BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF040I04

Length=858
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     375   5e-122   Nelumbo nucifera [Indian lotus]
gb|ACU17965.1|  unknown                                                 360   5e-122   Glycine max [soybeans]
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...    375   6e-122   
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     375   7e-122   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB72130.1|  heat shock protein 70                                  375   7e-122   Cucumis sativus [cucumbers]
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     375   7e-122   Cucumis melo [Oriental melon]
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    374   1e-121   Nelumbo nucifera [Indian lotus]
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    374   2e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    372   6e-121   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO36486.1|  hypothetical protein CISIN_1g020168mg                   361   7e-121   Citrus sinensis [apfelsine]
emb|CAA67588.1|  70 kD heatshockprotein                                 357   9e-121   Medicago sativa [alfalfa]
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             371   1e-120   Citrus clementina [clementine]
gb|ACJ11745.1|  heat shock protein 70                                   371   2e-120   Gossypium hirsutum [American cotton]
gb|EAY81899.1|  hypothetical protein OsI_37065                          364   2e-120   Oryza sativa Indica Group [Indian rice]
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                371   2e-120   Erythranthe guttata [common monkey flower]
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       370   2e-120   Cucurbita maxima [Boston marrow]
ref|XP_002311161.1|  heat shock protein 70                              370   3e-120   Populus trichocarpa [western balsam poplar]
gb|KJB20110.1|  hypothetical protein B456_003G133400                    370   3e-120   Gossypium raimondii
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             370   4e-120   Citrus clementina [clementine]
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    370   7e-120   Elaeis guineensis
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         369   7e-120   Jatropha curcas
ref|XP_002527736.1|  heat shock protein, putative                       369   1e-119   Ricinus communis
gb|ACJ11741.1|  heat shock protein 70                                   369   1e-119   Gossypium hirsutum [American cotton]
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     369   1e-119   Elaeis guineensis
ref|XP_004142750.1|  PREDICTED: heat shock cognate 70 kDa protein...    367   1e-119   
gb|ABG22609.1|  Heat shock cognate 70 kDa protein, putative, expr...    365   2e-119   Oryza sativa Japonica Group [Japonica rice]
gb|KJB16979.1|  hypothetical protein B456_002G258500                    368   2e-119   Gossypium raimondii
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    368   2e-119   Phoenix dactylifera
ref|XP_002316294.1|  heat shock protein 70                              368   2e-119   Populus trichocarpa [western balsam poplar]
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...    368   2e-119   Cucumis sativus [cucumbers]
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    368   2e-119   Phoenix dactylifera
gb|KDP35613.1|  hypothetical protein JCGZ_09051                         368   2e-119   Jatropha curcas
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    368   3e-119   Phoenix dactylifera
gb|ACJ11742.1|  heat shock protein 70                                   368   3e-119   Gossypium hirsutum [American cotton]
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    368   3e-119   Populus euphratica
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         368   3e-119   Jatropha curcas
gb|AEO13403.1|  heat shock 70                                           365   4e-119   Glycine max [soybeans]
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       367   5e-119   Glycine soja [wild soybean]
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     367   5e-119   
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    367   5e-119   Cicer arietinum [garbanzo]
dbj|BAA34919.1|  heat shock protein 70 cognate                          359   5e-119   Salix gilgiana
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     367   6e-119   Glycine max [soybeans]
gb|ABP01597.1|  heat shock protein 70                                   355   6e-119   Ageratina adenophora
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     367   6e-119   Vigna radiata [mung bean]
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    367   6e-119   
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    367   7e-119   Populus euphratica
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             367   7e-119   Phaseolus vulgaris [French bean]
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...    367   8e-119   
gb|ADZ46371.1|  HSP70                                                   367   9e-119   Malus hupehensis
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       366   1e-118   Cucumis melo [Oriental melon]
ref|XP_002312089.1|  heat shock protein 70 cognate                      366   1e-118   
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             366   1e-118   Prunus persica
gb|ABG22608.1|  Heat shock cognate 70 kDa protein, putative, expr...    365   2e-118   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ11740.1|  heat shock protein 70                                   366   2e-118   Gossypium hirsutum [American cotton]
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    366   2e-118   Pyrus x bretschneideri [bai li]
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    366   2e-118   
ref|XP_001783063.1|  predicted protein                                  351   2e-118   
ref|XP_010042813.1|  PREDICTED: probable mediator of RNA polymera...    358   2e-118   Eucalyptus grandis [rose gum]
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     365   2e-118   
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     365   2e-118   Populus euphratica
gb|KHN48981.1|  Heat shock cognate 70 kDa protein                       363   2e-118   Glycine soja [wild soybean]
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    365   5e-118   Nicotiana sylvestris
gb|AAK59628.2|  putative dnaK-type molecular chaperone hsc70.1 pr...    350   5e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    365   5e-118   Nicotiana tomentosiformis
gb|KJB46580.1|  hypothetical protein B456_007G375600                    365   5e-118   Gossypium raimondii
