006838250.1|  hypothetical protein AMTR_s00103p00049220        58.2    1e-06    
gb|ABW69691.1|  chalcone isomerase                                    57.8    1e-06    
gb|AII80421.1|  chalcone isomerase                                    57.8    2e-06    
ref|XP_010034339.1|  PREDICTED: chalcone--flavonone isomerase-like    58.2    2e-06    
gb|AFL72080.1|  chalcone isomerase                                    57.8    2e-06    
gb|ACB42446.1|  chalcone isomerase                                    57.8    2e-06    
gb|EMT09843.1|  hypothetical protein F775_13377                       58.2    2e-06    
gb|EPS69369.1|  hypothetical protein M569_05397                       58.2    2e-06    
ref|XP_010101512.1|  Chalcone--flavonone isomerase                    57.0    2e-06    
ref|XP_001783129.1|  predicted protein                                58.5    2e-06    
gb|KJB65385.1|  hypothetical protein B456_010G092800                  58.2    3e-06    
ref|XP_010261878.1|  PREDICTED: fatty-acid-binding protein 2-like...  57.8    3e-06    
ref|XP_002516151.1|  conserved hypothetical protein                   57.8    3e-06    
gb|AAU11843.1|  chalcone isomerase                                    56.6    3e-06    
gb|KJB65388.1|  hypothetical protein B456_010G092800                  57.4    3e-06    
ref|XP_004960880.1|  PREDICTED: chalcone--flavonone isomerase-like    57.8    4e-06    
sp|Q8S911.1|CFI_IPOBA  RecName: Full=Chalcone--flavonone isomeras...  56.6    4e-06    
gb|AEK81535.1|  chalcone isomerase                                    56.6    5e-06    
sp|Q6QHK0.1|CFI_ALLCE  RecName: Full=Chalcone--flavonone isomeras...  56.2    5e-06    
ref|XP_010273909.1|  PREDICTED: fatty-acid-binding protein 2-like     57.4    5e-06    
gb|ABW69676.1|  chalcone isomerase                                    56.2    6e-06    
ref|XP_003570514.1|  PREDICTED: fatty-acid-binding protein 2-like     57.0    6e-06    
sp|O22604.1|CFI_IPOPU  RecName: Full=Chalcone--flavonone isomeras...  56.2    6e-06    
ref|XP_004367465.1|  hypothetical protein ACA1_195220                 56.2    7e-06    
ref|XP_010516069.1|  PREDICTED: chalcone--flavonone isomerase 1       55.8    7e-06    
ref|XP_002463631.1|  hypothetical protein SORBIDRAFT_01g003330        55.8    7e-06    
dbj|BAO32070.1|  chalcone isomerase Type1                             55.8    7e-06    
gb|AGK90268.1|  chalcone isomerase                                    55.1    7e-06    
sp|Q8H0F6.1|CFI3_LOTJA  RecName: Full=Chalcone--flavonone isomera...  55.5    8e-06    
ref|XP_004157379.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  55.8    8e-06    
gb|EGU13282.1|  hypothetical protein RTG_00445                        56.2    9e-06    
gb|EMS20575.1|  chalcone-flavanone isomerase                          56.2    9e-06    
gb|ABW69677.1|  chalcone isomerase                                    55.8    9e-06    
ref|XP_010324996.1|  PREDICTED: fatty-acid-binding protein 2 isof...  56.6    1e-05    
ref|WP_025514499.1|  membrane protein                                 55.1    1e-05    
gb|AAU11844.1|  chalcone isomerase                                    55.5    1e-05    
ref|XP_004497327.1|  PREDICTED: chalcone--flavonone isomerase 1B-...  55.1    1e-05    
gb|ACR38767.1|  unknown                                               55.5    1e-05    
gb|ACG27784.1|  hypothetical protein                                  55.8    1e-05    
gb|ABY55859.1|  CHIcm                                                 54.3    1e-05    
dbj|BAK04136.1|  predicted protein                                    55.8    2e-05    
ref|NP_001130555.1|  hypothetical protein                             55.8    2e-05    
ref|XP_006293143.1|  hypothetical protein CARUB_v10019455mg           55.1    2e-05    
dbj|BAA90334.1|  chalcone isomerase                                   54.7    2e-05    
dbj|BAG14301.1|  chalcone isomerase                                   54.3    2e-05    
ref|WP_043396018.1|  membrane protein                                 53.9    2e-05    
ref|XP_006353847.1|  PREDICTED: fatty-acid-binding protein 2-like     55.5    2e-05    
gb|KFK34755.1|  hypothetical protein AALP_AA5G189500                  54.7    2e-05    
ref|XP_004497326.1|  PREDICTED: chalcone--flavonone isomerase 1-like  54.3    2e-05    
ref|WP_015350972.1|  hypothetical protein                             53.5    2e-05    
ref|WP_002637564.1|  hypothetical protein                             53.5    2e-05    
ref|XP_010324997.1|  PREDICTED: fatty-acid-binding protein 2 isof...  55.1    2e-05    
ref|XP_004245040.1|  PREDICTED: fatty-acid-binding protein 2 isof...  55.1    3e-05    
ref|XP_011270569.1|  hypothetical protein CAOG_08907                  55.1    3e-05    
ref|XP_009610108.1|  PREDICTED: fatty-acid-binding protein 2          55.1    3e-05    
ref|XP_009337152.1|  PREDICTED: fatty-acid-binding protein 2-like     55.1    3e-05    
gb|ABK25337.1|  unknown                                               54.7    3e-05    
ref|XP_007161039.1|  hypothetical protein PHAVU_001G037700g           55.1    3e-05    
ref|XP_002452913.1|  hypothetical protein SORBIDRAFT_04g034910        55.1    3e-05    
ref|XP_001745097.1|  hypothetical protein                             54.3    3e-05    
ref|XP_011467221.1|  PREDICTED: fatty-acid-binding protein 2          54.7    3e-05    
ref|XP_002296145.1|  predicted protein                                55.1    4e-05    
ref|XP_001755373.1|  predicted protein                                53.5    4e-05    
gb|EPS73111.1|  chalcone--flavonone isomerase                         53.5    4e-05    
ref|WP_038497642.1|  lipoprotein transmembrane                        53.1    4e-05    
dbj|BAH89258.1|  putative chalcone isomerase fragment                 51.2    4e-05    
gb|ADB28939.1|  chalcone isomerase                                    53.5    4e-05    
ref|XP_006955964.1|  chalcone isomerase                               54.3    4e-05    
emb|CAA48774.1|  chalcone isomerase                                   52.4    4e-05    
emb|CDX77042.1|  BnaC04g38370D                                        54.3    4e-05    
ref|WP_029757419.1|  hypothetical protein                             53.1    4e-05    
ref|XP_009362846.1|  PREDICTED: fatty-acid-binding protein 2          54.3    5e-05    
ref|XP_010427261.1|  PREDICTED: chalcone--flavonone isomerase 1-like  53.5    5e-05    
ref|XP_010526034.1|  PREDICTED: fatty-acid-binding protein 2 isof...  53.9    5e-05    
ref|XP_004141346.1|  PREDICTED: uncharacterized protein LOC101215752  53.5    5e-05    
sp|Q9LKC3.1|CFI_ARALP  RecName: Full=Chalcone--flavonone isomeras...  53.5    5e-05    



>ref|XP_011098156.1| PREDICTED: fatty-acid-binding protein 3 [Sesamum indicum]
Length=289

 Score =   348 bits (894),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 201/239 (84%), Gaps = 1/239 (0%)
 Frame = -3

Query  803  STFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSL  624
            STFP +  +   +A L G  SP+AASSSSV ++EY EEP T VKFQ SLSLPGC +SLSL
Sbjct  52   STFPPNLCIKRRNAGLEGRLSPKAASSSSVVSSEYTEEPETKVKFQTSLSLPGC-SSLSL  110

Query  623  LGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEK  444
            LGTGYREKVFAIIGVKVYAAGLY N+S+ +KLDAW+GRS+ ELQ DS +F+ IF+APLEK
Sbjct  111  LGTGYREKVFAIIGVKVYAAGLYTNQSVFSKLDAWKGRSSVELQQDSSIFDAIFQAPLEK  170

Query  443  SLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTW  264
            SL I+LVRDVDGKTFWDALDEAISPRI SP+  DE+ALSTFR+IFQGRPLKKGT I LTW
Sbjct  171  SLHIILVRDVDGKTFWDALDEAISPRITSPTPVDESALSTFRSIFQGRPLKKGTSIFLTW  230

Query  263  VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            +D TKMLVCVS D  PSS+DA IES+NVTSALFDVFLG NPVSPSLKAS +NGL   LK
Sbjct  231  LDTTKMLVCVSPDGAPSSVDATIESSNVTSALFDVFLGGNPVSPSLKASASNGLAATLK  289



>ref|XP_008226205.1| PREDICTED: fatty-acid-binding protein 3 [Prunus mume]
Length=280

 Score =   348 bits (892),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = -3

Query  731  ASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYV  552
            ASSSSVG+AEY+EEP T V+FQ SLSLPGC  SLSLLGTGYREKVFAIIGVKVYAAGLYV
Sbjct  66   ASSSSVGSAEYIEEPATKVRFQTSLSLPGCSISLSLLGTGYREKVFAIIGVKVYAAGLYV  125

Query  551  NESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  372
            N+SILN L+AW+GRSAAE+Q DS LF TIF++PLEKSL IVLVRDVDGKTFWDAL++AIS
Sbjct  126  NQSILNSLNAWKGRSAAEIQEDSSLFSTIFQSPLEKSLQIVLVRDVDGKTFWDALNDAIS  185

Query  371  PRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIE  192
            PRIKSP+  DE+ALSTFR+IFQG+PLKKGTFI LTW DP KMLVC+S+D  PSS+DA IE
Sbjct  186  PRIKSPTPVDESALSTFRSIFQGQPLKKGTFIFLTWPDPLKMLVCISADGLPSSVDAAIE  245

Query  191  SANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            S NV  ALFDVF G  PVSPSLK+SV NGLE VLK
Sbjct  246  SENVALALFDVFFGDTPVSPSLKSSVVNGLESVLK  280



>ref|XP_007212009.1| hypothetical protein PRUPE_ppa011189mg [Prunus persica]
 gb|EMJ13208.1| hypothetical protein PRUPE_ppa011189mg [Prunus persica]
Length=220

 Score =   340 bits (873),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -3

Query  722  SSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNES  543
            ++VG+AEY+EEP T V+FQ SLSLPGC  SLSLLGTGYREKVFAIIGVKVYAAGLYVN+S
Sbjct  9    TTVGSAEYIEEPATKVRFQTSLSLPGCSISLSLLGTGYREKVFAIIGVKVYAAGLYVNQS  68

Query  542  ILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRI  363
            ILN L+AW+GRSAAE+Q DS LF TIF++PLEKSL IVLVRDV+GKTFWDAL++AISPRI
Sbjct  69   ILNSLNAWKGRSAAEIQEDSSLFSTIFQSPLEKSLQIVLVRDVEGKTFWDALNDAISPRI  128

Query  362  KSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESAN  183
            KSP+  DE+ALSTFR+IFQG+PLKKGTFI LTW DP+KMLVC+S+D  PSS+DA IES N
Sbjct  129  KSPTPVDESALSTFRSIFQGQPLKKGTFIFLTWPDPSKMLVCISADGLPSSVDAAIESEN  188

Query  182  VTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            V  ALFDVF G  PVSPSLK+SV NGLE VLK
Sbjct  189  VALALFDVFFGDTPVSPSLKSSVVNGLESVLK  220



>ref|XP_011009097.1| PREDICTED: fatty-acid-binding protein 3 [Populus euphratica]
 ref|XP_011009098.1| PREDICTED: fatty-acid-binding protein 3 [Populus euphratica]
 ref|XP_011009099.1| PREDICTED: fatty-acid-binding protein 3 [Populus euphratica]
 ref|XP_011009100.1| PREDICTED: fatty-acid-binding protein 3 [Populus euphratica]
Length=279

 Score =   333 bits (855),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 174/249 (70%), Positives = 199/249 (80%), Gaps = 2/249 (1%)
 Frame = -3

Query  830  KTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSS-VGNAEYVEEPTTNVKFQRSLS  654
            KTHS F+  STFP H +  S    L    +  ++SSS  VG+AEY EE  T  KFQRSLS
Sbjct  32   KTHSDFSPLSTFP-HLNNNSTPTHLSFKAASSSSSSSFSVGSAEYTEETATKEKFQRSLS  90

Query  653  LPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLF  474
            LPGC TSLSLLGTGYREKVFAIIGVKVYAAGLYVN SIL+ L  W+G+SA+E+Q +S LF
Sbjct  91   LPGCSTSLSLLGTGYREKVFAIIGVKVYAAGLYVNPSILSTLSTWKGQSASEIQENSALF  150

Query  473  ETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPL  294
             +IF+APLEKSL IVLVRD+DGKTFWDALD+AISPRIK+ +  DE+ALSTFR+IFQGR L
Sbjct  151  SSIFQAPLEKSLQIVLVRDIDGKTFWDALDDAISPRIKTATPVDESALSTFRSIFQGRSL  210

Query  293  KKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASV  114
            KKGT I LTW++P+KMLVCVSSD  PSS+DA IES NVTSALFDVF G  PVSPSLK S 
Sbjct  211  KKGTLIFLTWLNPSKMLVCVSSDGIPSSVDATIESENVTSALFDVFFGDAPVSPSLKNSA  270

Query  113  ANGLEVVLK  87
            ANGL  +LK
Sbjct  271  ANGLATILK  279



>ref|XP_004146009.1| PREDICTED: chalcone--flavonone isomerase 2-like [Cucumis sativus]
 ref|XP_004168303.1| PREDICTED: chalcone--flavonone isomerase 2-like [Cucumis sativus]
 gb|KGN55017.1| hypothetical protein Csa_4G622760 [Cucumis sativus]
Length=278

 Score =   332 bits (852),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 168/236 (71%), Positives = 197/236 (83%), Gaps = 1/236 (0%)
 Frame = -3

Query  791  SHFSLGSLDARLPGLFSPRAASS-SSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGT  615
            S FSL + + R    FS R +SS +SVGNA +VEEP+TNVKF  SL+LPGC TSLSLLGT
Sbjct  43   STFSLSNNNFRFYSNFSLRPSSSLASVGNAGFVEEPSTNVKFPTSLTLPGCSTSLSLLGT  102

Query  614  GYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLS  435
            GYREKVFAIIGVKVYAAGLY+N S+ N+L+AWRGRSAA +Q DS LF+ IF++  EKSL 
Sbjct  103  GYREKVFAIIGVKVYAAGLYINSSVSNELNAWRGRSAAAIQEDSSLFDIIFQSRSEKSLQ  162

Query  434  IVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDP  255
            IVLVRDVDGKTFWDALD+AISPRIK+P+ DDE+ALSTFR+IF+GR LKKGTFI LTW++P
Sbjct  163  IVLVRDVDGKTFWDALDDAISPRIKAPTPDDESALSTFRSIFEGRSLKKGTFIFLTWLEP  222

Query  254  TKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
             KMLV +S D +P+ IDA IES NVTS+LFDVF G +PVSP+LKASVA GL  VLK
Sbjct  223  PKMLVSISIDGSPTGIDATIESNNVTSSLFDVFFGDSPVSPTLKASVATGLAAVLK  278



>ref|XP_007022087.1| Chalcone-flavanone isomerase family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY13612.1| Chalcone-flavanone isomerase family protein isoform 3, partial 
[Theobroma cacao]
Length=210

 Score =   330 bits (845),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = -3

Query  716  VGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESIL  537
            VG A+Y EEP T VKFQ SLSLPGC +SLSLLGTGYREKVFAIIGVKVYAAGLYVN+SIL
Sbjct  1    VGAADYTEEPATKVKFQTSLSLPGCSSSLSLLGTGYREKVFAIIGVKVYAAGLYVNQSIL  60

Query  536  NKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKS  357
            +KLDAW+G  A+++Q+D  LF++IF+ PLEKSL IVLVRDVDGKTFWDALDEAISPRIK+
Sbjct  61   SKLDAWKGWLASQIQDDLSLFKSIFEVPLEKSLQIVLVRDVDGKTFWDALDEAISPRIKA  120

Query  356  PSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVT  177
            P+  D++ALSTFR+IFQGRPL KGTFI LTW DP+KMLV VSSD  P+S DA IESANV 
Sbjct  121  PTPVDQSALSTFRSIFQGRPLNKGTFIFLTWPDPSKMLVAVSSDGMPASTDATIESANVA  180

Query  176  SALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            SALFDVF G  PVSPSLK SVANGL  +LK
Sbjct  181  SALFDVFFGDAPVSPSLKTSVANGLASILK  210



>ref|XP_002283758.2| PREDICTED: fatty-acid-binding protein 3 [Vitis vinifera]
 emb|CBI20088.3| unnamed protein product [Vitis vinifera]
Length=283

 Score =   331 bits (848),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/250 (69%), Positives = 201/250 (80%), Gaps = 3/250 (1%)
 Frame = -3

Query  830  KTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNA--EYVEEPTTNVKFQRSL  657
            K H+  ++ STF  HFSL   D     +    ++SSSS      EY+EEP+TNVKFQ SL
Sbjct  35   KIHTC-SLLSTFAHHFSLQRKDRFQTHVSPNASSSSSSASVGSAEYIEEPSTNVKFQTSL  93

Query  656  SLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            +LP C + LSLLGTGYREKVFAIIGVKVYAAGLY+N+SI NKL+AW+GRSA E+Q DS L
Sbjct  94   TLPECSSPLSLLGTGYREKVFAIIGVKVYAAGLYLNQSISNKLNAWKGRSATEIQGDSSL  153

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRP  297
            F++IF+ P EKSL IVLVRDVDGKTFWDALDEAISPRIK+PS  D +ALSTFR+IFQGR 
Sbjct  154  FDSIFQIPQEKSLQIVLVRDVDGKTFWDALDEAISPRIKAPSPVDVSALSTFRSIFQGRS  213

Query  296  LKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKAS  117
            L+KGTFI LTW++P+KMLVC+SSD  PSS+DA I+S NVT ALFDVF G +PVSPSLKAS
Sbjct  214  LRKGTFIFLTWMEPSKMLVCISSDGLPSSVDATIKSMNVTMALFDVFFGNSPVSPSLKAS  273

Query  116  VANGLEVVLK  87
            VANGL  VLK
Sbjct  274  VANGLATVLK  283



>ref|XP_006348346.1| PREDICTED: fatty-acid-binding protein 3-like [Solanum tuberosum]
Length=274

 Score =   329 bits (844),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = -3

Query  704  EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLD  525
            EY EEP T VKFQRSLSLPGC TSLSLLGTGYREK+FAIIGVKVYAAGLYVN+S+ ++LD
Sbjct  69   EYTEEPATKVKFQRSLSLPGCSTSLSLLGTGYREKIFAIIGVKVYAAGLYVNDSVFSRLD  128

Query  524  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSAD  345
            AWRGRSAA++Q D  LF  IF+A LEKSL IVLVRD+DGKTFWDALDEAISPRIKSP+A+
Sbjct  129  AWRGRSAADIQQDPSLFNNIFEANLEKSLLIVLVRDIDGKTFWDALDEAISPRIKSPTAN  188

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALF  165
            D++ALSTFR +FQG+PLKK T I LTW+DPTKMLV +S D  PSS+DA +ES NV SALF
Sbjct  189  DKSALSTFRAVFQGKPLKKETSIFLTWIDPTKMLVSLSFDGMPSSVDATVESPNVASALF  248

Query  164  DVFLGRNPVSPSLKASVANGLEVVLK  87
            DVFLG +PVSP+LKASVA GLE  LK
Sbjct  249  DVFLGGDPVSPTLKASVAKGLEATLK  274



>emb|CDP06071.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   330 bits (845),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 191/240 (80%), Gaps = 1/240 (0%)
 Frame = -3

Query  809  IFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSL  630
            + S F +H S+          FS +AASSSSV + EY EEP T VKFQ SLS+PGC TS+
Sbjct  42   LLSRFCTHLSIQK-HGSFHSYFSLKAASSSSVESTEYTEEPATKVKFQTSLSIPGCSTSM  100

Query  629  SLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPL  450
             L GTGYREKVFA+IGVKVYAAGLYVN+SI  +L+AW+G+SAA+LQ DS  F+TIF+APL
Sbjct  101  PLTGTGYREKVFAVIGVKVYAAGLYVNQSIFARLEAWKGQSAADLQQDSEFFDTIFQAPL  160

Query  449  EKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVL  270
            EKSL IVLVRDVDGKTFWDALDEAISPRIKSP+  D +ALSTF T+FQGRPL KGT I+L
Sbjct  161  EKSLQIVLVRDVDGKTFWDALDEAISPRIKSPTPVDTSALSTFSTLFQGRPLNKGTIILL  220

Query  269  TWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            TW+D TKMLV VSSD  PS +DA IES NV SALFDVFLG + VSP+LKASV +GL  +L
Sbjct  221  TWLDSTKMLVSVSSDGLPSGVDATIESTNVISALFDVFLGSDSVSPTLKASVTSGLTALL  280



>ref|XP_009769181.1| PREDICTED: fatty-acid-binding protein 3 [Nicotiana sylvestris]
 ref|XP_009769182.1| PREDICTED: fatty-acid-binding protein 3 [Nicotiana sylvestris]
Length=282

 Score =   328 bits (840),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 177/203 (87%), Gaps = 0/203 (0%)
 Frame = -3

Query  695  EEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWR  516
            EEP T VKFQRSLSLPGC TSLSLLGTGYREKVFAIIGVKVYAAGLYVN+S+ ++LDAWR
Sbjct  80   EEPATKVKFQRSLSLPGCSTSLSLLGTGYREKVFAIIGVKVYAAGLYVNDSVFSRLDAWR  139

Query  515  GRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDET  336
            G SAA +Q D+ LF  IF+A LEKSL IVLVRD+DGKTFWDALDEAISPRIKSP+A+D++
Sbjct  140  GHSAAAIQQDTSLFNMIFEANLEKSLRIVLVRDIDGKTFWDALDEAISPRIKSPTAEDKS  199

Query  335  ALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVF  156
            ALSTFR +FQG+PLKK T I LTW+DPTKMLV +S D TPSS+DA IES NV SALFDVF
Sbjct  200  ALSTFRGVFQGKPLKKETSIFLTWIDPTKMLVSLSFDGTPSSVDAIIESTNVASALFDVF  259

Query  155  LGRNPVSPSLKASVANGLEVVLK  87
            LG  PVSPSLKASVANGLE  LK
Sbjct  260  LGGYPVSPSLKASVANGLEAALK  282



>ref|XP_004244307.1| PREDICTED: fatty-acid-binding protein 3 [Solanum lycopersicum]
Length=274

 Score =   327 bits (838),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = -3

Query  704  EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLD  525
            EY EEP T VKFQRSLSLPGC TSLSLLGTGYREK+FAIIGVKVYAAGLYVN+S+ + LD
Sbjct  69   EYTEEPATKVKFQRSLSLPGCSTSLSLLGTGYREKIFAIIGVKVYAAGLYVNDSVFSSLD  128

Query  524  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSAD  345
            AWRGRSAA++Q D  LF  IF+A LEKSL IVLVRDVDGKTFWDALDEAISPRIKSP+AD
Sbjct  129  AWRGRSAADIQQDPSLFNKIFEADLEKSLLIVLVRDVDGKTFWDALDEAISPRIKSPTAD  188

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALF  165
            D++ALSTFR +FQG+PLKK T I LTW+DP KMLV +S D  PSS+DA IES NV SALF
Sbjct  189  DKSALSTFRGVFQGKPLKKETSIFLTWIDPNKMLVSLSFDGMPSSVDATIESPNVASALF  248

Query  164  DVFLGRNPVSPSLKASVANGLEVVLK  87
            DVFLG +PVSP+LKASVA GLE  LK
Sbjct  249  DVFLGGDPVSPTLKASVAKGLEATLK  274



>ref|XP_006377696.1| hypothetical protein POPTR_0011s10330g [Populus trichocarpa]
 gb|ERP55493.1| hypothetical protein POPTR_0011s10330g [Populus trichocarpa]
Length=282

 Score =   327 bits (839),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 173/252 (69%), Positives = 198/252 (79%), Gaps = 5/252 (2%)
 Frame = -3

Query  830  KTHSYFTIFSTFPSHFSLGS----LDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQR  663
            KTHS F+  ST P H +  S    L  +     S  ++SS SVG+AEY EE  T  KFQR
Sbjct  32   KTHSDFSPLSTIP-HLNNNSTPTHLSFKASSSSSSSSSSSFSVGSAEYTEETATKEKFQR  90

Query  662  SLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDS  483
            SLSLPGC TSLSLLGTGYREKVFAIIGVKVYAAGLYVN SIL+ L  W+G+SA+E+Q +S
Sbjct  91   SLSLPGCSTSLSLLGTGYREKVFAIIGVKVYAAGLYVNPSILSTLSTWKGQSASEIQENS  150

Query  482  PLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQG  303
             LF +IF+APLEKSL IVLVRD+DGKTFWDALD+AISPRIK+    DE+ALS FR+IFQG
Sbjct  151  ALFSSIFQAPLEKSLQIVLVRDIDGKTFWDALDDAISPRIKTAIPVDESALSIFRSIFQG  210

Query  302  RPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLK  123
            R LKKGT I LTW++P+KMLVCVSSD  PSS+DA+IES NVTSALFDVF G  PVSPSLK
Sbjct  211  RSLKKGTLIFLTWLNPSKMLVCVSSDGIPSSVDARIESENVTSALFDVFFGDAPVSPSLK  270

Query  122  ASVANGLEVVLK  87
             S ANGL  +LK
Sbjct  271  NSAANGLATILK  282



>ref|XP_009339359.1| PREDICTED: fatty-acid-binding protein 3-like isoform X2 [Pyrus 
x bretschneideri]
Length=278

 Score =   327 bits (837),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 185/215 (86%), Gaps = 0/215 (0%)
 Frame = -3

Query  731  ASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYV  552
            ASS+SVG+AEY+EEP T  KFQ SLSLPGC +SL+LLGTGYREKVFAIIGVKVYAAGLYV
Sbjct  64   ASSASVGSAEYIEEPATKEKFQTSLSLPGCSSSLTLLGTGYREKVFAIIGVKVYAAGLYV  123

Query  551  NESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  372
            N+S+L  L+AW+GRSAAE+Q DS LF +IF +PLEKSL IVLVRDVDGKTFWDAL++AIS
Sbjct  124  NQSVLYSLNAWKGRSAAEIQEDSSLFNSIFLSPLEKSLQIVLVRDVDGKTFWDALNDAIS  183

Query  371  PRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIE  192
            PRIKSP+  DE+ALSTFR+IFQG+PLKKGTFI LTW DP+KMLV +SSD  PS +DA+I+
Sbjct  184  PRIKSPTPVDESALSTFRSIFQGQPLKKGTFIFLTWPDPSKMLVSISSDGLPSGVDAEIK  243

Query  191  SANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            S NV  ALFDVF G  PVS SLKASV  GLE +LK
Sbjct  244  SENVAFALFDVFFGDTPVSFSLKASVVKGLESILK  278



>gb|EYU26288.1| hypothetical protein MIMGU_mgv1a0115041mg, partial [Erythranthe 
guttata]
Length=209

 Score =   323 bits (829),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -3

Query  710  NAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNK  531
            N+++ EEP T VKFQ SLSLPGC ++LSLLGTGYREKVFAIIGVKVYAAGLY N+S+  K
Sbjct  2    NSDFAEEPATKVKFQTSLSLPGCSSTLSLLGTGYREKVFAIIGVKVYAAGLYANQSVFTK  61

Query  530  LDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS  351
            LDAW G S+AELQ DS LF+ IF+AP+EKSL+IVLVRD+DGKTFWDALDEA+SPRI SP+
Sbjct  62   LDAWSGLSSAELQKDSSLFDAIFQAPVEKSLNIVLVRDIDGKTFWDALDEAVSPRISSPT  121

Query  350  ADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSA  171
              DE+ALSTFR++FQGRPLKKGT I LTW+D T +LVC+S D  PSS+DA IES+NV SA
Sbjct  122  QVDESALSTFRSVFQGRPLKKGTSIFLTWLDTTNVLVCISPDGVPSSVDATIESSNVASA  181

Query  170  LFDVFLGRNPVSPSLKASVANGLEVVLK  87
            LFDVFLG NPVSPSLK+S +NGL   LK
Sbjct  182  LFDVFLGGNPVSPSLKSSASNGLAAALK  209



>emb|CAN75399.1| hypothetical protein VITISV_004495 [Vitis vinifera]
Length=234

 Score =   324 bits (830),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 185/229 (81%), Gaps = 19/229 (8%)
 Frame = -3

Query  716  VGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGT-------------------GYREKVF  594
            +G+AEY+EEP+TNVKFQ SL+LP C + LSLLGT                   GYREKVF
Sbjct  6    IGSAEYIEEPSTNVKFQTSLTLPECSSPLSLLGTVFEHPKLTKAFIFMVCNNSGYREKVF  65

Query  593  AIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDV  414
            AIIGVKVYAAGLY+N+SI NKL+AW+GRSA E+Q DS LF++IF+ PLEKSL IVLVRDV
Sbjct  66   AIIGVKVYAAGLYLNQSISNKLNAWKGRSATEIQGDSSLFDSIFQIPLEKSLQIVLVRDV  125

Query  413  DGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCV  234
            DGKTFWDALDEAISPRIK+PS  D +ALSTFR+IFQGR L+KGTFI LTW++P+KMLVC+
Sbjct  126  DGKTFWDALDEAISPRIKAPSPVDVSALSTFRSIFQGRSLRKGTFIFLTWMEPSKMLVCI  185

Query  233  SSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            SSD  PSS+DA I+S NVT  LFDVF G +PVSPSLKASVANGL  VLK
Sbjct  186  SSDGLPSSVDATIKSMNVTMVLFDVFFGNSPVSPSLKASVANGLATVLK  234



>ref|XP_010241349.1| PREDICTED: fatty-acid-binding protein 3 [Nelumbo nucifera]
Length=281

 Score =   324 bits (830),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  719  SVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESI  540
            SV +AEY  EP TNVKFQ SLSLPGC + L+LLGTGYREKVFAI+GVKVYAAGLY N  I
Sbjct  71   SVESAEYAAEPATNVKFQTSLSLPGCSSELALLGTGYREKVFAIVGVKVYAAGLYANPLI  130

Query  539  LNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIK  360
            +  L+AW+GRSAAE+Q DS LF ++F+A LEKSL IVLVRDVDGKTFW ALDEAI+PRIK
Sbjct  131  IGTLNAWKGRSAAEIQQDSSLFHSMFQASLEKSLQIVLVRDVDGKTFWGALDEAITPRIK  190

Query  359  SPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANV  180
             P+  DE+ALS FR IFQGRPLKKGTFI LTW+ P+KM VCVSSD  PS++DA IES NV
Sbjct  191  EPTLVDESALSKFRDIFQGRPLKKGTFIFLTWLGPSKMQVCVSSDGMPSNVDATIESTNV  250

Query  179  TSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            T ALFDVFLG  PVSPSLKASV+NGL  VLK
Sbjct  251  TLALFDVFLGNTPVSPSLKASVSNGLAKVLK  281



>gb|KJB82093.1| hypothetical protein B456_013G176000 [Gossypium raimondii]
Length=278

 Score =   323 bits (828),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 179/213 (84%), Gaps = 0/213 (0%)
 Frame = -3

Query  725  SSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNE  546
            +SSVG A+Y EEP T VKF+ SLS+P C TSLSLLGTGYREKVFAIIGVKVYAAGLYVN 
Sbjct  66   ASSVGTADYTEEPATKVKFRTSLSVPDCSTSLSLLGTGYREKVFAIIGVKVYAAGLYVNP  125

Query  545  SILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPR  366
            SIL+KLDAW+GRSAA++Q+D PLF++ F+ P+EKSL IVLVRDVDGKTFWDALDEAISPR
Sbjct  126  SILSKLDAWKGRSAAQIQDDMPLFKSFFEDPMEKSLQIVLVRDVDGKTFWDALDEAISPR  185

Query  365  IKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESA  186
            IK+P+  DE+ALSTFR IFQGRPL KGT I LTW  P+KMLV VSSD  P+S DA IES 
Sbjct  186  IKAPTPVDESALSTFRGIFQGRPLNKGTSIFLTWPHPSKMLVAVSSDGLPTSNDATIESP  245

Query  185  NVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            NV SALFDVF G  PVSPSLK SVA GL  +LK
Sbjct  246  NVGSALFDVFFGDAPVSPSLKTSVATGLATILK  278



>ref|XP_009625508.1| PREDICTED: fatty-acid-binding protein 3 [Nicotiana tomentosiformis]
 ref|XP_009625509.1| PREDICTED: fatty-acid-binding protein 3 [Nicotiana tomentosiformis]
Length=285

 Score =   323 bits (829),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 175/201 (87%), Gaps = 0/201 (0%)
 Frame = -3

Query  689  PTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGR  510
            P T VKFQRSLSLPGC TSLSLLGTGYREKVFAIIGVKVYAAGLY+N+S+ ++LD WRGR
Sbjct  85   PATKVKFQRSLSLPGCSTSLSLLGTGYREKVFAIIGVKVYAAGLYINDSVFSRLDTWRGR  144

Query  509  SAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETAL  330
            SAAE+Q D+ LF  IF+A LEKSL IVLVRD+DGKTFWDALDEAISPRIKSP+A+D+ AL
Sbjct  145  SAAEIQQDTSLFNMIFEANLEKSLRIVLVRDIDGKTFWDALDEAISPRIKSPTAEDKAAL  204

Query  329  STFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLG  150
            STFR +FQG+PLKK T I LTW++PTKMLV +S D  PSS+DA IES NV SALFDVFLG
Sbjct  205  STFRGVFQGKPLKKETSIFLTWINPTKMLVSLSFDGMPSSVDATIESTNVASALFDVFLG  264

Query  149  RNPVSPSLKASVANGLEVVLK  87
             +PVSPSLKASVANGLE  LK
Sbjct  265  GDPVSPSLKASVANGLEAALK  285



>ref|XP_007022085.1| Chalcone-flavanone isomerase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY13610.1| Chalcone-flavanone isomerase family protein isoform 1 [Theobroma 
cacao]
Length=281

 Score =   323 bits (828),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = -3

Query  704  EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLD  525
            +Y EEP T VKFQ SLSLPGC +SLSLLGTGYREKVFAIIGVKVYAAGLYVN+SIL+KLD
Sbjct  76   DYTEEPATKVKFQTSLSLPGCSSSLSLLGTGYREKVFAIIGVKVYAAGLYVNQSILSKLD  135

Query  524  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSAD  345
            AW+G  A+++Q+D  LF++IF+ PLEKSL IVLVRDVDGKTFWDALDEAISPRIK+P+  
Sbjct  136  AWKGWLASQIQDDLSLFKSIFEVPLEKSLQIVLVRDVDGKTFWDALDEAISPRIKAPTPV  195

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALF  165
            D++ALSTFR+IFQGRPL KGTFI LTW DP+KMLV VSSD  P+S DA IESANV SALF
Sbjct  196  DQSALSTFRSIFQGRPLNKGTFIFLTWPDPSKMLVAVSSDGMPASTDATIESANVASALF  255

Query  164  DVFLGRNPVSPSLKASVANGLEVVLK  87
            DVF G  PVSPSLK SVANGL  +LK
Sbjct  256  DVFFGDAPVSPSLKTSVANGLASILK  281



>ref|XP_009344622.1| PREDICTED: fatty-acid-binding protein 3-like [Pyrus x bretschneideri]
Length=278

 Score =   322 bits (824),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/237 (71%), Positives = 195/237 (82%), Gaps = 4/237 (2%)
 Frame = -3

Query  794  PSHFS-LGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLG  618
            P HFS   ++ +R P   +   ASS+SVG+AEY+EEP T  KFQ SLSLPGC +SL+LLG
Sbjct  45   PIHFSPQKNIKSRTPFAVN---ASSTSVGSAEYIEEPATKEKFQTSLSLPGCSSSLTLLG  101

Query  617  TGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSL  438
            TGYREKVFAIIGVKVYAAGLY N+SILN L+AW+GRS A +Q DS LF +IF +P EKSL
Sbjct  102  TGYREKVFAIIGVKVYAAGLYANQSILNSLNAWKGRSTAYIQEDSSLFSSIFLSPSEKSL  161

Query  437  SIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVD  258
             IVLVRDVDGKTFWDAL++AISPRIKSP+  DE+ALSTFR+IFQG+PLKKGTFI LTW D
Sbjct  162  QIVLVRDVDGKTFWDALNDAISPRIKSPTPVDESALSTFRSIFQGQPLKKGTFIFLTWPD  221

Query  257  PTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            P+KMLVC+SSD  PS +DA+IES NV  ALFDVF G  PVSPSLKASV NGLE +LK
Sbjct  222  PSKMLVCISSDGLPSGVDAEIESENVAFALFDVFFGDTPVSPSLKASVLNGLESILK  278



>gb|KDO52113.1| hypothetical protein CISIN_1g023649mg [Citrus sinensis]
Length=279

 Score =   322 bits (824),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 189/225 (84%), Gaps = 0/225 (0%)
 Frame = -3

Query  761  RLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIG  582
            R+   F+ +A+SSSSVG+AEY EEP T VKFQ+SLSLPG  + LSLLGTGYREKVFAIIG
Sbjct  55   RIQPHFTVKASSSSSVGSAEYTEEPATKVKFQKSLSLPGYSSPLSLLGTGYREKVFAIIG  114

Query  581  VKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKT  402
            VKVYAAGLY+N+SIL+KL+AW+G+ AA +Q DS LF+TI++AP EKSL IVLVRDVDGKT
Sbjct  115  VKVYAAGLYINQSILSKLNAWKGKGAANIQEDSSLFDTIYQAPSEKSLKIVLVRDVDGKT  174

Query  401  FWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDA  222
            FWDALD+AISPRI+ P+  DE+ALSTFR+IFQGR L KGTFI LTW+DP+KMLV +S D 
Sbjct  175  FWDALDDAISPRIRIPTPVDESALSTFRSIFQGRNLMKGTFIFLTWLDPSKMLVSISGDG  234

Query  221  TPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
             PS +DA IES NVT AL+DVF G  PVSPSLKASVA GL  +LK
Sbjct  235  LPSGVDATIESENVTFALYDVFFGGAPVSPSLKASVATGLATILK  279



>ref|XP_008363648.1| PREDICTED: fatty-acid-binding protein 3-like [Malus domestica]
Length=278

 Score =   322 bits (824),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/237 (72%), Positives = 194/237 (82%), Gaps = 4/237 (2%)
 Frame = -3

Query  794  PSHFSLG-SLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLG  618
            P HFSL  ++ +R P   +   ASS+SVG AEY+EEP T  KFQ SLSLPGC +SL+LLG
Sbjct  45   PIHFSLQKNIKSRTPFAVN---ASSTSVGRAEYMEEPVTKEKFQTSLSLPGCSSSLTLLG  101

Query  617  TGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSL  438
            TGYREKVFAIIGVKVYAAGLY N+SILN L+AW GRS AE+Q DS LF +IF +P  KSL
Sbjct  102  TGYREKVFAIIGVKVYAAGLYANQSILNSLNAWXGRSTAEIQEDSSLFSSIFLSPSVKSL  161

Query  437  SIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVD  258
             IVLVRDVDGKTFWDAL++AISPRIKSP+  DE+ALSTFR+IFQG+PLKKGTFI LTW D
Sbjct  162  QIVLVRDVDGKTFWDALNDAISPRIKSPTPVDESALSTFRSIFQGQPLKKGTFIFLTWPD  221

Query  257  PTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            P+KMLVC+SSD  PS +DA+IES NV  ALFDVF G  PVSPSLKASV NGLE +LK
Sbjct  222  PSKMLVCISSDGLPSGVDAEIESENVAFALFDVFFGDTPVSPSLKASVLNGLESILK  278



>ref|XP_006442319.1| hypothetical protein CICLE_v10021578mg [Citrus clementina]
 gb|ESR55559.1| hypothetical protein CICLE_v10021578mg [Citrus clementina]
Length=279

 Score =   321 bits (823),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 189/225 (84%), Gaps = 0/225 (0%)
 Frame = -3

Query  761  RLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIG  582
            R+   F+ +A+SSSSVG+AEY EEP T VKFQ+SLSLPG  + LSLLGTGYREKVFAIIG
Sbjct  55   RIQPHFTVKASSSSSVGSAEYTEEPVTKVKFQKSLSLPGYSSPLSLLGTGYREKVFAIIG  114

Query  581  VKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKT  402
            VKVYAAGLY+N+SIL+KL+AW+G+ AA +Q DS LF+TI++AP EKSL IVLVRDVDGKT
Sbjct  115  VKVYAAGLYINQSILSKLNAWKGKGAANIQEDSSLFDTIYQAPSEKSLKIVLVRDVDGKT  174

Query  401  FWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDA  222
            FWDALD+AISPRI+ P+  DE+ALSTFR+IFQGR L KGTFI LTW+DP+KMLV +S D 
Sbjct  175  FWDALDDAISPRIRIPTPVDESALSTFRSIFQGRNLMKGTFIFLTWLDPSKMLVSISGDG  234

Query  221  TPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
             PS +DA IES NVT AL+DVF G  PVSPSLKASVA GL  +LK
Sbjct  235  LPSGVDATIESENVTFALYDVFFGGAPVSPSLKASVATGLATILK  279



>ref|XP_006477800.1| PREDICTED: fatty-acid-binding protein 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006477801.1| PREDICTED: fatty-acid-binding protein 3-like isoform X2 [Citrus 
sinensis]
Length=279

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 189/225 (84%), Gaps = 0/225 (0%)
 Frame = -3

Query  761  RLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIG  582
            R+   F+ +A+SSSSVG+AEY EEP T VKFQ+SLSLPG  + LSLLGTGYREKVFAIIG
Sbjct  55   RIQPHFTVKASSSSSVGSAEYTEEPATKVKFQKSLSLPGYSSPLSLLGTGYREKVFAIIG  114

Query  581  VKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKT  402
            VKVYAAGLY+N+SIL+KL+AW+G+ AA +Q DS LF+TI++AP EKSL IVLVRDVDGKT
Sbjct  115  VKVYAAGLYINQSILSKLNAWKGKGAANIQEDSSLFDTIYQAPSEKSLKIVLVRDVDGKT  174

Query  401  FWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDA  222
            FWDALD+AISPRI+ P+  DE+ALSTFR+IFQGR L KGTFI LTW+DP+KMLV +S D 
Sbjct  175  FWDALDDAISPRIRIPTPVDESALSTFRSIFQGRNLMKGTFIFLTWLDPSKMLVSISVDG  234

Query  221  TPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
             PS +DA IES NVT AL+DVF G  PVSPSLKASVA GL  +LK
Sbjct  235  LPSGVDATIESENVTFALYDVFFGGAPVSPSLKASVATGLATILK  279



>ref|XP_008452432.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Cucumis melo]
Length=316

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 193/236 (82%), Gaps = 1/236 (0%)
 Frame = -3

Query  791  SHFSLGSLDARLPGLFSPRAASS-SSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGT  615
            S FSL +   R    FS + +SS +SVGNA +VEEP+TNVKF  SL+LPGC TSLSLLGT
Sbjct  81   STFSLNNNFFRFSSNFSLKPSSSLASVGNAGFVEEPSTNVKFPTSLTLPGCSTSLSLLGT  140

Query  614  GYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLS  435
            GYREKVFAIIGVKVYAAGLY+N S+ N+L+AWRGRSAA +Q DS LF+ IF++  EKSL 
Sbjct  141  GYREKVFAIIGVKVYAAGLYINSSVSNELNAWRGRSAAAIQEDSSLFDIIFQSCSEKSLQ  200

Query  434  IVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDP  255
            IVLVRDVDGKTFWDALD+AISPRIK+P+  DE+ALSTFR+IF+GR LKKGTFI LTW++P
Sbjct  201  IVLVRDVDGKTFWDALDDAISPRIKAPTPGDESALSTFRSIFEGRSLKKGTFIFLTWLEP  260

Query  254  TKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
             KMLV +S +  P+ IDA IES NVTSALFDVF G +PVS +LKASVA GL  VLK
Sbjct  261  PKMLVSISINGPPTGIDATIESNNVTSALFDVFFGDSPVSSTLKASVATGLAAVLK  316



>gb|KJB82094.1| hypothetical protein B456_013G176000 [Gossypium raimondii]
Length=277

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 177/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  722  SSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNES  543
            +S G A+Y EEP T VKF+ SLS+P C TSLSLLGTGYREKVFAIIGVKVYAAGLYVN S
Sbjct  66   ASSGTADYTEEPATKVKFRTSLSVPDCSTSLSLLGTGYREKVFAIIGVKVYAAGLYVNPS  125

Query  542  ILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRI  363
            IL+KLDAW+GRSAA++Q+D PLF++ F+ P+EKSL IVLVRDVDGKTFWDALDEAISPRI
Sbjct  126  ILSKLDAWKGRSAAQIQDDMPLFKSFFEDPMEKSLQIVLVRDVDGKTFWDALDEAISPRI  185

Query  362  KSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESAN  183
            K+P+  DE+ALSTFR IFQGRPL KGT I LTW  P+KMLV VSSD  P+S DA IES N
Sbjct  186  KAPTPVDESALSTFRGIFQGRPLNKGTSIFLTWPHPSKMLVAVSSDGLPTSNDATIESPN  245

Query  182  VTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            V SALFDVF G  PVSPSLK SVA GL  +LK
Sbjct  246  VGSALFDVFFGDAPVSPSLKTSVATGLATILK  277



>ref|XP_008346589.1| PREDICTED: LOW QUALITY PROTEIN: fatty-acid-binding protein 3-like, 
partial [Malus domestica]
Length=234

 Score =   318 bits (814),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 194/238 (82%), Gaps = 6/238 (3%)
 Frame = -3

Query  797  FPSHFSLGSLDARLPGLFSPRAASSSS-VGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLL  621
            FP H    ++ ++ P  F+  A+S+S+ VGNAE +EEP T  KFQ SLSLPGC +SL+LL
Sbjct  2    FPPH---KNIKSQTP--FAVNASSTSAAVGNAEXIEEPATKEKFQTSLSLPGCSSSLTLL  56

Query  620  GTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKS  441
            GTGYREKVFAIIGV+VYAAGLYVN+S+LN L+AW+GRSAAE+Q DS LF +IF +P EKS
Sbjct  57   GTGYREKVFAIIGVEVYAAGLYVNQSVLNSLNAWKGRSAAEIQEDSSLFNSIFLSPSEKS  116

Query  440  LSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWV  261
            + IVLVRDVDGKTFWDAL++AISPRIKSP+  DE+ALSTFR+IFQG+PLKKGTFI  TW 
Sbjct  117  IQIVLVRDVDGKTFWDALNDAISPRIKSPTPVDESALSTFRSIFQGQPLKKGTFIFXTWP  176

Query  260  DPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            D +KMLV +SSD  PS +DA+I+S NV  ALFDVF+G  PVS SLKASV  GLE +LK
Sbjct  177  DXSKMLVSISSDGLPSGVDAEIKSENVAFALFDVFVGDTPVSFSLKASVVKGLESILK  234



>ref|XP_008368445.1| PREDICTED: fatty-acid-binding protein 3 [Malus domestica]
Length=278

 Score =   316 bits (809),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 168/237 (71%), Positives = 193/237 (81%), Gaps = 4/237 (2%)
 Frame = -3

Query  794  PSHFSLG-SLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLG  618
            P HFSL  ++ +R P   +   ASS+SVG AEY+EEP T  KFQ SLSLPGC +SL+LLG
Sbjct  45   PIHFSLQKNIKSRTPFAVN---ASSTSVGRAEYIEEPATKEKFQTSLSLPGCSSSLTLLG  101

Query  617  TGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSL  438
            TGYREKVFAIIGVKVYAAGLY N+SILN L+AW+GRS AE+Q DS LF + F +P  KSL
Sbjct  102  TGYREKVFAIIGVKVYAAGLYANQSILNSLNAWKGRSTAEIQEDSSLFSSXFLSPSXKSL  161

Query  437  SIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVD  258
             IVLVRDVDGKTFWDAL++AISPRIKSP+  DE+ALSTFR+IFQG+PLKKGTFI LTW D
Sbjct  162  QIVLVRDVDGKTFWDALNDAISPRIKSPTPVDESALSTFRSIFQGQPLKKGTFIFLTWPD  221

Query  257  PTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            P+KMLVC+SSD  PS +DA+IES NV  ALFDVF G  PVSPSLK SV NGLE +LK
Sbjct  222  PSKMLVCISSDGLPSGVDAEIESENVAFALFDVFFGDTPVSPSLKXSVLNGLESILK  278



>gb|KFK35722.1| hypothetical protein AALP_AA4G028300 [Arabis alpina]
Length=287

 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 181/216 (84%), Gaps = 1/216 (0%)
 Frame = -3

Query  731  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            +++SS GN E Y EEP T+VKFQRS++LPGC   LSLLGTG+REK FAIIGVKVYAAGLY
Sbjct  72   SAASSAGNVEEYTEEPATSVKFQRSVTLPGCSNPLSLLGTGFREKKFAIIGVKVYAAGLY  131

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            VNESIL+ L AW+G+S  E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  132  VNESILSGLSAWKGKSTDEIQRDSSLFSSIFQAQEEKSLQIVLVRDVDGKTFWDALDEAI  191

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            SPRIKSPS+DD+TALSTFR IFQ RPL KG+ I+LTW+ P+KMLV VSS   P+ ++A I
Sbjct  192  SPRIKSPSSDDKTALSTFREIFQNRPLNKGSVILLTWISPSKMLVSVSSGGLPTDVNASI  251

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            ES NVTSALFDVF G +PVSP+LK+SVAN L ++LK
Sbjct  252  ESGNVTSALFDVFFGDSPVSPTLKSSVANQLAMILK  287



>ref|XP_004294183.1| PREDICTED: fatty-acid-binding protein 3 [Fragaria vesca subsp. 
vesca]
Length=285

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -3

Query  701  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  522
            Y+EEP TNV+FQ S+SLPGC +SL+LLGTGYREKVFAIIGVKVYAAGLYVN+SILN L+A
Sbjct  81   YIEEPATNVRFQTSVSLPGCSSSLALLGTGYREKVFAIIGVKVYAAGLYVNQSILNNLNA  140

Query  521  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD  342
            W+GR AAE+Q D  LF ++F++P EKSL I+LVRDVDGKTFWDAL++AISPRIKSP+  D
Sbjct  141  WKGRPAAEIQKDPSLFSSMFQSPSEKSLQIILVRDVDGKTFWDALNDAISPRIKSPTPVD  200

Query  341  ETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFD  162
            E+ALSTFR+ F+G+PLKKGTFI LTW+  +KMLV +SS+  PSS+DA IES NV+S LFD
Sbjct  201  ESALSTFRSTFEGQPLKKGTFIFLTWLQASKMLVSISSNGLPSSVDATIESENVSSVLFD  260

Query  161  VFLGRNPVSPSLKASVANGLEVVLK  87
            VF G  PVSP+LKASVA GLE VLK
Sbjct  261  VFFGDTPVSPTLKASVATGLESVLK  285



>gb|KJB82095.1| hypothetical protein B456_013G176000 [Gossypium raimondii]
Length=277

 Score =   314 bits (805),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/213 (74%), Positives = 178/213 (84%), Gaps = 1/213 (0%)
 Frame = -3

Query  725  SSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNE  546
            +SSVG A+Y EEP T VKF+ SLS+P C TSLSLLGTG +EKVFAIIGVKVYAAGLYVN 
Sbjct  66   ASSVGTADYTEEPATKVKFRTSLSVPDCSTSLSLLGTG-QEKVFAIIGVKVYAAGLYVNP  124

Query  545  SILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPR  366
            SIL+KLDAW+GRSAA++Q+D PLF++ F+ P+EKSL IVLVRDVDGKTFWDALDEAISPR
Sbjct  125  SILSKLDAWKGRSAAQIQDDMPLFKSFFEDPMEKSLQIVLVRDVDGKTFWDALDEAISPR  184

Query  365  IKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESA  186
            IK+P+  DE+ALSTFR IFQGRPL KGT I LTW  P+KMLV VSSD  P+S DA IES 
Sbjct  185  IKAPTPVDESALSTFRGIFQGRPLNKGTSIFLTWPHPSKMLVAVSSDGLPTSNDATIESP  244

Query  185  NVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            NV SALFDVF G  PVSPSLK SVA GL  +LK
Sbjct  245  NVGSALFDVFFGDAPVSPSLKTSVATGLATILK  277



>ref|XP_009339358.1| PREDICTED: fatty-acid-binding protein 3-like isoform X1 [Pyrus 
x bretschneideri]
Length=280

 Score =   314 bits (805),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = -3

Query  704  EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLD  525
            EY+EEP T  KFQ SLSLPGC +SL+LLGTGYREKVFAIIGVKVYAAGLYVN+S+L  L+
Sbjct  75   EYIEEPATKEKFQTSLSLPGCSSSLTLLGTGYREKVFAIIGVKVYAAGLYVNQSVLYSLN  134

Query  524  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSAD  345
            AW+GRSAAE+Q DS LF +IF +PLEKSL IVLVRDVDGKTFWDAL++AISPRIKSP+  
Sbjct  135  AWKGRSAAEIQEDSSLFNSIFLSPLEKSLQIVLVRDVDGKTFWDALNDAISPRIKSPTPV  194

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALF  165
            DE+ALSTFR+IFQG+PLKKGTFI LTW DP+KMLV +SSD  PS +DA+I+S NV  ALF
Sbjct  195  DESALSTFRSIFQGQPLKKGTFIFLTWPDPSKMLVSISSDGLPSGVDAEIKSENVAFALF  254

Query  164  DVFLGRNPVSPSLKASVANGLEVVLK  87
            DVF G  PVS SLKASV  GLE +LK
Sbjct  255  DVFFGDTPVSFSLKASVVKGLESILK  280



>ref|XP_009147594.1| PREDICTED: fatty-acid-binding protein 3 [Brassica rapa]
Length=283

 Score =   314 bits (805),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 185/216 (86%), Gaps = 1/216 (0%)
 Frame = -3

Query  731  ASSSSVGNA-EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            +++SSVGNA E VEEP T+VKFQR+++LPGC T+LSLLGTG+REK FAIIGVKVYAAGLY
Sbjct  68   SAASSVGNADEKVEEPATSVKFQRTVALPGCSTALSLLGTGFREKKFAIIGVKVYAAGLY  127

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            VNESIL  L AW+G+SA E+Q DS LF +IF+   EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  128  VNESILTGLTAWKGKSADEIQRDSSLFSSIFQDQAEKSLEIVLVRDVDGKTFWDALDEAI  187

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            SPRIKSP++DD+TALSTF+ IFQ RPL KG+ I+LTW++P+KMLV VSS   P  +DA+I
Sbjct  188  SPRIKSPTSDDKTALSTFQGIFQNRPLNKGSVILLTWINPSKMLVSVSSGGLPKDVDAEI  247

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            ES +VTSALFDVF G +PVSP+LK+SVAN L +VLK
Sbjct  248  ESGSVTSALFDVFFGDSPVSPTLKSSVANQLAMVLK  283



>ref|XP_010694734.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=292

 Score =   314 bits (804),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 195/249 (78%), Gaps = 4/249 (2%)
 Frame = -3

Query  830  KTHSYFTIFSTFPSHFSLGSLDARLPGLFSP-RAASSSSVGNAEYVEEPTTNVKFQRSLS  654
            KTH + +  ST  S FSL   + R  G   P +  +SSSVGN+EY EEP T+VKF +S  
Sbjct  46   KTH-FLSHLSTTSSRFSLQ--NGRNFGTHFPSKVYASSSVGNSEYAEEPATSVKFLKSAY  102

Query  653  LPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLF  474
            LPGC +SLSLLGTGYREKVFAIIGVKVYAAGLYVN S+LN+L  W+G+S  E++ D  LF
Sbjct  103  LPGCSSSLSLLGTGYREKVFAIIGVKVYAAGLYVNPSLLNELSPWKGKSKPEVEQDLALF  162

Query  473  ETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPL  294
            ++I+++PLEKSL I LVRDVDGKTFWDALDEA+SPR+K+P+  D+ ALSTFR IFQ   L
Sbjct  163  QSIYQSPLEKSLQIALVRDVDGKTFWDALDEAVSPRVKAPTDVDKLALSTFRNIFQALSL  222

Query  293  KKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASV  114
            KKGT I+LTW++P++MLV VS +  P+ +DA IES NVT ALFDVFLG +PVSP+LK+SV
Sbjct  223  KKGTLILLTWLEPSQMLVSVSLNGIPTKVDATIESLNVTKALFDVFLGESPVSPTLKSSV  282

Query  113  ANGLEVVLK  87
            ANGL + LK
Sbjct  283  ANGLAITLK  291



>gb|KDP39780.1| hypothetical protein JCGZ_04939 [Jatropha curcas]
Length=268

 Score =   312 bits (799),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -3

Query  701  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  522
            Y EEP TNV+FQ SLSLPGC +SLSLLGTGYREKVFAIIGVKVYAAGLYVN SIL+ LD 
Sbjct  64   YTEEPATNVRFQTSLSLPGCSSSLSLLGTGYREKVFAIIGVKVYAAGLYVNPSILSALDT  123

Query  521  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD  342
            W+G+S AE+  ++  F +IF+A LEKSL IVLVRDVDGKTFWDALD+AISPRIK+P+  D
Sbjct  124  WKGQSTAEIHGNAAFFSSIFQAALEKSLQIVLVRDVDGKTFWDALDDAISPRIKAPTLVD  183

Query  341  ETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFD  162
            E+ALS FR++FQ R LKKGTFI LTW+DP+K+L+CVSSD  PSS+DA IESANV SALFD
Sbjct  184  ESALSAFRSVFQDRALKKGTFIFLTWLDPSKLLICVSSDGIPSSVDATIESANVASALFD  243

Query  161  VFLGRNPVSPSLKASVANGLEVVLK  87
            VF G   VSPSLKASV  GL  +LK
Sbjct  244  VFFGDASVSPSLKASVTTGLATILK  268



>gb|KEH38484.1| chalcone-flavanone isomerase family protein [Medicago truncatula]
Length=277

 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/250 (65%), Positives = 196/250 (78%), Gaps = 1/250 (0%)
 Frame = -3

Query  836  LSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSL  657
            L+  HS F++F+    HF+        P   S  ++SSS+  NAEY+EEP TNVKFQ SL
Sbjct  29   LNYVHS-FSLFTPPSLHFASKRHPHFFPQAASSSSSSSSAAANAEYLEEPATNVKFQTSL  87

Query  656  SLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            S PGC  SL+L GTGYREKVFAIIGVKVYA+GLY+N+SI+N+L+AW+G+S   +Q  S L
Sbjct  88   SFPGCSDSLTLFGTGYREKVFAIIGVKVYASGLYLNQSIVNELNAWKGQSKDVIQGKSSL  147

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRP  297
            F+TIF++PLEK L IVLVRDVDGKTFWDAL +AISPRI  P+  DETAL+TFR++FQ RP
Sbjct  148  FKTIFQSPLEKLLQIVLVRDVDGKTFWDALSDAISPRIAKPTTADETALTTFRSVFQDRP  207

Query  296  LKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKAS  117
            LKKGTFI LTW++PTK+LV VSS+  PS+ DA IESANVT ALFDVFLG +PVSPSLKAS
Sbjct  208  LKKGTFIFLTWLNPTKLLVSVSSEGIPSTADATIESANVTYALFDVFLGDSPVSPSLKAS  267

Query  116  VANGLEVVLK  87
            VA  L  VL+
Sbjct  268  VAQCLSKVLE  277



>ref|XP_008452433.1| PREDICTED: fatty-acid-binding protein 3 isoform X2 [Cucumis melo]
Length=312

 Score =   313 bits (801),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 189/235 (80%), Gaps = 3/235 (1%)
 Frame = -3

Query  791  SHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTG  612
            S FSL +   R    FS + +SS + G   +VEEP+TNVKF  SL+LPGC TSLSLLGTG
Sbjct  81   STFSLNNNFFRFSSNFSLKPSSSLASG---FVEEPSTNVKFPTSLTLPGCSTSLSLLGTG  137

Query  611  YREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSI  432
            YREKVFAIIGVKVYAAGLY+N S+ N+L+AWRGRSAA +Q DS LF+ IF++  EKSL I
Sbjct  138  YREKVFAIIGVKVYAAGLYINSSVSNELNAWRGRSAAAIQEDSSLFDIIFQSCSEKSLQI  197

Query  431  VLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPT  252
            VLVRDVDGKTFWDALD+AISPRIK+P+  DE+ALSTFR+IF+GR LKKGTFI LTW++P 
Sbjct  198  VLVRDVDGKTFWDALDDAISPRIKAPTPGDESALSTFRSIFEGRSLKKGTFIFLTWLEPP  257

Query  251  KMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            KMLV +S +  P+ IDA IES NVTSALFDVF G +PVS +LKASVA GL  VLK
Sbjct  258  KMLVSISINGPPTGIDATIESNNVTSALFDVFFGDSPVSSTLKASVATGLAAVLK  312



>ref|XP_004488681.1| PREDICTED: chalcone--flavonone isomerase-like [Cicer arietinum]
Length=274

 Score =   311 bits (798),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 187/233 (80%), Gaps = 2/233 (1%)
 Frame = -3

Query  782  SLGSLDARLPGLFSPRAASSSSVG-NAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYR  606
            SL +   + P LF P+A SSSS   NAEY+EEP T VKF  SLS PGC  SL+L G GYR
Sbjct  43   SLHNTSKKQP-LFFPQATSSSSPAVNAEYIEEPATTVKFHTSLSFPGCSDSLTLFGAGYR  101

Query  605  EKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVL  426
            EKVFAIIGVKVYAAGLY+N+SI+++L+AW+G+S   +Q +S LF+TIF++PLEK L I+L
Sbjct  102  EKVFAIIGVKVYAAGLYLNQSIISELNAWKGQSKDGIQGNSSLFKTIFQSPLEKLLQIIL  161

Query  425  VRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKM  246
            VRDVDGKTFWDAL +AISPRI  P+  DETAL+TFR +FQ RPLKKGTFI LTW++PTK+
Sbjct  162  VRDVDGKTFWDALSDAISPRIAKPTTADETALNTFRNVFQDRPLKKGTFIFLTWLNPTKL  221

Query  245  LVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            LV VSS+  PS+ DA IES+NV+ ALFDVFLG +PVSPSLK+SVA  L  VLK
Sbjct  222  LVSVSSEGVPSTADATIESSNVSYALFDVFLGDSPVSPSLKSSVAESLSKVLK  274



>gb|AFK39093.1| unknown [Medicago truncatula]
Length=277

 Score =   311 bits (797),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/250 (65%), Positives = 196/250 (78%), Gaps = 1/250 (0%)
 Frame = -3

Query  836  LSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSL  657
            L+  HS F++F+    HF+        P   S  ++SSS+  NAEY+EEP TNVKFQ SL
Sbjct  29   LNYVHS-FSLFTPPSLHFASERHPHFFPQAASSSSSSSSAAANAEYLEEPATNVKFQTSL  87

Query  656  SLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            S PGC  SL+L GTGYREKVFAIIGVKVYA+GLY+N+SI+N+L+AW+G+S   +Q  S L
Sbjct  88   SFPGCSDSLTLFGTGYREKVFAIIGVKVYASGLYLNQSIVNELNAWKGQSKDVIQGKSSL  147

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRP  297
            F+TIF++PLEK L IVLVRDVDGKTFWDAL +AISPRI  P+  DETAL+TFR++FQ RP
Sbjct  148  FKTIFQSPLEKLLQIVLVRDVDGKTFWDALSDAISPRIAKPTTADETALTTFRSVFQDRP  207

Query  296  LKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKAS  117
            LKKGTFI LTW++PTK+LV VSS+  PS+ DA IESANVT ALFDVFLG +PVSPSLKAS
Sbjct  208  LKKGTFIFLTWLNPTKLLVSVSSEGIPSTADATIESANVTYALFDVFLGDSPVSPSLKAS  267

Query  116  VANGLEVVLK  87
            VA  L  VL+
Sbjct  268  VAQCLSKVLE  277



>ref|XP_002894446.1| hypothetical protein ARALYDRAFT_474480 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70705.1| hypothetical protein ARALYDRAFT_474480 [Arabidopsis lyrata subsp. 
lyrata]
Length=288

 Score =   311 bits (797),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 180/215 (84%), Gaps = 1/215 (0%)
 Frame = -3

Query  731  ASSSSVGNA-EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            +++SSVGN  EY EE  T+VKFQRS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  73   SAASSVGNVDEYAEETATSVKFQRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  132

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            VNESIL+ L AW+GRSA E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  133  VNESILSGLSAWKGRSADEIQRDSSLFSSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI  192

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            SPRIKSPS+DD TALSTFR IFQ RPL KG+ I+LTW++ +KMLV +SS+  P+ +DA I
Sbjct  193  SPRIKSPSSDDTTALSTFRGIFQNRPLNKGSVILLTWINTSKMLVSISSEGLPTDVDATI  252

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            ES NVTSALFDVF G +PVSP+LK+SVAN L + L
Sbjct  253  ESGNVTSALFDVFFGDSPVSPTLKSSVANQLAMTL  287



>emb|CDY24090.1| BnaA06g00880D [Brassica napus]
Length=288

 Score =   311 bits (797),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 181/216 (84%), Gaps = 1/216 (0%)
 Frame = -3

Query  731  ASSSSVGNA-EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            +++SSVGNA E VEEP T+VKFQRS++LPGC T+LSLLGTG+REK FAIIGVKVYAAGLY
Sbjct  73   SAASSVGNADENVEEPATSVKFQRSVTLPGCSTTLSLLGTGFREKKFAIIGVKVYAAGLY  132

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            VNESIL  L AW+G+SAAE+  DS LF +IF+   EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  133  VNESILTGLTAWKGKSAAEIHGDSSLFSSIFQDQAEKSLQIVLVRDVDGKTFWDALDEAI  192

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            SPRIKSPS  D+TALSTF+ IFQ RPL KG+ I+LTW  P+KMLV VSS   P  +DA+I
Sbjct  193  SPRIKSPSPVDKTALSTFQGIFQNRPLNKGSVILLTWTSPSKMLVSVSSGGLPKDVDAEI  252

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            ES +VTSALFDVF G +PVSP+LK+SVAN L +VLK
Sbjct  253  ESGSVTSALFDVFFGDSPVSPTLKSSVANQLGMVLK  288



>ref|XP_010060770.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Eucalyptus 
grandis]
 gb|KCW67631.1| hypothetical protein EUGRSUZ_F01378 [Eucalyptus grandis]
Length=286

 Score =   310 bits (794),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -3

Query  701  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  522
            Y EEP T VKFQ  L+LPGC TSL+L+GTGYREKVFAIIGVKVYAAGLY+N SI +KLDA
Sbjct  82   YAEEPATRVKFQTPLTLPGCSTSLTLVGTGYREKVFAIIGVKVYAAGLYINPSIFSKLDA  141

Query  521  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD  342
            W+G+SAA++Q +  LF +IF+APLEKSL IVLVRDVDGKTFWDALD+AISPRIKS +  D
Sbjct  142  WKGKSAADIQENRSLFNSIFQAPLEKSLQIVLVRDVDGKTFWDALDDAISPRIKSLTPVD  201

Query  341  ETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFD  162
            ++ALSTFR+IFQGRPLKKGT I LTW+D +KMLV VSSD  PS  DA IES NVT ALFD
Sbjct  202  QSALSTFRSIFQGRPLKKGTSIFLTWLDSSKMLVSVSSDGLPSGTDATIESQNVTFALFD  261

Query  161  VFLGRNPVSPSLKASVANGLEVVLK  87
            VFLG   VSPSLKASVANGL  +LK
Sbjct  262  VFLGDASVSPSLKASVANGLATILK  286



>ref|XP_010501004.1| PREDICTED: fatty-acid-binding protein 3-like [Camelina sativa]
Length=289

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 181/215 (84%), Gaps = 1/215 (0%)
 Frame = -3

Query  731  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            +++SSVGNAE Y EE  T+VKFQRS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  74   SAASSVGNAEDYAEETATSVKFQRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  133

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            VNESIL+ L AW+GRSA E+Q+DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  134  VNESILSGLSAWKGRSADEIQSDSSLFSSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI  193

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            SPRI+SPS++D TALSTFR IFQ R L KG+ I+LTW++P+KMLV VSS   P+ +DA I
Sbjct  194  SPRIRSPSSEDTTALSTFRGIFQSRSLNKGSVILLTWINPSKMLVSVSSGGLPTDVDATI  253

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            ES NVTSALFDVF G +PVSP+LK+SVAN L + L
Sbjct  254  ESGNVTSALFDVFFGDSPVSPTLKSSVANQLAMTL  288



>ref|XP_010462251.1| PREDICTED: fatty-acid-binding protein 3-like [Camelina sativa]
Length=287

 Score =   310 bits (793),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 180/215 (84%), Gaps = 1/215 (0%)
 Frame = -3

Query  731  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            +++SSVGNAE Y EE  T+VKFQRS++LPGC +SLSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  72   SAASSVGNAEEYAEETATSVKFQRSVTLPGCSSSLSLLGTGFREKKFAIIGVKVYAAGYY  131

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            VNESIL+ L AW+GRSA E+Q DS LF +IF+   EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  132  VNESILSGLSAWKGRSADEIQRDSSLFSSIFQTQAEKSLQIVLVRDVDGKTFWDALDEAI  191

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            SPRIKSPS++D TALSTFR IFQ R L KG+ I+LTW++P+KMLV VSS   P+ +DA I
Sbjct  192  SPRIKSPSSEDTTALSTFRGIFQSRSLNKGSLILLTWINPSKMLVSVSSGGLPTDVDATI  251

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            ES +VTSALFDVF G +PVSP+LK+SVAN L + L
Sbjct  252  ESGSVTSALFDVFFGDSPVSPTLKSSVANQLAMTL  286



>emb|CDY45118.1| BnaC06g06390D [Brassica napus]
Length=292

 Score =   310 bits (793),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 179/216 (83%), Gaps = 1/216 (0%)
 Frame = -3

Query  731  ASSSSVGNA-EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            A++SSVGNA E VEEP T+VKFQRS++LPGC T+LSLLGTG+REK FAIIGVKVYAAGLY
Sbjct  77   AAASSVGNADENVEEPATSVKFQRSVALPGCSTTLSLLGTGFREKKFAIIGVKVYAAGLY  136

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            VNESIL  L  W+GRSA  +Q DS LF +IF+   EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  137  VNESILTGLTTWKGRSADAIQRDSSLFNSIFQDQAEKSLQIVLVRDVDGKTFWDALDEAI  196

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            SPR+KSPS DD+TALSTF+ IFQ RPL KG+ I+LTW  P+KMLV VSS   P  +DA +
Sbjct  197  SPRLKSPSPDDKTALSTFQGIFQNRPLNKGSVILLTWTSPSKMLVSVSSGGLPKDVDAAV  256

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            ES +VTSALFDVF G +PVSP+LK+SVAN L +VLK
Sbjct  257  ESGSVTSALFDVFFGDSPVSPTLKSSVANQLAMVLK  292



>ref|XP_010479918.1| PREDICTED: fatty-acid-binding protein 3-like isoform X1 [Camelina 
sativa]
Length=291

 Score =   306 bits (785),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 179/216 (83%), Gaps = 1/216 (0%)
 Frame = -3

Query  734  AASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGL  558
            AASS  VGNAE Y EE  T+VKFQRS++LPGC + LSLLGTG+REK FAIIGVKVYAAG 
Sbjct  75   AASSGKVGNAEDYAEETATSVKFQRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGY  134

Query  557  YVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEA  378
            YVNESIL+ L AW+GRSA E+Q+DS LF +IF+A  EK+L IVLVRDVDGKTFWDALDEA
Sbjct  135  YVNESILSGLSAWKGRSADEIQSDSSLFSSIFQAQAEKALQIVLVRDVDGKTFWDALDEA  194

Query  377  ISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAK  198
            ISPRIKSPS++D TALSTFR IFQ R L KG+ I+LTW++P+KMLV VSS   P+ +DA 
Sbjct  195  ISPRIKSPSSEDTTALSTFRGIFQSRSLNKGSVILLTWINPSKMLVSVSSGGLPTVVDAT  254

Query  197  IESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            IES +V SALFDVF G +PVSP+LK+SVAN L + L
Sbjct  255  IESGSVISALFDVFFGDSPVSPTLKSSVANQLAMTL  290



>ref|XP_006305475.1| hypothetical protein CARUB_v10009906mg [Capsella rubella]
 gb|EOA38373.1| hypothetical protein CARUB_v10009906mg [Capsella rubella]
Length=291

 Score =   305 bits (782),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 179/215 (83%), Gaps = 1/215 (0%)
 Frame = -3

Query  731  ASSSSVGNA-EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            +++SSVGNA EY EE  T+VKF+RS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  76   SAASSVGNADEYAEETATSVKFRRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  135

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            VNESIL  L AW+GRSA E++ DS LF +IF+   EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  136  VNESILRGLSAWKGRSADEIEKDSSLFSSIFQDQAEKSLQIVLVRDVDGKTFWDALDEAI  195

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            SPRIKSPS++D TALSTFR IFQ RPL KG+ I+LTW++P+KMLV VS+   P+ +DA I
Sbjct  196  SPRIKSPSSEDTTALSTFRGIFQSRPLNKGSVILLTWINPSKMLVSVSTGGLPTDVDATI  255

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            ES NVTSALFDVF G +PVSP+LK+SVAN L + L
Sbjct  256  ESGNVTSALFDVFFGDSPVSPTLKSSVANQLAMTL  290



>gb|AAM61303.1| chalcone isomerase, putative [Arabidopsis thaliana]
Length=287

 Score =   305 bits (781),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 180/215 (84%), Gaps = 1/215 (0%)
 Frame = -3

Query  731  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            +++SSVGNAE Y EE  T+VKF+RS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  72   SAASSVGNAEDYAEETATSVKFKRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  131

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            VNESIL+ L AW+GRSA E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  132  VNESILSGLSAWKGRSADEIQRDSSLFVSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI  191

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            SPRIKSPS++D TALSTFR IFQ RPL KG+ I+LTW++ + MLV VSS   P+++DA I
Sbjct  192  SPRIKSPSSEDTTALSTFRGIFQNRPLNKGSVILLTWINTSNMLVSVSSGGLPTNVDATI  251

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            ES NVTSALFD+F G +PVSP+LK+SVAN L + L
Sbjct  252  ESGNVTSALFDLFFGDSPVSPTLKSSVANQLAMTL  286



>ref|XP_010535016.1| PREDICTED: fatty-acid-binding protein 3 [Tarenaya hassleriana]
Length=281

 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  725  SSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNE  546
            S+S GN +Y+EEP T+V+FQRS++LPGC + L+LLGTGYREK FAIIGVKVYAAG YVNE
Sbjct  72   SASSGNVDYMEEPATSVRFQRSVTLPGCSSPLALLGTGYREKTFAIIGVKVYAAGFYVNE  131

Query  545  SILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPR  366
            S+L+ L AW+GRSA+E+Q DS +F +IF+A  EKSL IVLVRDVDGKTFWDALDEAI+PR
Sbjct  132  SVLSGLSAWKGRSASEIQKDSSVFNSIFQAAGEKSLQIVLVRDVDGKTFWDALDEAITPR  191

Query  365  IKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESA  186
            IKSP+ DD++ALS F ++FQGRPLKKGT I LTW  P+KMLV VS++  PS +DA+IES 
Sbjct  192  IKSPTPDDKSALSAFSSVFQGRPLKKGTLIFLTWTQPSKMLVSVSANGLPSHVDAEIESG  251

Query  185  NVTSALFDVFLGRNPVSPSLKASVANGL  102
            NV SALFDVF G  PVSP+LK+SV++ L
Sbjct  252  NVASALFDVFFGDVPVSPTLKSSVSDQL  279



>ref|NP_175757.1| fatty-acid-binding protein 3 [Arabidopsis thaliana]
 sp|Q9C8L2.1|FAP3_ARATH RecName: Full=Fatty-acid-binding protein 3; Short=AtFAP3; AltName: 
Full=Chalcone-flavanone isomerase family protein 3 [Arabidopsis 
thaliana]
 gb|AAG51975.1|AC024260_13 chalcone isomerase, putative; 94270-95700 [Arabidopsis thaliana]
 gb|ABF82628.1| At1g53520 [Arabidopsis thaliana]
 gb|AEE32951.1| fatty-acid-binding protein 3 [Arabidopsis thaliana]
Length=287

 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 179/215 (83%), Gaps = 1/215 (0%)
 Frame = -3

Query  731  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            +++SSVGNAE Y EE  T+VKF+RS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  72   SAASSVGNAEDYAEETATSVKFKRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  131

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            VNESIL+ L AW GRSA E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  132  VNESILSGLSAWTGRSADEIQRDSSLFVSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI  191

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            SPRIKSPS++D TALSTFR IFQ RPL KG+ I+LTW++ + MLV VSS   P+++DA I
Sbjct  192  SPRIKSPSSEDTTALSTFRGIFQNRPLNKGSVILLTWINTSNMLVSVSSGGLPTNVDATI  251

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            ES NVTSALFDVF G +PVSP+LK+SVAN L + L
Sbjct  252  ESGNVTSALFDVFFGDSPVSPTLKSSVANQLAMTL  286



>ref|XP_010479919.1| PREDICTED: fatty-acid-binding protein 3-like isoform X2 [Camelina 
sativa]
 ref|XP_010479922.1| PREDICTED: fatty-acid-binding protein 3-like [Camelina sativa]
Length=289

 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 180/215 (84%), Gaps = 1/215 (0%)
 Frame = -3

Query  731  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            +++SSVGNAE Y EE  T+VKFQRS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  74   SAASSVGNAEDYAEETATSVKFQRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  133

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            VNESIL+ L AW+GRSA E+Q+DS LF +IF+A  EK+L IVLVRDVDGKTFWDALDEAI
Sbjct  134  VNESILSGLSAWKGRSADEIQSDSSLFSSIFQAQAEKALQIVLVRDVDGKTFWDALDEAI  193

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            SPRIKSPS++D TALSTFR IFQ R L KG+ I+LTW++P+KMLV VSS   P+ +DA I
Sbjct  194  SPRIKSPSSEDTTALSTFRGIFQSRSLNKGSVILLTWINPSKMLVSVSSGGLPTVVDATI  253

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            ES +V SALFDVF G +PVSP+LK+SVAN L + L
Sbjct  254  ESGSVISALFDVFFGDSPVSPTLKSSVANQLAMTL  288



>pdb|4DOL|A Chain A, Crystal Structure Of Arabidopsis Thaliana Fatty-Acid 
Binding Protein At1g53520 (Atfap3)
Length=217

 Score =   301 bits (772),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 178/215 (83%), Gaps = 1/215 (0%)
 Frame = -3

Query  731  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            +++SSVGNAE Y EE  T+VKF+RS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  2    SAASSVGNAEDYAEETATSVKFKRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  61

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            VNESIL+ L AW GRSA E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  62   VNESILSGLSAWTGRSADEIQRDSSLFVSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI  121

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            SPRIKSPS++D TALSTF  IFQ RPL KG+ I+LTW++ + MLV VSS   P+++DA I
Sbjct  122  SPRIKSPSSEDTTALSTFCCIFQNRPLNKGSVILLTWINTSNMLVSVSSGGLPTNVDATI  181

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            ES NVTSALFDVF G +PVSP+LK+SVAN L + L
Sbjct  182  ESGNVTSALFDVFFGDSPVSPTLKSSVANQLAMTL  216