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     365   6e-118   
gb|EAZ19310.1|  hypothetical protein OsJ_34853                          364   6e-118   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001068540.1|  Os11g0703900                                       364   9e-118   
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    364   9e-118   Oryza brachyantha
emb|CDP09040.1|  unnamed protein product                                364   9e-118   Coffea canephora [robusta coffee]
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       364   9e-118   Medicago truncatula
gb|AAP42157.1|AF509339_1  heat shock protein 70                         357   1e-117   Saussurea medusa
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    363   1e-117   Populus euphratica
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          363   1e-117   
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     363   1e-117   Sesamum indicum [beniseed]
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       362   1e-117   Medicago truncatula
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    363   1e-117   Solanum lycopersicum
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    363   2e-117   Solanum tuberosum [potatoes]
gb|AEX55235.1|  heat shock protein 70                                   354   2e-117   Allium sativum
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    363   2e-117   Glycine max [soybeans]
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    363   3e-117   Citrus sinensis [apfelsine]
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    363   3e-117   Nicotiana sylvestris
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    363   3e-117   Fragaria vesca subsp. vesca
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    363   3e-117   Nicotiana tomentosiformis
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             363   3e-117   Citrus clementina [clementine]
gb|AAR17080.1|  heat shock protein 70-3                                 362   4e-117   Nicotiana tabacum [American tobacco]
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             362   4e-117   Phaseolus vulgaris [French bean]
gb|KDP44987.1|  hypothetical protein JCGZ_01487                         362   5e-117   Jatropha curcas
gb|AIU34470.1|  putative heat shock protein                             362   5e-117   Taraxacum brevicorniculatum
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    362   6e-117   Nicotiana tomentosiformis
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       362   7e-117   Medicago truncatula
gb|AFA51946.1|  heat shock protein 70                                   362   7e-117   Paeonia suffruticosa [moutan peony]
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    362   7e-117   Prunus mume [ume]
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    362   8e-117   Nicotiana tomentosiformis
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           362   8e-117   Cucurbita maxima [Boston marrow]
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    362   8e-117   
ref|XP_004156719.1|  PREDICTED: heat shock cognate 70 kDa protein...    358   9e-117   
emb|CAA47948.2|  heat shock protein 70                                  361   9e-117   Oryza sativa Indica Group [Indian rice]
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    371   1e-116   
ref|XP_002528432.1|  heat shock protein, putative                       361   1e-116   Ricinus communis
gb|KHG00348.1|  Heat shock 70 kDa 4 -like protein                       358   1e-116   Gossypium arboreum [tree cotton]
gb|ADD71975.1|  heat shock protein 70                                   361   1e-116   Rhododendron calophytum
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...    357   2e-116   Populus euphratica
ref|XP_006378714.1|  heat shock protein 70 cognate                      360   2e-116   Populus trichocarpa [western balsam poplar]
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             360   2e-116   Prunus persica
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             360   2e-116   Citrus clementina [clementine]
gb|AEK70336.1|  heat shock protein 70                                   360   3e-116   Paeonia lactiflora [common garden peony]
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    360   3e-116   Phoenix dactylifera
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    360   3e-116   Populus euphratica
gb|AAB65162.1|  heat shock cognate protein                              350   4e-116   Solanum commersonii
gb|KJB55903.1|  hypothetical protein B456_009G100400                    360   4e-116   Gossypium raimondii
gb|AAP04522.1|  heat shock protein 70                                   360   4e-116   Nicotiana tabacum [American tobacco]
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    360   5e-116   Sesamum indicum [beniseed]
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    359   7e-116   Tarenaya hassleriana [spider flower]
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        359   7e-116   Morus notabilis
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             358   7e-116   
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    359   8e-116   Prunus mume [ume]
gb|AAA62445.1|  heat shock protein                                      359   9e-116   Spinacia oleracea
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     359   9e-116   Vigna radiata [mung bean]
ref|XP_007009369.1|  Heat shock protein 70                              359   1e-115   
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        359   1e-115   Morus notabilis
gb|ABP35942.1|  heat shock protein 70                                   358   1e-115   Cyclamen persicum
ref|XP_002532297.1|  heat shock protein, putative                       358   1e-115   Ricinus communis
gb|ACB70177.1|  70 kDa heat shock protein                               358   1e-115   Capparis spinosa [caper]
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    358   2e-115   Nicotiana sylvestris
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     358   2e-115   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    358   3e-115   Cucumis melo [Oriental melon]
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    357   3e-115   Glycine max [soybeans]
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    358   3e-115   Tarenaya hassleriana [spider flower]
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    357   3e-115   Cicer arietinum [garbanzo]
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    357   3e-115   Populus euphratica