>ref|XP_010060771.1| PREDICTED: fatty-acid-binding protein 3 isoform X2 [Eucalyptus 
grandis]
 gb|KCW67629.1| hypothetical protein EUGRSUZ_F01378 [Eucalyptus grandis]
Length=285

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = -3

Query  689  PTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGR  510
            P T VKFQ  L+LPGC TSL+L+GTGYREKVFAIIGVKVYAAGLY+N SI +KLDAW+G+
Sbjct  85   PATRVKFQTPLTLPGCSTSLTLVGTGYREKVFAIIGVKVYAAGLYINPSIFSKLDAWKGK  144

Query  509  SAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETAL  330
            SAA++Q +  LF +IF+APLEKSL IVLVRDVDGKTFWDALD+AISPRIKS +  D++AL
Sbjct  145  SAADIQENRSLFNSIFQAPLEKSLQIVLVRDVDGKTFWDALDDAISPRIKSLTPVDQSAL  204

Query  329  STFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLG  150
            STFR+IFQGRPLKKGT I LTW+D +KMLV VSSD  PS  DA IES NVT ALFDVFLG
Sbjct  205  STFRSIFQGRPLKKGTSIFLTWLDSSKMLVSVSSDGLPSGTDATIESQNVTFALFDVFLG  264

Query  149  RNPVSPSLKASVANGLEVVLK  87
               VSPSLKASVANGL  +LK
Sbjct  265  DASVSPSLKASVANGLATILK  285



>ref|XP_007149369.1| hypothetical protein PHAVU_005G0645000g, partial [Phaseolus vulgaris]
 gb|ESW21363.1| hypothetical protein PHAVU_005G0645000g, partial [Phaseolus vulgaris]
Length=278

 Score =   300 bits (769),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/250 (60%), Positives = 190/250 (76%), Gaps = 2/250 (1%)
 Frame = -3

Query  836  LSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSL  657
            LS     F++ S+ P HFS     +R   LF  + ASSS   NAEYVEEP TNVKFQ  L
Sbjct  31   LSSHGQSFSLLSSTPMHFS-SHKSSRNQPLFLAQVASSSD-ANAEYVEEPETNVKFQTCL  88

Query  656  SLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            + PGC  SL+LLGTGYREK+FAI+ VKVYAAGLY+++ I  +L+AW+G+S   +Q +S L
Sbjct  89   NFPGCSNSLTLLGTGYREKIFAIVSVKVYAAGLYLDQHITRELNAWKGQSKDAIQGNSSL  148

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRP  297
            F+TIF++  EKSL I+L R++DGKTFW+AL +AISPRI S +  DE ALS FR++F  RP
Sbjct  149  FQTIFQSSFEKSLQIILARNIDGKTFWEALSDAISPRIPSSTTVDEIALSIFRSVFLDRP  208

Query  296  LKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKAS  117
            LKKGTFI+LTW++P+K+LV VSS+  PS+IDA IES NV+ ALF+VFLG +PVSPSLKAS
Sbjct  209  LKKGTFIILTWLNPSKLLVSVSSNGLPSTIDAAIESENVSCALFNVFLGDSPVSPSLKAS  268

Query  116  VANGLEVVLK  87
            VA GL  VLK
Sbjct  269  VAEGLSKVLK  278



>ref|NP_001238390.1| chalcone isomerase 3-like [Glycine max]
 gb|AAT94361.1| putative chalcone isomerase 3 [Glycine max]
 gb|KHN47453.1| Chalcone--flavonone isomerase 2 [Glycine soja]
Length=281

 Score =   301 bits (770),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 161/250 (64%), Positives = 194/250 (78%), Gaps = 3/250 (1%)
 Frame = -3

Query  836  LSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSL  657
            L+  HS F + S  P HFS      R P  F  +AA+SS+V NAEYVEEP TNVKFQ SL
Sbjct  35   LNNGHS-FLLLSAKPMHFSSHKSSRRQPH-FLAQAAASSAV-NAEYVEEPATNVKFQTSL  91

Query  656  SLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            S PGC  SL+L GTGYREKVFAIIGVKVYAAGLY+++SI  +L+AW+G+S   +Q +S L
Sbjct  92   SFPGCSNSLTLFGTGYREKVFAIIGVKVYAAGLYLDQSIALELNAWKGQSKEAIQGNSSL  151

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRP  297
            FETIF++  EKSL I+LVRDVDGKTFWDAL +AISPRI+ P+  DETAL+TFR +F  RP
Sbjct  152  FETIFQSSFEKSLQIILVRDVDGKTFWDALSDAISPRIQQPTTTDETALTTFRGVFLDRP  211

Query  296  LKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKAS  117
            LKKG  I+LTW++P+ +LV VSS+  PS++DA IESANV SALF+VFLG +PVSPSLKAS
Sbjct  212  LKKGAIIILTWLNPSGLLVSVSSNGLPSTMDATIESANVASALFNVFLGDSPVSPSLKAS  271

Query  116  VANGLEVVLK  87
            VA  L  VLK
Sbjct  272  VAESLSKVLK  281



>ref|XP_006392782.1| hypothetical protein EUTSA_v10011696mg [Eutrema salsugineum]
 gb|ESQ30068.1| hypothetical protein EUTSA_v10011696mg [Eutrema salsugineum]
Length=295

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 177/215 (82%), Gaps = 1/215 (0%)
 Frame = -3

Query  731  ASSSSVGNA-EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            +++SS GN  EY +E  T+VKFQR+++LPGC + LSLLGTG+REK FAIIGVKVYAAGLY
Sbjct  80   SAASSAGNVDEYAQESATSVKFQRTVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGLY  139

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            VNESIL+ L AW+GRS+ E+Q DS LF +IF+A   KSL IVLVRDVDGKTFWDALDEAI
Sbjct  140  VNESILSGLSAWKGRSSDEIQIDSSLFSSIFQAQAAKSLQIVLVRDVDGKTFWDALDEAI  199

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            SPRIKS S+DD+TALSTF  IFQ RPL KG+ I+LTW+ P+KMLV VSS   P+ +DA I
Sbjct  200  SPRIKSQSSDDKTALSTFSGIFQNRPLNKGSVILLTWISPSKMLVSVSSGGLPTDVDAAI  259

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            ES NVTSALFDVF G +PVSP+LK+SVAN L + L
Sbjct  260  ESVNVTSALFDVFFGDSPVSPTLKSSVANQLAMSL  294



>ref|XP_006593488.1| PREDICTED: chalcone isomerase 3-like isoform X1 [Glycine max]
Length=280

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 159/250 (64%), Positives = 190/250 (76%), Gaps = 4/250 (2%)
 Frame = -3

Query  836  LSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSL  657
            L+  HS F + S  P HFS      R P   +  AASS    NAEYVEEP TNVKFQ SL
Sbjct  35   LNNGHS-FLLLSAKPMHFSSHKSSRRQPHFLAQAAASSV---NAEYVEEPATNVKFQTSL  90

Query  656  SLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            S PGC  SL+L GTGYREKVFAIIGVKVYAAGLY+++SI  +L+AW+G+S   +Q +S L
Sbjct  91   SFPGCSNSLTLFGTGYREKVFAIIGVKVYAAGLYLDQSIALELNAWKGQSKEAIQGNSSL  150

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRP  297
            FETIF++  EKSL I+LVRDVDGKTFWDAL +AISPRI+ P+  DETAL+TFR +F  RP
Sbjct  151  FETIFQSSFEKSLQIILVRDVDGKTFWDALSDAISPRIQQPTTTDETALTTFRGVFLDRP  210

Query  296  LKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKAS  117
            LKKG  I+LTW++P+ +LV VSS+  PS++DA IESANV SALF+VFLG +PVSPSLKAS
Sbjct  211  LKKGAIIILTWLNPSGLLVSVSSNGLPSTMDATIESANVASALFNVFLGDSPVSPSLKAS  270

Query  116  VANGLEVVLK  87
            VA  L  VLK
Sbjct  271  VAESLSKVLK  280



>ref|XP_010106740.1| Chalcone--flavonone isomerase [Morus notabilis]
 gb|EXC11707.1| Chalcone--flavonone isomerase [Morus notabilis]
Length=290

 Score =   298 bits (764),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = -3

Query  731  ASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYV  552
            AS++SVG+AEY EEP T V FQ +LSLP C +SLSLLGTG+REKVFAIIGVKVYA GLYV
Sbjct  75   ASAASVGSAEYAEEPATKVAFQTTLSLPSCSSSLSLLGTGFREKVFAIIGVKVYAVGLYV  134

Query  551  NESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  372
            N S+ +KLD+W GRSAAE+Q DS +F +IF+APLEKSL IVLVRDVDGKTFWDALD+AIS
Sbjct  135  NPSVFSKLDSWNGRSAAEIQEDSSVFSSIFQAPLEKSLQIVLVRDVDGKTFWDALDDAIS  194

Query  371  PRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDA-TPSSIDAKI  195
            PRIKSP+  DETAL TF +IFQGRPLKKGTFI LTW+DP+KMLV VSSD   PSS+DA I
Sbjct  195  PRIKSPTPVDETALFTFHSIFQGRPLKKGTFIFLTWLDPSKMLVSVSSDGLIPSSVDATI  254

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            ES +V SALFDVF G  PVS SLKASVANGL   LK
Sbjct  255  ESEHVASALFDVFFGEAPVSLSLKASVANGLATNLK  290



>gb|ACU19407.1| unknown [Glycine max]
Length=281

 Score =   298 bits (762),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 160/250 (64%), Positives = 193/250 (77%), Gaps = 3/250 (1%)
 Frame = -3

Query  836  LSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSL  657
            L+  HS F + S  P HFS      R P  F  +AA+SS+V NAEYVEEP TNVKFQ SL
Sbjct  35   LNNGHS-FLLLSAKPMHFSSHKSSRRQPH-FLAQAAASSAV-NAEYVEEPATNVKFQTSL  91

Query  656  SLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            S PGC  SL+L GTGYREKVFAIIGVKVYAAGLY+++SI  +L+AW+G+S   +Q +S L
Sbjct  92   SFPGCSNSLTLFGTGYREKVFAIIGVKVYAAGLYLDQSIALELNAWKGQSKEAIQGNSSL  151

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRP  297
            FETIF++  EKSL I+LVRDVDGKTFWDAL +AISPRI+ P+  DETAL+TFR +F  RP
Sbjct  152  FETIFQSSFEKSLQIILVRDVDGKTFWDALSDAISPRIQQPTTTDETALTTFRGVFLDRP  211

Query  296  LKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKAS  117
            LKKG  I+LTW++P+ +LV VSS+  PS++DA IESANV  ALF+VFLG +PVSPSLKAS
Sbjct  212  LKKGAIIILTWLNPSGLLVSVSSNGLPSTMDATIESANVAFALFNVFLGDSPVSPSLKAS  271

Query  116  VANGLEVVLK  87
            VA  L  VLK
Sbjct  272  VAESLSKVLK  281



>ref|XP_008784378.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Phoenix dactylifera]
 ref|XP_008784379.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Phoenix dactylifera]
 ref|XP_008784380.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Phoenix dactylifera]
Length=265

 Score =   296 bits (758),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 181/235 (77%), Gaps = 11/235 (5%)
 Frame = -3

Query  806  FSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLS  627
            FSTFP   SL S        F PRA    SVG++EYV EP TNVKF R L +PGC  SL 
Sbjct  37   FSTFPRLNSLHSP-------FIPRA----SVGSSEYVMEPGTNVKFPRELRVPGCSGSLV  85

Query  626  LLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLE  447
            LLGTGYREKVFAIIG+KVYAAG Y   SI  +LDAW+G+ AAE+ +D  LF +I +APLE
Sbjct  86   LLGTGYREKVFAIIGIKVYAAGFYAEPSIRERLDAWKGKPAAEILDDCSLFSSILQAPLE  145

Query  446  KSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLT  267
            KSL+I+LVRDVDGKTFW+ALD+ ISPRIK+P++ DE+AL TFR  FQ R LK+GTFI LT
Sbjct  146  KSLNIMLVRDVDGKTFWNALDDVISPRIKNPTSVDESALLTFRNTFQSRDLKQGTFIFLT  205

Query  266  WVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGL  102
            WV+P+KML+ +SS   PS +DA+IESANV+ AL+D FLG +PVSP+LK SVANGL
Sbjct  206  WVEPSKMLISISSGGFPSKVDAEIESANVSMALYDAFLGESPVSPTLKTSVANGL  260



>ref|XP_009413396.1| PREDICTED: fatty-acid-binding protein 3 [Musa acuminata subsp. 
malaccensis]
Length=274

 Score =   292 bits (748),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 146/237 (62%), Positives = 181/237 (76%), Gaps = 0/237 (0%)
 Frame = -3

Query  803  STFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSL  624
            S FPS      L A   G   P +   +SVG+A+YV EP T+VKF + L +PGC +SL L
Sbjct  36   SKFPSTAPAPLLLAHPLGRTRPDSTPRASVGSADYVVEPGTSVKFPKELQVPGCSSSLVL  95

Query  623  LGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEK  444
            LGTGYREKVFAIIGVKVY+AG Y + SI N  D+W+G+S+ EL  DS LF +IF APLEK
Sbjct  96   LGTGYREKVFAIIGVKVYSAGFYADLSIRNTFDSWKGKSSTELLEDSSLFSSIFHAPLEK  155

Query  443  SLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTW  264
            SL+I+LVRDVDGKTFW ALD+ ISPRIK P+ADDE+ LSTF+  FQGR LK+GT IVLTW
Sbjct  156  SLNIMLVRDVDGKTFWTALDDVISPRIKKPTADDESTLSTFQNTFQGRDLKRGTMIVLTW  215

Query  263  VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVV  93
            V+P+KML+ +SS   PS++DA+I+S NV  AL+D F G NPVSP+LKASVA+GL ++
Sbjct  216  VEPSKMLISISSSGFPSNVDAEIKSMNVNLALYDGFFGDNPVSPTLKASVADGLRML  272



>ref|XP_008784382.1| PREDICTED: fatty-acid-binding protein 3 isoform X3 [Phoenix dactylifera]
Length=229

 Score =   290 bits (743),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 171/212 (81%), Gaps = 0/212 (0%)
 Frame = -3

Query  737  RAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGL  558
            R    ++VG++EYV EP TNVKF R L +PGC  SL LLGTGYREKVFAIIG+KVYAAG 
Sbjct  13   RVVFLAAVGSSEYVMEPGTNVKFPRELRVPGCSGSLVLLGTGYREKVFAIIGIKVYAAGF  72

Query  557  YVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEA  378
            Y   SI  +LDAW+G+ AAE+ +D  LF +I +APLEKSL+I+LVRDVDGKTFW+ALD+ 
Sbjct  73   YAEPSIRERLDAWKGKPAAEILDDCSLFSSILQAPLEKSLNIMLVRDVDGKTFWNALDDV  132

Query  377  ISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAK  198
            ISPRIK+P++ DE+AL TFR  FQ R LK+GTFI LTWV+P+KML+ +SS   PS +DA+
Sbjct  133  ISPRIKNPTSVDESALLTFRNTFQSRDLKQGTFIFLTWVEPSKMLISISSGGFPSKVDAE  192

Query  197  IESANVTSALFDVFLGRNPVSPSLKASVANGL  102
            IESANV+ AL+D FLG +PVSP+LK SVANGL
Sbjct  193  IESANVSMALYDAFLGESPVSPTLKTSVANGL  224



>ref|XP_003546743.1| PREDICTED: fatty-acid-binding protein 3-like [Glycine max]
 gb|KHN39751.1| Chalcone--flavonone isomerase 2 [Glycine soja]
Length=281

 Score =   290 bits (743),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 159/250 (64%), Positives = 192/250 (77%), Gaps = 3/250 (1%)
 Frame = -3

Query  836  LSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSL  657
             S  HS F++ S  P HFS      R P   +   A+SSS  NAEYVEEP TNVKFQ SL
Sbjct  35   FSNDHS-FSLLSATPMHFSSHKSSRRQPHFLA--QAASSSAANAEYVEEPATNVKFQTSL  91

Query  656  SLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            + PGC  SL+L GTGYREKVFAIIGVKVYAAGLY+++S+  +L+AW+G+S   +Q +S L
Sbjct  92   NFPGCSNSLTLFGTGYREKVFAIIGVKVYAAGLYLDQSVTQELNAWKGQSKDAIQGNSSL  151

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRP  297
            FETIF++  EKSL IVLVRDVDGKTFWDAL +AISPRI  P+  DETAL+TFR +F  RP
Sbjct  152  FETIFQSSFEKSLQIVLVRDVDGKTFWDALSDAISPRIPQPTTTDETALTTFRGVFLDRP  211

Query  296  LKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKAS  117
            LKKG  I+LTW++P+++LV VSS+  PS++DA IESANV SALF+VFLG +PVSPSLKAS
Sbjct  212  LKKGAIIILTWLNPSRLLVSVSSNGFPSTVDATIESANVASALFNVFLGDSPVSPSLKAS  271

Query  116  VANGLEVVLK  87
            VA GL  VLK
Sbjct  272  VAEGLSKVLK  281



>ref|XP_007149370.1| hypothetical protein PHAVU_005G064600g [Phaseolus vulgaris]
 gb|ESW21364.1| hypothetical protein PHAVU_005G064600g [Phaseolus vulgaris]
Length=282

 Score =   289 bits (740),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 184/250 (74%), Gaps = 2/250 (1%)
 Frame = -3

Query  836  LSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSL  657
            LS     F++ S+ P HFS      R P LF  + ASSS+  NAEYVEEP TNVK Q  L
Sbjct  35   LSSHGQSFSLLSSTPMHFSSHKSSRRQP-LFLAQVASSSA-ANAEYVEEPETNVKLQTCL  92

Query  656  SLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            + PGC  SL+L GTGYRE VFAI+ VKVY AGLY+++ I  +L+AW+G+S   +Q +S L
Sbjct  93   NFPGCSNSLTLFGTGYRENVFAIVSVKVYTAGLYLDQHITRELNAWKGQSKDAIQGNSSL  152

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRP  297
            F+TIF++   KSL I+L R++ GKTFW+AL +AISPRI + +  DE ALS FR++F  RP
Sbjct  153  FQTIFQSSFGKSLQIILARNIHGKTFWEALSDAISPRIPASTTADEIALSIFRSVFLDRP  212

Query  296  LKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKAS  117
            LKKGTFI+LTW+ P+K+LV VSS+  PS++DA IES NV+ ALF+VFLG +PVSPSLKAS
Sbjct  213  LKKGTFIILTWLKPSKLLVSVSSNGLPSTVDAAIESENVSCALFNVFLGDSPVSPSLKAS  272

Query  116  VANGLEVVLK  87
            VA GL  VLK
Sbjct  273  VAEGLSKVLK  282



>ref|XP_010916104.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Elaeis guineensis]
 ref|XP_010916105.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Elaeis guineensis]
 ref|XP_010916107.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Elaeis guineensis]
 ref|XP_010916108.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Elaeis guineensis]
Length=265

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 166/211 (79%), Gaps = 0/211 (0%)
 Frame = -3

Query  722  SSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNES  543
            +SVG++EYV E  TNVKF R L +PGC  SL LLGTGYREKVFAIIGVKVYAAG YV  S
Sbjct  54   ASVGSSEYVVETGTNVKFPRELRVPGCSGSLVLLGTGYREKVFAIIGVKVYAAGFYVEPS  113

Query  542  ILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRI  363
            I  +LDAW+G+ A E+  D  LF  I +APLEKSL+I+LVRDVDGKTFW+ALD+ ISPRI
Sbjct  114  IRERLDAWKGKPATEVLGDCSLFSLILQAPLEKSLNIMLVRDVDGKTFWNALDDVISPRI  173

Query  362  KSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESAN  183
            K+P++ DE+AL TFR+ FQ R LK+GTFI LTWV P+KML+ +SS   PS++DA+IESAN
Sbjct  174  KNPTSVDESALLTFRSTFQSRDLKQGTFIFLTWVVPSKMLISISSGGFPSNVDAEIESAN  233

Query  182  VTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            V  AL+D F G +PVSP+LK SV NGL  V 
Sbjct  234  VNMALYDAFFGESPVSPTLKTSVVNGLTEVF  264



>ref|XP_007149371.1| hypothetical protein PHAVU_005G064600g [Phaseolus vulgaris]
 gb|ESW21365.1| hypothetical protein PHAVU_005G064600g [Phaseolus vulgaris]
Length=236

 Score =   274 bits (701),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 166/215 (77%), Gaps = 0/215 (0%)
 Frame = -3

Query  731  ASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYV  552
            +S +   NAEYVEEP TNVK Q  L+ PGC  SL+L GTGYRE VFAI+ VKVY AGLY+
Sbjct  22   SSVAKAANAEYVEEPETNVKLQTCLNFPGCSNSLTLFGTGYRENVFAIVSVKVYTAGLYL  81

Query  551  NESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  372
            ++ I  +L+AW+G+S   +Q +S LF+TIF++   KSL I+L R++ GKTFW+AL +AIS
Sbjct  82   DQHITRELNAWKGQSKDAIQGNSSLFQTIFQSSFGKSLQIILARNIHGKTFWEALSDAIS  141

Query  371  PRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIE  192
            PRI + +  DE ALS FR++F  RPLKKGTFI+LTW+ P+K+LV VSS+  PS++DA IE
Sbjct  142  PRIPASTTADEIALSIFRSVFLDRPLKKGTFIILTWLKPSKLLVSVSSNGLPSTVDAAIE  201

Query  191  SANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            S NV+ ALF+VFLG +PVSPSLKASVA GL  VLK
Sbjct  202  SENVSCALFNVFLGDSPVSPSLKASVAEGLSKVLK  236



>ref|XP_006370052.1| hypothetical protein POPTR_0001s38970g, partial [Populus trichocarpa]
 gb|ERP66621.1| hypothetical protein POPTR_0001s38970g, partial [Populus trichocarpa]
Length=179

 Score =   269 bits (687),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 152/184 (83%), Gaps = 5/184 (3%)
 Frame = -3

Query  713  GNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILN  534
            G+AEY +EP T  +FQ SLSLPGC TSLSLLGTGY EKVFA+IGVKVYAAG+YVN SIL 
Sbjct  1    GSAEYTQEPATKERFQTSLSLPGCSTSLSLLGTGYTEKVFAVIGVKVYAAGIYVNPSILT  60

Query  533  KLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSP  354
             +  W+G+SA+E+Q +S LF +IF+APLEKSL I     VDGKTFWDALDEAISPRIK  
Sbjct  61   TVSTWKGQSASEIQENSALFSSIFQAPLEKSLQI-----VDGKTFWDALDEAISPRIKEA  115

Query  353  SADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTS  174
            ++ D++ LSTFR+IFQGRP KKGT I LTW+DP+KMLVCVSSD TPSS+DA I S NV+S
Sbjct  116  TSGDKSVLSTFRSIFQGRPHKKGTSIFLTWLDPSKMLVCVSSDGTPSSLDATIASENVSS  175

Query  173  ALFD  162
            ALFD
Sbjct  176  ALFD  179



>gb|AAF78437.1|AC018748_16 Contains a weak similarity to chalcone--flavonone isomerase from 
Pueraria lobata gi|Q43056 and containes fanconi anaemia 
group C protein PF|02106 domain [Arabidopsis thaliana]
Length=271

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 166/215 (77%), Gaps = 17/215 (8%)
 Frame = -3

Query  731  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            +++SSVGNAE Y EE  T+VKF+RS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  72   SAASSVGNAEDYAEETATSVKFKRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  131

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            VNESIL+ L AW GRSA E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  132  VNESILSGLSAWTGRSADEIQRDSSLFVSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI  191

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            SPRIKSPS++D TALSTFR IFQ RPL KG+ I+LTW++ + MLV VSS   P+++DA I
Sbjct  192  SPRIKSPSSEDTTALSTFRGIFQNRPLNKGSVILLTWINTSNMLVSVSSGGLPTNVDATI  251

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            ES                VSP+LK+SVAN L + L
Sbjct  252  ES----------------VSPTLKSSVANQLAMTL  270



>gb|KCW67630.1| hypothetical protein EUGRSUZ_F01378 [Eucalyptus grandis]
Length=269

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 156/205 (76%), Gaps = 17/205 (8%)
 Frame = -3

Query  701  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  522
            Y EEP T VKFQ  L+LPGC TSL+L+GTG                 LY+N SI +KLDA
Sbjct  82   YAEEPATRVKFQTPLTLPGCSTSLTLVGTG-----------------LYINPSIFSKLDA  124

Query  521  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD  342
            W+G+SAA++Q +  LF +IF+APLEKSL IVLVRDVDGKTFWDALD+AISPRIKS +  D
Sbjct  125  WKGKSAADIQENRSLFNSIFQAPLEKSLQIVLVRDVDGKTFWDALDDAISPRIKSLTPVD  184

Query  341  ETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFD  162
            ++ALSTFR+IFQGRPLKKGT I LTW+D +KMLV VSSD  PS  DA IES NVT ALFD
Sbjct  185  QSALSTFRSIFQGRPLKKGTSIFLTWLDSSKMLVSVSSDGLPSGTDATIESQNVTFALFD  244

Query  161  VFLGRNPVSPSLKASVANGLEVVLK  87
            VFLG   VSPSLKASVANGL  +LK
Sbjct  245  VFLGDASVSPSLKASVANGLATILK  269



>ref|XP_010694735.1| PREDICTED: fatty-acid-binding protein 3 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=185

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = -3

Query  623  LGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEK  444
            L  GYREKVFAIIGVKVYAAGLYVN S+LN+L  W+G+S  E++ D  LF++I+++PLEK
Sbjct  6    LKNGYREKVFAIIGVKVYAAGLYVNPSLLNELSPWKGKSKPEVEQDLALFQSIYQSPLEK  65

Query  443  SLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTW  264
            SL I LVRDVDGKTFWDALDEA+SPR+K+P+  D+ ALSTFR IFQ   LKKGT I+LTW
Sbjct  66   SLQIALVRDVDGKTFWDALDEAVSPRVKAPTDVDKLALSTFRNIFQALSLKKGTLILLTW  125

Query  263  VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            ++P++MLV VS +  P+ +DA IES NVT ALFDVFLG +PVSP+LK+SVANGL + LK
Sbjct  126  LEPSQMLVSVSLNGIPTKVDATIESLNVTKALFDVFLGESPVSPTLKSSVANGLAITLK  184



>gb|EYU26287.1| hypothetical protein MIMGU_mgv1a0115041mg, partial [Erythranthe 
guttata]
Length=161

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  710  NAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNK  531
            N+++ EEP T VKFQ SLSLPGC ++LSLLGTGYREKVFAIIGVKVYAAGLY N+S+  K
Sbjct  2    NSDFAEEPATKVKFQTSLSLPGCSSTLSLLGTGYREKVFAIIGVKVYAAGLYANQSVFTK  61

Query  530  LDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS  351
            LDAW G S+AELQ DS LF+ IF+AP+EKSL+IVLVRD+DGKTFWDALDEA+SPRI SP+
Sbjct  62   LDAWSGLSSAELQKDSSLFDAIFQAPVEKSLNIVLVRDIDGKTFWDALDEAVSPRISSPT  121

Query  350  ADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLV  240
              DE+ALSTFR++FQGRPLKKGT I LTW+D T +LV
Sbjct  122  QVDESALSTFRSVFQGRPLKKGTSIFLTWLDTTNVLV  158



>gb|KCW67632.1| hypothetical protein EUGRSUZ_F01378 [Eucalyptus grandis]
Length=248

 Score =   246 bits (627),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -3

Query  701  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  522
            Y EEP T VKFQ  L+LPGC TSL+L+GTGYREKVFAIIGVKVYAAGLY+N SI +KLDA
Sbjct  82   YAEEPATRVKFQTPLTLPGCSTSLTLVGTGYREKVFAIIGVKVYAAGLYINPSIFSKLDA  141

Query  521  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD  342
            W+G+SAA++Q +  LF +IF+APLEKSL IVLVRDVDGKTFWDALD+AISPRIKS +  D
Sbjct  142  WKGKSAADIQENRSLFNSIFQAPLEKSLQIVLVRDVDGKTFWDALDDAISPRIKSLTPVD  201

Query  341  ETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCV  234
            ++ALSTFR+IFQGRPLKKGT I LTW+D +KMLV V
Sbjct  202  QSALSTFRSIFQGRPLKKGTSIFLTWLDSSKMLVSV  237



>ref|XP_008366525.1| PREDICTED: fatty-acid-binding protein 3-like [Malus domestica]
Length=251

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -3

Query  704  EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLD  525
            E +EEP T  KFQ SLSLPGC +SL LLGTGYREKVFAIIGV+VYAAGLYVN+S+LN L+
Sbjct  87   EXIEEPATKEKFQTSLSLPGCSSSLXLLGTGYREKVFAIIGVEVYAAGLYVNQSVLNSLN  146

Query  524  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSAD  345
            AW+GRSAAE+Q DS LF +IF +P EKS+ IVLVRDVDGKTFWDAL++AISPRIKSP+  
Sbjct  147  AWKGRSAAEIQEDSSLFNSIFLSPSEKSIQIVLVRDVDGKTFWDALNDAISPRIKSPTPV  206

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLV  240
            DE+ALSTFR+IFQG+PLKKGTFI  TW D +KMLV
Sbjct  207  DESALSTFRSIFQGQPLKKGTFIFXTWPDXSKMLV  241



>ref|XP_008784381.1| PREDICTED: fatty-acid-binding protein 3 isoform X2 [Phoenix dactylifera]
Length=231

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = -3

Query  620  GTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKS  441
             +GYREKVFAIIG+KVYAAG Y   SI  +LDAW+G+ AAE+ +D  LF +I +APLEKS
Sbjct  54   ASGYREKVFAIIGIKVYAAGFYAEPSIRERLDAWKGKPAAEILDDCSLFSSILQAPLEKS  113

Query  440  LSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWV  261
            L+I+LVRDVDGKTFW+ALD+ ISPRIK+P++ DE+AL TFR  FQ R LK+GTFI LTWV
Sbjct  114  LNIMLVRDVDGKTFWNALDDVISPRIKNPTSVDESALLTFRNTFQSRDLKQGTFIFLTWV  173

Query  260  DPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGL  102
            +P+KML+ +SS   PS +DA+IESANV+ AL+D FLG +PVSP+LK SVANGL
Sbjct  174  EPSKMLISISSGGFPSKVDAEIESANVSMALYDAFLGESPVSPTLKTSVANGL  226



>ref|XP_010916109.1| PREDICTED: fatty-acid-binding protein 3 isoform X2 [Elaeis guineensis]
Length=231

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -3

Query  620  GTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKS  441
             +GYREKVFAIIGVKVYAAG YV  SI  +LDAW+G+ A E+  D  LF  I +APLEKS
Sbjct  54   ASGYREKVFAIIGVKVYAAGFYVEPSIRERLDAWKGKPATEVLGDCSLFSLILQAPLEKS  113

Query  440  LSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWV  261
            L+I+LVRDVDGKTFW+ALD+ ISPRIK+P++ DE+AL TFR+ FQ R LK+GTFI LTWV
Sbjct  114  LNIMLVRDVDGKTFWNALDDVISPRIKNPTSVDESALLTFRSTFQSRDLKQGTFIFLTWV  173

Query  260  DPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
             P+KML+ +SS   PS++DA+IESANV  AL+D F G +PVSP+LK SV NGL  V 
Sbjct  174  VPSKMLISISSGGFPSNVDAEIESANVNMALYDAFFGESPVSPTLKTSVVNGLTEVF  230



>gb|ADE76284.1| unknown [Picea sitchensis]
Length=292

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 158/217 (73%), Gaps = 2/217 (1%)
 Frame = -3

Query  740  PRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAG  561
            PRA   ++VG  +++ EP TNVKF  SL++PG  +SLSL GTG+REK  AII VKVYAAG
Sbjct  78   PRA--KATVGTEDFIVEPATNVKFLTSLNVPGGSSSLSLAGTGFREKKIAIISVKVYAAG  135

Query  560  LYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE  381
            LYV+ +I + L AW G+  ++++ D+  F  +F+AP+EKSL IVLVRD+DG+TFW ALDE
Sbjct  136  LYVDTTIKSYLAAWSGKLGSQIEQDNLFFNAVFEAPVEKSLQIVLVRDIDGETFWGALDE  195

Query  380  AISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDA  201
            A+SPR+K+  A ++ AL  FR  F+G+ LK+GT I L W+  + MLV +SSD +PS  DA
Sbjct  196  ALSPRLKTTGAAEQKALDIFRETFRGKSLKRGTTIYLNWLKSSIMLVSISSDGSPSVADA  255

Query  200  KIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
             I+S  V  ALFDV+ G +PVSP LK SVA+GL  ++
Sbjct  256  TIDSPAVAFALFDVYFGSHPVSPPLKKSVASGLASII  292



>emb|CDP12481.1| unnamed protein product [Coffea canephora]
Length=184

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 135/210 (64%), Gaps = 42/210 (20%)
 Frame = -3

Query  716  VGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESIL  537
            V + EY EEP T VKF+ SLS+ GC TS+SL GTGYRE+VFAII                
Sbjct  16   VESKEYTEEPATKVKFRTSLSILGCSTSMSLTGTGYRERVFAII----------------  59

Query  536  NKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKS  357
                                      APLEKSL IVLVRDVDGKTFWDALDEAISPRIKS
Sbjct  60   --------------------------APLEKSLQIVLVRDVDGKTFWDALDEAISPRIKS  93

Query  356  PSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVT  177
            P+  D +ALSTF T+FQGRPL KGT I LTW D TKMLV VSSD  PS +DA  ES NV 
Sbjct  94   PTPVDTSALSTFSTLFQGRPLNKGTIIFLTWPDSTKMLVSVSSDGLPSGVDATTESTNVI  153

Query  176  SALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            SALFDVFLG + VSP+LKASV +GL  +L 
Sbjct  154  SALFDVFLGSDSVSPTLKASVTSGLTALLN  183



>ref|XP_007022086.1| Chalcone-flavanone isomerase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY13611.1| Chalcone-flavanone isomerase family protein isoform 2 [Theobroma 
cacao]
Length=229

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 130/206 (63%), Gaps = 52/206 (25%)
 Frame = -3

Query  704  EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLD  525
            +Y EEP T VKFQ SLSLPGC +SLSLLGT                              
Sbjct  76   DYTEEPATKVKFQTSLSLPGCSSSLSLLGT------------------------------  105

Query  524  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSAD  345
                                   PLEKSL IVLVRDVDGKTFWDALDEAISPRIK+P+  
Sbjct  106  ----------------------VPLEKSLQIVLVRDVDGKTFWDALDEAISPRIKAPTPV  143

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALF  165
            D++ALSTFR+IFQGRPL KGTFI LTW DP+KMLV VSSD  P+S DA IESANV SALF
Sbjct  144  DQSALSTFRSIFQGRPLNKGTFIFLTWPDPSKMLVAVSSDGMPASTDATIESANVASALF  203

Query  164  DVFLGRNPVSPSLKASVANGLEVVLK  87
            DVF G  PVSPSLK SVANGL  +LK
Sbjct  204  DVFFGDAPVSPSLKTSVANGLASILK  229



>gb|AFQ92050.1| chalcone isomerase, partial [Pyrus pyrifolia]
Length=139

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -3

Query  641  CTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIF  462
             +SL+LLGTGYREKVFAIIGVKVYAAGLY N+SILN L+AW+GRS A++Q DS LF +IF
Sbjct  1    SSSLALLGTGYREKVFAIIGVKVYAAGLYANQSILNSLNAWKGRSTADIQEDSSLFSSIF  60

Query  461  KAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGT  282
             +P EKSL IVLVRDVDGKTFWDAL++AISPRIKSP+  DE+ALSTFR+IFQG+PLKKGT
Sbjct  61   LSPSEKSLQIVLVRDVDGKTFWDALNDAISPRIKSPTPVDESALSTFRSIFQGQPLKKGT  120

Query  281  FIVLTWVDPTKMLVCVSSD  225
            FI LTW DP+KMLV +SSD
Sbjct  121  FIFLTWPDPSKMLVSISSD  139



>ref|XP_010234161.1| PREDICTED: fatty-acid-binding protein 3 [Brachypodium distachyon]
Length=274

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 150/215 (70%), Gaps = 5/215 (2%)
 Frame = -3

Query  734  AASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            AA  ++VG+A +V E  TNVKF R L+LPG    L +LGTGYREK F    VKVYAA  Y
Sbjct  63   AAGENAVGDA-FVGEGATNVKFPRELTLPGYTEPLVILGTGYREKFF----VKVYAAAFY  117

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            V+ SI    + W+ +   E  + S +F TIFKAP+ KSLSI LVRDVDGKTF  ALD+ I
Sbjct  118  VDYSIGLDTEQWKEKVGIESFDASSVFNTIFKAPVVKSLSITLVRDVDGKTFVKALDDVI  177

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            + RIK P+ ++E++LSTFR IF GR L++GT I LTW++P++ML+ +S++     +DA+ 
Sbjct  178  ARRIKKPTVEEESSLSTFRNIFLGRNLRQGTGIYLTWLEPSRMLISISTNQDACQVDAET  237

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            +SA V  AL+D F G +PVSP+LK+S A  LE +L
Sbjct  238  KSATVNYALYDGFFGGSPVSPTLKSSTAQLLEAIL  272



>dbj|BAJ85871.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 145/204 (71%), Gaps = 4/204 (2%)
 Frame = -3

Query  701  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  522
            YV E  TNVKF R L++PG    L +LGTGYR+K F    VKVYAA  YV+ SI    + 
Sbjct  61   YVVEGATNVKFSRELTVPGHAEPLIILGTGYRDKFF----VKVYAAAFYVDISIGLDTEQ  116

Query  521  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD  342
            WR +   +  + S  F++IFKAP+ KSLSI LVRDVDGKTF  ALD  I+ RI+ P+A++
Sbjct  117  WRRKVGLDTFDASSGFDSIFKAPVVKSLSITLVRDVDGKTFVKALDAVIARRIQKPTAEE  176

Query  341  ETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFD  162
            E++LSTFR  F GR LK+GT I LTW++P++MLV VS+D  PS IDA+++SA V+ AL+D
Sbjct  177  ESSLSTFRNSFLGRNLKQGTRIYLTWLEPSRMLVSVSTDQCPSQIDAEVKSATVSYALYD  236

Query  161  VFLGRNPVSPSLKASVANGLEVVL  90
             F G +PVSP+L++S A  LE +L
Sbjct  237  GFFGSSPVSPTLRSSTAQLLEAIL  260



>ref|XP_008386421.1| PREDICTED: fatty-acid-binding protein 3-like [Malus domestica]
Length=138

 Score =   204 bits (519),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  614  GYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLS  435
            GYREKVFAIIGV VYAAGLYVN+S+LN L+AW+GRSAAE+Q DS LF +IF +P EKS+ 
Sbjct  4    GYREKVFAIIGVXVYAAGLYVNQSVLNSLNAWKGRSAAEIQEDSSLFNSIFLSPSEKSIQ  63

Query  434  IVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDP  255
            IVLVRDVDGKTFWDAL++AISPRIKSP+  DE+ALSTFR+IFQG+PLKKGTFI  TW D 
Sbjct  64   IVLVRDVDGKTFWDALNDAISPRIKSPTPVDESALSTFRSIFQGQPLKKGTFIFXTWPDX  123

Query  254  TKMLVC  237
            +KMLV 
Sbjct  124  SKMLVS  129



>ref|NP_001046684.1| Os02g0320300 [Oryza sativa Japonica Group]
 dbj|BAD28958.1| chalcone isomerase-like [Oryza sativa Japonica Group]
 dbj|BAF08598.1| Os02g0320300 [Oryza sativa Japonica Group]
 dbj|BAG90517.1| unnamed protein product [Oryza sativa Japonica Group]
Length=280

 Score =   209 bits (531),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 152/217 (70%), Gaps = 5/217 (2%)
 Frame = -3