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    357   3e-115   
gb|EAY98319.1|  hypothetical protein OsI_20227                          350   3e-115   Oryza sativa Indica Group [Indian rice]
emb|CAB72129.1|  heat shock protein 70                                  357   3e-115   Cucumis sativus [cucumbers]
gb|AAL85887.1|AF479058_1  70 kDa heat shock protein                     347   4e-115   Sandersonia aurantiaca [Chinese-lantern lily]
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       357   4e-115   Glycine soja [wild soybean]
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             357   5e-115   Phaseolus vulgaris [French bean]
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    357   5e-115   Elaeis guineensis
gb|AAM48131.1|AF509336_1  heat shock protein 70                         357   5e-115   Saussurea medusa
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       357   5e-115   Phaseolus vulgaris [French bean]
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...    357   5e-115   
dbj|BAP90755.1|  heat shock protein 70                                  357   6e-115   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    357   7e-115   Pyrus x bretschneideri [bai li]
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    357   7e-115   Fragaria vesca subsp. vesca
emb|CAA55184.1|  heat shock protein 70 kDa                              342   8e-115   Zea mays [maize]
ref|XP_002805956.1|  PREDICTED: heat shock cognate 70 kDa protein...    342   8e-115   
gb|ABX76301.1|  heat shock protein 70                                   356   9e-115   Ageratina adenophora
emb|CCJ09763.1|  putative heat shock protein-70kDa                      342   9e-115   Hirudo medicinalis
ref|XP_002312090.1|  heat shock protein 70 cognate                      356   9e-115   Populus trichocarpa [western balsam poplar]
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    356   1e-114   
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    356   1e-114   Pyrus x bretschneideri [bai li]
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    356   1e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             356   1e-114   Phaseolus vulgaris [French bean]
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    356   1e-114   Fragaria vesca subsp. vesca
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    356   2e-114   Tarenaya hassleriana [spider flower]
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             355   2e-114   Populus trichocarpa [western balsam poplar]
gb|AAV97978.1|  heat shock protein hsp70                                355   2e-114   Saussurea medusa
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    355   2e-114   
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    355   2e-114   Solanum tuberosum [potatoes]
gb|ABR13285.1|  putative dnaK-type molecular chaperone hsc70.1          339   2e-114   Prunus dulcis [sweet almond]
gb|EAY89450.1|  hypothetical protein OsI_10982                          348   2e-114   Oryza sativa Indica Group [Indian rice]
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    357   2e-114   
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    355   3e-114   Cicer arietinum [garbanzo]
ref|XP_001767839.1|  predicted protein                                  355   3e-114   
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    355   3e-114   Pyrus x bretschneideri [bai li]
gb|AIA22210.1|  heat shock protein 70                                   355   4e-114   Chrysanthemum indicum
emb|CAA83548.1|  PsHSC71.0                                              355   4e-114   Pisum sativum [garden pea]
gb|EEC71767.1|  hypothetical protein OsI_04375                          347   4e-114   Oryza sativa Indica Group [Indian rice]
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    355   4e-114   Tarenaya hassleriana [spider flower]
gb|AGR45355.1|  HSP70                                                   354   5e-114   Dendrobium officinale
ref|XP_004492129.1|  PREDICTED: heat shock cognate 70 kDa protein...    351   6e-114   
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    354   7e-114   Oryza brachyantha
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       354   7e-114   Cucurbita maxima [Boston marrow]
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     354   7e-114   Nicotiana sylvestris
emb|CDP00073.1|  unnamed protein product                                353   7e-114   Coffea canephora [robusta coffee]
gb|ADB85350.1|  putative heat shock cognate                             355   8e-114   Phyllostachys edulis [kikko-chiku]
ref|XP_001783048.1|  predicted protein                                  353   1e-113   
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    353   1e-113   Tarenaya hassleriana [spider flower]
gb|KDO67650.1|  hypothetical protein CISIN_1g0212722mg                  338   1e-113   Citrus sinensis [apfelsine]
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     353   1e-113   Vigna radiata [mung bean]
gb|KJB73858.1|  hypothetical protein B456_011G256600                    353   1e-113   Gossypium raimondii
gb|AAX07349.1|  heat shock protein 70                                   344   1e-113   Zea mays [maize]
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     353   1e-113   Triticum urartu
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             353   1e-113   Eutrema salsugineum [saltwater cress]
gb|AGL07711.1|  heat shock protein 70                                   353   1e-113   Ziziphus jujuba [Chinese jujube]
ref|XP_006574857.1|  PREDICTED: heat shock cognate 70 kDa protein...    351   1e-113   Glycine max [soybeans]
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     353   2e-113   Nicotiana tomentosiformis
ref|XP_010452091.1|  PREDICTED: probable mediator of RNA polymera...    343   2e-113   Camelina sativa [gold-of-pleasure]
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    353   2e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2     353   2e-113   Fragaria vesca subsp. vesca
ref|XP_001785822.1|  predicted protein                                  353   2e-113   
emb|CAA54419.1|  heat shock cognate 70-1                                352   2e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             352   2e-113   
ref|XP_002873056.1|  HSC70-1                                            352   3e-113   Arabidopsis lyrata subsp. lyrata
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    352   3e-113   Camelina sativa [gold-of-pleasure]
emb|CAA52684.1|  heat shock protein 70 cognate                          352   3e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             352   3e-113   Capsella rubella