Query  740  PRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAG  561
            P AA   +VG+A +V E TTNVKF R +++PG    L +LGTGYREK F    +K+YAA 
Sbjct  67   PSAAGGGTVGDA-FVIEDTTNVKFPREIAVPGYTEPLVILGTGYREKFF----LKIYAAA  121

Query  560  LYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE  381
             YV+ SI      WR +   E  + S +F++IFKAP+ KSLSI+LVRDVDGKTF  ALD+
Sbjct  122  FYVDCSIGVDTMRWREKVGIETFDASSVFDSIFKAPVVKSLSIILVRDVDGKTFVKALDD  181

Query  380  AISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDA  201
             I+ +IK PSA++E +LSTF+  F GR LK+GT + LTW++P+K+L+ ++ +  P  +DA
Sbjct  182  IIARQIKKPSAEEEQSLSTFQKTFLGRSLKQGTTVYLTWLEPSKLLISIAGNQDPCQVDA  241

Query  200  KIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            +I SA V  AL+D FLG +PVSP+L++S A  LE +L
Sbjct  242  EITSATVNYALYDGFLGSSPVSPTLRSSTALLLEAIL  278



>ref|XP_002451868.1| hypothetical protein SORBIDRAFT_04g008910 [Sorghum bicolor]
 gb|EES04844.1| hypothetical protein SORBIDRAFT_04g008910 [Sorghum bicolor]
Length=314

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 147/205 (72%), Gaps = 4/205 (2%)
 Frame = -3

Query  701  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  522
            +V E TTNVKF R L++PG    L  +GTGYR+K F    VKVYAA  YV+ S+    + 
Sbjct  114  FVTEDTTNVKFPRELTVPGYTYPLVAVGTGYRDKFF----VKVYAAAFYVDYSLRLDTEQ  169

Query  521  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD  342
            W+ +   E  + S +F++IFKAP+ KSLSI+LVRDVDGKTF +AL++ I+ +IK+P+A++
Sbjct  170  WKEKIGIESFDGSSVFDSIFKAPVVKSLSIILVRDVDGKTFVNALNDVIARQIKNPNAEE  229

Query  341  ETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFD  162
            E++LST +  F GR LK+GT I LTW++P +ML+ +S +  P  +DA+IESA V  AL+D
Sbjct  230  ESSLSTLQNTFLGRNLKQGTNIYLTWLEPKRMLISISENQDPRQVDAEIESATVNYALYD  289

Query  161  VFLGRNPVSPSLKASVANGLEVVLK  87
             F G++PVSPSL++S A  LE +L+
Sbjct  290  GFFGKSPVSPSLRSSTARLLEALLQ  314



>gb|EEE56854.1| hypothetical protein OsJ_06472 [Oryza sativa Japonica Group]
Length=290

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 152/227 (67%), Gaps = 15/227 (7%)
 Frame = -3

Query  740  PRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGT----------GYREKVFA  591
            P AA   +VG+A +V E TTNVKF R +++PG    L +LGT          GYREK F 
Sbjct  67   PSAAGGGTVGDA-FVIEDTTNVKFPREIAVPGYTEPLVILGTVCNLNFSSLLGYREKFF-  124

Query  590  IIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVD  411
               +K+YAA  YV+ SI      WR +   E  + S +F++IFKAP+ KSLSI+LVRDVD
Sbjct  125  ---LKIYAAAFYVDCSIGVDTMRWREKVGIETFDASSVFDSIFKAPVVKSLSIILVRDVD  181

Query  410  GKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVS  231
            GKTF  ALD+ I+ +IK PSA++E +LSTF+  F GR LK+GT + LTW++P+K+L+ ++
Sbjct  182  GKTFVKALDDIIARQIKKPSAEEEQSLSTFQKTFLGRSLKQGTTVYLTWLEPSKLLISIA  241

Query  230  SDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
             +  P  +DA+I SA V  AL+D FLG +PVSP+L++S A  LE +L
Sbjct  242  GNQDPCQVDAEITSATVNYALYDGFLGSSPVSPTLRSSTALLLEAIL  288



>gb|EMT25778.1| Chalcone--flavonone isomerase 1B-1 [Aegilops tauschii]
Length=269

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 140/204 (69%), Gaps = 4/204 (2%)
 Frame = -3

Query  701  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  522
            +V E  TNVKF R L++PG    L +LGTGYR+K F    VKVYAA  YV+ SI    + 
Sbjct  68   FVVEGATNVKFSRELTVPGHKEPLIILGTGYRDKFF----VKVYAAAFYVDISIGLDTEQ  123

Query  521  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD  342
            WR +   E  + S  F++IFKAP+ KSL+I LVRDVDGKTF  ALD  I+ RI+  + ++
Sbjct  124  WRKKVGLETFDASSGFDSIFKAPVVKSLNITLVRDVDGKTFVKALDGVIARRIQKRTDEE  183

Query  341  ETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFD  162
            E++LS FR  F GR LKKGT I LTW++P++MLV VS+D  PS +D +++SA V  AL+D
Sbjct  184  ESSLSAFRNSFLGRNLKKGTTIYLTWLEPSRMLVSVSTDQGPSQVDVEVKSATVNYALYD  243

Query  161  VFLGRNPVSPSLKASVANGLEVVL  90
             F G +PVSP+L++S A  LE +L
Sbjct  244  GFFGSSPVSPTLRSSTAQLLEAIL  267



>ref|XP_002528487.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33904.1| conserved hypothetical protein [Ricinus communis]
Length=127

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -3

Query  449  EKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVL  270
            EKSL IVLVRDVDGKTFWDALD+AISPRI++P+  DE+ALSTFR+IFQGRPLKKGTFI L
Sbjct  7    EKSLLIVLVRDVDGKTFWDALDDAISPRIEAPTPVDESALSTFRSIFQGRPLKKGTFIFL  66

Query  269  TWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            TW+DP+KML+C+SSD   +++DA IES NVT ALFDVF    PVSPSLKASVANGL  +L
Sbjct  67   TWLDPSKMLICISSDGMQATVDATIESTNVTFALFDVFFSDAPVSPSLKASVANGLATIL  126

Query  89   K  87
            K
Sbjct  127  K  127



>gb|EMS65822.1| Chalcone--flavonone isomerase 1B-1 [Triticum urartu]
Length=244

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 142/230 (62%), Gaps = 25/230 (11%)
 Frame = -3

Query  716  VGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESIL  537
            V    +V E  TNVKF R L++PG    L +LGTGYR+K F    VKVYAA  YV+ SI 
Sbjct  17   VAGDAFVVEGATNVKFSRELTVPGHKEPLIILGTGYRDKFF----VKVYAAAFYVDISIG  72

Query  536  NKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKS  357
               + WR +   E  + S  F++IFKAP+ KSL+I LVRDVDG TF  ALD  I+ RI+ 
Sbjct  73   LDTEQWRKKVGLETFDASSGFDSIFKAPVVKSLNITLVRDVDGNTFVKALDGVIARRIQK  132

Query  356  PSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVC--------------------  237
             + ++E++LS FR  F GR LKKGT I LTW++P++ML+C                    
Sbjct  133  RTDEEESSLSAFRNSFLGRNLKKGTTIYLTWLEPSRMLLCLTSEALDFQISLFEFVISSV  192

Query  236  -VSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
             VS+D  PS +DA+++SA V  AL+D F G +PVSP+L++S A  LE +L
Sbjct  193  SVSTDQGPSQVDAEVKSATVNYALYDGFFGSSPVSPTLRSSTAQLLEAIL  242



>gb|AFW71098.1| hypothetical protein ZEAMMB73_950090 [Zea mays]
Length=268

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 144/206 (70%), Gaps = 5/206 (2%)
 Frame = -3

Query  734  AASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  555
            AA   +VG+  +V E TTNV F R +++PG    L  +GTGYREK F    VKVYAA  Y
Sbjct  56   AAGGGAVGDT-FVTEDTTNVMFPREVTVPGYTHPLVAVGTGYREKFF----VKVYAAAFY  110

Query  554  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  375
            V+ S+    + W+ ++  E  + S +F++IFKAP+ KSLSI+LVR VDGKTF +AL++ I
Sbjct  111  VDYSLRLDTEQWKAKTGIESFDSSSVFDSIFKAPVVKSLSIILVRAVDGKTFVNALNDVI  170

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
            + +IK+P+A++E++LST +  F GR LK+GT I LTW++P +ML+ +S D  P  +DA+I
Sbjct  171  ARQIKNPNAEEESSLSTLQNTFLGRNLKQGTSIYLTWLEPKRMLISISEDEDPRQVDAEI  230

Query  194  ESANVTSALFDVFLGRNPVSPSLKAS  117
            +SA V  AL+D F G++ V PSL++S
Sbjct  231  KSATVNYALYDGFFGKSTVCPSLRSS  256



>gb|AFW71097.1| hypothetical protein ZEAMMB73_950090 [Zea mays]
Length=212

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 138/195 (71%), Gaps = 4/195 (2%)
 Frame = -3

Query  701  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  522
            +V E TTNV F R +++PG    L  +GTGYREK F    VKVYAA  YV+ S+    + 
Sbjct  10   FVTEDTTNVMFPREVTVPGYTHPLVAVGTGYREKFF----VKVYAAAFYVDYSLRLDTEQ  65

Query  521  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD  342
            W+ ++  E  + S +F++IFKAP+ KSLSI+LVR VDGKTF +AL++ I+ +IK+P+A++
Sbjct  66   WKAKTGIESFDSSSVFDSIFKAPVVKSLSIILVRAVDGKTFVNALNDVIARQIKNPNAEE  125

Query  341  ETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFD  162
            E++LST +  F GR LK+GT I LTW++P +ML+ +S D  P  +DA+I+SA V  AL+D
Sbjct  126  ESSLSTLQNTFLGRNLKQGTSIYLTWLEPKRMLISISEDEDPRQVDAEIKSATVNYALYD  185

Query  161  VFLGRNPVSPSLKAS  117
             F G++ V PSL++S
Sbjct  186  GFFGKSTVCPSLRSS  200



>ref|XP_001764300.1| predicted protein [Physcomitrella patens]
 gb|EDQ70854.1| predicted protein [Physcomitrella patens]
Length=217

 Score =   177 bits (450),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 132/209 (63%), Gaps = 3/209 (1%)
 Frame = -3

Query  719  SVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESI  540
            +VG    V EP T++KF   L++P    +L+ LG G REK  A + VKVYA G+Y    +
Sbjct  5    AVGADNVVTEPATSIKFALLLTVPDSSNTLTFLGAGVREKQIAFLKVKVYAVGVYAQPDV  64

Query  539  LNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIK  360
               L +W+G+SAA+L  D  LF+ + +AP+EK+L I L RDVDG TFW ALDEA+ PR+ 
Sbjct  65   AASLASWKGKSAADLVKDEALFQELAQAPVEKALQIKLARDVDGATFWGALDEALVPRLT  124

Query  359  SPSADDETALST--FRTIFQGRPLKKGTFIVLTWVDPTKMLVCVS-SDATPSSIDAKIES  189
            +  A  +   +   F  +F+ R L+KG  I LTWV P+ + V +S S+A     +A IES
Sbjct  125  ASGAGADGDAALAEFGNVFKNRSLQKGYVITLTWVQPSTLRVTISESEAANLKTEASIES  184

Query  188  ANVTSALFDVFLGRNPVSPSLKASVANGL  102
              + SAL+DVFLG + VSPS KA+VA G+
Sbjct  185  KALLSALYDVFLGTSAVSPSAKAAVAEGI  213



>ref|XP_006665045.1| PREDICTED: fatty-acid-binding protein 3-like, partial [Oryza 
brachyantha]
Length=253

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 120/175 (69%), Gaps = 4/175 (2%)
 Frame = -3

Query  614  GYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLS  435
            GYREK F    +K+YAA  YV+ SI      WR +   E  + S +F++IFKAP+ KSLS
Sbjct  81   GYREKFF----LKIYAAAFYVDCSIGVDTARWREKVVIETFDASSVFDSIFKAPVVKSLS  136

Query  434  IVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDP  255
            I+LVRDVDGKTF  ALD+ I+ +IK PS ++E +LSTF   F GR LK+GT + LTW++P
Sbjct  137  IILVRDVDGKTFVKALDDIITRQIKKPSTEEEHSLSTFEKAFLGRSLKQGTTVYLTWLEP  196

Query  254  TKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL  90
            +++L+ ++ +   S +DA+I SA V  AL+D F G  PVSP+L++S +  LE +L
Sbjct  197  SRLLISIAGNQDSSQVDAEITSATVNYALYDGFFGGTPVSPTLRSSTSQLLEAIL  251



>ref|NP_001151850.1| LOC100285485 [Zea mays]
 gb|ACG44611.1| chalcone isomerase 3 [Zea mays]
Length=251

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 125/195 (64%), Gaps = 21/195 (11%)
 Frame = -3

Query  701  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  522
            +V E TTNVKF R +++PG    L  +GT Y                     S+    + 
Sbjct  66   FVTEDTTNVKFPREVTVPGYTHPLVAVGTDY---------------------SLRLDTEQ  104

Query  521  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD  342
            W+ ++  E  + S +F++IFKAP+ KSLSI+LVR VDGKTF +AL++ I+ +IK+P+A++
Sbjct  105  WKAKTGIESFDSSSVFDSIFKAPVVKSLSIILVRAVDGKTFVNALNDVIARQIKNPNAEE  164

Query  341  ETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFD  162
            E++LST +  F GR LK+GT I LTW++P +ML+ +S D  P  +DA+I+SA V  AL+D
Sbjct  165  ESSLSTLQNTFLGRNLKQGTSIYLTWLEPKRMLISISEDEDPRQVDAEIKSATVNYALYD  224

Query  161  VFLGRNPVSPSLKAS  117
             F G++ V PSL++S
Sbjct  225  GFFGKSTVCPSLRSS  239



>gb|AIE16842.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16843.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16844.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16845.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16848.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16851.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16854.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16855.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16857.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16858.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16861.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16862.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16864.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16865.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16866.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16867.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16868.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16871.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16873.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16874.1| chalcone isomerase, partial [Glycine max]
Length=114

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = -3

Query  524  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSAD  345
            AW+G+S   +Q +S LFETIF++  EKSL I+LVRDVDGKTFWDAL +AISPRI+ P+  
Sbjct  1    AWKGQSKEAIQGNSSLFETIFQSSFEKSLQIILVRDVDGKTFWDALSDAISPRIQQPTTT  60

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESAN  183
            DETAL+TFR +F  RPLKKG  I+LTW++P+ +LV VSS+  PS++DA IESAN
Sbjct  61   DETALTTFRGVFLDRPLKKGAIIILTWLNPSGLLVSVSSNGLPSTMDATIESAN  114



>gb|AIE16850.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16853.1| chalcone isomerase, partial [Glycine soja]
Length=114

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = -3

Query  524  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSAD  345
            AW+G+S   +Q +S LFETIF++  EKSL IVLVRDVDGKTFWDAL +AISPRI  P+  
Sbjct  1    AWKGQSKEAIQGNSSLFETIFQSSFEKSLQIVLVRDVDGKTFWDALSDAISPRIPQPTTT  60

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESAN  183
            DETAL+TFR +F  RPLKKG  I+LTW++P+++LV VSS+  PS++DA IESAN
Sbjct  61   DETALTTFRGVFLDRPLKKGAIIILTWLNPSRLLVSVSSNGFPSTVDATIESAN  114



>gb|AIE16846.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16859.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16863.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16869.1| chalcone isomerase, partial [Glycine max]
Length=114

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -3

Query  524  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSAD  345
            AW+G+S   +Q +S LFETIF++  EKSL I+LVRDVDGKTFWDAL +AISPRI  P+  
Sbjct  1    AWKGQSKEAIQGNSSLFETIFQSSFEKSLQIILVRDVDGKTFWDALSDAISPRIPQPTTT  60

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESAN  183
            DETAL+TFR +F  RPLKKG  I+LTW++P+ +LV VSS+  PS++DA IESAN
Sbjct  61   DETALTTFRGVFLDRPLKKGAIIILTWLNPSGLLVFVSSNGLPSTMDATIESAN  114



>gb|AIE16847.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16849.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16852.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16856.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16860.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16870.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16872.1| chalcone isomerase, partial [Glycine max]
Length=114

 Score =   139 bits (349),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = -3

Query  524  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSAD  345
            AW+G+S   +Q +  LFETIF++  EKSL I+LVRDVDGKTFWDAL +AISPRI  P+  
Sbjct  1    AWKGQSKEAIQGNYSLFETIFQSSFEKSLQIILVRDVDGKTFWDALSDAISPRIPQPTTT  60

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESAN  183
            DETAL+TFR +F  RPLKKG  I+LTW++P+ +LV VSS+  PS++DA IESAN
Sbjct  61   DETALTTFRGVFLDRPLKKGAIIILTWLNPSGLLVSVSSNGLPSTMDATIESAN  114



>gb|EMT21809.1| hypothetical protein F775_33111 [Aegilops tauschii]
Length=152

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = -3

Query  458  APLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTF  279
            A + KSLSI LVRDVDGKTF +ALD  I+  I+  + ++E++LS FR  F GR LK+GT 
Sbjct  27   ASVVKSLSITLVRDVDGKTFVNALDGVIARWIQKRTDEEESSLSAFRNSFLGRNLKQGTT  86

Query  278  IVLTWVDPTKMLVCVSS-DATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGL  102
            I LTW++P++MLV VS+ D  PS +DA+++SA V  AL+D F G +PVSP+L++S A  L
Sbjct  87   IYLTWLEPSRMLVSVSTKDQGPSQVDAEVKSATVNYALYDGFFGSSPVSPTLRSSTAQLL  146

Query  101  EVVL  90
            E +L
Sbjct  147  EAIL  150



>ref|XP_002993360.1| hypothetical protein SELMODRAFT_136990 [Selaginella moellendorffii]
 gb|EFJ05545.1| hypothetical protein SELMODRAFT_136990 [Selaginella moellendorffii]
Length=169

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 94/177 (53%), Gaps = 9/177 (5%)
 Frame = -3

Query  626  LLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLE  447
            LL  G REK  A + VK YA G Y N+  L   + W      E    +      F    E
Sbjct  2    LLNAGVREKKIAFVAVKAYAVGFYANKEQLP--NDWDKNFLVEAHTQT------FAGAFE  53

Query  446  KSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLT  267
            K L + L RDV G  F  AL++ + PR+KS S + E  LS F  +FQ R LKKGT +  T
Sbjct  54   KGLVVKLARDVSGALFSSALNDELKPRLKS-SPEGEKILSEFGKLFQNRKLKKGTTVYFT  112

Query  266  WVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEV  96
            W+ P  + V VS   TP++ ++   S    S LFDV+LG   VSPSLKAS+A+ L V
Sbjct  113  WIQPDTLYVGVSDGETPATPNSTFVSGFFASRLFDVYLGEKSVSPSLKASIADHLHV  169



>gb|EEC73031.1| hypothetical protein OsI_06969 [Oryza sativa Indica Group]
Length=109

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -3

Query  521  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD  342
            W  +   E  + S +F +IFKAP+ KSLSI+L+RDVDGKTF  ALD+ I+ +IK PSA++
Sbjct  3    WSEKVGIETFDASSVFVSIFKAPVVKSLSIILIRDVDGKTFVKALDDIIARQIKKPSAEE  62

Query  341  ETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLV  240
            E  LSTF+  F GR LK+GT + LTW++P+++LV
Sbjct  63   EQGLSTFQKTFLGRSLKQGTTVYLTWLEPSRLLV  96



>ref|XP_002972746.1| hypothetical protein SELMODRAFT_97953, partial [Selaginella moellendorffii]
 gb|EFJ25967.1| hypothetical protein SELMODRAFT_97953, partial [Selaginella moellendorffii]
Length=122

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 73/123 (59%), Gaps = 1/123 (1%)
 Frame = -3

Query  464  FKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKG  285
            F    EK L + L RDV G  F  AL++ + PR+KS S + E  LS F  +FQ R LKKG
Sbjct  1    FAGAFEKGLVVKLARDVSGALFSSALNDELKPRLKS-SPEGEKILSEFGKLFQNRKLKKG  59

Query  284  TFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANG  105
            T +  TW+ P  + V VS   TP++ ++   S    S LFDV+LG   VSPSLKAS+A+ 
Sbjct  60   TTVYFTWIQPDTLYVGVSDGETPATPNSTFVSGFFASRLFDVYLGEKSVSPSLKASIADH  119

Query  104  LEV  96
            L V
Sbjct  120  LHV  122



>ref|XP_002504118.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65376.1| predicted protein [Micromonas sp. RCC299]
Length=255

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 108/232 (47%), Gaps = 45/232 (19%)
 Frame = -3

Query  746  FSPRA-ASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVY  570
            FS +A  ++  V  A  + EP T V F ++ + P    ++  +G G REK  AII VKVY
Sbjct  31   FSKQARVNNEIVARAFSIVEPATKVSFPKTFN-PHGGDTMQCIGAGVREKKIAIINVKVY  89

Query  569  AAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDA  390
               +YV+ +          +   EL N   L    F    +K+L + LVRDVDGKTFW+A
Sbjct  90   GVAMYVDAA----------KCKEELANGGSLLTGSF----DKALLVQLVRDVDGKTFWEA  135

Query  389  LDEAISPRIKSPSADDETA-------------------------LSTFRTIFQGRPLKKG  285
            LDEA+ PRI+  + D  TA                             + +FQGR L+K 
Sbjct  136  LDEAVGPRIRRIATDMATAEDEDGNFMASVAEAAEVAEEKAMDECEEIKGLFQGRKLRKD  195

Query  284  TFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPS  129
               VL W  P K    +        +  ++ S  +  A+FDV+ G +PVSPS
Sbjct  196  D-KVLIWWSPNKGKFEI---GVVGGMPLELTSQQLAQAVFDVYCGDDPVSPS  243



>ref|XP_003059642.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56774.1| predicted protein [Micromonas pusilla CCMP1545]
Length=261

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 102/215 (47%), Gaps = 46/215 (21%)
 Frame = -3

Query  692  EPTTNVKFQRSL-SLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWR  516
            EP T + F+ +L S      SL+ +G G REK  AII VKVYA  LYV+       DA +
Sbjct  46   EPATKITFEDALPSAVKDGASLTCVGAGVREKKIAIINVKVYAVALYVDA------DACK  99

Query  515  GRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDET  336
               AA     +PL         +K+L+I L RDV G+TFWDAL++A++PRI+  + D  T
Sbjct  100  ---AALTTGATPL-----DGAFDKTLAIELARDVGGETFWDALEDAVTPRIRRIATDMAT  151

Query  335  -------------------------ALSTFRTIFQGRPLKKGTFIVLTW---VDPTKMLV  240
                                        + + +F G  LKKGT + + W         ++
Sbjct  152  KEDEDGNFMATVAEAAEVAEEAAMDGAESLKGLFAGENLKKGTRVTIAWRPNASDGGDVL  211

Query  239  CVSSDATPSSIDAKIESANVTSALFDVFLGRNPVS  135
            CVS     S   A   S  +  ALFDV+LG +PVS
Sbjct  212  CVSVGGGKSIASA---SEELALALFDVYLGDDPVS  243



>emb|CBJ30273.1| Chalcone Isomerase [Ectocarpus siliculosus]
Length=232

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 105/208 (50%), Gaps = 13/208 (6%)
 Frame = -3

Query  698  VEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNK-LDA  522
            V E  T + F+  +SLPG   S SL+GTG R K     GVKVYA GLYV+E    K L+ 
Sbjct  33   VTERATKISFREKVSLPGGSGS-SLMGTGVRVKKIGPAGVKVYAVGLYVDEKAAAKELEV  91

Query  521  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD  342
             +G     L  +   F  + K+  EK++ + + R+V  +    AL E++ PRI    +  
Sbjct  92   HKGEDGESLGKNDGFFTRVAKSNFEKTMVLKMAREVGTEKMVSALAESVKPRI----SGS  147

Query  341  ETALSTFRTIFQGRPLKKGTF---IVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSA  171
            +  L +F+ I      K+G     +   +V     L CVS +   +     I+S  ++SA
Sbjct  148  KKPLDSFQDILLKAVGKEGAAKKGMQFGFVCKPGAL-CVSVNGKDAGT---IKSGPLSSA  203

Query  170  LFDVFLGRNPVSPSLKASVANGLEVVLK  87
            + DV+LG+  VSP  K + A G+  +L+
Sbjct  204  MVDVYLGKKAVSPGAKKAFATGVAALLE  231



>ref|XP_001769093.1| predicted protein [Physcomitrella patens]
 gb|EDQ66067.1| predicted protein [Physcomitrella patens]
Length=212

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/200 (29%), Positives = 97/200 (49%), Gaps = 11/200 (6%)
 Frame = -3

Query  677  VKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAE  498
            + F    + P   T L L+G G        + ++  A G Y   SI   L  W+G++ +E
Sbjct  11   IDFATKFAPPTSSTELDLIGHGNTGMEIETVEIRFTAMGFYAEPSISEHLQKWKGKAVSE  70

Query  497  L-QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------  339
            L ++DS   + + + P+EK++ I +++ + G  +  AL  ++  R+ +   DD+      
Sbjct  71   LVEDDSGFHKELIQVPVEKAVRISIIKGIKGLPYGSALQSSLRDRLVN---DDKFEEEEE  127

Query  338  TALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDA-TPSSIDAKIESANVTSALFD  162
             AL      FQ   L KG  I+  W  P  + + +S +   P  +   IE ANV  AL D
Sbjct  128  EALEKLVEFFQPHNLPKGANIIYHWATPDTVKISLSEEGKIPDEVSYTIEDANVAEALLD  187

Query  161  VFLGRNPVSPSLKASVANGL  102
            ++LG N ++PS  +SVA  +
Sbjct  188  LYLGENTITPSTLSSVAEAI  207



>ref|XP_002503292.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64550.1| predicted protein [Micromonas sp. RCC299]
Length=258

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 97/203 (48%), Gaps = 16/203 (8%)
 Frame = -3

Query  698  VEEPTTNVKFQRSLSLPGC-CTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL--  528
            V EP T +K      + G  C  L+  G G R K  A IGVKVYA GLYVN +       
Sbjct  62   VTEPKTGLKLPGEYCVNGGKCAPLT--GMGVRIKRIAGIGVKVYACGLYVNPASARAAVG  119

Query  527  DAWRGRSAAELQNDSPLFETI-FKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS  351
            D + G+S  ++  D  LF+ +   A +EK++ +V  RD+D     DAL E + P + +  
Sbjct  120  DRYVGKSVKDVAKDQALFDVVNAAADVEKTVRLVFARDIDSAKIRDALSERLRPALGA--  177

Query  350  ADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSA  171
              D  +L  F   F G   KKG  +  T     K++    S       D K+      +A
Sbjct  178  --DSPSLRRFEAYFDGVTFKKGQSLTFT-ASGGKLITSFGSKEAGQIADGKL-----CTA  229

Query  170  LFDVFLGRNPVSPSLKASVANGL  102
            LFD +LG++PV PS K S+   L
Sbjct  230  LFDAYLGKSPVVPSAKESLGEQL  252



>ref|XP_001773128.1| predicted protein [Physcomitrella patens]
 gb|EDQ61981.1| predicted protein [Physcomitrella patens]
Length=209

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 99/198 (50%), Gaps = 5/198 (3%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAA  501
            ++ F    + P   T L L+G G        + ++  A G Y   SI   L  W+G  ++
Sbjct  10   DIDFATKFTPPTGSTELDLIGYGNTGMEIETVEIRFTAIGFYAEPSISEHLQKWKGTPSS  69

Query  500  EL-QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS---ADDETA  333
             L ++DS   + + +AP+EK++ I +++ + G  +  AL  ++  R+ +      ++E A
Sbjct  70   NLVEDDSGFHKELIQAPVEKAVRISIIKGIKGLPYGSALQSSLRDRLVNNDLFEEEEEEA  129

Query  332  LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDA-TPSSIDAKIESANVTSALFDVF  156
            L      FQ   L KGT I+  W  P+ + V +S +   P  +   I+ A+V  AL D++
Sbjct  130  LEKLAEFFQPHNLPKGTNIIYHWATPSSVKVSLSEEGKMPEDVAYTIDDAHVAEALLDLY  189

Query  155  LGRNPVSPSLKASVANGL  102
            LG N ++PS  ASVA  +
Sbjct  190  LGENTITPSTLASVAEAI  207



>ref|XP_005855968.1| hypothetical protein NGA_0361402 [Nannochloropsis gaditana CCMP526]
 gb|EKU20377.1| hypothetical protein NGA_0361402 [Nannochloropsis gaditana CCMP526]
Length=201

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 98/203 (48%), Gaps = 18/203 (9%)
 Frame = -3

Query  692  EPTTNVKFQRSLSLPGCCTSLSLLGTGYR-EKVFAIIGVKVYAAGLYVNESI-LNKLDAW  519
            EP T +KF+ ++SLPG    LSL G G R +K+   + VKVY  GLYV++ + + KL  +
Sbjct  3    EPATKIKFEETISLPGSVAGLSLAGVGVRVKKLVGPLAVKVYGVGLYVDKGVAVRKLSKF  62

Query  518  RGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE  339
            +G  A        LF+ +     +K + + + R V   T  +AL E++ PR+   S   E
Sbjct  63   KGHKA----GSKALFDALETGNFDKIVLLKMARKVGAATLVNALAESVKPRLGKGS---E  115

Query  338  TALSTFRTI----FQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSA  171
             AL  F+ +     +G   + G          +K++V ++          +I S  +  A
Sbjct  116  AALLQFQDVLLAGLKGGEAETGKQFGFGIQGGSKLIVTINGKK-----QGEIASGPLAQA  170

Query  170  LFDVFLGRNPVSPSLKASVANGL  102
            L   +L  N VS  +K SVA GL
Sbjct  171  LLKTYLDNNAVSKDMKESVAQGL  193



>gb|EWM23313.1| Chalcone isomerase, subgroup [Nannochloropsis gaditana]
Length=221

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 98/203 (48%), Gaps = 18/203 (9%)
 Frame = -3

Query  692  EPTTNVKFQRSLSLPGCCTSLSLLGTGYR-EKVFAIIGVKVYAAGLYVNESI-LNKLDAW  519
            EP T +KF+ ++SLPG    LSL G G R +K+   + VKVY  GLYV++ + + KL  +
Sbjct  23   EPATKIKFEETISLPGSVAGLSLAGVGVRVKKLVGPLAVKVYGVGLYVDKGVAVRKLSKF  82

Query  518  RGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE  339
            +G  A        LF+ +     +K + + + R V   T  +AL E++ PR+   S   E
Sbjct  83   KGHKA----GSKALFDALETGNFDKIVLLKMARKVGAATLVNALAESVKPRLGKGS---E  135

Query  338  TALSTFRTI----FQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSA  171
             AL  F+ +     +G   + G          +K++V ++          +I S  +  A
Sbjct  136  AALLQFQDVLLAGLKGGEAETGKQFGFGIQGGSKLIVTINGKK-----QGEIASGPLAQA  190

Query  170  LFDVFLGRNPVSPSLKASVANGL  102
            L   +L  N VS  +K SVA GL
Sbjct  191  LLKTYLDNNAVSKDMKESVAQGL  213



>ref|XP_001420321.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98614.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=312

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 100/222 (45%), Gaps = 52/222 (23%)
 Frame = -3

Query  692  EPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRG  513
            +P T + F  + S       L++LG G R K  AII VK+YA  +YV+       DA R 
Sbjct  115  DPATKISFPDTNS-----AGLTVLGAGCRVKRVAIIDVKIYALAMYVDA------DAARA  163

Query  512  RSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKS-----PSA  348
            +    L N             +K L+I L RDVDGKTF +A+DE++ PRI+       +A
Sbjct  164  QKGKGLLN----------GDYDKELAIELARDVDGKTFMEAMDESLGPRIREIATNMATA  213

Query  347  DDE--------------------TALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSS  228
            +DE                     +L   R  F    LK+GT + +TW        C  +
Sbjct  214  EDEDGNFMASVAEAAEKAEEAAVDSLDAMRDGFSSLKLKQGTKMTITWTSNG----CAIA  269

Query  227  DATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGL  102
             A  + ++   ESA    AL DV++G  PV+P+   +   GL
Sbjct  270  VAGAAKME--FESAEFAKALLDVYVGEGPVAPAAAQTFEKGL  309



>ref|XP_005644192.1| chalcone isomerase [Coccomyxa subellipsoidea C-169]
 gb|EIE19648.1| chalcone isomerase [Coccomyxa subellipsoidea C-169]
Length=289

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 103/208 (50%), Gaps = 10/208 (5%)
 Frame = -3

Query  737  RAASSSSVGNAEYVEEPTTNVKFQRSLSL-PGCCTSLSLLGTGYREKVFAIIGVKVYAAG  561
            R   S    +   V E +T V+F    +L  G    +  +G G R K FA + VKVYA  
Sbjct  58   RGGVSVQCSSGLVVREESTGVEFPEVTTLWEG--GKMRSMGAGVRAKKFAFVPVKVYAVT  115

Query  560  LYVNESILNKLDAWRGRSAAELQN-DSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALD  384
            +YV      +    R R      N D      +      K+L + LVR V+GK F++AL+
Sbjct  116  VYVEAEKAARELGVRQRGGFFDDNRDEDFTLALVDGAFAKALVVQLVRKVEGKQFYEALE  175

Query  383  EAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCV----SSDATP  216
            EA++PR++   A D  +L+ F     GR L+KGT I+L +     + V +    SSD + 
Sbjct  176  EALAPRLR--LAGDTGSLAKFGDFLSGRSLEKGTAIILFYRVEGVLEVALMPPGSSDYSQ  233

Query  215  SSIDAKIESANVTSALFDVFLGRNPVSP  132
            +  + ++ES  +  ALF+V++G + + P
Sbjct  234  AKPELRVESPMLCRALFEVYMGSDSIVP  261



>ref|XP_005845646.1| hypothetical protein CHLNCDRAFT_136673 [Chlorella variabilis]
 gb|EFN53544.1| hypothetical protein CHLNCDRAFT_136673 [Chlorella variabilis]
Length=288

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 89/185 (48%), Gaps = 6/185 (3%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            +  +G G R K  A IGVKVYA  LYV    + +    R R      +D    + +    
Sbjct  93   MRCVGAGCRSKKVAFIGVKVYAVALYVEAEKMARELGVRNRGGFFDGDDDFC-QALVDGG  151

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIV  273
              K+L + L RDV+G  F  AL+EA++PR++     D  +L  F+ +F  + L KGT +V
Sbjct  152  CVKALQLELARDVEGAQFVQALEEALAPRMRLMG--DTASLEAFKKVFVDKKLAKGTNVV  209

Query  272  LTWVDPTKMLVCVSS---DATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGL  102
            L +     + V V     D +    DA I SA +   LF+V++G   V    K   ANG 
Sbjct  210  LMYRTDATLDVAVRPGRVDWSTIVADASIASAGLCRGLFEVYMGGESVVADAKKEWANGA  269

Query  101  EVVLK  87
              +L+
Sbjct  270  RKLLE  274



>ref|XP_003058444.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56899.1| predicted protein [Micromonas pusilla CCMP1545]
Length=171

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 87/174 (50%), Gaps = 13/174 (7%)
 Frame = -3

Query  614  GYREKVFAIIGVKVYAAGLYVN-ESILNKL-DAWRGRSAAELQNDSPLFETIFKAP-LEK  444
            G R K  A IGVKVYA GLYV+ E     L D + GR  A++  D  LF+ + ++  ++K
Sbjct  2    GVRVKRIAGIGVKVYACGLYVDPEDARAALGDRFVGRDVADVGKDQSLFDGVLRSDDVDK  61

Query  443  SLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTW  264
            ++ +   R++D     DAL E + P +      D  +L TF T F G   +KG  +  + 
Sbjct  62   TVRLAFARNIDSAKIRDALSERLRPALGR----DSESLKTFETYFDGVTFEKGQALTFSA  117

Query  263  VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGL  102
                K+   +   +        I  A + +ALFD +LGR+PV PS K S+   L
Sbjct  118  T-GGKLETTMKGKSV-----GVIHDARLCAALFDAYLGRDPVVPSAKRSLGEAL  165



>dbj|BAJ10401.1| enhancer of flavonoid production [Torenia hybrid cultivar]
Length=214

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 95/183 (52%), Gaps = 6/183 (3%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y++  IL+ L  W+G+S  EL  D   FE I  AP
Sbjct  26   LSLLGHGITDIEIHFLQIKFTAIGIYLDLQILDHLQKWKGKSETELAQDDDFFEAIVSAP  85

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI---FQGRPLKKGT  282
            +EK + +V+++++ G  +   L+ A+  R+      +E   S+   +   FQ +  +K +
Sbjct  86   VEKFIRVVVIKEIKGSQYGVQLESAVRDRLAEEDKYEEEEESSLEKVVDFFQSKYFRKDS  145

Query  281  FIVLTWVDPTKM--LVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVA  111
             + L +   + +  +V  SSD        ++++ANV   +   +L G   VSP+  AS+A
Sbjct  146  VVTLHFPASSSIAEIVFASSDGDKEESRIEVKNANVVEMIQKWYLGGTRAVSPTTVASLA  205

Query  110  NGL  102
            +GL
Sbjct  206  SGL  208



>ref|XP_009627241.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Nicotiana 
tomentosiformis]
Length=210

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 97/183 (53%), Gaps = 8/183 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSL+G G  +     + +K  A G+Y++  I+  L  W+G++ AEL  +   FE I  AP
Sbjct  24   LSLMGHGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQWKGKTGAELTENDDFFEAIVNAP  83

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPLKKGT  282
            ++K L +V+++++ G  +   L+ A+  R   +     ++E AL      FQ +  KK +
Sbjct  84   VDKFLRVVVIKEIKGSQYGVQLESAVRDRLAEVDKYEEEEEEALEKIVEFFQSKYFKKSS  143

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDAKIE--SANVTSALFDVFLGRN-PVSPSLKASVA  111
              V+T+  P+   +   S AT    D++IE  +ANV   +   +LG N  VSP+  +S+A
Sbjct  144  --VITYSFPSTSGIAKISFATEGKEDSEIEVKNANVVEMMKKWYLGGNRGVSPTTISSLA  201

Query  110  NGL  102
            + L
Sbjct  202  DNL  204



>ref|XP_006435919.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
 ref|XP_006486169.1| PREDICTED: probable chalcone--flavonone isomerase 3-like [Citrus 
sinensis]
 gb|ESR49159.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
Length=209

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 93/183 (51%), Gaps = 8/183 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L+LLG G  +     + +K  A G+Y++  IL+ L  W+G+  + L  D   F+ +  AP
Sbjct  23   LNLLGHGLTDIEIHFLQIKFTAIGVYLDPEILSHLQQWKGKQGSSLAQDDDFFDALVSAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS---ADDETALSTFRTIFQGRPLKKGT  282
            +EK L IV+++++ G  +   L+ A+  R+        ++E+AL      FQ +  KK +
Sbjct  83   VEKFLRIVVIKEIKGSQYGVQLESAVRDRLAGADKYEEEEESALEKIVEFFQSKYFKKDS  142

Query  281  FIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVA  111
             I   +    PT  +V  S     S I  K+E+ANV   +   +L G   VSP+  +S+A
Sbjct  143  VIAYHFPATSPTAEIVFTSEGKEDSKI--KVENANVVEMIKKWYLGGARGVSPTTTSSLA  200

Query  110  NGL  102
            N L
Sbjct  201  NTL  203



>ref|XP_007509430.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19233.1| predicted protein [Bathycoccus prasinos]
Length=254

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 100/229 (44%), Gaps = 44/229 (19%)
 Frame = -3

Query  707  AEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILN--  534
            A  V EP T ++F      P    +L LLG G REK  AI+ VKVYA G+Y +E+ +N  
Sbjct  41   ASIVIEPQTKIQF------PETSNALKLLGVGSREKKIAILNVKVYAVGMYADETKMNSI  94

Query  533  KLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIK--  360
            K DA        + +D  L   +     EK + I L   V+ K F+ AL+EA+ PRI   
Sbjct  95   KKDA--------INDDEGLL--LLNGNFEKEIVIKLNMSVNEKDFFKALEEALVPRISRI  144

Query  359  ----SPSADDETALSTFRTIF--------------------QGRPLKKGTFIVLTWVDPT  252
                +   DDE    T    +                    +G  L+KG  I  T+++  
Sbjct  145  ATDMATREDDEGNFMTTTAEYSEECEERALEEMEMIRDGLGKGGKLEKGAQISFTFLETG  204

Query  251  KMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANG  105
              +  V   +  S  +   +S  +  AL DV++G +P+S   K +   G
Sbjct  205  GEVAMVMKSSLSSRTEIAFKSYELAKALLDVYVGDDPISVEAKKAFEAG  253



>ref|XP_004171055.1| PREDICTED: chalcone--flavonone isomerase-like [Cucumis sativus]
Length=209

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 97/189 (51%), Gaps = 12/189 (6%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  E     + +K+ A G+Y+  SI+  L  W+G++A +L+ D   F+ I  AP
Sbjct  23   LSLLGHGSTEIEIHFLEIKLTAIGVYLEPSIVEHLQQWKGKAAKDLEEDDDFFQAIISAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSA---DDETALSTFRTIFQGRPLKKGT  282
            +EK + +V+++++ G  +   L+ A+  R+ +      ++E  L      FQ + LK  T
Sbjct  83   VEKVIRVVVIKEIKGSQYGVQLESAVRDRLAADDKYEDEEEAQLEKIVEFFQSKYLK--T  140

Query  281  FIVLTWVDP---TKMLVCVSSDATPSSIDAKIESANVTSALFDVFLG--RNPVSPSLKAS  117
              V+ +  P   T   +  SSD    S   K+E+ NV   +   +LG  R    P++ +S
Sbjct  141  HSVINFHFPPASTIAEIEFSSDEKEES-KMKVENGNVVEMIKKWYLGGTRGVSQPTI-SS  198

Query  116  VANGLEVVL  90
            +AN L + L
Sbjct  199  LANNLAIEL  207



>gb|KGN50734.1| hypothetical protein Csa_5G221960 [Cucumis sativus]
Length=242

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 97/191 (51%), Gaps = 16/191 (8%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  E     + +K+ A G+Y+  SI+  L  W+G++A +L+ D   F+ I  AP
Sbjct  56   LSLLGHGSTEIEIHFLEIKLTAIGVYLEPSIVEHLQQWKGKAAKDLEEDDDFFQAIISAP  115

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD------ETALSTFRTIFQGRPLK  291
            +EK + +V+++++ G  +   L+ A+  R+   +ADD      E  L      FQ + LK
Sbjct  116  VEKVIRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEDEEEAQLEKIVEFFQSKYLK  172

Query  290  KGTFIVLTWVDPTKMLVCV--SSDATPSSIDAKIESANVTSALFDVFLG--RNPVSPSLK  123
              + I   +  P   +  +  SSD    S   K+E+ NV   +   +LG  R    P++ 
Sbjct  173  THSVINFHF-PPASTIAEIEFSSDEKEES-KMKVENGNVVEMIKKWYLGGTRGVSQPTI-  229

Query  122  ASVANGLEVVL  90
            +S+AN L + L
Sbjct  230  SSLANNLAIEL  240



>emb|CCM80406.1| chalcone isomerase 2 [Lupinus angustifolius]
Length=214

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 96/185 (52%), Gaps = 12/185 (6%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + VK Y+ G+Y++  I+  L  W+G+SA EL+ +   F+++  AP
Sbjct  28   LSLLGHGITDMEIHFLQVKFYSIGVYLDPEIVGHLQQWKGKSAKELEENDGFFDSVIFAP  87

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK + +V+++++ G  +   ++ A+  R+   +ADD+       AL       Q +  K
Sbjct  88   VEKVVRLVVIKEIKGAQYGVQIESAVRDRL---AADDKYEEEEEEALEKIVEFLQSKYFK  144

Query  290  KGTFIVLTW-VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKAS  117
            K + I   +  D T   + VS +    S    +E+ANV   +   +L G   VSPS  +S
Sbjct  145  KHSVITYHFSADSTTAEIVVSLEGKEDS-KFVVENANVVETIKKWYLGGSRAVSPSTISS  203

Query  116  VANGL  102
            +A+ L
Sbjct  204  LASTL  208



>ref|XP_004146474.1| PREDICTED: chalcone--flavonone isomerase-like [Cucumis sativus]
Length=291

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 97/189 (51%), Gaps = 12/189 (6%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  E     + +K+ A G+Y+  SI+  L  W+G++A +L+ D   F+ I  AP
Sbjct  105  LSLLGHGDTEIEIHFLEIKLTAIGVYLEPSIVEHLQQWKGKAAKDLEEDDDFFQAIISAP  164

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSA---DDETALSTFRTIFQGRPLKKGT  282
            +EK + +V+++++ G  +   L+ A+  R+ +      ++E  L      FQ + LK  T
Sbjct  165  VEKVIRVVVIKEIKGSQYGVQLESAVRDRLAADDKYEDEEEAQLEKIVEFFQSKYLK--T  222

Query  281  FIVLTWVDP---TKMLVCVSSDATPSSIDAKIESANVTSALFDVFLG--RNPVSPSLKAS  117
              V+ +  P   T   +  SSD    S   K+E+ NV   +   +LG  R    P++ +S
Sbjct  223  HSVINFHFPPASTIAEIEFSSDEKEES-KMKVENGNVVEMIKKWYLGGTRGVSQPTI-SS  280

Query  116  VANGLEVVL  90
            +AN L + L
Sbjct  281  LANNLAIEL  289



>ref|XP_010253088.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Nelumbo 
nucifera]
Length=212

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 97/197 (49%), Gaps = 9/197 (5%)
 Frame = -3

Query  653  LPGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSP  480
            LP   TS  LSLLG G  +     + +K  A G+Y+   ++  L  W+G+S  EL  D  
Sbjct  14   LPEISTSKPLSLLGHGITDIEIHFLQIKFTAIGVYLEPEVVAHLQQWKGKSGNELAQDDD  73

Query  479  LFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS---ADDETALSTFRTIF  309
             FE +  AP+EK + +V+++++ G  +   ++ A+  R+ +      ++E AL      F
Sbjct  74   FFEALISAPVEKIVRVVVIKEIKGSQYGVQIESAVRDRLAAVDKYEEEEEEALENIIQFF  133

Query  308  QGRPLKKGTFIVLTW--VDPTKMLVCVS-SDATPSSIDAKIESANVTSALFDVFL-GRNP  141
            Q +  KK + I  T+    P+     +S S         K+E+ NV   +   +L G + 
Sbjct  134  QSKYFKKHSVITYTFPSASPSTGTAEISFSTEGKEEAKIKVENGNVVEMIKKWYLGGSSG  193

Query  140  VSPSLKASVANGLEVVL  90
            VSP+  AS+AN L  +L
Sbjct  194  VSPTTVASLANNLSALL  210



>gb|AHL83555.1| chalcone isomerase type 4 [Iris x hollandica]
Length=209

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 90/182 (49%), Gaps = 6/182 (3%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L+LLGTG  +     + +K  A G+Y+ E+++  L  W+G+   EL  D   FE I  AP
Sbjct  23   LALLGTGLTDIEVHFLQIKYNAIGIYLEEAVVEHLGDWKGKKGGELAEDDDFFEAIVSAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS---ADDETALSTFRTIFQGRPLKKGT  282
            +EK   +V+++++ G  +   L+  +  R+ +      ++E AL      FQ + LK  +
Sbjct  83   VEKLFRVVIIKEIKGAQYGVQLESGVRDRLAAVDKYEEEEEEALEKVSEFFQSKYLKPDS  142

Query  281  FIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVAN  108
             I   +  PT +   +S  A        K+E+ANV   +   FL G   VSPS   S+A 
Sbjct  143  VITFHF-SPTPLAAEISFVAEGKDEAKIKVENANVVEMIQKWFLGGSRAVSPSTVKSLAE  201

Query  107  GL  102
            G+
Sbjct  202  GI  203



>ref|XP_006435917.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
 ref|XP_006435918.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
 gb|ESR49157.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
 gb|ESR49158.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
Length=197

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 91/183 (50%), Gaps = 12/183 (7%)
 Frame = -3

Query  626  LLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLE  447
            LL TG  +     + +K  A G+Y++  IL+ L  W+G+  + L  D   F+ +  AP+E
Sbjct  13   LLATGLTDIEIHFLQIKFTAIGVYLDPEILSHLQQWKGKQGSSLAQDDDFFDALVSAPVE  72

Query  446  KSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD-----ETALSTFRTIFQGRPLKKGT  282
            K L IV+++++ G  +   L+ A+  R+    AD      E+AL      FQ +  KK +
Sbjct  73   KFLRIVVIKEIKGSQYGVQLESAVRDRL--AGADKYEEEEESALEKIVEFFQSKYFKKDS  130

Query  281  FIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVA  111
             I   +    PT  +V  S     S I  K+E+ANV   +   +L G   VSP+  +S+A
Sbjct  131  VIAYHFPATSPTAEIVFTSEGKEDSKI--KVENANVVEMIKKWYLGGARGVSPTTTSSLA  188

Query  110  NGL  102
            N L
Sbjct  189  NTL  191



>gb|AFK43525.1| unknown [Lotus japonicus]
Length=217

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 94/194 (48%), Gaps = 7/194 (4%)
 Frame = -3

Query  662  SLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQ  492
             ++ P   T+   LSLLG G  + V   + VK Y  G+Y++  ++  L  W+G  A EL+
Sbjct  10   EITYPSKITTTKPLSLLGYGLNDMVIHFLQVKFYTIGVYLDPEVVGHLQQWKGTPAKELE  69

Query  491  NDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSA---DDETALSTF  321
                 F+ +  AP+EK++ +V+++++ G  +   ++ A+  R+ +      ++E AL   
Sbjct  70   EKDDFFDALISAPVEKAIRLVVMKEIKGAQYGVQIETAVRDRLVNDDKYEDEEEAALEQV  129

Query  320  RTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRN  144
               FQ +  KK + I   +   +     V S          +E+ANV   +   +L G  
Sbjct  130  VEFFQSKYFKKNSVITFHFPANSPTAEIVVSLEGKEDTKFVVENANVVETIKKWYLGGSG  189

Query  143  PVSPSLKASVANGL  102
             +SPS  +S+A+ L
Sbjct  190  AISPSTISSLASNL  203



>gb|KIZ04906.1| hypothetical protein MNEG_3049 [Monoraphidium neglectum]
Length=273

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 96/206 (47%), Gaps = 11/206 (5%)
 Frame = -3

Query  692  EPTTNVKFQRSLSLPGCCTSLSLLGTGYREK-VFAIIGVKVYAAGLYVNESILNK-LDAW  519
            EP T + +  +L +        L G G R K V  +  + VYA GLYV+     K L  W
Sbjct  74   EPATGIDYPDNLCVITKNHCPGLAGVGVRAKRVLGLKNINVYALGLYVDAHGAKKALGKW  133

Query  518  RGRSAAELQNDSPLFETIFKAP-LEKSLSIVL-VRDVDGKTFWDALDEAISPRIKSPSAD  345
            +G S+  L  +   F+ I  A   E+SL +V+    +    F +AL+E ++P +      
Sbjct  134  KGSSSDTLLTNQAAFDAITTAESFERSLRLVISFGSLKRAQFVNALEERLAPPLNKAGKS  193

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALF  165
            D   + +F  +F G   KKGT I  +     K++  +            IES  +  ALF
Sbjct  194  D--VMKSFERLFDGASFKKGTAIDFSASGKGKLVTKIDGQQV-----GTIESPELVKALF  246

Query  164  DVFLGRNPVSPSLKASVANGLEVVLK  87
            D++LG + VS   KAS A GL  +L+
Sbjct  247  DIYLGSDAVSADAKASFAQGLSSLLQ  272



>emb|CCM80407.1| chalcone isomerase 1 [Lupinus angustifolius]
Length=209

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 99/201 (49%), Gaps = 15/201 (7%)
 Frame = -3

Query  659  LSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQN  489
            +S P   T+   L LLG G  +     + VK Y+ G+Y++  I+  L  W+G+SA EL+ 
Sbjct  11   ISYPSKYTTTKPLPLLGHGITDMEIHFLQVKFYSIGVYLDPEIVGHLQQWKGKSAKELEE  70

Query  488  DSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALS  327
            +   F+ +  AP+EK + +V+++++ G  +   ++ A+  R+   +ADD+       AL 
Sbjct  71   NDEFFDALVSAPVEKVVRLVVIKEIKGAQYGVQIESAVRDRL---AADDKYEEEEEEALE  127

Query  326  TFRTIFQGRPLKKGTFIVLTW-VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-  153
                  Q +  KK + I   +  D     + VS +    S    + +ANV   +   +L 
Sbjct  128  KIVEFLQSKYFKKHSVITYHFSADSQTAEIVVSLEGKDDS-KFVVVNANVVETIQKWYLG  186

Query  152  GRNPVSPSLKASVANGLEVVL  90
            G   VSPS  AS+AN L V L
Sbjct  187  GSRAVSPSTIASLANTLSVEL  207



>ref|XP_001700277.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO98244.1| predicted protein [Chlamydomonas reinhardtii]
Length=260

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 87/165 (53%), Gaps = 8/165 (5%)
 Frame = -3

Query  713  GNAEYVEEPTTNVKFQRSLS-LPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESIL  537
            G+A    EP T  +F   L  L   C SL+  G G R K   I  + VYA G+YV+ +  
Sbjct  56   GSAGGRVEPATGYEFPAELCYLKKPCPSLA--GLGVRNKKIVIKDIHVYALGIYVDAAAA  113

Query  536  NK-LDAWRGRSAAELQNDSPLFETIFKAP-LEKSLSIVL-VRDVDGKTFWDALDEAISPR  366
               L  ++ ++AAEL+ D   ++ +   P +EKSL +V+  R VD K F DAL++ ++PR
Sbjct  114  KSALSGFKKKTAAELEADQSFYDAVVSTPSVEKSLRLVISSRLVDRKKFLDALEDRLAPR  173

Query  365  IKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVS  231
            +K   A + + L  FR  F     +KG  I  T VD  K++  V+
Sbjct  174  LK--QAGEPSTLDNFRAQFDSVHFEKGLEIAFTCVDNKKLVTKVA  216



>gb|AHC07954.1| CHI [Indosasa hispida]
Length=213

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 96/188 (51%), Gaps = 9/188 (5%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAELQNDSPLFETIFKA  456
            LSL+G G  +     + +K  A GLY+  +++L  L+ W+GR A EL  D   F+ +  A
Sbjct  26   LSLVGHGITDIEIHFLQIKYNAIGLYLEKDNVLEHLEDWKGRKAVELVEDDAFFQALVSA  85

Query  455  PLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSA---DDETALSTFRTIFQGRPLKKG  285
            P+EK   IV+++++ G  +   L+ ++  R+ S      D+E AL      FQ +  K  
Sbjct  86   PVEKLFRIVVIKEIKGSQYGVQLESSVRDRLVSADKYDDDEEEALEKVTDFFQSKYFKPN  145

Query  284  TFIVLTWVDPTKMLVCVSSDATPSSIDAK--IESANVTSALFDVFL-GRNPVSPSLKASV  114
            +  V+T+  PT   V   S AT    +AK  +E+ NV   +   +L G + VSP+   S+
Sbjct  146  S--VVTFHFPTTPGVAEISFATEGKDEAKTTVENTNVAEMIQKWYLGGASAVSPATVKSL  203

Query  113  ANGLEVVL  90
            A+    +L
Sbjct  204  ADHFAALL  211



>ref|XP_008792229.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Phoenix 
dactylifera]
Length=205

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 91/186 (49%), Gaps = 6/186 (3%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L+LLG G  +     + +K  A G+Y+ + I+  L  WRG+  AEL  D+  FE +  AP
Sbjct  19   LALLGHGITDIEIHFLQIKYNAIGIYMEKHIVEHLGNWRGKKGAELAKDNLFFEALVAAP  78

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPLKKGT  282
            ++K   IV+++++ G  +   L+ A+  R   I     ++E AL      FQ +  KK +
Sbjct  79   VDKFFRIVVIKEIKGSQYGVQLESAVRDRLADIDKYEEEEEEALEKVSEFFQTKYFKKDS  138

Query  281  FIVLTW-VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVAN  108
             I   + V P    +   ++    +   K+E+ANV   +   +L G   VSPS   S+A 
Sbjct  139  VITFNFPVTPRTAAISFVTEGKEQT-KIKVENANVVEMIQKWYLGGSRAVSPSTVKSLAE  197

Query  107  GLEVVL  90
             L  +L
Sbjct  198  NLGAML  203



>gb|AHL83557.1| chalcone isomerase type 4 [Iris x hollandica]
Length=209

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 92/183 (50%), Gaps = 8/183 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L+LLGTG  +     + +K  A G+Y+ E+++  +  W+G+   EL  D   FE I  AP
Sbjct  23   LALLGTGLTDIEVHFLQIKYNAIGIYLEEAVVEHVGDWKGKKGGELAEDDDFFEAIVSAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS---ADDETALSTFRTIFQGRPLKKGT  282
            +EK   +V+++++ G  +   L+  +  R+ +      ++E AL      FQ + LK  +
Sbjct  83   VEKLFRVVIIKEIKGAQYGVQLESGVRDRLAAADKYEEEEEEALEKVSDFFQSKYLKPDS  142

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDAKI--ESANVTSALFDVFL-GRNPVSPSLKASVA  111
             I   +  PT +   +S   T    +AKI  E+ANV   +   FL G   VSPS   S+A
Sbjct  143  VITFHF-SPTPLAAEISF-VTEGKGEAKIKVENANVVEMIQKWFLGGSRAVSPSTVKSLA  200

Query  110  NGL  102
             G+
Sbjct  201  EGI  203



>ref|XP_008456952.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Cucumis 
melo]
Length=242

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/245 (28%), Positives = 112/245 (46%), Gaps = 26/245 (11%)
 Frame = -3

Query  794  PSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGT  615
            PS  +L SL        SP     S V       E   ++ F + +        LSLLG 
Sbjct  12   PSPVTLFSLSRSTSSFLSPSPIMGSEV-------EVVADIAFPKQIV---KAKPLSLLGH  61

Query  614  GYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLS  435
            G  E     + +K+ A G+Y+  S++  L  W+G++A +L  D   F+ I  AP+EK + 
Sbjct  62   GTTEIEIHFLEIKLTAIGVYLEPSVVEHLQQWKGKAAKDLVEDDDFFQAIVSAPVEKVIR  121

Query  434  IVLVRDVDGKTFWDALDEAISPRIKSPSADD------ETALSTFRTIFQGRPLKKGTFIV  273
            +V+++++ G  +   L+ A+  R+   +ADD      E  L      FQ + LK  + I 
Sbjct  122  VVVIKEIKGSQYGVQLESAVRDRL---AADDKYEDEEEAQLEKIVEFFQSKYLKTHSVIN  178

Query  272  LTWVDPTKMLVCV--SSDATPSSIDAKIESANVTSALFDVFLG--RNPVSPSLKASVANG  105
              +  P   +  +  SSD    S   K+E+ NV   +   +LG  R    P++ +S+AN 
Sbjct  179  FHF-PPASTIAQIEFSSDEKEES-KMKVENGNVVEMIKKWYLGGTRGVSQPTI-SSLANN  235

Query  104  LEVVL  90
            L + L
Sbjct  236  LAIEL  240



>gb|AFK36813.1| unknown [Medicago truncatula]
Length=209

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 100/195 (51%), Gaps = 11/195 (6%)
 Frame = -3

Query  659  LSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQN  489
            +S P   T+   LSLLG G  +     + VK Y+ G+Y+   ++N L  W+G+ A EL++
Sbjct  11   ISYPSKITTNKPLSLLGHGITDMEIHFLQVKFYSIGVYLEPEVVNHLQQWKGKPAKELED  70

Query  488  DSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI-  312
            +   F+ +  +P+EK++ +V+++++ G  +   ++ A+  R+ +    ++        + 
Sbjct  71   NDDFFDALISSPVEKAIRLVVIKEIKGAQYGVQIETAVRDRLAADDKYEDEEEEALEKVI  130

Query  311  --FQGRPLKKGTFIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GR  147
              FQ +  KK + I   +    PT  +V VS +    S    IE+ANV   +   +L G 
Sbjct  131  EFFQSKYFKKHSVITYHFPANSPTAEIV-VSLEGKEDS-KYVIENANVVETIKKWYLAGS  188

Query  146  NPVSPSLKASVANGL  102
              +SPS  +S+AN L
Sbjct  189  RAISPSTISSLANHL  203



>dbj|BAJ10402.1| enhancer of flavonoid production [Torenia hybrid cultivar]
Length=214

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 95/183 (52%), Gaps = 6/183 (3%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSL+G G  +     + +K  A G+Y++  I++ L  W+G+S  EL  D   FE I  AP
Sbjct  26   LSLVGHGITDIEIHFLQIKFTAIGIYLDLQIVDHLQKWKGKSETELAKDDDFFEAIVSAP  85

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRI---KSPSADDETALSTFRTIFQGRPLKKGT  282
            +EK   +V+++++ G  +   L+ A+  R+        ++E +L      FQ +  +K +
Sbjct  86   VEKFFRVVVIKEIKGSQYGVQLESAVRDRLAEEDKYEEEEEESLEKVVEFFQSKYFRKDS  145

Query  281  FIVLTWVDPTKM--LVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVA  111
             ++L +   + +  +V  SSD        ++++ANV   +   +L G   VSP+  AS+A
Sbjct  146  VVILHFPASSSIAEIVFASSDGDREESRIEVKNANVVEMIQKWYLDGTRSVSPTTVASLA  205

Query  110  NGL  102
            +GL
Sbjct  206  SGL  208



>ref|XP_009804396.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Nicotiana 
sylvestris]
Length=210

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 94/183 (51%), Gaps = 8/183 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSL+G G  +     + +K  A G+Y++  I+  L  W+G++  EL  +   FE I  AP
Sbjct  24   LSLMGYGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQWKGKTGTELTENDDFFEAIVNAP  83

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPLKKGT  282
            ++K L +V+++++ G  +   L+ A+  R   +     ++E AL      FQ +  KK +
Sbjct  84   VDKFLRVVVIKEIKGSQYGVQLESAVRDRLAEVDKYEEEEEEALEKIVEFFQSKYFKKSS  143

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDA--KIESANVTSALFDVFL-GRNPVSPSLKASVA  111
              V+T+  P    +   S AT    D+  K+E+ANV   +   +L G   VSP+  +S+A
Sbjct  144  --VITYSFPATSGIAKISFATEGKEDSEIKVENANVVEMMKKWYLGGSRGVSPTTISSLA  201

Query  110  NGL  102
            + L
Sbjct  202  HNL  204



>ref|XP_004307734.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Fragaria 
vesca subsp. vesca]
Length=212

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 91/186 (49%), Gaps = 14/186 (8%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L+LLG G  +     + +K  A G+Y++  I+  L  W+ +   EL  D   F+ +  AP
Sbjct  26   LALLGHGITDIEIHFLQIKFTAIGVYLDPEIVGHLQKWKTKKGTELAEDDDFFDALISAP  85

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK L +V+++++ G  +   L+ ++  R+   +ADD+       AL      FQ +  K
Sbjct  86   VEKFLRVVVIKEIKGSQYGVQLESSVRDRL---AADDKYEEEEEEALEKIVEFFQSKYFK  142

Query  290  KGTFIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKA  120
            K + I   +    PT  +V  +     S I  K+E+ANV   +   +L G   VSPS  +
Sbjct  143  KDSIITFHFPATSPTAEIVFTAEGKEESKI--KVENANVVETIQKWYLGGTRGVSPSTIS  200

Query  119  SVANGL  102
             +AN +
Sbjct  201  CLANTI  206



>gb|KEH35544.1| chalcone-flavanone isomerase family protein [Medicago truncatula]
Length=229

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 100/196 (51%), Gaps = 11/196 (6%)
 Frame = -3

Query  662  SLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQ  492
             +S P   T+   LSLLG G  +     + VK Y+ G+Y+   ++N L  W+G+ A EL+
Sbjct  30   EISYPSKITTNKPLSLLGHGITDMEIHFLQVKFYSIGVYLEPEVVNHLQQWKGKPAKELE  89

Query  491  NDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI  312
            ++   F+ +  +P+EK++ +V+++++ G  +   ++ A+  R+ +    ++        +
Sbjct  90   DNDDFFDALISSPVEKAIRLVVIKEIKGAQYGVQIETAVRDRLAADDKYEDEEEEALEKV  149

Query  311  ---FQGRPLKKGTFIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-G  150
               FQ +  KK + I   +    PT  +V VS +    S    IE+ANV   +   +L G
Sbjct  150  IEFFQSKYFKKHSVITYHFPANSPTAEIV-VSLEGKEDS-KYVIENANVVETIKKWYLAG  207

Query  149  RNPVSPSLKASVANGL  102
               +SPS  +S+AN L
Sbjct  208  SRAISPSTISSLANHL  223



>gb|AIU39024.1| chalcone isomerase 2 [Narcissus tazetta var. chinensis]
Length=216

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 90/183 (49%), Gaps = 8/183 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L L+G+G  + V   + +K  A G+Y++++I+  L  W+GR  +EL  D   F+ +  AP
Sbjct  29   LPLVGSGITDIVIHFLQIKHNAIGIYLDDNIVEHLGNWKGRKGSELAEDDDFFDALISAP  88

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI---FQGRPLKKGT  282
             EK   +V+++++ G  F   L+ A+  R+ S    +E        I   FQ    K+G+
Sbjct  89   TEKYFRVVIIKEIKGAQFGLQLESALRDRLVSVDRYEEEEEEQVEKIAHFFQAPYFKRGS  148

Query  281  FIVLTWVDPTKMLVCVSSDATPS--SIDAKIESANVTSALFDVFL-GRNPVSPSLKASVA  111
              V+T+  P        S A      +  K+E+ANVT  +   +L G N VSP    S+A
Sbjct  149  --VITYHFPANSSSAEVSYAVEGKDEVKIKVENANVTEMMQKWYLGGSNAVSPCTVQSLA  206

Query  110  NGL  102
              L
Sbjct  207  EKL  209



>ref|XP_010922741.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Elaeis guineensis]
Length=209

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 90/189 (48%), Gaps = 4/189 (2%)
 Frame = -3

Query  644  CCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETI  465
               SL+LLG G  +     + +K  A G+Y+ ++I+  L  W+G+  AEL  D   FE +
Sbjct  19   AAKSLALLGHGITDIEIHFLQIKYNAIGIYMEKNIIEHLGNWKGKKGAELAEDDLFFEAL  78

Query  464  FKAPLEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPL  294
              AP++K   I++++++ G  +   L+ A+  R   I     ++E AL    T FQ +  
Sbjct  79   VAAPVDKFFRIMVIKEIKGSQYGVQLESAVRDRLAAIDKYEEEEEEALEKVSTFFQSKYF  138

Query  293  KKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKAS  117
            KK + I   +   ++ +    +          +E+ NV   +   +L G   VSP+   S
Sbjct  139  KKDSVITFNFSASSRAVEISFATEGKEETKINVENENVVEMIEKWYLGGSRAVSPTTVKS  198

Query  116  VANGLEVVL  90
            +A+ L  +L
Sbjct  199  LADNLGAML  207



>ref|XP_009363797.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Pyrus x 
bretschneideri]
 ref|XP_009363878.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Pyrus x 
bretschneideri]
Length=209

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 94/192 (49%), Gaps = 12/192 (6%)
 Frame = -3

Query  650  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            P   T+  LSLLG G  +     + +K  A G+Y++  I++ L  W+ + A+EL  D   
Sbjct  15   PQITTTKPLSLLGQGITDIEIHFLQIKFTAIGVYLDAEIVSHLQQWKAKKASELAEDDDF  74

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRT  315
            F+ +  AP+EK + +V+++++ G  +   L+ A+  R+   +ADD+       AL     
Sbjct  75   FDALVSAPVEKFIRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKVVE  131

Query  314  IFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPV  138
             FQ +  KK + +   +   +     V S         K+E+ANV   +   +L G   V
Sbjct  132  FFQSKYFKKDSVVTFHFPATSNTAEIVFSTEGKEESKIKVENANVVENIKKWYLGGTRGV  191

Query  137  SPSLKASVANGL  102
            SPS  +S+AN L
Sbjct  192  SPSTISSLANAL  203



>gb|AHY20030.1| chalcone isomerase [Tulipa fosteriana]
Length=207

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 88/188 (47%), Gaps = 10/188 (5%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y+ + I++ L  W+G+  +EL  D   FE I  AP
Sbjct  21   LSLLGKGLTDIEIHFLQIKFNAVGIYLEKEIIDHLGKWKGKKGSELVEDDLFFEDIVSAP  80

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK   IV+++++ G  +   L+ A+  R+   +ADD+       AL      FQ +  K
Sbjct  81   VEKFFRIVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKITEFFQTKYFK  137

Query  290  KGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASV  114
            K + I   +   ++                K+E+ANV   +   +L G   VS +   S+
Sbjct  138  KDSVITFHFPASSRTTEISFVTEGKGETKMKVENANVVEMIQKWYLGGSRAVSQTTVKSL  197

Query  113  ANGLEVVL  90
            A  L  +L
Sbjct  198  AEKLGEIL  205



>ref|XP_009349076.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X2 
[Pyrus x bretschneideri]
Length=240

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 93/192 (48%), Gaps = 12/192 (6%)
 Frame = -3

Query  650  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            P   TS  LSLLG G  +     + +K  A G+Y++  +++ L  W+ + A EL  D   
Sbjct  46   PQITTSKPLSLLGQGITDIEIHFLQIKFTAIGVYLDPEVVSHLQQWKAKKADELAEDDDF  105

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRT  315
            F+ +  AP+EK + +V+++++ G  +   L+ A+  R+   +ADD+       AL     
Sbjct  106  FDALISAPVEKFIRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKVVE  162

Query  314  IFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPV  138
             FQ +  KK + I   +   +     V S         K+E+ANV   +   +L G   V
Sbjct  163  FFQSKYFKKDSVITFHFPATSAAAEIVFSTEGKQESKLKVENANVVENIKKWYLGGTRGV  222

Query  137  SPSLKASVANGL  102
            SPS  +S+AN L
Sbjct  223  SPSTISSLANAL  234



>ref|XP_009349075.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X1 
[Pyrus x bretschneideri]
Length=242

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 93/192 (48%), Gaps = 12/192 (6%)
 Frame = -3

Query  650  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            P   TS  LSLLG G  +     + +K  A G+Y++  +++ L  W+ + A EL  D   
Sbjct  48   PQITTSKPLSLLGQGITDIEIHFLQIKFTAIGVYLDPEVVSHLQQWKAKKADELAEDDDF  107

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRT  315
            F+ +  AP+EK + +V+++++ G  +   L+ A+  R+   +ADD+       AL     
Sbjct  108  FDALISAPVEKFIRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKVVE  164

Query  314  IFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPV  138
             FQ +  KK + I   +   +     V S         K+E+ANV   +   +L G   V
Sbjct  165  FFQSKYFKKDSVITFHFPATSAAAEIVFSTEGKQESKLKVENANVVENIKKWYLGGTRGV  224

Query  137  SPSLKASVANGL  102
            SPS  +S+AN L
Sbjct  225  SPSTISSLANAL  236



>ref|XP_004502829.1| PREDICTED: chalcone--flavonone isomerase-like [Cicer arietinum]
Length=209

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 96/186 (52%), Gaps = 14/186 (8%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + VK Y+ G+Y++  ++  L  W+G+ A EL+N+   F+ +  AP
Sbjct  23   LSLLGHGITDMEIHFLQVKFYSIGVYLDPEVVGHLQQWKGKPAKELENNDDFFDALISAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK + +V+++++ G  +   ++ A+  R+   +ADD+       AL      FQ +  K
Sbjct  83   VEKVIRLVVIKEIKGSQYGVQIETAVRDRL---AADDKYEEEEEEALEKVVEFFQSKYFK  139

Query  290  KGTFIVLTWV--DPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKA  120
            K + I   +    PT  +V VS +    S    IE+ANV   +   +L G   +SPS  A
Sbjct  140  KHSVISFHFFANSPTAEIV-VSLEGKEDS-KYVIENANVVETIKKWYLAGSRALSPSTIA  197

Query  119  SVANGL  102
            S+A  L
Sbjct  198  SLATIL  203



>ref|XP_008369367.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X1 
[Malus domestica]
 ref|XP_008369368.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X2 
[Malus domestica]
Length=209

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 89/184 (48%), Gaps = 10/184 (5%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y++  I++ L  W+ + A EL  D   F+ +  AP
Sbjct  23   LSLLGQGITDIEIHFLQIKFTAIGVYLDAEIVSHLQQWKAKKANELAEDDDFFDALVSAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK + +V+++++ G  +   L+ A+  R+   +ADD+        L      FQ +  K
Sbjct  83   VEKFIRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEETLEKVVEFFQSKYFK  139

Query  290  KGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASV  114
            K + I   +   +     V S         K+E+ANV   +   +L G   VSPS  +S+
Sbjct  140  KDSVITFHFPATSNTAEIVFSTEGKEESKIKVENANVVENIKKWYLGGTRGVSPSTISSL  199

Query  113  ANGL  102
            AN L
Sbjct  200  ANTL  203



>gb|AFK33841.1| unknown [Medicago truncatula]
Length=209

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 99/196 (51%), Gaps = 11/196 (6%)
 Frame = -3

Query  662  SLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQ  492
             +S P   T+   L LLG G  +     + VK Y+ G+Y+   ++N L  W+G+ A EL+
Sbjct  10   EISYPSKITTNKPLFLLGHGITDMEIHFLQVKFYSIGVYLEPEVVNHLQQWKGKPAKELE  69

Query  491  NDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI  312
            ++   F+ +  +P+EK++ +V+++++ G  +   ++ A+  R+ +    ++        +
Sbjct  70   DNDDFFDALISSPVEKAIRLVVIKEIKGAQYGVQIETAVRDRLAADDKYEDEEEEALEKV  129

Query  311  ---FQGRPLKKGTFIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-G  150
               FQ +  KK + I   +    PT  +V VS +    S    IE+ANV   +   +L G
Sbjct  130  IEFFQSKYFKKHSVITYHFPANSPTAEIV-VSLEGKEDS-KYVIENANVVETIKKWYLAG  187

Query  149  RNPVSPSLKASVANGL  102
               +SPS  +S+AN L
Sbjct  188  SRAISPSTISSLANHL  203



>ref|XP_008366803.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Malus domestica]
Length=209

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 93/192 (48%), Gaps = 12/192 (6%)
 Frame = -3

Query  650  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            P   T+  LSLLG G  +     + +K  A G+Y++  +++ L  W+ + A EL  D   
Sbjct  15   PQITTTKPLSLLGQGITDIEIHFLQIKFTAIGVYLDPEVVSHLQQWKAKKADELAEDDDF  74

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRT  315
            F+ +  AP+EK + +V+++++ G  +   L+ A+  R+   +ADD+       AL     
Sbjct  75   FDALISAPVEKFIRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKVVE  131

Query  314  IFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPV  138
             FQ +  KK + I   +   +     V S         K+E+ANV   +   +L G   V
Sbjct  132  FFQSKYFKKDSVITFHFPATSAAAEIVFSTEGKEESKLKVENANVVENIKKWYLGGTRGV  191

Query  137  SPSLKASVANGL  102
            SPS  +S+AN L
Sbjct  192  SPSTISSLANAL  203



>ref|XP_007218407.1| hypothetical protein PRUPE_ppa011476mg [Prunus persica]
 gb|AEJ88218.1| chalcone flavonone isomerase [Prunus persica]
 gb|EMJ19606.1| hypothetical protein PRUPE_ppa011476mg [Prunus persica]
Length=209

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 92/186 (49%), Gaps = 14/186 (8%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y++  +++ L  W+ + A EL  D   F+ +  AP
Sbjct  23   LSLLGHGITDIEIHFLQIKFTAIGVYLDPEVVSHLQQWKTKKANELAEDDDFFDALISAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK L +V+++++ G  +   L+ A+  R+   +ADD+       AL      FQ +  K
Sbjct  83   VEKFLRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKIVEFFQSKYFK  139

Query  290  KGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI--ESANVTSALFDVFL-GRNPVSPSLKA  120
            K + I   +  P        S  T    ++KI  E+ANV   +   +L G   VSPS  +
Sbjct  140  KDSTITFHF--PATSATAEISFHTEGKEESKIKVENANVVENIKKWYLGGTRGVSPSTIS  197

Query  119  SVANGL  102
            S+AN L
Sbjct  198  SLANTL  203



>gb|ACN40662.1| unknown [Picea sitchensis]
Length=214

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 107/203 (53%), Gaps = 8/203 (4%)
 Frame = -3

Query  674  KFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAEL  495
            +F +S++ P    +L L+G G  +     + +K  A G+Y+N  + + L  W+G+S AE+
Sbjct  12   QFPKSIT-PTASKALHLVGYGITDMEIHFLQIKFTAIGIYLNAEVASHLQGWKGKSGAEI  70

Query  494  QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALST  324
              D   F+++  AP++K + +V+++++ G  +   L+ A+  R   I     ++E AL  
Sbjct  71   LADDDFFDSLCGAPVDKFIRVVVIKELKGAQYGLQLENAVRDRLAAIDKFEEEEEEALEK  130

Query  323  FRTIFQGRPLKKGTFIVLTWVDPTKML-VCVSSDATPSSIDAK--IESANVTSALFDVFL  153
                FQG+ LKK + I   +   TK + V   S+    +  AK  +E+ NV + +   +L
Sbjct  131  LVEFFQGKYLKKNSLITYNFSASTKTVEVNFLSEGKEENKLAKTVLENENVAAMIKKWYL  190

Query  152  -GRNPVSPSLKASVANGLEVVLK  87
             G + VS +   ++A+G+  +LK
Sbjct  191  GGSSAVSQNTVKTLADGMAALLK  213



>ref|XP_006842472.1| hypothetical protein AMTR_s00077p00075600 [Amborella trichopoda]
 gb|ERN04147.1| hypothetical protein AMTR_s00077p00075600 [Amborella trichopoda]
Length=216

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 92/183 (50%), Gaps = 8/183 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L LLG G  +     + +K  A G+Y++  ++N L +++G + AEL  D    + + +AP
Sbjct  30   LHLLGHGITDIEIHFLQIKFTAIGIYLDSDVVNHLQSFKGTTGAELAEDDSFSDALIQAP  89

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRI---KSPSADDETALSTFRTIFQGRPLKKGT  282
            +EK   IV+++++ G  +   L+ A+  R+        ++E AL      FQG+  KK +
Sbjct  90   VEKFFRIVVIKEIKGSQYGVQLESAVRDRLAAEDKYEEEEEEALEKLLEFFQGKFFKKNS  149

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDA--KIESANVTSALFDVFL-GRNPVSPSLKASVA  111
              VLT+  P           T    +A  K+E+ NV   L   +L G   VSP+  AS+A
Sbjct  150  --VLTYHFPASSKTAEVGFITEGKEEAKTKVENGNVVEMLQTWYLGGSRAVSPTTMASLA  207

Query  110  NGL  102
            NGL
Sbjct  208  NGL  210



>ref|XP_006850621.1| hypothetical protein AMTR_s00034p00169430 [Amborella trichopoda]
 gb|ERN12202.1| hypothetical protein AMTR_s00034p00169430 [Amborella trichopoda]
Length=221

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 85/191 (45%), Gaps = 15/191 (8%)
 Frame = -3

Query  632  LSLLGTGYR----EKVFAIIGVKVYAAGLYVNESILNKLD-AWRGRSAAELQNDSPLFET  468
            L+L G G R    E VF    VK     LY+ E+ +  L+  W+G+SA EL      F  
Sbjct  33   LALCGAGVRGVEKEGVF----VKFTCTALYMEEAAVYDLEPKWKGKSAEELLASLNFFMD  88