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     352   3e-113   Vitis vinifera
gb|AFU34347.1|  70-kDa heat shock protein                               352   3e-113   Ipomoea batatas [batate]
ref|NP_195870.1|  heat shock cognate protein 70-1                       352   3e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             352   4e-113   Capsella rubella
ref|XP_006407675.1|  hypothetical protein EUTSA_v10020258mg             349   4e-113   
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             352   4e-113   Arabidopsis lyrata subsp. lyrata
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    352   5e-113   Camelina sativa [gold-of-pleasure]
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     352   5e-113   Prunus mume [ume]
dbj|BAD94888.1|  dnaK-type molecular chaperone hsc70.1 - like           344   5e-113   Arabidopsis thaliana [mouse-ear cress]
gb|ADN03965.1|  heat shock cognate 70 kDa protein                       350   6e-113   Phytolacca acinosa [food pokeberry]
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     352   6e-113   Glycine soja [wild soybean]
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    352   6e-113   Glycine max [soybeans]
gb|AHW48175.1|  heat shock protein 70                                   348   7e-113   Triticum aestivum [Canadian hard winter wheat]
gb|AEO22185.1|  CytHSP70                                                348   7e-113   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    351   8e-113   Solanum lycopersicum
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    351   9e-113   Solanum tuberosum [potatoes]
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          351   1e-112   Sorghum bicolor [broomcorn]
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    351   1e-112   Arabis alpina [alpine rockcress]
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    351   1e-112   
gb|ABD32895.1|  Heat shock protein Hsp70                                351   1e-112   Medicago truncatula
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     351   1e-112   
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     351   1e-112   Glycine soja [wild soybean]
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    350   1e-112   Nelumbo nucifera [Indian lotus]
gb|AAV98051.1|  heat shock protein 70                                   351   1e-112   Medicago sativa [alfalfa]
ref|XP_003621886.1|  Heat shock protein                                 350   1e-112   Medicago truncatula
ref|XP_003621869.1|  Heat shock protein                                 350   1e-112   Medicago truncatula
ref|NP_001055754.1|  Os05g0460000                                       350   2e-112   
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    351   2e-112   
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    350   2e-112   
gb|AAB88009.1|  heat shock cognate protein HSC70                        350   2e-112   Brassica napus [oilseed rape]
gb|ACM42161.1|  heat shock protein 70.58                                350   2e-112   Ageratina adenophora
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    350   2e-112   Fragaria vesca subsp. vesca
ref|XP_001751923.1|  predicted protein                                  350   2e-112   
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     350   4e-112   Vitis vinifera
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    349   4e-112   Brachypodium distachyon [annual false brome]
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    349   4e-112   Brassica rapa
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    349   4e-112   Brassica rapa
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    349   5e-112   Camelina sativa [gold-of-pleasure]
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     349   5e-112   
gb|ACJ85522.1|  unknown                                                 349   5e-112   Medicago truncatula
dbj|BAJ91305.1|  predicted protein                                      349   5e-112   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA55190.1|  TPA: heat shock protein70-4                            345   5e-112   
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    349   6e-112   Spinacia oleracea
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    349   6e-112   Elaeis guineensis
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             349   6e-112   Eutrema salsugineum [saltwater cress]
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    349   8e-112   Setaria italica
dbj|BAJ34054.1|  unnamed protein product                                349   8e-112   Eutrema halophilum
gb|AIZ68155.1|  heat shock protein 70                                   348   8e-112   Ornithogalum longebracteatum [sea-onion]
gb|ACR38891.1|  heat shock protein 70                                   348   8e-112   Apopellia endiviifolia (species B)
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    348   1e-111   Tarenaya hassleriana [spider flower]
emb|CCA29120.1|  heat shock protein 70 isoform 1                        348   1e-111   Solanum lycopersicum
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    348   1e-111   Camelina sativa [gold-of-pleasure]
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720          348   1e-111   Amborella trichopoda
ref|NP_001044757.1|  Os01g0840100                                       348   1e-111   
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    348   1e-111   Brachypodium distachyon [annual false brome]
ref|XP_002873055.1|  predicted protein                                  348   1e-111   Arabidopsis lyrata subsp. lyrata
ref|WP_039310754.1|  molecular chaperone DnaK                           348   1e-111   Paenibacillus sp. IHB B 3415
ref|NP_001049712.1|  Os03g0276500                                       348   1e-111   
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     348   1e-111   Brachypodium distachyon [annual false brome]
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     348   2e-111   Vitis vinifera
tpg|DAA44672.1|  TPA: hsp70 protein                                     345   2e-111   
emb|CAA55183.1|  heat shock protein 70 kDa                              333   2e-111   Zea mays [maize]
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          347   2e-111   Sorghum bicolor [broomcorn]
emb|CDP09035.1|  unnamed protein product                                347   2e-111   Coffea canephora [robusta coffee]
ref|XP_006649850.1|  PREDICTED: probable mediator of RNA polymera...    348   2e-111   
gb|ACD93209.1|  heat shock protein 70                                   348   3e-111   Camellia sinensis [black tea]