Query  467  IFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIK-----SPSADDETALSTFRTIFQG  303
            I   P EK   + ++  +DGK F   + E     ++     SP      AL  F   F+G
Sbjct  89   IINCPFEKMSHVAMISTLDGKEFSGKVVEKCKAIMEGSGTFSPQ-QSPLALHKFMEAFKG  147

Query  302  RPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLK  123
            + L  G+ I  T+++    +      + P   D  IE   +  AL D  +G + VSP+ K
Sbjct  148  KMLTYGSAIFFTYLEAGLSIAIAEDGSIPDKGDVMIEDKALAQALLDSIIGEHGVSPAAK  207

Query  122  ASVANGLEVVL  90
             SVA  L  VL
Sbjct  208  RSVAERLSEVL  218



>dbj|BAO32071.1| chalcone isomerase Type4 [Antirrhinum majus]
Length=212

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 90/183 (49%), Gaps = 8/183 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y++  I+  L  W+G+ A EL  D  LF+ I  AP
Sbjct  26   LSLLGHGLTDIEIHFLQIKFTAIGVYLDPEIVAHLLKWKGKPATELAEDDDLFDAIISAP  85

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI---FQGRPLKKGT  282
            ++K + +V+++++ G  +   L+ A+  R+      ++        I    Q +  KK +
Sbjct  86   VDKIVRVVVIKEIKGSQYGVQLESAVRDRLADEDKYEDEEEEALEQIIDFLQSKYFKKNS  145

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDAKIE--SANVTSALFDVFL-GRNPVSPSLKASVA  111
              VLT+  P          AT    D+KIE  +ANV   L   +L G   VSP+  AS+A
Sbjct  146  --VLTYYFPATSATAEIIFATEGKEDSKIEVKNANVVDMLKKWYLGGTRGVSPTTIASLA  203

Query  110  NGL  102
             GL
Sbjct  204  TGL  206



>ref|XP_009384766.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=211

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 90/187 (48%), Gaps = 8/187 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y+ + I+  L  W+G+  +EL  D   F+ +  AP
Sbjct  25   LSLLGYGVTDIEIHFLQIKYNAIGIYMEKEIIQHLADWKGKKGSELAEDDVFFDAVVSAP  84

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPLKKGT  282
            +EK   IV+++++ G  +   L+ A+  R   I     ++E AL      FQ +  KK +
Sbjct  85   VEKYFRIVVIKEIKGSQYGVQLESAVRDRLAAIDKYEEEEEEALEKVTEFFQKKYFKKDS  144

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDA--KIESANVTSALFDVFL-GRNPVSPSLKASVA  111
             I   +  P        S AT    +A  K+E+ NV   +   +L G   VSP+   S+A
Sbjct  145  LITFHF--PAASRTAEISFATEGKEEAKVKVENPNVAEMIQKWYLGGTRSVSPTTVKSLA  202

Query  110  NGLEVVL  90
            + L  +L
Sbjct  203  DNLGTML  209



>gb|ACM62743.1| chalcone isomerase [Garcinia mangostana]
Length=209

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 96/203 (47%), Gaps = 11/203 (5%)
 Frame = -3

Query  683  TNVKFQRSLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRG  513
            T V     +S P   T+   LSLLG G  +     + +K+ A G+Y+   +L+ L  W+G
Sbjct  3    TEVVMVDEVSFPPQITTTKPLSLLGHGMTDIEIHFLQIKLTAIGVYLEPEVLSHLQKWKG  62

Query  512  RSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETA  333
            +   EL  +   F+ +  AP+EK L +V+++++ G  +   L+ ++  R+      +E  
Sbjct  63   KPGNELAENDEFFDALIAAPVEKFLRVVIIKEIKGSQYGVQLESSVRDRLAEEDKYEEEE  122

Query  332  LSTFRTI---FQGRPLKKGTFIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSAL  168
                  I   FQ + LKK + I   +    PT  +V  +     S I   +E+ANV   +
Sbjct  123  EEALEKIVEFFQSKYLKKHSVITFHFPVTSPTAEIVVSTEGKEDSKI--LVENANVVEMI  180

Query  167  FDVFL-GRNPVSPSLKASVANGL  102
               +L G   VSPS  + +AN L
Sbjct  181  KRWYLGGTRGVSPSTISCLANAL  203



>ref|XP_009384767.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X2 
[Musa acuminata subsp. malaccensis]
 ref|XP_009384768.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X3 
[Musa acuminata subsp. malaccensis]
Length=209

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 90/187 (48%), Gaps = 8/187 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y+ + I+  L  W+G+  +EL  D   F+ +  AP
Sbjct  23   LSLLGYGVTDIEIHFLQIKYNAIGIYMEKEIIQHLADWKGKKGSELAEDDVFFDAVVSAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPLKKGT  282
            +EK   IV+++++ G  +   L+ A+  R   I     ++E AL      FQ +  KK +
Sbjct  83   VEKYFRIVVIKEIKGSQYGVQLESAVRDRLAAIDKYEEEEEEALEKVTEFFQKKYFKKDS  142

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDA--KIESANVTSALFDVFL-GRNPVSPSLKASVA  111
             I   +  P        S AT    +A  K+E+ NV   +   +L G   VSP+   S+A
Sbjct  143  LITFHF--PAASRTAEISFATEGKEEAKVKVENPNVAEMIQKWYLGGTRSVSPTTVKSLA  200

Query  110  NGLEVVL  90
            + L  +L
Sbjct  201  DNLGTML  207



>gb|ADV71377.1| chalcone isomerase 2 [Pueraria montana var. lobata]
Length=221

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 94/202 (47%), Gaps = 5/202 (2%)
 Frame = -3

Query  677  VKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAA  501
            ++F   ++ PG   S  L G G R        VK    G+Y+ +  ++ L A W+G+SAA
Sbjct  15   LEFPAVVTPPGSTKSYFLGGAGVRGLNIEGEFVKFTGIGVYLEDKAVSSLAAKWKGKSAA  74

Query  500  ELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETAL  330
            EL N    +  I K P EK +    +R +DG  +   + E   A    + + S  +E A+
Sbjct  75   ELLNSLDFYRDIIKGPFEKLIRGSKLRTLDGPEYVRKVSENCVAFMKSVGTYSDAEEKAI  134

Query  329  STFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFL  153
              FR  F+ +    G+ +         + +  S D T P    A I++  ++ A+ +  +
Sbjct  135  GEFRNAFKDQNFPPGSTVFYKQSPTGTLGLSFSKDETIPEHEHAVIDNKPLSEAVLETMI  194

Query  152  GRNPVSPSLKASVANGLEVVLK  87
            G  PVSP+LK S+A    V LK
Sbjct  195  GEIPVSPALKESLATRFYVFLK  216



>gb|AGE10598.1| chalcone isomerase [Lonicera japonica]
Length=208

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/187 (29%), Positives = 95/187 (51%), Gaps = 8/187 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y++  I++ L  W+G++  EL  D   F+++  AP
Sbjct  22   LSLLGHGITDIEIHFLQIKFTAIGVYLDSEIVSHLQKWKGKTGTELAEDDDFFDSLISAP  81

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS---ADDETALSTFRTIFQGRPLKKGT  282
            ++K L +V+++++ G  +   L+ A+  R+ +      ++E AL      FQ +  KK +
Sbjct  82   VDKCLRVVVIKEIKGSQYGVQLESAVRDRLAAADKYEEEEEEALEQLVEFFQSKYFKKDS  141

Query  281  FIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVA  111
             I  T+     T  ++  +     S I  K+E+ NV   +   +L G   VSPS   ++A
Sbjct  142  VITYTFPATSSTAEILFTTGGKEDSKI--KVENENVVEMIKKWYLGGTRGVSPSTITNLA  199

Query  110  NGLEVVL  90
            N L V L
Sbjct  200  NTLSVEL  206



>gb|ABK23299.1| unknown [Picea sitchensis]
Length=214

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 107/203 (53%), Gaps = 8/203 (4%)
 Frame = -3

Query  674  KFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAEL  495
            +F +S++ P    +L L+G G  +     + +K  A G+Y+N  + + L  W+G+S AE+
Sbjct  12   QFPKSIA-PTASKALHLVGYGITDMEIHFLQIKFTAIGIYLNAEVASHLQGWKGKSGAEI  70

Query  494  QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALST  324
              D   F+++  AP++K + +V+++++ G  +   L+ A+  R   I     ++E AL  
Sbjct  71   LADDDFFDSLCGAPVDKFIRVVVIKELKGAQYGLQLENAVRDRLAAIDKFEEEEEEALEK  130

Query  323  FRTIFQGRPLKKGTFIVLTWVDPTKML-VCVSSDATPSSIDAK--IESANVTSALFDVFL  153
                FQG+ LKK + I   +   TK + V   ++    +  AK  +E+ NV + +   +L
Sbjct  131  LVEFFQGKYLKKNSLITYHFSASTKTVEVSFLAEGKEENKLAKTVVENENVAAMIKKWYL  190

Query  152  -GRNPVSPSLKASVANGLEVVLK  87
             G + VS +   ++A+G+  +LK
Sbjct  191  GGSSAVSQNTVKTLADGMAALLK  213



>ref|XP_008233882.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Prunus mume]
Length=209

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 95/194 (49%), Gaps = 16/194 (8%)
 Frame = -3

Query  650  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            P   T+  LSLLG G  +     + +K  A G+Y++  +++ L  W+ + A EL  D   
Sbjct  15   PQITTTKPLSLLGHGITDIEIHFLQIKFTAIGVYLDPEVVSHLQQWKTKQANELAEDDDF  74

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRT  315
            F  +  AP+EK L +V+++++ G  +   L+ A+  R+   +ADD+       AL     
Sbjct  75   FGALISAPVEKFLRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKIVE  131

Query  314  IFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI--ESANVTSALFDVFL-GRN  144
             FQ +  KK + I  T+  P        S  T    ++KI  E+ANV   +   +L G  
Sbjct  132  FFQSKYFKKDSTI--TYHFPATSATAEISFHTEGKEESKIKVENANVVENIKKWYLGGTR  189

Query  143  PVSPSLKASVANGL  102
             VSPS  +S+AN L
Sbjct  190  GVSPSTISSLANTL  203



>gb|AFQ92051.1| chalcone isomerase [Pyrus pyrifolia]
Length=209

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 92/192 (48%), Gaps = 12/192 (6%)
 Frame = -3

Query  650  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            P   T+  LSLLG G  +     + +K  A G+Y++  + + L  W+ + A EL  D   
Sbjct  15   PQITTTKLLSLLGQGITDIEIHFLQIKFTAIGVYLDPEVASHLQQWKAKKADELAEDDDF  74

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRT  315
            F+ +  AP+EK + +V+++++ G  +   L+ A+  R+   +ADD+       AL     
Sbjct  75   FDALISAPVEKFIRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKVVE  131

Query  314  IFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPV  138
             FQ +  KK + I   +   +     V S         K+E+ANV   +   +L G   V
Sbjct  132  FFQSKYFKKDSVITFHFPATSAAAEIVFSTEGKQESKLKVENANVVENIKKWYLGGTRGV  191

Query  137  SPSLKASVANGL  102
            SPS  +S+AN L
Sbjct  192  SPSTISSLANAL  203



>gb|AHZ08832.1| CHI-ACAD [Allium cepa]
Length=210

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 92/188 (49%), Gaps = 8/188 (4%)
 Frame = -3

Query  635  SLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKA  456
            +L LLG G  +     + +K  A G+Y++E +L +L  W+G+   EL ND   F+ I  A
Sbjct  22   ALPLLGCGITDIEIHFLQIKHNAIGIYLDECVLERLSNWKGKKGNELANDDEFFDAIVSA  81

Query  455  PLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI---FQGRPLKKG  285
             +EK + +V+++++ G  F   +  AI  R+ S    ++        I   FQ   LKKG
Sbjct  82   DVEKFIRVVIIKEIKGSQFGLQVGSAIRDRLVSYDKFEDEEDEELEKITEFFQTPYLKKG  141

Query  284  TFIVLTWVDPTKMLVCVSSDATPSSIDAKIE--SANVTSALFDVFL-GRNPVSPSLKASV  114
            +  V+T+  P K      S       + KIE  +ANV   +   ++ G   VSPS   S+
Sbjct  142  S--VITYHFPAKSQTAELSYLVEGKDEMKIEVKNANVVEMIQKWYMGGSRAVSPSTVQSL  199

Query  113  ANGLEVVL  90
            A  L ++L
Sbjct  200  AEKLGLML  207



>ref|XP_002948067.1| hypothetical protein VOLCADRAFT_103700 [Volvox carteri f. nagariensis]
 gb|EFJ51055.1| hypothetical protein VOLCADRAFT_103700 [Volvox carteri f. nagariensis]
Length=260

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 86/188 (46%), Gaps = 15/188 (8%)
 Frame = -3

Query  623  LGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEK  444
            LG   R K    + VKVY+   YV      K    R R     + D      I      K
Sbjct  68   LGAATRSKQIVFVNVKVYSVAAYVEADRAAKELGIRERGGF-FETDDDYCSAILDGAFNK  126

Query  443  SLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTW  264
             L++ LVRDV G+ F +A++++++PR++   A D  +L  F   F  + L   T ++L W
Sbjct  127  VLALHLVRDVTGEQFTEAINKSLAPRMQ--LAGDTASLDKFNAFFSSKNLVNNTEVLLLW  184

Query  263  VDPTKMLVCVS---------SDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVA  111
                 + V V+           ATP   + +I S  ++  LF++FLG +PV P  +A   
Sbjct  185  SMAGDLEVLVTPPVTAPQEYGQATP---ELRISSPALSRGLFEIFLGSSPVVPEARAEWV  241

Query  110  NGLEVVLK  87
             G + +L+
Sbjct  242  KGAKTLLE  249



>ref|XP_010481171.1| PREDICTED: fatty-acid-binding protein 3-like [Camelina sativa]
Length=133

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -3

Query  731  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIG  582
            +++SSVGNAE Y EE  T+VKFQRS++LPGC + LSLLGTG+REK FAIIG
Sbjct  74   SAASSVGNAEDYAEETATSVKFQRSVTLPGCSSPLSLLGTGFREKKFAIIG  124



>gb|ACB37367.1| chalcone isomerase 2 [Glycine max]
Length=212

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/193 (28%), Positives = 89/193 (46%), Gaps = 5/193 (3%)
 Frame = -3

Query  650  PGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAELQNDSPLF  474
            PG   S  L G G R        VK    G+Y+ +  ++ L A W+G+SAAEL +    +
Sbjct  10   PGSTKSYFLGGAGVRGLNIQEEFVKFTGIGVYLEDKAVSSLGAKWKGKSAAELLDSLDFY  69

Query  473  ETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSP---SADDETALSTFRTIFQG  303
              I K P EK +    +R +DG+ +   + E     ++S    S ++E A+  FR  F+ 
Sbjct  70   RDIIKGPFEKLIRGSKLRTLDGREYVRKVSENCVAHMQSVGTYSDEEEKAIEEFRNAFKD  129

Query  302  RPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFLGRNPVSPSL  126
            +    G+ +         + +  S D T P    A I++  ++ A+ +  +G  PVSP+L
Sbjct  130  QNFPPGSTVFYKQSPTGTLGLSFSKDETIPEHEHAVIDNKPLSEAVLETMIGEIPVSPAL  189

Query  125  KASVANGLEVVLK  87
            K S+A       K
Sbjct  190  KESLATRFHQFFK  202



>ref|XP_010063418.1| PREDICTED: chalcone--flavonone isomerase-like [Eucalyptus grandis]
 ref|XP_010063419.1| PREDICTED: chalcone--flavonone isomerase-like [Eucalyptus grandis]
 gb|KCW70646.1| hypothetical protein EUGRSUZ_F03816 [Eucalyptus grandis]
Length=243

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 97/203 (48%), Gaps = 5/203 (2%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA  504
            +VKF  S+  PG    L L G G R        +K  A G+Y+ ++ L  L A W G+SA
Sbjct  16   SVKFPPSIKPPGSAKILFLGGAGARGLEIQGKFIKFTAIGVYLEDAALPSLAAKWSGKSA  75

Query  503  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSA--DDE-TA  333
             EL +    F  +   P EK   + ++  + G  + + + E      +S     D E  A
Sbjct  76   EELADSVEFFRDVVTGPFEKFSRVTMILPLTGAQYAEKVTENCVKYWQSVGTYTDAEAVA  135

Query  332  LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVF  156
            +  FR +F+ +    G  I+ T      + + +S D + P + +  IE+  +T A+F+  
Sbjct  136  VEKFREVFKDQSFPPGASILFTLSPNGSLTIALSEDGSVPEASNTVIENRQLTEAIFESM  195

Query  155  LGRNPVSPSLKASVANGLEVVLK  87
            +G++ VSP  K S+A+ +  +LK
Sbjct  196  IGKHGVSPEAKTSLASRISELLK  218



>dbj|BAJ10400.1| enhancer of flavonoid production [Petunia x hybrida]
Length=210

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 93/183 (51%), Gaps = 8/183 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L L+G G  +     + +K  A G+Y++  I+  L  W+G+S AEL  +   FE I  AP
Sbjct  24   LPLMGHGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQWKGKSGAELIENDEFFEAIVNAP  83

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPLKKGT  282
            ++K L +V+++++ G  +   L+ A+  R   +     ++E AL      FQ +  KK +
Sbjct  84   VDKFLRVVVIKEIKGSQYGVQLESAVRDRLAEVDKYEEEEEEALEKIVEFFQSKYFKKDS  143

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDAKIE--SANVTSALFDVFL-GRNPVSPSLKASVA  111
              V+T+  P        S AT    D++IE  +ANV   +   +L G   +SP+  +S+A
Sbjct  144  --VVTYSFPATSGNVKISFATEGKEDSEIEVQNANVAGEIKKWYLGGSRGLSPTTISSLA  201

Query  110  NGL  102
            N L
Sbjct  202  NTL  204



>ref|XP_010321455.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Solanum 
lycopersicum]
Length=210

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 91/185 (49%), Gaps = 4/185 (2%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L L+G G  +     + +K  A G+Y++  I+  L  W+G++ AEL  +   FE I  AP
Sbjct  24   LPLMGHGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQWKGKTGAELTENDEFFEAIVNAP  83

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPLKKGT  282
            ++K L +V+++++ G  +   L+ AI  R   +     ++E AL      FQ +  KK +
Sbjct  84   VDKFLRVVVIKEIKGSQYGVQLESAIRDRLAEVDKYEEEEEEALEKIVEFFQSKYFKKDS  143

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVANG  105
             I   +   +       +      ++ ++E+ANV   +   +L G   VSP+  +S+AN 
Sbjct  144  VITYYFPGASGSAKISFAIEGKEDLEIEVENANVVEMMKKWYLGGTRGVSPTTISSLANN  203

Query  104  LEVVL  90
            + V L
Sbjct  204  ICVEL  208



>ref|NP_001236755.1| chalcone--flavonone isomerase 1B-1 [Glycine max]
 sp|Q53B75.1|CF1B1_SOYBN RecName: Full=Chalcone--flavonone isomerase 1B-1; Short=Chalcone 
isomerase 1B-1 [Glycine max]
 gb|AAT94359.1| chalcone isomerase 1B1 [Glycine max]
 gb|ACU19885.1| unknown [Glycine max]
 gb|KHN20295.1| Chalcone--flavonone isomerase 1B-1 [Glycine soja]
Length=226

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 96/203 (47%), Gaps = 7/203 (3%)
 Frame = -3

Query  677  VKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAA  501
            ++F   ++ PG   S  L G G R        VK    G+Y+ +  ++ L A W+G+SAA
Sbjct  15   LQFPALVTPPGSTKSYFLGGAGVRGLNIQEEFVKFTGIGVYLEDKAVSSLAAKWKGKSAA  74

Query  500  ELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSP---SADDETAL  330
            EL +    +  I K P EK +    +R +DG+ +   + E     ++S    S ++E A+
Sbjct  75   ELLDSLDFYRDIIKGPFEKLIRGSKLRTLDGREYVRKVSENCVAHMQSVGTYSDEEEKAI  134

Query  329  STFRTIFQGRPLKKGTFIVLTWVDPTKML-VCVSSDAT-PSSIDAKIESANVTSALFDVF  156
              FR  F+ +    G+  V     PT  L +  S D T P    A I++  ++ A+ +  
Sbjct  135  EEFRNAFKDQNFPPGS-TVFYKQSPTGTLGLSFSKDETIPEHEHAVIDNKPLSEAVLETM  193

Query  155  LGRNPVSPSLKASVANGLEVVLK  87
            +G  PVSP+LK S+A       K
Sbjct  194  IGEIPVSPALKESLATRFHQFFK  216



>sp|A7ISP5.1|CFI2B_SOYBN RecName: Full=Chalcone--flavonone isomerase 2-B; Short=Chalcone 
isomerase 2-B [Glycine max]
 gb|ABA86741.1| chalcone isomerase 2 [Glycine max]
 gb|ABA86743.1| chalcone isomerase 2 [Glycine max]
Length=227

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 96/204 (47%), Gaps = 8/204 (4%)
 Frame = -3

Query  677  VKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAA  501
            ++F   ++ PG   S  L G G R        VK    G+Y+ +  ++ L A W+G+SAA
Sbjct  15   LQFPALVTPPGSTKSYFLGGAGVRGLNIQEEFVKFTGIGVYLEDKAVSSLAAKWKGKSAA  74

Query  500  ELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSP---SADDETAL  330
            EL +    +  I K P EK +    +R +DG+ +   + E     ++S    S ++E A+
Sbjct  75   ELLDSLDFYRDIIKGPFEKLIRGSKLRTLDGREYVRKVSENCVAHMQSVGTYSDEEEKAI  134

Query  329  STFRTIFQGRPLKKGTFIVLTWVDPTKML--VCVSSDAT-PSSIDAKIESANVTSALFDV  159
              FR  F+ +    G+  V     PT  L  +  S D T P    A I++  ++ A+ + 
Sbjct  135  EEFRNAFKDQNFPPGS-TVFYKQSPTGTLGQLIFSKDETIPEHEHAVIDNKPLSEAVLET  193

Query  158  FLGRNPVSPSLKASVANGLEVVLK  87
             +G  PVSP+LK S+A       K
Sbjct  194  MIGEIPVSPALKESLATRFHQFFK  217



>ref|XP_011027080.1| PREDICTED: chalcone--flavonone isomerase-like [Populus euphratica]
Length=223

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 98/203 (48%), Gaps = 5/203 (2%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA  504
            NV F  ++  P    +L L G G R        +K  A G+Y+ ++ L  L A W+G+SA
Sbjct  14   NVTFPPAVKPPASNNTLFLGGAGVRGLEIEGKFIKFTAIGVYLEDNSLQSLAAKWKGKSA  73

Query  503  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS--ADDET-A  333
             EL +    F  I + P EK + + ++  + G  F + + E      KS     D E  A
Sbjct  74   QELTDSVEFFRDIVRGPFEKFMRVTMILPLTGLQFSEKVAENCVNIWKSLGIYTDAEAKA  133

Query  332  LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVF  156
            +  F+ +F+      G+ I+ T      + +  S D + P + +A IE+  ++ A+ +  
Sbjct  134  IEKFQQVFKEETFPPGSSILFTLSTHGSLAISFSKDGSVPETENAVIENKLLSEAVLESM  193

Query  155  LGRNPVSPSLKASVANGLEVVLK  87
            +G++ VSP+ K S+A  L  +LK
Sbjct  194  IGKHGVSPAAKQSLATTLSELLK  216



>ref|XP_004497328.1| PREDICTED: chalcone--flavonone isomerase 2-like [Cicer arietinum]
Length=227

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 100/206 (49%), Gaps = 9/206 (4%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL-DAWRGRSA  504
            N+ F  ++  PG C +L L G G R        VK  A  +Y+  + +  L D W+G+SA
Sbjct  13   NIVFPPTVKPPGSCDTLFLGGAGVRGLQIHDKFVKFTAIAIYLQYTSIPFLADKWKGKSA  72

Query  503  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA  333
             EL    P F  I   P EK + + ++  + G+ + + + E   AI   +   + ++  A
Sbjct  73   TELTETVPFFRDIVTGPFEKFMQVTMILPLTGQQYSEKVSENCVAIWKSLGIYTDEEAKA  132

Query  332  LSTFRTIFQGRPLKKGTFIVLTWVDPT---KMLVCVSSDAT-PSSIDAKIESANVTSALF  165
            +  F ++F+ +    G+ I+ T V P     + +  S D + P    A IE+  ++ A+ 
Sbjct  133  IEKFLSVFKDQTFPSGSSILFT-VSPKGAGSLTISFSKDGSIPEVESAVIENKLLSEAVL  191

Query  164  DVFLGRNPVSPSLKASVANGLEVVLK  87
            +  +G + VSP+ K S+A+ L  + K
Sbjct  192  ESMIGAHGVSPAAKQSLASRLSELFK  217



>ref|XP_002980623.1| hypothetical protein SELMODRAFT_444624 [Selaginella moellendorffii]
 gb|EFJ18274.1| hypothetical protein SELMODRAFT_444624 [Selaginella moellendorffii]
Length=216

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 95/204 (47%), Gaps = 12/204 (6%)
 Frame = -3

Query  674  KFQRSLSLPGCCTSLSLLGTGYRE-KVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAA  501
            +F   L+ P    SL L G G R  ++   + + V   G Y  + IL  L   W G+S +
Sbjct  16   QFPPGLTSPVSQKSLFLAGAGVRSIQINPQVTITVTVLGFYFEDGILKHLSGKWSGKSGS  75

Query  500  ELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETAL  330
            EL+ +   F  I  AP EK  S+ +++ + G  F   + E    +     S   D+E A+
Sbjct  76   ELEKEDDFFTDIINAPSEKIFSVTMLKPLPGTEFSKKVMENTKQVLAESNSLGEDEEKAI  135

Query  329  STFRTIFQGRPLKKGT--FIVLTWVDPTKMLVCVSSDATPSS--IDAKIESANVTSALFD  162
              F  +F+ + LK G   F V +    + + V  +    PS+  I + I +    +AL  
Sbjct  136  EEFSKLFEDQALKPGMGPFYVSSS---SGLGVGFTDPDEPSNLKISSSIGNVKFANALLS  192

Query  161  VFLGRNPVSPSLKASVANGLEVVL  90
              +G+NPVSP+ KA +A  L  +L
Sbjct  193  TMIGKNPVSPASKACIAQRLSALL  216



>ref|XP_010252061.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Nelumbo 
nucifera]
Length=209

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 92/183 (50%), Gaps = 8/183 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSL+G G  +     + +K  A G+Y++  I++ L  W+G+S  EL  +   F+ +  AP
Sbjct  23   LSLIGHGITDIEIHFLQIKFTAIGVYLDPEIVSHLQQWKGKSGNELAKNDDFFDALISAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPLKKGT  282
            ++K + +V+++++ G  +   L+ A+  R   +     ++E AL      FQ +  KK +
Sbjct  83   VDKLVRVVVIKEIKGSQYGVQLESAVRDRLAEVDKYEEEEEEALEKLIQFFQSKYFKKHS  142

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDAKI--ESANVTSALFDVFL-GRNPVSPSLKASVA  111
              V+T+  P        S  T    +AKI  E+ANVT  L   +L G + VS +    +A
Sbjct  143  --VITYTFPATSATAEISFVTEGKEEAKIKVENANVTEMLKKWYLGGSSGVSATTITCLA  200

Query  110  NGL  102
            N L
Sbjct  201  NNL  203



>ref|XP_005704170.1| chalcone isomerase [Galdieria sulphuraria]
 gb|EME27650.1| chalcone isomerase [Galdieria sulphuraria]
Length=324

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 64/231 (28%), Positives = 102/231 (44%), Gaps = 37/231 (16%)
 Frame = -3

Query  725  SSSVGNAEYVEEPTTNVKFQRSLSL--PGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYV  552
            S  +  AE +EEPTT V+F + L +   G      LLG G R      + VKVY+ G+YV
Sbjct  99   SEQLKEAEEIEEPTTQVRFPKWLEVMESGVLKRQRLLGAGPR--FMTPLRVKVYSVGVYV  156

Query  551  NES----ILNKLDAWRGRSAAELQNDSPLFETIF---------KAPLEKSLSIVLVRDVD  411
            +E     +L+  D     +  +L+ D   + T           K    K+  +V +R+V 
Sbjct  157  DEKEARPVLSGFDY---SNPEQLEGDERFWSTFCIPRSIPGEGKKGFGKTFRLVCIREVA  213

Query  410  GKTFWDALDEAISPRIKSPSA-----DDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKM  246
            GK   +  D  +  R++         D + AL  F   F    L+KG+  V        +
Sbjct  214  GKHMQNGFDRGLLKRVRDAEKKMNMPDGKQALKKFNGFF----LEKGSMAV----GCELL  265

Query  245  LVCVSSDATPSSIDA----KIESANVTSALFDVFLGRNPVSPSLKASVANG  105
             VC ++    + ID     ++++  +  AL D+FLG  PVS  +K   +NG
Sbjct  266  FVCSANGTVDTWIDGVHYGQVKNDALCWALSDMFLGMKPVSKEIKQQTSNG  316



>ref|XP_006348611.1| PREDICTED: chalcone--flavonone isomerase-like isoform X1 [Solanum 
tuberosum]
Length=246

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 89/192 (46%), Gaps = 5/192 (3%)
 Frame = -3

Query  650  PGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL-DAWRGRSAAELQNDSPLF  474
            PG   +  L G G R        VK  A G+Y+ ES +  L D W+G+S+ EL++    F
Sbjct  22   PGSNNTFFLAGAGNRGLEIEGKFVKFTAIGVYLEESAIPFLADKWKGKSSEELEHSVEFF  81

Query  473  ETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETALSTFRTIFQG  303
              I   P EK   + ++  + GK + + + E   A    I + S  +  A+  F  +FQ 
Sbjct  82   RDIVTGPFEKFTRVTMILPLTGKQYSEKVAENCVAYWKAIGTYSDAEREAIEKFLNVFQS  141

Query  302  RPLKKGTFIVLTWVDPTKMLVCVSS-DATPSSIDAKIESANVTSALFDVFLGRNPVSPSL  126
                 G  I+ T      + +  S  D+ P   +A IE+  ++ A+ D  +G + VSP+ 
Sbjct  142  ETFPPGASIIFTQSPLGSLTISFSKDDSVPCVGNAVIENKQLSEAVLDSIIGEHGVSPAA  201

Query  125  KASVANGLEVVL  90
            K S+A  +  +L
Sbjct  202  KCSIAKRVSELL  213



>ref|XP_007159893.1| hypothetical protein PHAVU_002G276500g [Phaseolus vulgaris]
 gb|ESW31887.1| hypothetical protein PHAVU_002G276500g [Phaseolus vulgaris]
Length=265

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/203 (27%), Positives = 96/203 (47%), Gaps = 5/203 (2%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA  504
            NV F  +++ P   T+  L G G R        VK  A G+Y+  + +  L   W G+SA
Sbjct  54   NVTFPPTVNPPSSATAFFLAGAGVRGLQIQDNFVKFTAIGVYLQPNAVPLLSVKWNGKSA  113

Query  503  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA  333
             EL +    F  I   P EK + + ++  + G+ + + + E   AI   +   +  +  A
Sbjct  114  PELTDSVEFFRDIITGPFEKFMQVTMILPLTGQQYSEKVSENCVAIWKSLGIYTEAEAEA  173

Query  332  LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSD-ATPSSIDAKIESANVTSALFDVF  156
            +  F +IF+      G+ I+ T +    +L+  S D A P      IE+  ++ A+ +  
Sbjct  174  IDKFVSIFKDETFPPGSSILFTVLPKGSLLISFSKDGAIPEEASTVIENKLLSEAVLESM  233

Query  155  LGRNPVSPSLKASVANGLEVVLK  87
            +G++ VSP+ K S+A+ L  + K
Sbjct  234  IGKHGVSPAAKQSLASRLSELFK  256



>gb|KDP21650.1| hypothetical protein JCGZ_03321 [Jatropha curcas]
Length=214

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 89/186 (48%), Gaps = 14/186 (8%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y++  I+  L  W+G+    L  D   FE +  AP
Sbjct  28   LSLLGHGITDIEIHFLQIKFTAIGVYLDPEIVGHLQQWKGKPGNHLAEDDDFFEALIAAP  87

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK L +V+++++ G  +   L+ A+  R+   +ADD+       AL      FQ +  K
Sbjct  88   VEKFLRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKVVEFFQSKYFK  144

Query  290  KGTFIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKA  120
            K + I   +    PT  +   +     S +  K+E+ANV   +   +L G   VS +   
Sbjct  145  KDSIITFHFPATSPTAEIAFSTEGKEESKL--KVENANVVEMIKKWYLGGTRGVSATTIT  202

Query  119  SVANGL  102
            S+AN L
Sbjct  203  SLANTL  208



>gb|ACN60401.1| chalcone isomerase, partial [Capsicum annuum]
Length=226

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 93/193 (48%), Gaps = 5/193 (3%)
 Frame = -3

Query  650  PGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAELQNDSPLF  474
            PG  T+L L G G R        VK  A G+Y+ ES +  L A W+G+S+ EL +    F
Sbjct  16   PGSNTTLFLAGAGIRGVDIEGKFVKCTAIGVYMEESAVPFLAAKWKGKSSKELTDSVEFF  75

Query  473  ETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKS--PSADDET-ALSTFRTIFQG  303
              I   P EK   + ++  + GK + + + E      K+     D E+ A+  F + FQ 
Sbjct  76   RDIVTGPFEKFFRVTMITPLTGKQYSEKVAENCVANWKALGTYGDAESEAIEKFLSAFQS  135

Query  302  RPLKKGTFIVLTWVDPTKMLVCVSS-DATPSSIDAKIESANVTSALFDVFLGRNPVSPSL  126
                 G  I+ T      + +  S  D+ P + +A IE+  ++ A+ +  +G++ VSP+ 
Sbjct  136  ENFPPGASILFTQSPAGSLTISFSKDDSVPGTGNAVIENKQLSEAVLESIIGKHGVSPAA  195

Query  125  KASVANGLEVVLK  87
            K S+A  +  +LK
Sbjct  196  KNSLAKRVSELLK  208



>ref|XP_005843375.1| hypothetical protein CHLNCDRAFT_55230 [Chlorella variabilis]
 gb|EFN51273.1| hypothetical protein CHLNCDRAFT_55230 [Chlorella variabilis]
Length=231

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 88/197 (45%), Gaps = 35/197 (18%)
 Frame = -3

Query  629  SLLGTGYREKVFAIIGVK---VYAAGLYVNESILNKL--DAWRGRSAAELQNDSPLF---  474
            ++ G G R K   I GVK   +YA GL+V+ S +       +RG   A L  D  LF   
Sbjct  43   AIAGAGARTK--RIAGVKNLDIYALGLFVDPSAVRGALQGKFRGADPASLAKDQKLFDGS  100

Query  473  --------ETIFKAPLEKSLSIVLVRD-VDGKTFWDALDEAISPRIKSPSADDETALSTF  321
                    E +    +EK+L IV+    V  + F +AL+E + P +K   A +  AL  F
Sbjct  101  DCTRLSAAELVSHEGIEKTLRIVITSGMVKQRPFLEALEERLEPPLKQ--AGELEALQRF  158

Query  320  RTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAK----IESANVTSALFDVFL  153
            +  F G P ++G  I            C S     ++ID K    I S  +T AL D++L
Sbjct  159  KRQFDGAPFRRGLQITF----------CASGTKLTTTIDGKQVGTIASRQLTRALLDIYL  208

Query  152  GRNPVSPSLKASVANGL  102
            G NP S   K S   GL
Sbjct  209  GTNPASKGAKDSFGRGL  225



>emb|CDP13908.1| unnamed protein product [Coffea canephora]
Length=244

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/194 (29%), Positives = 93/194 (48%), Gaps = 17/194 (9%)
 Frame = -3

Query  650  PGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFE  471
            P     LSLLG G  +     + +K  A G+Y++  I+  L  W+G+   +L  D   FE
Sbjct  50   PSTTKPLSLLGHGITDIEIHFLQIKFTAIGVYMDSEIVTYLQQWKGKKCTDLAEDDDFFE  109

Query  470  TIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIF  309
             I  AP++K L IV+++++ G  +   L+ A+  R+   +ADD        AL      F
Sbjct  110  AIISAPVDKFLRIVVIKEIKGSQYGVQLESAVRDRL---AADDRYEDEEEAALEELIEFF  166

Query  308  QGRPLKKGTFIVLTWVDP----TKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRN  144
            Q +  KK +  +LT+  P        +  +++    S   K+E+ANV   +   +L G  
Sbjct  167  QPKYFKKDS--ILTYYFPAGSSASAEIAFTTEGKEES-KIKVENANVVETIKKWYLGGTR  223

Query  143  PVSPSLKASVANGL  102
             VS +  +S+AN L
Sbjct  224  GVSQTTISSLANTL  237



>ref|XP_002325926.1| hypothetical protein POPTR_0019s08610g [Populus trichocarpa]
 gb|ABK96098.1| unknown [Populus trichocarpa]
 gb|EEF00308.1| hypothetical protein POPTR_0019s08610g [Populus trichocarpa]
Length=210

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 87/183 (48%), Gaps = 12/183 (7%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y+   I+  L  W+G+   EL  +   FE +  AP
Sbjct  24   LSLLGHGITDIEIHFLQIKFTAIGVYLEPKIVGHLQQWKGKPGNELAENDDFFEALIAAP  83

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD-----ETALSTFRTIFQGRPLKK  288
            +EK L +V+++++ G  +   L+  +  R+    AD      E AL      FQ + +KK
Sbjct  84   VEKFLRVVVIKEIKGSQYGVQLESVVRDRL--ADADKYEEEEEEALEKIVEFFQSKYMKK  141

Query  287  GTFIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKAS  117
             + I   +    PT  +   +     S I  K+E+ANV   +   +L G   VS +  +S
Sbjct  142  NSIITFYFPSTSPTAEIGFATEGKEESKI--KVENANVVEMIKKWYLGGTRGVSATTISS  199

Query  116  VAN  108
            +AN
Sbjct  200  LAN  202



>ref|XP_010670602.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Beta vulgaris 
subsp. vulgaris]
Length=207

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 84/181 (46%), Gaps = 5/181 (3%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSL G G  E     + +K  A G+Y+ + ++  L  W+G+S  EL +D   F+ +  AP
Sbjct  22   LSLFGYGCTELEIHYLQIKFTAIGVYLEKEVVQHLQKWKGKSGKELADDDEFFDALAAAP  81

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPLKKGT  282
            +E  +  V+++++        L+ ++  R   I     ++E AL      F  + LKK +
Sbjct  82   VESVIKAVVIKEIKASQLGTQLEGSVRDRLAAIDKYEDEEEVALEKVAEFFPTKYLKKNS  141

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVANG  105
            +   ++       + +++D    S    +E+ NV   +   +L G   V+PS    +AN 
Sbjct  142  YFTFSFFASGTAEIAITTDEKEES-KTTVENKNVVEMIKKWYLGGSRSVTPSTIECLANT  200

Query  104  L  102
            L
Sbjct  201  L  201



>emb|CBJ33403.1| Similar to Chalcone Isomerase [Ectocarpus siliculosus]
Length=229

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 87/205 (42%), Gaps = 12/205 (6%)
 Frame = -3

Query  698  VEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNK-LDA  522
            V +P T +   R+       T L  LG G R K  A + V VY  GLYV      K L +
Sbjct  33   VRDPATGLVLPRTKQFASSKTGLVCLGVGVRVKSVAFVNVNVYTVGLYVEPKGARKALKS  92

Query  521  WRGRSAAELQNDSPLFETIFKA-PLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSAD  345
            + GR   EL  D  ++  +  A    K L +V  R V  +   DA        +K  + D
Sbjct  93   YAGRDPEELSKDKSVYRVLGGAGDFSKYLHLVFARSVGAQKVVDAFTA-----VKGVNQD  147

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALF  165
                 S+      G+ + +   + L W    +++V V      S ID  +      +++F
Sbjct  148  VLDKFSSLTMEGVGKSINREESVTLGWEGKDRLVVLVRDKEIGSVIDESLP-----ASVF  202

Query  164  DVFLGRNPVSPSLKASVANGLEVVL  90
            ++FLG +PVSP  K + A G+   L
Sbjct  203  NLFLGSDPVSPVAKTAFAEGVPAFL  227



>gb|AHA61355.1| chalcone isomerase [Phyllanthus emblica]
Length=209

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 87/183 (48%), Gaps = 8/183 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSL+G G  +     + +K  A G+Y+   I+N L  W G+S  ELQ D   F  +  AP
Sbjct  23   LSLVGHGITDIEIHFLQIKFTAIGVYLEPEIVNHLQKWNGKSGNELQEDDDFFAALIDAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRT---IFQGRPLKKGT  282
            +EK L +V+++++ G  +   L+ A+  R+      +E   +        FQ +  KK +
Sbjct  83   VEKFLRVVVIKEIKGSQYGVQLESAVRDRLAEDDKYEEEEEAALEKLVEFFQSKYFKKDS  142

Query  281  FIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVA  111
             I   +    P+  +V  +     S I   +E+ANV   +   +L G   +S +  +S+A
Sbjct  143  IITFHFPGTSPSAEIVFSTEGKEDSKI--TVENANVVEMIKKWYLGGTRGLSATTISSLA  200

Query  110  NGL  102
            N L
Sbjct  201  NNL  203



>emb|CBI25366.3| unnamed protein product [Vitis vinifera]
Length=218

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 89/186 (48%), Gaps = 14/186 (8%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L LLG G  +     + +K  A G+Y+   I+  L  W+G+S  EL  +   FE +  AP
Sbjct  32   LCLLGYGITDIEIHFLQIKFTAIGVYLEPEIVGHLQPWKGKSGKELAENDDFFEALISAP  91

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
             EK L IV+++++ G  +   L+ A+  R+   +ADD+       AL      FQ +  K
Sbjct  92   GEKFLRIVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKVVEFFQSKYFK  148

Query  290  KGTFIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKA  120
            K + I   +     T  +V  +     S I   +E+ANV   +   +L G   VSP+  +
Sbjct  149  KDSIITFHFPATSCTAEIVFATEGKEESKIT--VENANVVEMIKKWYLGGTRGVSPTTIS  206

Query  119  SVANGL  102
            ++AN L
Sbjct  207  ALANTL  212



>emb|CAN70349.1| hypothetical protein VITISV_012581 [Vitis vinifera]
Length=205

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 89/186 (48%), Gaps = 14/186 (8%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L LLG G  +     + +K  A G+Y+   I+  L  W+G+S  EL  +   FE +  AP
Sbjct  19   LCLLGYGITDIEIHFLQIKFTAIGVYLEPEIVGHLQPWKGKSGKELAENDDFFEALISAP  78

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
             EK L IV+++++ G  +   L+ A+  R+   +ADD+       AL      FQ +  K
Sbjct  79   GEKFLRIVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKVVEFFQSKYFK  135

Query  290  KGTFIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKA  120
            K + I   +     T  +V  +     S I   +E+ANV   +   +L G   VSP+  +
Sbjct  136  KDSIITFHFPATSCTAEIVFATEGKEESKIT--VENANVVEMIKKWYLGGTRGVSPTTIS  193

Query  119  SVANGL  102
            ++AN L
Sbjct  194  ALANTL  199



>ref|XP_002280158.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Vitis vinifera]
Length=209

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 89/186 (48%), Gaps = 14/186 (8%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L LLG G  +     + +K  A G+Y+   I+  L  W+G+S  EL  +   FE +  AP
Sbjct  23   LCLLGYGITDIEIHFLQIKFTAIGVYLEPEIVGHLQPWKGKSGKELAENDDFFEALISAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
             EK L IV+++++ G  +   L+ A+  R+   +ADD+       AL      FQ +  K
Sbjct  83   GEKFLRIVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKVVEFFQSKYFK  139

Query  290  KGTFIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKA  120
            K + I   +     T  +V  +     S I   +E+ANV   +   +L G   VSP+  +
Sbjct  140  KDSIITFHFPATSCTAEIVFATEGKEESKIT--VENANVVEMIKKWYLGGTRGVSPTTIS  197

Query  119  SVANGL  102
            ++AN L
Sbjct  198  ALANTL  203



>ref|XP_011084819.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Sesamum 
indicum]
Length=213

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = -3

Query  656  SLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  477
            SL      LSLLG G  +     + +K  A G+Y++  I++ L  W+G+SAAEL  D   
Sbjct  17   SLVNVTKPLSLLGHGITDIEIHFLQIKFTAIGVYLDPQIVSHLHKWKGKSAAELTQDHHF  76

Query  476  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRI  363
            F+TI  AP++K + +V+++++ G  F   ++ A+  R+
Sbjct  77   FQTIISAPVDKLVRVVVIKEIKGSQFGVQIESAVRDRL  114



>sp|Q3Y4F4.1|CFI_CANGE RecName: Full=Chalcone--flavonone isomerase; Short=Chalcone isomerase 
[Canna x generalis]
 gb|AAZ80910.1| chalcone isomerase [Canna x generalis]
Length=226

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/204 (27%), Positives = 96/204 (47%), Gaps = 6/204 (3%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLD-AWRGRSA  504
             V F  + + PG  +SL L G G R        V   A G+Y+ +  ++ L   W+G++A
Sbjct  15   EVTFPPAAAPPGSSSSLFLAGAGERGLEIDRQFVVFTAIGVYLEDLAVSTLGPKWKGKTA  74

Query  503  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE---TA  333
             +L  +S  F  IF  P EK   I +V+ + G+ + + ++E      K+     E    A
Sbjct  75   DDLAGNSDFFRDIFTGPFEKFTRITMVKPLSGQQYSEKVEENCVAHWKAAGTYTEAEAAA  134

Query  332  LSTFRTIFQGRPLKKGTFIVLT-WVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDV  159
            +  F+   +      GT I+ T  V P  + +    + + P + +  IES  ++ A+ + 
Sbjct  135  VEKFKEACKNETFPPGTSILFTHQVSPASLTITFWREGSMPETGNTVIESKALSEAILES  194

Query  158  FLGRNPVSPSLKASVANGLEVVLK  87
             +G++ VSP  K SVA  L  +L+
Sbjct  195  IIGKHGVSPGAKRSVAQRLSEILE  218



>gb|AGV53050.1| chalcone isomerase [Actinidia chinensis]
Length=210

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 93/186 (50%), Gaps = 14/186 (8%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y++  I+  L  W+G++  +L  D   FE +  AP
Sbjct  24   LSLLGHGIADIEIHFLQIKFTAIGVYLDCEIVGHLQQWKGKTGKDLAEDDDFFEALVSAP  83

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK L +V++++V G  +   L+ A+  R+   +ADD+       AL      FQ +  K
Sbjct  84   VEKFLRVVVIKEVKGSQYGVQLESAVRDRL---AADDKYEEEEEAALELVVEFFQSKYFK  140

Query  290  KGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI--ESANVTSALFDVFL-GRNPVSPSLKA  120
            K +  V+T+  P        + +T    ++KI  E+ANV   +   +L G   VSPS  +
Sbjct  141  KDS--VITFHFPASSGTAEIAFSTEGKGESKICVENANVVEMIKKWYLGGTRGVSPSTIS  198

Query  119  SVANGL  102
             +A  L
Sbjct  199  CLATTL  204



>ref|XP_008809461.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Phoenix 
dactylifera]
Length=192

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 83/169 (49%), Gaps = 6/169 (4%)
 Frame = -3

Query  581  VKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKT  402
            +K  A G+Y+ ++I+  L  W+G+  AEL  D   FE +  AP++K   IV+++++ G  
Sbjct  23   IKYNAIGIYMEKNIIEHLGNWKGKKGAELAEDDTFFEALVAAPVDKFFRIVVIKEIKGSQ  82

Query  401  FWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPLKKGTFIVLTW-VDPTKMLVCV  234
            +   L+ A+  R   I     ++E AL      FQ +  KK + I   +   P  + +  
Sbjct  83   YGVQLESAVRDRLAAIDKYEEEEEEALEKVSAFFQSKYFKKDSVITFNFPASPRTVEISF  142

Query  233  SSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVANGLEVVL  90
             ++    +   K+E+ANV   +   +L G   VSP+   S+A  +  +L
Sbjct  143  VTEGKEET-KIKVENANVVEMIQKWYLGGSRAVSPTTVKSLAENIGTML  190



>ref|XP_006365329.1| PREDICTED: probable chalcone--flavonone isomerase 3-like [Solanum 
tuberosum]
Length=210

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 93/189 (49%), Gaps = 12/189 (6%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L L+G G  +     + +K  A G+Y++  I+  L  W+G++  EL  +   FE I  AP
Sbjct  24   LPLMGHGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQWKGKTGEELTENDEFFEAIVNAP  83

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI---FQGRPLKKGT  282
            ++K L +V+++++ G  +   L+ AI  R+      +E        I   FQ +  KK +
Sbjct  84   VDKFLRVVVIKEIKGSQYGVQLESAIRDRLAEVDKYEEDEEEALEKIVEFFQSKYFKKDS  143

Query  281  FIVLTWVDP----TKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKAS  117
              V+T+  P    +  + C        +++ ++E+ANV   +   +L G   VSP+  +S
Sbjct  144  --VITYYFPATSGSAKISCTIEGK--ENLEIEVENANVVEMMKKWYLGGTRGVSPTTISS  199

Query  116  VANGLEVVL  90
            +AN + V L
Sbjct  200  LANNICVEL  208



>ref|XP_010103648.1| Chalcone--flavonone isomerase [Morus notabilis]
 gb|EXB96531.1| Chalcone--flavonone isomerase [Morus notabilis]
Length=229

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 15/170 (9%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L+LLG G  +     + +K  A G+Y++  ++N L+ W+G++  EL  D   F  +  AP
Sbjct  44   LALLGHGITDIEVHFLQIKFTAIGVYLDSVVVNHLEQWKGKTGNELAKDDDFFTALISAP  103

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK + IV+++++ G  +   ++ A+  R+   +ADD+       AL      FQ + LK
Sbjct  104  VEKLVRIVVIKEIKGAQYGVQIESALRDRL---AADDKYEEEEEEALEKIVDFFQSKYLK  160

Query  290  KGTFIVLTWVDP---TKMLVCVSSDATPSSIDAKIESANVTSALFDVFLG  150
            K +  V+T+  P   T   + V+++    S    +E+ANV   +    LG
Sbjct  161  KQS--VITYHFPATSTTAEIVVTTEGKEES-KYIVENANVVETIKKWLLG  207



>gb|KHN37310.1| Chalcone--flavonone isomerase 1B-2 [Glycine soja]
Length=226

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 94/203 (46%), Gaps = 7/203 (3%)
 Frame = -3

Query  677  VKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAA  501
            ++F   ++ P    S  L G G R        VK    G+Y+ +  ++ L A W+G+SAA
Sbjct  15   LQFPAVVTPPASTKSYFLGGAGVRGLNIEEEFVKFTGIGVYLEDKAVSSLGAKWKGKSAA  74

Query  500  ELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSP---SADDETAL  330
            EL +    +  I K P EK +    +R +DG+ +   + E     ++S    S  +E A+
Sbjct  75   ELLDSLDFYRDIIKGPFEKLIRGSKLRTLDGREYVRKVSENCVAHMESVGTYSEAEEKAI  134

Query  329  STFRTIFQGRPLKKGTFIVLTWVDPTKML-VCVSSDAT-PSSIDAKIESANVTSALFDVF  156
              FR  F+ +    G+  V     PT  L +  S D T P    A I++  ++ A+ +  
Sbjct  135  EEFRNAFKDQNFPPGS-TVFYKQSPTGTLGLSFSKDETIPEHEHAVIDNKPLSEAVLETM  193

Query  155  LGRNPVSPSLKASVANGLEVVLK  87
            +G  PVSP+LK S+A       K
Sbjct  194  IGEIPVSPALKESLATRFHQFFK  216



>ref|XP_001419318.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97611.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=172

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 89/195 (46%), Gaps = 32/195 (16%)
 Frame = -3

Query  698  VEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAW  519
            V EP T +K   +++ PG   +L+L G G R K  A + VKVYA G YV+      +D  
Sbjct  2    VTEPRTGLKVPAAMT-PGD-KALALAGRGARVKRIAGLSVKVYACGFYVD------VDGA  53

Query  518  RGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE  339
            R   AA                 E+ + +V  R+V G    +AL E I P + +    D 
Sbjct  54   RDGDAASY---------------ERLVRLVFARNVGGDKIVEALAERIRPAMDA----DS  94

Query  338  TALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDV  159
             AL  F  IF G   KKGT +        ++   +          + I  A++  ALFD 
Sbjct  95   PALRAFEAIFDGVSFKKGTSLDFHATFEGELATFIKGKRV-----SVIADASLCRALFDC  149

Query  158  FLGRNPVSPSLKASV  114
            ++G++PV P LK++V
Sbjct  150  YVGKDPVIPELKSTV  164



>gb|ADT63063.1| chalcone isomerase [Fagopyrum esculentum]
Length=256

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 90/199 (45%), Gaps = 5/199 (3%)
 Frame = -3

Query  671  FQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL-DAWRGRSAAEL  495
            F  S+  P    S  L G G R        +   A G+Y  E+ +  L D W+G+SA EL
Sbjct  17   FPPSVRPPATEKSFFLGGAGVRGLTIQGTFISFTAIGIYFEETAVASLADKWKGKSATEL  76

Query  494  QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETALST  324
                  F  +     EK + I +++ + G  + + + E   AI   I   S  DE A+  
Sbjct  77   AESVEFFRDVVTGQFEKFIQISMLKPLTGAQYSEKVSENCVAIWKAIGIYSEADEKAIEK  136

Query  323  FRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSS-DATPSSIDAKIESANVTSALFDVFLGR  147
            F  IF+ +    GT I+     P  + +     DA P +  A IE+  ++ ++ +  +G+
Sbjct  137  FTEIFKEQNFPPGTSILFKQCAPKSLRIAFGKHDAIPEADVAVIENGPLSQSVLESIIGK  196

Query  146  NPVSPSLKASVANGLEVVL  90
            N VSP+ + S+A  L  +L
Sbjct  197  NGVSPAARESLAVRLHELL  215



>gb|AIY53017.1| chalcone isomerase [Actinidia chrysantha]
Length=210

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 93/186 (50%), Gaps = 14/186 (8%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y++  I+  L  W+G++  +L  D   FE +  AP
Sbjct  24   LSLLGHGITDIEIHFLQIKFTAIGVYLDCEIVGHLQQWKGKTGKDLAEDDDFFEALVSAP  83

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK L +V+++++ G  +   L+ A+  R+   +ADD+       AL      FQ +  K
Sbjct  84   VEKFLRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEAALELVVEFFQSKYFK  140

Query  290  KGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI--ESANVTSALFDVFL-GRNPVSPSLKA  120
            K +  V+T+  P        + +T    ++KI  E+ANV   +   +L G   VSPS  +
Sbjct  141  KDS--VITFHFPASSGTAEIAFSTEGKGESKICVENANVVEMIKKWYLGGTRGVSPSTIS  198

Query  119  SVANGL  102
             +A  L
Sbjct  199  CLATTL  204



>gb|AAZ80911.1| chalcone isomerase [Canna x generalis]
Length=226

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/204 (27%), Positives = 96/204 (47%), Gaps = 6/204 (3%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL-DAWRGRSA  504
             V F  + + PG  +SL L G G R        V   A G+Y+ +  ++ L   W+G++A
Sbjct  15   EVTFPPAAAPPGSSSSLFLAGAGERGLEIDRQFVVFTAIGVYLEDLAVSTLAPKWKGKTA  74

Query  503  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE---TA  333
             +L  +S  F  IF  P EK   I +V+ + G+ + + ++E      K+     E    A
Sbjct  75   DDLAGNSDFFRDIFTGPFEKFTRITMVKPLSGQQYSEKVEENCVAHWKAAGTYTEAEAAA  134

Query  332  LSTFRTIFQGRPLKKGTFIVLT-WVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDV  159
            +  F+   +      GT I+ T  V P  + +    + + P + +  IES  ++ A+ + 
Sbjct  135  VEKFKEACKNETFPPGTSILFTHQVSPASLTITFWREGSMPETGNTVIESKALSEAILES  194

Query  158  FLGRNPVSPSLKASVANGLEVVLK  87
             +G++ VSP  K SVA  L  +L+
Sbjct  195  IIGKHGVSPGAKRSVAQRLSEILE  218



>gb|AHH84790.1| chalcone isomerase [Fagopyrum dibotrys]
Length=249

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 90/199 (45%), Gaps = 5/199 (3%)
 Frame = -3

Query  671  FQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL-DAWRGRSAAEL  495
            F  S+  P    S  L G G R        +   A G+Y  E+ +  L D W+G+SA EL
Sbjct  17   FPPSVRPPATDKSFFLGGAGVRGLTINGTFISFTAIGIYFEETAVASLADKWKGKSATEL  76

Query  494  QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETALST  324
                  F  +     EK + I +++ + G  + + + E   AI   I   S  +E A+  
Sbjct  77   TESVEFFRDVVTGQFEKFIQITMLKPLTGAQYSEKVSENCVAIWKAIGIYSEAEEKAIEK  136

Query  323  FRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSS-DATPSSIDAKIESANVTSALFDVFLGR  147
            F  IF+ +    GT I+     P  + +     DA P +  A IE+  ++ ++ +  +G+
Sbjct  137  FTEIFKEQNFPPGTSILFKQCAPKSLRIAFGKHDAIPEADVAVIENGPLSQSVLESIIGK  196

Query  146  NPVSPSLKASVANGLEVVL  90
            N VSP+ K S+A  L  +L
Sbjct  197  NGVSPAAKESLAVRLHELL  215



>ref|XP_010931364.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Elaeis guineensis]
Length=209

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 90/186 (48%), Gaps = 6/186 (3%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L+LLG G  +     + +K  A G+Y+ ++I+  L +W+G+  AEL  D   FE +  AP
Sbjct  23   LALLGHGITDIEIHFLQIKYNAIGIYMEKNIVEHLGSWKGKKGAELAEDDLFFEALAAAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPLKKGT  282
            ++K   IV+++++ G  +   L+ A+  R   I      +E AL      FQ +  KK +
Sbjct  83   VDKFFRIVVIKEIKGSQYGVQLESAVRDRLAAIDKYEEGEEEALEKVSEFFQTKYFKKDS  142

Query  281  FIVLTW-VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVAN  108
             I   +   P    +   ++    +   K+E+ANV   +   +L G   VSP+   S+A 
Sbjct  143  VITFGFPATPCTAEISFVTEGKEQT-KIKVENANVVEMIQKWYLGGSRAVSPTTVKSLAE  201

Query  107  GLEVVL  90
             L  +L
Sbjct  202  NLGAML  207



>gb|AGY46120.1| chalcone isomerase 1 [Dendrobium hybrid cultivar]
Length=209

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 89/186 (48%), Gaps = 6/186 (3%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L+L+G G        + +K  A G+Y+++ +   L  W G+   EL+ D   F  +F AP
Sbjct  23   LALVGQGMTSVEIHFLQIKYNAIGIYMDKDVTKYLKNWEGKKGTELEEDDLFFAALFLAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPLKKGT  282
            +EK   IV+++++ G  +   L+ A+  +   I     ++E AL      FQ   LKKG+
Sbjct  83   VEKVFRIVVIKEIKGSQYGIQLESAVRDQLAAIDHYEEEEEEALEKVTKFFQSIYLKKGS  142

Query  281  FIVLTWVD-PTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRN-PVSPSLKASVAN  108
             I   +   P+   +   ++    S   ++++ NV   +   +LG +  VSPS   S+A 
Sbjct  143  IITFYFATIPSTAEITFDTEGKGQS-KIQVDNTNVVEQMQKWYLGGSFAVSPSTVKSLAV  201

Query  107  GLEVVL  90
              E +L
Sbjct  202  KFEDIL  207



>ref|NP_001236782.1| chalcone isomerase 4-like [Glycine max]
 gb|AAT94362.1| putative chalcone isomerase 4 [Glycine max]
Length=209

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 92/181 (51%), Gaps = 8/181 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     I VK Y+ G+Y+   ++  LD ++G+SA EL+++   F  +  AP
Sbjct  23   LSLLGHGITDMEIHFIHVKFYSIGVYLEPEVVGHLDQFKGKSAKELEDNEEFFNALISAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI---FQGRPLKKGT  282
            +EK + +V+++++ G  +   ++ A+  R+ +    +E        +   FQ +  KK +
Sbjct  83   VEKFIRLVVIKEIKGAQYGVQIETAVRDRLAAEDKYEEEEEEALEKVIEFFQSKYFKKLS  142

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDAK--IESANVTSALFDVFL-GRNPVSPSLKASVA  111
              V+T+  P          +     D+K  IE+ANV  A+   +L G + VS S   S+A
Sbjct  143  --VITYHFPANSATAEIVVSLEGKEDSKYVIENANVVEAIKKWYLGGSSAVSSSTIQSLA  200

Query  110  N  108
            +
Sbjct  201  S  201



>ref|NP_001236097.1| chalcone--flavonone isomerase 1B-2 [Glycine max]
 sp|Q53B70.1|CF1B2_SOYBN RecName: Full=Chalcone--flavonone isomerase 1B-2; Short=Chalcone 
isomerase 1B-2 [Glycine max]
 gb|AAT94364.1| chalcone isomerase 1B2 [Glycine max]
Length=226

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 94/203 (46%), Gaps = 7/203 (3%)
 Frame = -3

Query  677  VKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAA  501
            ++F   ++ P    S  L G G R        VK    G+Y+ +  ++ L A W+G+SAA
Sbjct  15   LQFPALVTPPASTKSYFLGGAGVRGLNIQEEFVKFTGIGVYLEDKAVSSLGAKWKGKSAA  74

Query  500  ELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSP---SADDETAL  330
            EL +    +  I K P EK +    +R +DG+ +   + E     ++S    S  +E A+
Sbjct  75   ELLDSLDFYRDIIKGPFEKLIRGSKLRTLDGREYVRKVSENCVAHMESVGTYSEAEEKAI  134

Query  329  STFRTIFQGRPLKKGTFIVLTWVDPTKML-VCVSSDAT-PSSIDAKIESANVTSALFDVF  156
              FR  F+ +    G+  V     PT  L +  S D T P    A I++  ++ A+ +  
Sbjct  135  EEFRNAFKDQNFPPGS-TVFYKQSPTGTLGLSFSKDETIPEHEHAVIDNKPLSEAVLETM  193

Query  155  LGRNPVSPSLKASVANGLEVVLK  87
            +G  PVSP+LK S+A       K
Sbjct  194  IGEIPVSPALKESLATRFHQFFK  216



>gb|AGL50916.1| chalcone synthase [Pyrus communis]
Length=219

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 95/199 (48%), Gaps = 5/199 (3%)
 Frame = -3

Query  671  FQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAEL  495
            F  S+  PG   +L L G G R        VK  A G+Y+ ++ +  L   W+G++A EL
Sbjct  17   FPPSVKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPLLAVKWKGKTAEEL  76

Query  494  QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS--ADDE-TALST  324
                  F  I   P EK + + ++  + G+ + + + E      KS     D E  A+  
Sbjct  77   SESVEFFRDIVTGPFEKFIQVTMILPLTGQQYSEKVSENCVAFWKSVGIYTDAEGKAIEK  136

Query  323  FRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFLGR  147
            F  +F+ +    G  I+ T      + +C S DA+ P + +A IE+  ++ A+ +  +G+
Sbjct  137  FIEVFKDQNFPPGASILFTQSPKGSLTICFSKDASVPEAANAMIENKLLSEAVLESIVGK  196

Query  146  NPVSPSLKASVANGLEVVL  90
            + VSP+ K S+A  L  +L
Sbjct  197  HGVSPAAKRSLAARLSELL  215



>gb|ADG27840.1| chalcone isomerase [Gossypium hirsutum]
 gb|KHG08378.1| Chalcone--flavonone isomerase [Gossypium arboreum]
Length=209

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 90/186 (48%), Gaps = 14/186 (8%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y+   ++  L  W+G+    L  D   FE +  AP
Sbjct  23   LSLLGHGITDIEIHFLQIKFTAIGVYLEPEVVGHLQQWKGKPGNVLAEDDDFFEALINAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK L +V+++++ G  +   L+ A+  R+   +ADD+       AL      FQ +  K
Sbjct  83   VEKFLRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKVVEFFQSKYFK  139

Query  290  KGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI--ESANVTSALFDVFL-GRNPVSPSLKA  120
            K +  V+T+  P        +  T    +AKI  E+ANV   +   +L G   VS +  +
Sbjct  140  KDS--VITYHFPANSATAEIAFTTEGKEEAKIKVENANVVEMIKKWYLGGTRGVSATTIS  197

Query  119  SVANGL  102
            S+AN L
Sbjct  198  SLANTL  203



>gb|KJB74932.1| hypothetical protein B456_012G014600 [Gossypium raimondii]
Length=209

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 90/186 (48%), Gaps = 14/186 (8%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y+   ++  L  W+G+    L  D   FE +  AP
Sbjct  23   LSLLGHGITDIEIHFLQIKFTAIGVYLEPEVVGHLQQWKGKPGNVLAEDDNFFEALINAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK L +V+++++ G  +   L+ A+  R+   +ADD+       AL      FQ +  K
Sbjct  83   VEKFLRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKVVEFFQSKYFK  139

Query  290  KGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI--ESANVTSALFDVFL-GRNPVSPSLKA  120
            K +  V+T+  P        +  T    +AKI  E+ANV   +   +L G   VS +  +
Sbjct  140  KDS--VITYHFPANSATAEIAFTTEGKEEAKIKVENANVVEMIKKWYLGGTRGVSATTIS  197

Query  119  SVANGL  102
            S+AN L
Sbjct  198  SLANTL  203



>gb|AGY46121.1| chalcone isomerase 2 [Dendrobium hybrid cultivar]
Length=209

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 91/186 (49%), Gaps = 6/186 (3%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L+L+G G        + +K  A G+Y+++ +   L  W G++  EL+ D   F  +F AP
Sbjct  23   LALVGQGMTSVEIHFLEIKYNAIGIYMDKDVTEYLKNWEGKTETELEEDDLFFAALFLAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS---ADDETALSTFRTIFQGRPLKKGT  282
            +EK   IV+++++ G  +   L+ A+  ++ +      ++E AL      FQ   LKKG+
Sbjct  83   VEKVFRIVVIKEIKGSQYGIQLESAVRDQLAAVDRYEEEEEEALEKVTKFFQSIYLKKGS  142

Query  281  FIVLTW-VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRN-PVSPSLKASVAN  108
             I   +   P+   +   S+    S   ++++ NV   +   +LG +  VSPS   S+A 
Sbjct  143  VITFYFAAKPSTAEITFDSEGKGES-KIQVDNKNVVEQMQKWYLGGSFAVSPSTVKSLAV  201

Query  107  GLEVVL  90
              E +L
Sbjct  202  KFEDIL  207



>ref|XP_005837532.1| hypothetical protein GUITHDRAFT_151184, partial [Guillardia theta 
CCMP2712]
 gb|EKX50552.1| hypothetical protein GUITHDRAFT_151184, partial [Guillardia theta 
CCMP2712]
Length=198

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 81/158 (51%), Gaps = 15/158 (9%)
 Frame = -3

Query  731  ASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYV  552
            A+ +  G   +VEE  T+VKF   L +PG  +SL LLG   R K    + V+VYA G+Y 
Sbjct  3    AAVAMAGEDHFVEE-ATSVKF--PLDIPGEKSSLVLLGATVRVKKILFVNVQVYAVGVYT  59

Query  551  NESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  372
               ++ +L   +G+      ND  +++ + + P++ SL + +VR V G     AL EA+ 
Sbjct  60   EPGVVEEL---KGKEP----ND--MYKYLMEHPVQSSLRLTMVRSVTGDQMGGALKEAVQ  110

Query  371  PRIKSPSADDETA---LSTFRTIFQGRPLKKGTFIVLT  267
            PR+K  + D+ +    +S F   F    L  GT +  +
Sbjct  111  PRLKLFARDEASTAGDMSAFEKQFDMSSLAAGTVLTFS  148



>gb|KJB74930.1| hypothetical protein B456_012G014600 [Gossypium raimondii]
Length=205

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 90/186 (48%), Gaps = 14/186 (8%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y+   ++  L  W+G+    L  D   FE +  AP
Sbjct  19   LSLLGHGITDIEIHFLQIKFTAIGVYLEPEVVGHLQQWKGKPGNVLAEDDNFFEALINAP  78

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK L +V+++++ G  +   L+ A+  R+   +ADD+       AL      FQ +  K
Sbjct  79   VEKFLRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKVVEFFQSKYFK  135

Query  290  KGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI--ESANVTSALFDVFL-GRNPVSPSLKA  120
            K +  V+T+  P        +  T    +AKI  E+ANV   +   +L G   VS +  +
Sbjct  136  KDS--VITYHFPANSATAEIAFTTEGKEEAKIKVENANVVEMIKKWYLGGTRGVSATTIS  193

Query  119  SVANGL  102
            S+AN L
Sbjct  194  SLANTL  199



>emb|CEG01417.1| Chalcone isomerase [Ostreococcus tauri]
Length=185

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 88/202 (44%), Gaps = 30/202 (15%)
 Frame = -3

Query  692  EPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRG  513
            E  T +   R+ +  G   +L+L G G R K    +GVKVYA G YV+           G
Sbjct  7    ERATGLAVPRAQTFDG--AALTLAGVGARVKKICGLGVKVYACGFYVDAV---------G  55

Query  512  RSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETA  333
               A    ++   E +     E+S+ +   RDV G    +AL E I P + +    D T+
Sbjct  56   VREAMGDGETDALEAL--KTCERSIRLKFARDVGGDKIVEALAERIRPAMDA----DSTS  109

Query  332  LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAK----IESANVTSALF  165
            L  F  IF G   KKGT +  T           +  A  + I  K    I    +  ALF
Sbjct  110  LKRFEAIFDGVSFKKGTSLDFT---------ATADGALATRIKGKKVSHIADRALVDALF  160

Query  164  DVFLGRNPVSPSLKASVANGLE  99
              ++G +PV PSLK++V   +E
Sbjct  161  AAYVGADPVIPSLKSAVREFIE  182



>gb|KEH35545.1| chalcone-flavanone isomerase family protein [Medicago truncatula]
Length=177

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/168 (27%), Positives = 88/168 (52%), Gaps = 8/168 (5%)
 Frame = -3

Query  587  IGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDG  408
            + VK Y+ G+Y+   ++N L  W+G+ A EL+++   F+ +  +P+EK++ +V+++++ G
Sbjct  6    LQVKFYSIGVYLEPEVVNHLQQWKGKPAKELEDNDDFFDALISSPVEKAIRLVVIKEIKG  65

Query  407  KTFWDALDEAISPRIKSPSADDETALSTFRTI---FQGRPLKKGTFIVLTW--VDPTKML  243
              +   ++ A+  R+ +    ++        +   FQ +  KK + I   +    PT  +
Sbjct  66   AQYGVQIETAVRDRLAADDKYEDEEEEALEKVIEFFQSKYFKKHSVITYHFPANSPTAEI  125

Query  242  VCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVANGL  102
            V VS +    S    IE+ANV   +   +L G   +SPS  +S+AN L
Sbjct  126  V-VSLEGKEDS-KYVIENANVVETIKKWYLAGSRAISPSTISSLANHL  171



>ref|XP_011001399.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Populus 
euphratica]
Length=210

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 8/181 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y+   I+  L  W+G+   EL  +   FE +  AP
Sbjct  24   LSLLGHGITDIEIHFLQIKFTAIGVYLEPEIVGHLQQWKGKPGNELAENDDFFEALIAAP  83

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI---FQGRPLKKGT  282
            +EK L +V+++++ G  +   L+  +  R+      +E        I   FQ + +KK +
Sbjct  84   VEKFLRVVVIKEIKGSQYGVQLESVVRDRLAEADKYEEEEEEALEKIVEFFQSKYMKKNS  143

Query  281  FIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVA  111
             I   +    PT  +   +     S I  K+E+ANV   +   +L G   VS +  +S+A
Sbjct  144  IITFYFPSTSPTAEIGFATEGKEESKI--KVENANVVEMIKKWYLGGTRGVSATTISSLA  201

Query  110  N  108
            N
Sbjct  202  N  202



>ref|XP_002520870.1| Chalcone--flavonone isomerase, putative [Ricinus communis]
 gb|EEF41579.1| Chalcone--flavonone isomerase, putative [Ricinus communis]
Length=204

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 81/169 (48%), Gaps = 8/169 (5%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y++  I+  L  W+G+   +L  D   F+ +  AP
Sbjct  17   LSLLGHGITDIEIHFLQIKFTAIGVYLDPQIVGHLQQWKGKPGNQLAEDDDFFDALIAAP  76

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPLKKGT  282
            +EK L +V+++++ G  +   L+ A+  R   +     ++E AL      FQ +  KK +
Sbjct  77   VEKLLRVVVIKEIKGSQYGVQLESAVRDRLAEVDKYEEEEEEALEKVTEFFQSKFFKKDS  136

Query  281  FIVLTW---VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRN  144
             I   +     PT  +V  +     + +  K+E+ NV   +   +LG N
Sbjct  137  IITFHFPATSSPTAEIVFSTEGKEDTKL--KVENGNVVEMVKKWYLGGN  183



>ref|XP_002315258.1| chalcone isomerase family protein [Populus trichocarpa]
 gb|ABK94676.1| unknown [Populus trichocarpa]
 gb|EEF01429.1| chalcone isomerase family protein [Populus trichocarpa]
Length=223

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 96/203 (47%), Gaps = 5/203 (2%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA  504
            NV F  ++  P    +L L G G R        +K  A G+Y+ ++ L  L A W+G+ A
Sbjct  14   NVTFPPAVKPPASNNTLFLGGAGVRGLEIEGKFIKFTAIGVYLEDNSLQSLAAKWKGKIA  73

Query  503  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS--ADDET-A  333
             EL +    F  I + P EK + + ++  + G  + + + E      KS     D E  A
Sbjct  74   KELTDSVEFFRDIVRGPFEKFMRVTMILPLTGLQYSEKVAENCVSIWKSLGIYTDAEAKA  133

Query  332  LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVF  156
            +  FR +F+      G+ I+ T      + +  S D + P   +A IE+  ++ A+ +  
Sbjct  134  IEKFREVFKEETFPPGSSILFTLSPHGSLAISFSKDGSVPEIENAVIENKLLSEAVLESM  193

Query  155  LGRNPVSPSLKASVANGLEVVLK  87
            +G++ VSP+ K S+A  L  +LK
Sbjct  194  IGKHGVSPAAKQSLATTLSELLK  216



>ref|XP_010543680.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Tarenaya 
hassleriana]
Length=209

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 91/188 (48%), Gaps = 9/188 (5%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILN-KLDAWRGRSAAELQNDSPLFETIFKA  456
            LSL+G G  +     + VK  A G+YV+ S +   L  W+G+    L +D   F  +  A
Sbjct  23   LSLIGQGITDIEIHFLQVKFTAIGVYVDSSDVGPHLGNWKGKPGNALVDDDDFFHALVSA  82

Query  455  PLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI---FQGRPLKKG  285
            P+EK + +V+++++ G  +   ++ A+  R+      +E   +    +   FQ +  KK 
Sbjct  83   PVEKIVRVVVIKEIKGSQYGVQMENAVRDRLAEEDKYEEEEEAALEKVVEFFQSKYFKKD  142

Query  284  TFIVLTWVDPTKMLVCVSSDATPSSIDA--KIESANVTSALFDVFL-GRNPVSPSLKASV  114
            + I  T+  P+    C  + AT     A  K+E+ANV   +   +L G   VSPS  AS+
Sbjct  143  SLI--TYHFPSDSRFCEIAFATEGKEGAKMKVENANVAEMIQKWYLGGSRGVSPSTTASL  200

Query  113  ANGLEVVL  90
            A  L  +L
Sbjct  201  AGALSAIL  208



>gb|AIS35913.1| chalcone isomerase [Phalaenopsis equestris]
Length=209

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 93/186 (50%), Gaps = 6/186 (3%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L+LLG G        + +K  A G+Y+ + +   L+ W+G+  AEL++D+  F+ +  AP
Sbjct  23   LALLGQGLTSLEIHFLQIKHNAIGIYIEKDVTQHLENWKGKKRAELEDDNLFFDALVSAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI---FQGRPLKKGT  282
            +EK   IV+++++ G  +   L+ AI  ++ +    +E        +   FQ   LKK +
Sbjct  83   VEKLFRIVVIKEIKGSQYGVQLEGAIRDQLAAAEKYEEEEEEALEKVAKFFQTLYLKKDS  142

Query  281  FIVLTW-VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRN-PVSPSLKASVAN  108
             I   +    +   +  S+D    S   ++E+ANV   +   ++G +  +SPS   ++A+
Sbjct  143  VISFYFPATSSTAEITFSTDGKGES-KVEVENANVVEMMQKRYIGGSMAISPSTVKNLAD  201

Query  107  GLEVVL  90
              E +L
Sbjct  202  KFEAIL  207



>sp|A5HBK6.1|CFI_PYRCO RecName: Full=Chalcone--flavonone isomerase; Short=Chalcone isomerase 
[Pyrus communis]
 gb|ABQ08639.1| chalcone isomerase [Pyrus communis]
Length=219

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 94/199 (47%), Gaps = 5/199 (3%)
 Frame = -3

Query  671  FQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAEL  495
            F  S+  PG   +L L G G R        VK  A G+Y+ ++ +  L   W+G++A EL
Sbjct  17   FPPSVKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPLLAVKWKGKTAEEL  76

Query  494  QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS--ADDE-TALST  324
                  F  I   P EK + +  +  + G+ + + + E      KS     D E  A+  
Sbjct  77   SESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSEKVSENCVAFWKSVGIYTDAEGKAIEK  136

Query  323  FRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFLGR  147
            F  +F+ +    G  I+ T      + +C S DA+ P + +A IE+  ++ A+ +  LG+
Sbjct  137  FIEVFKDQNFPPGASILFTQSPKGSLTICFSKDASVPEAANAVIENKLLSEAVLESILGK  196

Query  146  NPVSPSLKASVANGLEVVL  90
            + VSP+ K S+A  L  +L
Sbjct  197  HGVSPAAKRSLAARLSELL  215



>ref|XP_005854048.1| chalcone isomerase-like protein [Nannochloropsis gaditana CCMP526]
 ref|XP_005855216.1| chalcone isomerase-like protein [Nannochloropsis gaditana CCMP526]
 gb|EKU21138.1| chalcone isomerase-like protein [Nannochloropsis gaditana CCMP526]
 gb|EKU22307.1| chalcone isomerase-like protein [Nannochloropsis gaditana CCMP526]
Length=235

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 58/208 (28%), Positives = 95/208 (46%), Gaps = 13/208 (6%)
 Frame = -3

Query  725  SSSVGNAEYVEEPTTNV-KFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVN  549
            +  V   E V++ T  V    R L   G    L+LLG G R K   ++ V VYA GLY+ 
Sbjct  30   TCEVKGKEVVDKVTGLVFPMHRILPHGGRGRELTLLGVGPRRKNLFVVEVNVYAVGLYLE  89

Query  548  ESILNKLDAWRGRSAAELQNDSPLFETIFK--APLEKSLSIVLVRDVDGKTFWDALDEAI  375
             S+L +L A+RG+S+  L  ++  + T+ K  + L ++L ++  R V      +AL  A+
Sbjct  90   TSLLGRLKAFRGKSSEALAKEAKYYATLMKEGSGLNRALYLIFARTVPAGKIVEAL-AAV  148