emb|CDY50531.1|  BnaA01g30490D                                          347   3e-111   Brassica napus [oilseed rape]
dbj|BAJ86014.1|  predicted protein                                      347   3e-111   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC76425.1|  hypothetical protein OsI_14101                          340   3e-111   Oryza sativa Indica Group [Indian rice]
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                347   3e-111   Arabidopsis lyrata subsp. lyrata
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     347   4e-111   Triticum urartu
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             347   5e-111   Phaseolus vulgaris [French bean]
ref|NP_195869.1|  heat shock protein 70                                 347   5e-111   Arabidopsis thaliana [mouse-ear cress]
emb|CDY52661.1|  BnaC01g38510D                                          346   7e-111   Brassica napus [oilseed rape]
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     346   7e-111   Petunia x hybrida [garden petunia]
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     349   7e-111   Triticum urartu
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     346   7e-111   Phoenix dactylifera
gb|EMS50129.1|  Heat shock cognate 70 kDa protein 1                     348   8e-111   Triticum urartu
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          346   8e-111   Sorghum bicolor [broomcorn]
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    346   1e-110   Petunia x hybrida [garden petunia]
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    346   1e-110   Phoenix dactylifera
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    345   1e-110   Setaria italica
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             345   1e-110   
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    345   1e-110   
gb|AII99890.1|  heat shock protein                                      351   1e-110   
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    345   2e-110   
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    345   2e-110   
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    345   2e-110   
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    345   2e-110   
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    345   2e-110   
gb|AAB42159.1|  Hsc70                                                   345   2e-110   
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    345   3e-110   
ref|XP_010911697.1|  PREDICTED: probable mediator of RNA polymera...    331   3e-110   
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     345   3e-110   
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    345   3e-110   
gb|AAB97316.1|  cytosolic heat shock 70 protein                         345   3e-110   
ref|NP_187555.1|  heat shock protein 70-3                               344   4e-110   
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    344   4e-110   
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             344   4e-110   
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    345   4e-110   
ref|XP_003625487.1|  Heat shock protein                                 346   5e-110   
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    344   6e-110   
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                344   6e-110   
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    344   6e-110   
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                344   7e-110   
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                343   7e-110   
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    343   8e-110   
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    343   9e-110   
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    343   1e-109   
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                343   1e-109   
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        343   1e-109   
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    343   1e-109   
gb|KFK33437.1|  hypothetical protein AALP_AA5G013700                    343   2e-109   
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                343   2e-109   
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    342   2e-109   
ref|XP_001759874.1|  predicted protein                                  343   2e-109   
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    343   2e-109   
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    342   2e-109   
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       344   2e-109   
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    349   2e-109   
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       342   3e-109   
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     342   3e-109   
gb|EPS68565.1|  hypothetical protein M569_06198                         342   3e-109   
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        342   3e-109   
emb|CCA29121.1|  heat shock protein 70 isoform 2                        342   4e-109   
emb|CDX73815.1|  BnaA03g32320D                                          342   5e-109   
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    341   6e-109   
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    341   6e-109   
emb|CDY00784.1|  BnaC03g37680D                                          341   7e-109   
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       341   7e-109   
ref|XP_010446275.1|  PREDICTED: probable mediator of RNA polymera...    340   7e-109   
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                341   8e-109   
ref|NP_001051724.1|  Os03g0821100                                       341   1e-108   
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     355   1e-108   
ref|XP_009122774.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    338   1e-108   
gb|EPS60056.1|  heat shock protein 70                                   340   1e-108   
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             340   1e-108   
ref|NP_187864.1|  heat shock protein 70-4                               340   1e-108   
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   2e-108   
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     342   2e-108   
gb|AAB99745.1|  HSP70                                                   340   2e-108   
emb|CAA05547.1|  heat shock protein 70                                  340   2e-108   
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     342   2e-108   
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             340   2e-108   