Query  374  SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI  195
                K   AD + +L        G  LK+   + L W    ++ + V      +      
Sbjct  149  DGVKKEVMADFKKSLLA----AIGSSLKEKETLTLAWTPDDRLSLFVRDKPVKT-----F  199

Query  194  ESANVTSALFDVFLGRNPVSPSLKASVA  111
             S  +   +F+++LG  P+SP  K   A
Sbjct  200  PSLELARGIFNLYLGEKPISPEAKKGFA  227



>gb|AFC75728.1| chalcone isomerase [Narcissus tazetta var. chinensis]
Length=244

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 93/206 (45%), Gaps = 13/206 (6%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYR-----EKVFAIIGVKVYAAGLYVNESILNKLDAWR  516
             + F   ++ PG   +  L G G R     +K  A   + +Y      N+S+    + WR
Sbjct  18   GIAFPAVITPPGSSKAHFLGGAGVRGLKIDDKFIAFTAIAIYLE----NDSVKTLAEKWR  73

Query  515  GRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSAD  345
            G+ A E  +    F  I+  P EK   +V++  + G  +   + E   A    I   +  
Sbjct  74   GKGAEECSDSMDFFRDIYAGPFEKFTQVVMLLPLTGDQYTKKVSENCVAYWKAIGIHTDA  133

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSAL  168
            +  A+  F+ +F+G+    G+ I+ T      + +  S DA+ P +  A IE+  +T A+
Sbjct  134  EAAAIEKFKGVFKGQSFPPGSSILFTHSPTGSLTIAFSKDASIPEAGAAVIENKALTQAI  193

Query  167  FDVFLGRNPVSPSLKASVANGLEVVL  90
             +  +G + VSP+ K S+A  L  +L
Sbjct  194  LESIIGEHGVSPAAKQSLALRLSEIL  219



>gb|KHN25809.1| Chalcone--flavonone isomerase [Glycine soja]
Length=251

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/179 (28%), Positives = 90/179 (50%), Gaps = 6/179 (3%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     I VK Y+ G+Y+   ++  LD ++G+SA EL+++   F  +  AP
Sbjct  65   LSLLGHGITDMEIHFIHVKFYSIGVYLEPEVVGHLDQFKGKSAKELEDNEEFFNALISAP  124

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI---FQGRPLKKGT  282
            +EK + +V+++++ G  +   ++ A+  R+ +    +E        +   FQ +  KK +
Sbjct  125  VEKFIRLVVIKEIKGAQYGVQIETAVRDRLAAEDKYEEEEEEALEKVIEFFQSKYFKKLS  184

Query  281  FIVLTW-VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVA  111
             I   +  +     + VS +    S    IE+ANV  A+   +L G + VS S   S+A
Sbjct  185  VITYHFPANSATAEIVVSLEGKEDS-KYVIENANVVEAIKKWYLGGSSAVSSSTIQSLA  242



>ref|XP_006577878.1| PREDICTED: chalcone isomerase 4B isoform X1 [Glycine max]
Length=209

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 88/178 (49%), Gaps = 10/178 (6%)
 Frame = -3

Query  659  LSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQN  489
            ++ P   T+   LSLLG G  +     I VK Y+ G+Y+   ++  L+ ++G SA EL+ 
Sbjct  11   ITYPSKITTTKPLSLLGHGITDMEIHFIHVKFYSIGIYLEPEVVGHLEQFKGISAKELEE  70

Query  488  DSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI-  312
            +   F  +  AP+EK + +V+++++ G  +   ++ A+  R+ +    +E        + 
Sbjct  71   NDEFFNALISAPVEKFIRLVVIKEIKGAQYGVQIETAVRDRLAAEDKYEEEEEEALEKVI  130

Query  311  --FQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAK--IESANVTSALFDVFLG  150
              FQ +  KK +  V+T+  PT         +     D+K  IE+ANV  A+   +LG
Sbjct  131  EFFQSKYFKKHS--VITYHFPTNSATAEIVVSLEGKEDSKYVIENANVVEAVKKWYLG  186



>gb|ACU16129.1| unknown [Glycine max]
Length=210

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/166 (28%), Positives = 83/166 (50%), Gaps = 7/166 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     I VK Y+ G+Y+   ++  LD ++G+SA EL+++   F  +  AP
Sbjct  23   LSLLGHGITDMEIHFIHVKFYSIGVYLEPEVVGHLDQFKGKSAKELEDNEEFFNALISAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI---FQGRPLKKGT  282
            +EK + +V+++++ G  +   ++ A+  R+ +    +E        +   FQ +  KK +
Sbjct  83   MEKFIRLVVIKEIKGAQYGVQIETAVRDRLAAEDKYEEEEEEALEKVIEFFQSKYFKKLS  142

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDAK--IESANVTSALFDVFLG  150
              V+T+  P          +     D+K  IE+ANV  A    +LG
Sbjct  143  --VITYHFPANSATAEIVVSLEGKEDSKYVIENANVVEANKKWYLG  186



>dbj|BAO58577.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
 dbj|BAO58578.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
 dbj|BAO58579.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
 dbj|BAO58580.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
Length=206

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 93/183 (51%), Gaps = 8/183 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSL+G G  +     + +K  A G+Y++  I++ L  W+G++  +L  D   FE I  AP
Sbjct  24   LSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGKTPVDLAQDDDFFEAIINAP  83

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAIS---PRIKSPSADDETALSTFRTIFQGRPLKKGT  282
            ++K L +V+++++ G  +   L+ ++      +     ++E AL      FQ +  KK +
Sbjct  84   VDKVLRVVVIKEIKGSQYGVQLENSVRDLLAEVDKYEEEEEAALEKVVDFFQSKYFKKSS  143

Query  281  FIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVA  111
             I  ++     T  +V  +     SSI+  +E+ANV   +   +L G   VSPS  +S+A
Sbjct  144  VITFSFPANTATAKIVFATEGKEDSSIE--VENANVGGMIKKWYLGGSRAVSPSTISSLA  201

Query  110  NGL  102
            N L
Sbjct  202  NIL  204



>ref|XP_005645369.1| chalcone isomerase [Coccomyxa subellipsoidea C-169]
 gb|EIE20825.1| chalcone isomerase [Coccomyxa subellipsoidea C-169]
Length=205

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 90/186 (48%), Gaps = 14/186 (8%)
 Frame = -3

Query  629  SLLGTGYREKVFA-IIGVKVYAAGLYVNESILNKLDAWRGRSA---AELQNDSPLFETIF  462
            +L+GTG R K  A +  + VYA G Y+ +S   K +  R         L+++  L E + 
Sbjct  23   ALIGTGARAKKLAGLKNIDVYAMGFYI-DSRAAKQELGRDFDCLPPVSLEHNQVLAERLK  81

Query  461  KAP-LEKSLSIVLVRD-VDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKK  288
             A  +EK++ IV+    V+   F   L E++ PR+K     D  AL  F  +F+G    K
Sbjct  82   TANNIEKTVRIVVTSGMVNQSRFSKGLRESLEPRLKQTG--DTAALDEFEALFKGAQFYK  139

Query  287  GTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVAN  108
            G  +  T      + + + +         ++ +   T A FD++LG +PVSP  KAS+A 
Sbjct  140  GLEMSFTNTKNGSLALRIGNKEV-----GQVHAPGFTRAFFDLYLGTDPVSPDGKASIAK  194

Query  107  GLEVVL  90
            GL  V+
Sbjct  195  GLAAVI  200



>ref|XP_007011312.1| Chalcone-flavanone isomerase family protein [Theobroma cacao]
 gb|EOY20122.1| Chalcone-flavanone isomerase family protein [Theobroma cacao]
Length=264

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 88/186 (47%), Gaps = 14/186 (8%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     + +K  A G+Y+   +   L  W+G+    L  D   FE +  AP
Sbjct  78   LSLLGYGITDIEIHFLQIKFTAIGVYLEPEVAGHLQQWKGKPGNVLAEDDDFFEALINAP  137

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK L +V+++++ G  +   L+ A+  R+   +ADD+       AL      FQ +  K
Sbjct  138  VEKFLRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKVVEFFQSKYFK  194

Query  290  KGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI--ESANVTSALFDVFL-GRNPVSPSLKA  120
            K +  ++T+  P        +  T    +AKI  E+ANV   +   +L G   VS +   
Sbjct  195  KNS--IITYHFPANSCTAEIAFTTEGKEEAKIKVENANVVEMIKKWYLGGTRGVSATTIT  252

Query  119  SVANGL  102
            S+AN L
Sbjct  253  SLANAL  258



>ref|XP_011399347.1| hypothetical protein F751_0173 [Auxenochlorella protothecoides]
 gb|KFM22426.1| hypothetical protein F751_0173 [Auxenochlorella protothecoides]
Length=183

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 83/186 (45%), Gaps = 33/186 (18%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            +  +G G R K  A +G+KVYA  +Y       +    R R  +                
Sbjct  11   MRCIGAGARTKKVAFLGIKVYAVAVYAEAEKAARELGIRARQGS---------------M  55

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIV  273
             E ++ I LVR+V+G  F +AL EA++PR++                  G+ L KG+ I 
Sbjct  56   REGAVEIHLVRNVEGTQFVEALAEALTPRMRLSGGG-------------GQQLSKGSVIT  102

Query  272  LTWVDPTKMLVCVSSDATPSSIDAK-----IESANVTSALFDVFLGRNPVSPSLKASVAN  108
            L +     + + +SS   P+ + A      I+SA++  ALF+ FLG + V P  +A  A 
Sbjct  103  LLYRTDATLDIALSSPERPADLAAARASLCIKSASLCRALFETFLGESSVVPEARAVWAA  162

Query  107  GLEVVL  90
            G   +L
Sbjct  163  GARQLL  168



>ref|XP_005845734.1| hypothetical protein CHLNCDRAFT_136326 [Chlorella variabilis]
 gb|EFN53632.1| hypothetical protein CHLNCDRAFT_136326 [Chlorella variabilis]
Length=219

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 95/209 (45%), Gaps = 23/209 (11%)
 Frame = -3

Query  707  AEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL  528
            A+ ++E  T V F R          L+ LG G R K  A++  KVYA  +YV+     + 
Sbjct  2    ADIIKETVTGVAFPRKQQF-WHGGELTCLGAGARVKKVAMMTAKVYAVSMYVDADSAARA  60

Query  527  DAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIK----  360
            D+   R     ++++ +   +      K L + LVR + GK F DALDE++ P ++    
Sbjct  61   DSQEKRP----ESEAAVLRALQNGAFTKVLQMHLVRSITGKQFADALDESLRPMMRWAMH  116

Query  359  -------SPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCV--SSDATP---  216
                   +    DE  +  F   F+ + + K   I L W     + VC+  ++D TP   
Sbjct  117  AEGAWACAAVGGDEAVMDDFCGFFEAKKMDKDAEICLLWHADGPLDVCLRPATDKTPYAS  176

Query  215  SSIDAKIESANVTSALFDVFLGRNPVSPS  129
            +     I S  +  A+++++L  +P +PS
Sbjct  177  AQPGLSITSPRLGRAMWELYL--SPKTPS  203



>gb|KEH35546.1| chalcone-flavanone isomerase family protein [Medicago truncatula]
Length=158

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 60/103 (58%), Gaps = 3/103 (3%)
 Frame = -3

Query  662  SLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQ  492
             +S P   T+   LSLLG G  +     + VK Y+ G+Y+   ++N L  W+G+ A EL+
Sbjct  10   EISYPSKITTNKPLSLLGHGITDMEIHFLQVKFYSIGVYLEPEVVNHLQQWKGKPAKELE  69

Query  491  NDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRI  363
            ++   F+ +  +P+EK++ +V+++++ G  +   ++ A+  R+
Sbjct  70   DNDDFFDALISSPVEKAIRLVVIKEIKGAQYGVQIETAVRDRL  112



>ref|XP_002963874.1| hypothetical protein SELMODRAFT_227414 [Selaginella moellendorffii]
 gb|EFJ35745.1| hypothetical protein SELMODRAFT_227414 [Selaginella moellendorffii]
Length=205

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 93/195 (48%), Gaps = 5/195 (3%)
 Frame = -3

Query  671  FQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQ  492
            F +S+  P    +L LLG G  +     I V     G+Y    + + L +++    +EL 
Sbjct  7    FAQSIQSPSSSETLILLGHGITDMTIETIHVIFTKIGVYFAPEVKDHLQSFKCLPVSELL  66

Query  491  ND-SPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRI---KSPSADDETALST  324
             D S  F+ + +AP+ K + I+LV+   G  +   ++ +I  R+        D+E AL+ 
Sbjct  67   KDGSEFFQQLIQAPVSKLIKILLVKGQLGSQYASTIETSIRDRLAYDDKYEEDEEIALAN  126

Query  323  FRTIFQGRPLKKGTFIVLTWVDPTKML-VCVSSDATPSSIDAKIESANVTSALFDVFLGR  147
                FQ + L+  + IV +W   +  + V V  + + +     + + NV++++ +  LG 
Sbjct  127  LCEFFQSKKLEPNSTIVYSWPSSSSHVEVFVREEGSKAPSRFIVNNENVSTSIIEWILGE  186

Query  146  NPVSPSLKASVANGL  102
            N ++PS   SVA  +
Sbjct  187  NCMTPSTVESVAKSI  201



>gb|AFC75729.1| chalcone isomerase [Narcissus tazetta var. chinensis]
Length=244

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 94/206 (46%), Gaps = 13/206 (6%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYRE-----KVFAIIGVKVYAAGLYVNESILNKLDAWR  516
             + F   ++ PG   +  L G G R      K  A   + +Y      N+S+    + WR
Sbjct  18   GIAFPAVITPPGSFKAHFLGGAGVRGLKIDGKFMAFTAIAIYLE----NDSVKTLAEKWR  73

Query  515  GRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSAD  345
            G+ A E  +    F  I+  P EK   +V++  + G  + + + E   A    I   +  
Sbjct  74   GKGAEECSDSMDFFRDIYAGPFEKFTQVVMLLPLTGDQYTEKVSENCVAYWKAIGIYTDA  133

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSAL  168
            +  A+  F+ +F+G+    G+ I+ T    + + +  S DA+ P +  A IE+  +T A+
Sbjct  134  EAAAIEKFKGVFKGQSFPPGSSILFTHSPTSSLTIAFSKDASIPEAGAAVIENKALTQAI  193

Query  167  FDVFLGRNPVSPSLKASVANGLEVVL  90
             +  +G + VSP+ K S+A  L  +L
Sbjct  194  LESIIGEHGVSPAAKQSLALRLSEIL  219



>gb|AIC33515.1| CHI [Lycium chinense]
Length=210

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 87/181 (48%), Gaps = 4/181 (2%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            L L+G G  +     + +K  A G+Y++  I++ L  W+G++ A L  +   FE I  AP
Sbjct  24   LPLMGHGITDIEIHFLQIKFTAIGVYLDPEIVSHLQQWKGKTGAGLTENDEFFEAIVNAP  83

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETALSTFRTIFQGRPLKKGT  282
            ++K L +V+++++ G  +   L+ AI  R   +     ++E AL      FQ +  KK +
Sbjct  84   VDKFLRVVVIKEIKGSQYGVQLESAIRDRLAEVDKYEEEEEEALEKIVEFFQSKYFKKDS  143

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASVANG  105
             I  ++   +      S+       +  + + NV   +   +L G   VSP+  +S+AN 
Sbjct  144  VITYSFQATSATAKISSTIEGKEDSEIDVTNTNVVEMIKKWYLGGSRGVSPTTISSLANN  203

Query  104  L  102
            L
Sbjct  204  L  204



>sp|P11650.1|CFI1_PETHY RecName: Full=Chalcone--flavonone isomerase A; Short=CHI-A; Short=Chalcone 
isomerase A [Petunia x hybrida]
 emb|CAA68769.1| unnamed protein product [Petunia x hybrida]
 emb|CAA32729.1| unnamed protein product [Petunia x hybrida]
Length=241

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 95/204 (47%), Gaps = 7/204 (3%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL-DAWRGRSA  504
            N  F  +++  G   +L L G G+R        VK  A G+Y+ ES +  L + W+G++ 
Sbjct  14   NYAFAPTVNPAGSTNTLFLAGAGHRGLEIEGKFVKFTAIGVYLEESAIPFLAEKWKGKTP  73

Query  503  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPR---IKSPSADDETA  333
             EL +    F  +   P EK   + ++  + GK + + + E        I + + D+  A
Sbjct  74   QELTDSVEFFRDVVTGPFEKFTRVTMILPLTGKQYSEKVAENCVAHWKGIGTYTDDEGRA  133

Query  332  LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVC--VSSDATPSSIDAKIESANVTSALFDV  159
            +  F  +F+      G  I+ T   P  +L       D+   + +A IE+  ++ A+ + 
Sbjct  134  IEKFLDVFRSETFPPGASIMFTQ-SPLGLLTISFAKDDSVTGTANAVIENKQLSEAVLES  192

Query  158  FLGRNPVSPSLKASVANGLEVVLK  87
             +G++ VSP+ K SVA  +  +LK
Sbjct  193  IIGKHGVSPAAKCSVAERVAELLK  216



>ref|XP_006348610.1| PREDICTED: chalcone--flavonone isomerase-like [Solanum tuberosum]
Length=222

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 54/193 (28%), Positives = 91/193 (47%), Gaps = 5/193 (3%)
 Frame = -3

Query  650  PGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAELQNDSPLF  474
            P    +  L G G+R        VK    G+Y+ E+++  L A W+G+S+ EL      F
Sbjct  22   PSSNNTFFLGGAGHRGLEVEGKFVKFSVIGVYLEENVVPFLAAKWKGKSSEELTYSLEFF  81

Query  473  ETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETALSTFRTIFQG  303
              I   P EK + + L+  + GK F + +     AI   I + S  +  A+  F  IFQ 
Sbjct  82   RDIVTGPFEKFMRVTLLLPLTGKQFSEKVAGNCVAIMKSIGTYSDAERLAIVKFLNIFQS  141

Query  302  RPLKKGTFIVLTWVDPTKMLVCVSSD-ATPSSIDAKIESANVTSALFDVFLGRNPVSPSL  126
                 G  I+ T      + +  S D + P S +A +E+  ++ A+ +  +G+N VSP+ 
Sbjct  142  ETFSSGASILFTQSVVGSLTISFSDDDSVPGSGNAVVENKPLSEAVLESMIGKNGVSPAA  201

Query  125  KASVANGLEVVLK  87
            K S+A  +  +L+
Sbjct  202  KRSLAKRVSEMLE  214



>ref|XP_004238994.1| PREDICTED: chalcone--flavonone isomerase [Solanum lycopersicum]
Length=226

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 83/178 (47%), Gaps = 5/178 (3%)
 Frame = -3

Query  626  LLGTGYREKVFAIIGVKVYAAGLYVNESILNKL-DAWRGRSAAELQNDSPLFETIFKAPL  450
            L G G R        VK  A G+Y+ ES +  L D W+G+S+ EL++    F  I   P 
Sbjct  30   LAGAGNRGLEIEGKFVKFTAIGVYLEESAIPFLADKWKGKSSEELEHSVEFFRDIVTGPF  89

Query  449  EKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETALSTFRTIFQGRPLKKGTF  279
            EK   + ++  + GK + + + E   A    I + S  +  A+  F  +FQ      G  
Sbjct  90   EKFTRVTMILPLTGKQYSEKVAENCVAYWKAIGTYSDAEMQAIEKFLDVFQSETFPPGAS  149

Query  278  IVLTWVDPTKMLVCVSS-DATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVAN  108
            I+ T      + +  S  D+ P   +A IE+  ++ A+ D  +G + VSP+ K S+A 
Sbjct  150  ILFTQSPLGSLTISFSEDDSVPCVGNAVIENKQLSEAVLDSIIGEHGVSPAAKCSIAK  207



>gb|AGM46640.1| chalcone isomerase protein, partial [Apium graveolens]
Length=210

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 93/202 (46%), Gaps = 5/202 (2%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA  504
            N  F  ++  P    +L L G G R        VK  A G+Y+ E+ +  L   W G++A
Sbjct  8    NYVFPPTVKPPASTNTLLLGGAGVRGLEIEGKFVKFTAIGVYLEENAVPLLAVKWNGKTA  67

Query  503  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS--ADDET-A  333
             EL +    F  I   P EK + + ++  + G+ + + + E      K+     D E  A
Sbjct  68   EELTDSVDFFRDIVTGPFEKFIQVTMILPLTGQQYSEKVSENCVANWKAVGIYTDAEAKA  127

Query  332  LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVF  156
            +  F  +F+      G  I+ T      + +C S D + P + +A IE+  ++ A+ +  
Sbjct  128  IEKFLEVFKDENFPPGASILFTQSPLGSLTLCFSKDGSIPETGNAVIENKQLSEAVLESM  187

Query  155  LGRNPVSPSLKASVANGLEVVL  90
            +G+N VSP+ K S+A  L ++ 
Sbjct  188  IGKNGVSPAAKQSLATRLSLLF  209



>gb|EYU35208.1| hypothetical protein MIMGU_mgv1a024098mg [Erythranthe guttata]
Length=365

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 91/188 (48%), Gaps = 8/188 (4%)
 Frame = -3

Query  635  SLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKA  456
            +L LL  G  +     + +K  A G+Y++  I+  L  W+G+SAA+L  D   FE I  A
Sbjct  178  TLPLLANGITDIEIHFLQIKFTAIGVYLDPEIVTHLIKWKGKSAADLAKDDDFFEAIISA  237

Query  455  PLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS---ADDETALSTFRTIFQGRPLKKG  285
            P+EK + +V+++++ G  F   ++ A+  R+        ++E AL      FQ +  K  
Sbjct  238  PVEKLIRVVVIKEIKGSQFGVQIESAVRDRLAEVDKFEEEEEEALEQLVDFFQSKYFKTD  297

Query  284  TFIVLTW--VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKASV  114
            + +   +    PT  +V        S I+ K  + NV   +   +L G + VS +  +S+
Sbjct  298  SVLTFYFPTTSPTAEIVVAIEGKEESKIEVK--NGNVAEMIKKWYLGGSSGVSSTTISSL  355

Query  113  ANGLEVVL  90
            AN L + L
Sbjct  356  ANALSLQL  363



>ref|NP_001151452.1| chalcone--flavonone isomerase [Zea mays]
 gb|ACF88309.1| unknown [Zea mays]
 gb|ACG42924.1| chalcone--flavonone isomerase [Zea mays]
 gb|ACN33297.1| unknown [Zea mays]
 gb|ACR36618.1| unknown [Zea mays]
 tpg|DAA59281.1| TPA: chalcone--flavonone isomerase [Zea mays]
Length=227

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 97/199 (49%), Gaps = 18/199 (9%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNE---------SILNKLDAWRGRSAAELQNDSP  480
            LSLLGTG  +     + +K  A G+Y++          ++L  L AW+G++A EL  D+ 
Sbjct  25   LSLLGTGITDIEIHFLQIKYNAIGVYLHNAGGGDSTTPTLLGHLGAWKGKTAEELLADAA  84

Query  479  LFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSP---SADDETALSTFRTIF  309
             +  +  AP+EK   +V+++++ G  +   L+ ++  R+ +      D+E AL      F
Sbjct  85   FWAALVAAPVEKLFRVVVIKEIKGSQYGVQLESSVRDRLAAADLYEDDEEEALEKVADFF  144

Query  308  QGRPLKKGTFIVLTWVDPTKMLVCVSSD---ATPSSIDAKI--ESANVTSALFDVFLGRN  144
            Q +  K G+ +   +  P       +++   AT    DA+I  E+ NV   +   +LG +
Sbjct  145  QSKYFKPGSVVTFHFPAPASASPGPAAEITFATEGKGDARIAVENGNVAGMIQTWYLGGD  204

Query  143  -PVSPSLKASVANGLEVVL  90
              VSPS   S+AN    +L
Sbjct  205  SAVSPSTVRSLANRFAALL  223



>gb|AFM36772.1| chalcone isomerase [Narcissus tazetta var. chinensis]
Length=244

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/199 (25%), Positives = 92/199 (46%), Gaps = 13/199 (7%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYR-----EKVFAIIGVKVYAAGLYVNESILNKLDAWR  516
             + F   ++ PG   +  L G G R     +K  A   + +Y      N+++    + WR
Sbjct  18   GIAFPAVITPPGSFKAHFLGGAGVRGLKIDDKFIAFTAIAIYLE----NDAVKTLAEKWR  73

Query  515  GRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSAD  345
            G+ A E  +    F  I+  P EK   +V++  + G  + + + E   A    I   +  
Sbjct  74   GKGAEECSDSMDFFRDIYAGPFEKFTQVVMLLPLTGDQYTEKVSENCVAYWKAIGIYTDA  133

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSAL  168
            +  A+  F+ +F+G+    G+ I+ T    + + +  S DA+ P +  A IE+  +T A+
Sbjct  134  EAAAIEKFKGVFKGQSFPPGSSILFTHSPTSSLTIAFSKDASIPEAGAAVIENKALTQAI  193

Query  167  FDVFLGRNPVSPSLKASVA  111
             +  +G + VSP+ K S+A
Sbjct  194  LESIIGEHGVSPAAKQSLA  212



>gb|AIC73814.1| chalcone isomerase [Hibiscus cannabinus]
Length=209

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 88/185 (48%), Gaps = 12/185 (6%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSL G G  +     + +K  A G+Y+   ++  L  W+G+    L  D   FE +  AP
Sbjct  23   LSLFGHGITDIEIHFLQIKFTAIGVYLEPQVVGHLQQWKGKPGNVLAEDDDFFEALINAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE------TALSTFRTIFQGRPLK  291
            +EK + +V+++++ G  +   L+ A+  R+   +ADD+       AL      FQ +  K
Sbjct  83   VEKFVRVVVIKEIKGSQYGVQLESAVRDRL---AADDKYEEEEEEALEKVVEFFQSKYFK  139

Query  290  KGTFIVLTW-VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFL-GRNPVSPSLKAS  117
            K + I   +  +     +  SS+    +   K+E+ANV   +   +L G   VS +  + 
Sbjct  140  KDSVITYHFPANSAAAEIAFSSEGKEEA-KIKVENANVVEMIKKWYLGGTRGVSATTISC  198

Query  116  VANGL  102
            +ANGL
Sbjct  199  LANGL  203



>ref|XP_006850622.1| hypothetical protein AMTR_s00034p00169920 [Amborella trichopoda]
 gb|ERN12203.1| hypothetical protein AMTR_s00034p00169920 [Amborella trichopoda]
Length=221

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 85/187 (45%), Gaps = 7/187 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLD-AWRGRSAAELQNDSPLFETIFKA  456
            L+L G G R      + VK     LY+ E+ +  L+  W+G+SA EL      F  I   
Sbjct  33   LALGGAGVRGVERGGVFVKSTCMALYMEEAAVYDLEPKWKGKSAEELLASPNFFMDIVNC  92

Query  455  PLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSA----DDETALSTFRTIFQGRPLKK  288
            P +K   + ++  +DG+ F   + + +   +++           AL  F   F+G+ L  
Sbjct  93   PFQKMSHMAMISTLDGEEFSGKVVDKLKAIMEASGTFSPQQSLLALHKFLEAFKGKMLTY  152

Query  287  GTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVA  111
            G+ I   +     +L+ ++ D + P   D  IE   +T AL D  +G + VSP+ K SVA
Sbjct  153  GSAIFFAY-SKAGLLIAITEDGSVPEQEDVMIEDKALTQALLDSIIGEHGVSPAAKRSVA  211

Query  110  NGLEVVL  90
              L   L
Sbjct  212  KRLSEAL  218



>ref|XP_009396862.1| PREDICTED: chalcone--flavonone isomerase [Musa acuminata subsp. 
malaccensis]
Length=236

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 82/170 (48%), Gaps = 5/170 (3%)
 Frame = -3

Query  581  VKVYAAGLYVNESILNKLDA-WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGK  405
            V   A G+Y+ ++ +  L + W+G+SA EL      F  IF  P EK   + L++ + G+
Sbjct  49   VAFTAIGVYLEDAAVQSLASKWKGKSADELDGAVEFFRDIFGGPFEKFTRVTLLKPLTGQ  108

Query  404  TFWDALDEAISPRIKSP---SADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCV  234
             + + + E  + + K+    +  D  AL  F+  F+      G+ I+ T      +L+  
Sbjct  109  QYAEKVSENCTAQWKAAGVYAEADGAALEQFKEAFRAETFPPGSSILFTHAPSDSLLIAF  168

Query  233  SSDAT-PSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVLK  87
            S D + P +  A I++  ++  + +  +G N VSP  K S+A     +LK
Sbjct  169  SKDGSMPEAGIAMIQNQPLSQGILESIIGENGVSPGAKRSLALRFSELLK  218



>gb|AFM36773.1| chalcone isomerase [Narcissus tazetta var. chinensis]
Length=244

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/206 (25%), Positives = 93/206 (45%), Gaps = 13/206 (6%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYRE-----KVFAIIGVKVYAAGLYVNESILNKLDAWR  516
             + F   ++ PG   +  L G G R      K  A   + +Y      N+++    + WR
Sbjct  18   GIAFPAVITPPGSSKAHFLGGAGVRGLKIDGKFIAFTAIAIYLE----NDAVKTLAEKWR  73

Query  515  GRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSAD  345
            G+ A E  +    F  I+  P EK   +V++  + G  + + + E   A    I   +  
Sbjct  74   GKGAEECSDSMDFFRDIYAGPFEKFTQVVMLLPLTGDQYTEKVSENCVAYWKAIGIHTDA  133

Query  344  DETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSAL  168
            +  A+  F+ +F+G+    G+ I+ T      + +  S DA+ P +  A IE+  +T A+
Sbjct  134  EAAAIEKFKGVFKGQSFPPGSSILFTHSPTGSLTIAFSKDASIPEAGAAVIENKALTQAI  193

Query  167  FDVFLGRNPVSPSLKASVANGLEVVL  90
             +  +G + VSP+ K S+A  L  +L
Sbjct  194  LESIIGEHGVSPAAKQSLALRLSEIL  219



>ref|NP_001242041.1| chalcone isomerase 4B [Glycine max]
 gb|ACU13171.1| unknown [Glycine max]
Length=227

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/166 (28%), Positives = 83/166 (50%), Gaps = 7/166 (4%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  453
            LSLLG G  +     I VK Y+ G+Y+   ++  L+ ++G SA EL+ +   F  +  AP
Sbjct  23   LSLLGHGITDMEIHFIHVKFYSIGIYLEPEVVGHLEQFKGISAKELEENDEFFNALISAP  82

Query  452  LEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTI---FQGRPLKKGT  282
            +EK + +V+++++ G  +   ++ A+  R+ +    +E        +   FQ +  KK +
Sbjct  83   VEKFIRLVVIKEIKGAQYGVQIETAVRDRLAAEDKYEEEEEEALEKVIEFFQSKYFKKHS  142

Query  281  FIVLTWVDPTKMLVCVSSDATPSSIDAK--IESANVTSALFDVFLG  150
              V+T+  PT         +     D+K  IE+ANV  A+   +LG
Sbjct  143  --VITYHFPTNSATAEIVVSLEGKEDSKYVIENANVVEAVKKWYLG  186



>gb|ADQ13184.1| chalcone isomerase [Scutellaria baicalensis]
Length=215

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 89/198 (45%), Gaps = 5/198 (3%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA  504
            +++F  +   PG   +L L G G R        VK  A G+Y+ +S +  L   W+G++A
Sbjct  14   SIEFSPAAKPPGSSNTLFLGGAGVRGMEIQGNFVKFTAIGVYLEDSAVPSLAVNWKGKTA  73

Query  503  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA  333
             EL      F  I   P EK   + ++  + GK + + + E   A    +   +  +  A
Sbjct  74   EELTESDDFFREIVSGPFEKFTKVTMILPLTGKQYSEKVAENCVAYWKAVGKYTDAESEA  133

Query  332  LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVF  156
            +  F  +F+      G  I+ T      + +  S D + P    A IE+  ++ A+ +  
Sbjct  134  IDKFLQVFKDETFAPGASILFTQSPACSLTISFSKDGSIPEQGKAVIENKQLSEAVLESI  193

Query  155  LGRNPVSPSLKASVANGL  102
            +G++ VSPS K S+A  L
Sbjct  194  IGKHGVSPSAKQSLAARL  211



>gb|AJO67964.1| chalcone isomerase [Prunus avium]
Length=238

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/200 (28%), Positives = 92/200 (46%), Gaps = 5/200 (3%)
 Frame = -3

Query  671  FQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAEL  495
            F  S+  PG   +L L G G R        VK  A G+Y+ E  +  L   W+G++A EL
Sbjct  17   FPPSVKPPGSANTLFLGGAGVRGLEIQGNFVKFTAIGVYLEEKAVPLLAVKWKGKTAQEL  76

Query  494  QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETALST  324
                  F  I   P EK   +  +  + G+ + + + E   AI   I   +  +  A+  
Sbjct  77   TESVEFFREIVTGPFEKFTQVTTILPLTGQQYSEKVSENCVAIWKSIGIYTDAEAKAIEK  136

Query  323  FRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFLGR  147
            F  +F+ +    G  I+ T      + +  S DA+ P + +A IE+  ++ A+ +  +G+
Sbjct  137  FLEVFKDQNFPPGASILFTQSPKGSLTISFSKDASVPEAGNAVIENKLLSEAVLESIIGK  196

Query  146  NPVSPSLKASVANGLEVVLK  87
            + VSP  + SVA  L  +LK
Sbjct  197  HGVSPGARQSVAARLSELLK  216



>gb|KIY97814.1| chalcone-flavanone isomerase [Monoraphidium neglectum]
Length=252

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 84/182 (46%), Gaps = 14/182 (8%)
 Frame = -3

Query  602  KVFAI--IGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIV  429
            ++FA+   GV+VY+  +YV     +K    R R     +ND      +      K+L   
Sbjct  60   RLFAVPVSGVRVYSVAVYVEAERCSKELGIRARGGF-FENDGDFCAALLDGAFGKALVFK  118

Query  428  LVRDVDGKTFWDALDEAISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTW-----  264
            L+RD+ G+ F +A+DEA++PR K     D  +L  F   F  R L K T +   W     
Sbjct  119  LLRDITGQQFAEAIDEALAPRAKVTG--DSASLQQFGQFFASRQLPKDTQVAFVWPLKGG  176

Query  263  ----VDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEV  96
                +    +L   + D   ++ + +I S  +  ALF+++LG + V P  + + A G   
Sbjct  177  EAGELQAEVVLPGEAKDLVTTAPELRIPSPGLARALFELYLGDSSVVPEGRPAWAAGARE  236

Query  95   VL  90
            +L
Sbjct  237  LL  238



>dbj|BAJ21533.1| chalcone isomerase [Dahlia pinnata]
Length=224

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 96/199 (48%), Gaps = 7/199 (4%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA  504
            ++ F  S+  PG  T+  L G G R        VK    G+Y+ +  ++ L   W+G++A
Sbjct  8    SIVFPPSVKPPGATTTFFLAGAGVRGLEIQGNFVKFTGIGIYLEDKAISSLAVKWKGKTA  67

Query  503  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKS---PSADDETA  333
             EL +    F  I   P EK   + ++  + G+ + + + E      KS    +  D  A
Sbjct  68   HELTDSVDFFRDIVTGPFEKFSQVTMILPLTGQQYAEKVSENCVAAWKSLGIYTEADAKA  127

Query  332  LSTFRTIFQGRPLKKGTFIVLTWVDPTKML-VCVSSDAT-PSSIDAKIESANVTSALFDV  159
            +  F  IF+ +    G+ I+ T + P  +L +  S D + P + +A +E+  +  A+ + 
Sbjct  128  IDKFLEIFKDQHFPPGSSILFT-ISPAGLLTISFSKDGSIPEAGNAVLENEKLGEAIIES  186

Query  158  FLGRNPVSPSLKASVANGL  102
             +G++ VSP+ K S+A+ L
Sbjct  187  MIGKHGVSPAAKQSLASRL  205



>ref|XP_004977383.1| PREDICTED: probable chalcone--flavonone isomerase 3-like [Setaria 
italica]
Length=215

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/189 (26%), Positives = 94/189 (50%), Gaps = 10/189 (5%)
 Frame = -3

Query  632  LSLLGTGYREKVFAIIGVKVYAAGLYV--NESILNKLDAWRGRSAAELQNDSPLFETIFK  459
            LSLL  G  +     + +K  A G+Y+  N ++L+ L +W+G++A EL  D   F+ +  
Sbjct  25   LSLLANGITDIEIHFLQIKYNAIGIYLHNNHALLHHLQSWKGKTADELLGDDAFFQALVS  84

Query  458  APLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSA---DDETALSTFRTIFQGRPLKK  288
            AP+EK   +V+++++ G  +   L+ ++  R+ +      ++E  L      FQ +  K 
Sbjct  85   APVEKLFRVVVIKEIKGSQYGVQLESSVRDRLVAADKYDDEEEEVLEKVAEFFQSKYFKP  144

Query  287  GTFIVLTWVDPTKMLVCVSSDATPSSIDAK--IESANVTSALFDVFL-GRNPVSPSLKAS  117
             +  V+T+  P        S AT    +AK  +++ NV + +   +L G +  SP+   S
Sbjct  145  SS--VITFHFPATPGAAEISFATEGKDEAKMRVDNENVAAMIQKWYLGGESAASPTTVQS  202

Query  116  VANGLEVVL  90
            +A+    +L
Sbjct  203  LADRFAALL  211



>gb|AJR10104.1| chalcone flavanone isomerase [Scutellaria baicalensis]
Length=215

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/195 (26%), Positives = 88/195 (45%), Gaps = 5/195 (3%)
 Frame = -3

Query  680  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA  504
            +++F  +   PG   +L L G G R        VK  A G+Y+ +S +  L   W+G++A
Sbjct  14   SIEFSPAAKPPGSSNTLLLGGAGVRGMEIQGNFVKFTAIGVYLEDSAVPSLAVNWKGKTA  73

Query  503  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA  333
             EL      F  I   P EK   + ++  + GK + + + E   A    +   +  +  A
Sbjct  74   EELTESDDFFREIVSGPFEKFTKVTMILPLTGKQYSEKVAENCVAYWKAVGKYTDAESEA  133

Query  332  LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVF  156
            +  F  +F+      G  I+ T      + +  S D + P    A IE+  ++ A+ +  
Sbjct  134  IDKFLQVFKDETFAPGASILFTQSPAGSLTISFSKDGSIPEQGKAVIENKQLSEAVLESI  193

Query  155  LGRNPVSPSLKASVA  111
            +G++ VSPS K S+A
Sbjct  194  IGKHGVSPSAKQSLA  208



>gb|ABA55017.2| chalcone isomerase [Astragalus mongholicus]
Length=219

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 88/194 (45%), Gaps = 5/194 (3%)
 Frame = -3

Query  677  VKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL-DAWRGRSAA  501
            ++F   +S PG   S  L G G R        +     G+Y+ E+ +  L   W+G++ A
Sbjct  15   LEFPPVVSPPGSTKSYFLGGAGVRGLDINGQFITFTGIGVYLEENAIASLAPKWKGKTPA  74

Query  500  ELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSP---SADDETAL  330
            EL      +  I K P EK +    ++ +DG  +   + E  +  IKS    S  +E A+
Sbjct  75   ELIQSLDFYRDIIKGPFEKLVRGSKLKKLDGNEYVRKVSENCASFIKSEGIHSEAEEKAI  134

Query  329  STFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFL  153
              FR  F+ R    G+ +        ++ +  S D T P    A I +  ++ A+ +  +
Sbjct  135  EEFREAFKDRVFPPGSTVFYRQSPAGELGLSFSKDETVPEHEHAVINNKALSEAVLETMI  194

Query  152  GRNPVSPSLKASVA  111
            G  PVSP+LK S+A
Sbjct  195  GEIPVSPALKESLA  208



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1752914777460