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          340   2e-108   
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    340   3e-108   
dbj|BAK00257.1|  predicted protein                                      339   3e-108   
gb|KJB36734.1|  hypothetical protein B456_006G174000                    339   5e-108   
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  339   6e-108   
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    339   6e-108   
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    338   6e-108   
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          338   8e-108   
ref|NP_001183165.1|  uncharacterized protein LOC100501536               338   9e-108   
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    337   1e-107   
gb|EMS51616.1|  Heat shock cognate 70 kDa protein 1                     340   2e-107   
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             338   2e-107   
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             338   2e-107   
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             337   2e-107   
gb|ACC93947.1|  heat-shock protein 70                                   335   1e-106   
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       335   1e-106   
emb|CDY40362.1|  BnaA10g27060D                                          329   1e-106   
emb|CAA27330.1|  heat shock protein 70                                  333   1e-106   
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    335   1e-106   
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       335   1e-106   
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       335   1e-106   
ref|XP_002446329.1|  hypothetical protein SORBIDRAFT_06g014400          333   1e-106   
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    333   5e-106   
gb|ACH61066.1|  heat shock protein 70 kDa                               320   5e-106   
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    347   9e-106   
prf||1205208A  heat shock protein hsp70                                 333   1e-105
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        333   1e-105   
gb|AIU40169.1|  heat shock protein 70                                   332   2e-105   
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    332   2e-105   
ref|XP_002512742.1|  heat shock protein, putative                       332   2e-105   
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    332   3e-105   
gb|ACH61090.1|  heat shock protein 70 kDa                               318   3e-105   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       332   4e-105   
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       331   5e-105   
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       331   5e-105   
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    331   7e-105   
gb|ACD45076.1|  heat-shock protein 70                                   330   1e-104   
gb|ABR18415.1|  unknown                                                 330   1e-104   
ref|XP_001421920.1|  Heat Shock Protein 70, cytosolic                   329   2e-104   
dbj|BAK02194.1|  predicted protein                                      329   3e-104   
gb|EAY89457.1|  hypothetical protein OsI_10990                          321   5e-104   
ref|NP_001049719.2|  Os03g0277300                                       321   5e-104   
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    327   5e-104   
gb|KHN17505.1|  Heat shock 70 kDa protein                               324   8e-104   
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                    327   1e-103   
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    327   2e-103   
ref|XP_007023492.1|  Heat shock protein 70B                             327   2e-103   
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       327   3e-103   
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein               327   4e-103   
emb|CDY49668.1|  BnaC06g01970D                                          322   4e-103   
gb|KJB83911.1|  hypothetical protein B456_013G270600                    326   4e-103   
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein               326   6e-103   
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    326   6e-103   
ref|XP_010094065.1|  Heat shock 70 kDa protein                          326   7e-103   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             325   8e-103   
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg             325   1e-102   
gb|EPS64948.1|  hypothetical protein M569_09829                         324   2e-102   
gb|KJB20862.1|  hypothetical protein B456_003G169700                    325   2e-102   
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg             325   2e-102   
gb|AEP40944.1|  heat shock protein 70 family protein                    310   2e-102   
gb|KDO55360.1|  hypothetical protein CISIN_1g038511mg                   323   2e-102   
ref|XP_003549537.1|  PREDICTED: heat shock 70 kDa protein-like is...    323   3e-102   
ref|NP_001140835.1|  uncharacterized protein LOC100272911               321   4e-102   
ref|XP_006368489.1|  heat shock protein 70 cognate                      324   4e-102   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               323   4e-102   
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                     327   6e-102   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    323   6e-102   
sp|P26413.1|HSP70_SOYBN  RecName: Full=Heat shock 70 kDa protein        323   7e-102   
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    323   1e-101   
ref|XP_003064239.1|  heat shock protein 70kDa                           323   1e-101   
ref|XP_002502667.1|  heat shock 70 kDa protein                          322   1e-101   
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1    322   1e-101   
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein               322   2e-101   
sp|P16121.2|HSP70_LUPPO  RecName: Full=Heat shock 70 kDa protein        309   2e-101   
gb|ACJ54890.1|  heat shock protein 70                                   322   2e-101   
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    322   3e-101   
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg             322   3e-101   
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    321   5e-101   
gb|AAS09825.1|  heat shock cognate protein 70                           320   9e-101   
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein               320   1e-100   
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          319   2e-100   
ref|NP_173055.1|  heat shock protein 70B                                318   6e-100   
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    321   9e-100   
ref|XP_009789460.1|  PREDICTED: heat shock 70 kDa protein               318   9e-100   
gb|AGT97046.1|  heat shock protein 70                                   317   1e-99    
ref|XP_006826662.1|  hypothetical protein AMTR_s00137p00032560          317   1e-99    
ref|XP_003610287.1|  Heat-shock protein                                 317   2e-99    
emb|CAA44820.1|  heat shock protein 70                                  314   2e-99    
emb|CEG00633.1|  Heat shock protein 70 family                           317   2e-99    
gb|ABK25453.1|  unknown                                                 317   2e-99    
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like          316   3e-99    
ref|XP_009615698.1|  PREDICTED: heat shock 70 kDa protein               316   4e-99    
ref|XP_002512741.1|  heat shock protein, putative                       316   4e-99    
ref|XP_011082530.1|  PREDICTED: heat shock 70 kDa protein-like          316   4e-99    
ref|XP_006341414.1|  PREDICTED: heat shock cognate 70 kDa protein...    316   4e-99    
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          316   5e-99    
ref|XP_003519161.1|  PREDICTED: heat shock 70 kDa protein-like          315   6e-99    
ref|XP_007512662.1|  Heat Shock Protein 70, cytosolic                   316   7e-99    
gb|KHN14134.1|  Heat shock 70 kDa protein                               315   1e-98    
ref|XP_010905019.1|  PREDICTED: heat shock 70 kDa protein               314   2e-98    
ref|XP_008353760.1|  PREDICTED: heat shock 70 kDa protein isoform X4    314   2e-98    
ref|XP_008794364.1|  PREDICTED: heat shock 70 kDa protein-like          314   2e-98    
ref|XP_011079384.1|  PREDICTED: heat shock 70 kDa protein               314   3e-98    
gb|KDP41951.1|  hypothetical protein JCGZ_26969                         313   3e-98    
ref|XP_007154870.1|  hypothetical protein PHAVU_003G154800g             313   5e-98    
gb|AAA82975.1|  PsHSP71.2                                               313   5e-98    
ref|XP_006346613.1|  PREDICTED: heat shock 70 kDa protein-like          313   6e-98    
ref|XP_010459142.1|  PREDICTED: heat shock 70 kDa protein 5-like        313   6e-98    
ref|XP_002892893.1|  HSP70B                                             312   7e-98    
emb|CDO98244.1|  unnamed protein product                                313   8e-98    
ref|XP_002987209.1|  hypothetical protein SELMODRAFT_125427             312   1e-97    
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein               312   1e-97    
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          312   1e-97    
ref|XP_010318701.1|  PREDICTED: heat shock 70 kDa protein 5             312   1e-97    
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          311   2e-97    
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          311   2e-97    
ref|XP_002976367.1|  hypothetical protein SELMODRAFT_443126             311   2e-97    
ref|XP_011073307.1|  PREDICTED: heat shock 70 kDa protein-like          311   2e-97    
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...    311   3e-97    
ref|XP_006416851.1|  hypothetical protein EUTSA_v10007031mg             311   3e-97    
dbj|BAJ34597.1|  unnamed protein product                                311   4e-97    
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein               310   5e-97    
ref|XP_010476705.1|  PREDICTED: heat shock 70 kDa protein 5             310   8e-97    
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1    310   9e-97    
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3    310   1e-96    
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg             309   2e-96    
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   309   2e-96    
emb|CDP02832.1|  unnamed protein product                                309   2e-96    
gb|KCW53915.1|  hypothetical protein EUGRSUZ_J03127                     309   2e-96    
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          309   2e-96    
gb|KDP41952.1|  hypothetical protein JCGZ_26970                         308   4e-96    
ref|XP_010034044.1|  PREDICTED: heat shock 70 kDa protein-like          308   5e-96    
emb|CDY35063.1|  BnaA06g10730D                                          304   5e-96    
ref|XP_008450536.1|  PREDICTED: heat shock 70 kDa protein               307   7e-96    
gb|KDP38702.1|  hypothetical protein JCGZ_04055                         306   9e-96    
ref|XP_009110463.1|  PREDICTED: heat shock 70 kDa protein 5-like        307   1e-95    
emb|CDX96825.1|  BnaA08g23680D                                          307   1e-95    
emb|CDX83960.1|  BnaC08g16850D                                          307   1e-95    
ref|XP_007013854.1|  Heat shock protein 70B                             306   1e-95    
ref|XP_010094064.1|  Heat shock cognate 70 kDa protein                  306   1e-95    
ref|XP_006408646.1|  hypothetical protein EUTSA_v10002169mg             304   1e-95    
ref|XP_006343624.1|  PREDICTED: heat shock 70 kDa protein-like          306   2e-95    
ref|XP_004507753.1|  PREDICTED: heat shock 70 kDa protein-like          306   2e-95    
ref|XP_001781229.1|  predicted protein                                  306   2e-95    
ref|XP_010497610.1|  PREDICTED: heat shock 70 kDa protein 5-like        306   3e-95    
ref|XP_006306285.1|  hypothetical protein CARUB_v10012149mg             306   3e-95    
ref|XP_006368490.1|  heat shock protein 70 cognate                      306   3e-95    
ref|XP_004152854.1|  PREDICTED: heat shock 70 kDa protein-like          306   3e-95    
gb|KDO37859.1|  hypothetical protein CISIN_1g041209mg                   298   4e-95    
emb|CDY33359.1|  BnaC05g12240D                                          302   4e-95    
emb|CDY04364.1|  BnaC04g18290D                                          293   5e-95    
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like          305   5e-95    
ref|XP_010929169.1|  PREDICTED: heat shock 70 kDa protein-like          305   6e-95    
ref|XP_010265523.1|  PREDICTED: heat shock 70 kDa protein-like          305   7e-95    
emb|CCD74508.1|  early-responsive to dehydration 2                      304   7e-95    
ref|XP_009622824.1|  PREDICTED: heat shock 70 kDa protein-like          304   1e-94    
ref|XP_009149047.1|  PREDICTED: heat shock 70 kDa protein 5             303   3e-94    
ref|XP_010687621.1|  PREDICTED: heat shock 70 kDa protein-like          303   5e-94    
ref|XP_009771888.1|  PREDICTED: heat shock 70 kDa protein-like          303   5e-94    



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   375 bits (963),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG+KLAPADKKKIEDAIEQ IQWLDGNQLAE+DEF+DKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGAKLAPADKKKIEDAIEQAIQWLDGNQLAEADEFDDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG M D+ PS GGS AGPKIEEVD
Sbjct  618  QGAGPDMGGGMDDEGPSVGGSGAGPKIEEVD  648



>gb|ACU17965.1| unknown [Glycine max]
Length=233

 Score =   360 bits (925),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  23   SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  82

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYSYNMRN
Sbjct  83   DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRN  142

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL PADKKKIEDAIEQ IQWLD NQL E+DEFEDKMKELE ICNPIIAKMY
Sbjct  143  TIKDEKIGGKLDPADKKKIEDAIEQAIQWLDSNQLGEADEFEDKMKELESICNPIIAKMY  202

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG  G   G   DD     GS AGPKIEEVD
Sbjct  203  QGGAGPDVGGAMDDDVPAAGSGAGPKIEEVD  233



>ref|XP_004142076.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 ref|XP_004161675.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   375 bits (962),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 202/211 (96%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TVND+KIG+KL+PADKKKI+DAIEQ+IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG   D APS GGS AGPKIEEVD
Sbjct  618  QGAGADMGGGADDSAPS-GGSGAGPKIEEVD  647



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   375 bits (962),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+NDDKI SKLA ADKKKIEDAIEQ IQWLDGNQLAE+DEF+DKMKELE ICNPIIAKMY
Sbjct  558  TINDDKIASKLAAADKKKIEDAIEQAIQWLDGNQLAEADEFDDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DM G M DDAP  GGS AGPKIEEVD
Sbjct  618  QGAGADMAGGMDDDAPPAGGSGAGPKIEEVD  648



>emb|CAB72130.1| heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   375 bits (962),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 193/211 (91%), Positives = 201/211 (95%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TVND+KIG+KL+PADKKKI+DAIEQ+IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG   D  PS GGS AGPKIEEVD
Sbjct  618  QGAGADMGGGADDSVPS-GGSGAGPKIEEVD  647



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   375 bits (962),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 202/211 (96%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TVND+KIG+KL+PADKKKI+DAIEQ+IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG   D APS GGS AGPKIEEVD
Sbjct  618  QGAGADMGGGADDSAPS-GGSGAGPKIEEVD  647



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   374 bits (959),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG+KLAPADKKKIEDAIEQ IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGAKLAPADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG D G  M +D PS GG+ AGPKIEEVD
Sbjct  618  QGAGPDAGAGMDEDGPSVGGTGAGPKIEEVD  648



>ref|XP_009414320.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=648

 Score =   374 bits (959),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 195/211 (92%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENYSYNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKLA ADKKKIEDAI+Q IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKIASKLAAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG M DDAPS G S AGPKIEEVD
Sbjct  618  QGAGADMGGGMDDDAPSAGASGAGPKIEEVD  648



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   372 bits (956),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKLA AD+KKIEDAIEQ IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKIASKLAAADRKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DM G M DD P+ GGS AGPKIEEVD
Sbjct  618  QGAGADMAGEMDDDVPAAGGSGAGPKIEEVD  648



>gb|KDO36486.1| hypothetical protein CISIN_1g020168mg [Citrus sinensis]
Length=330

 Score =   361 bits (927),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  119  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAE  178

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+ED++HKKKVEAKNALENY+YNMRN
Sbjct  179  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRN  238

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI +KL  ADKKKIEDAIE+ IQWLDGNQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  239  TIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMY  298

Query  317  QgaggdmggamgddAPSHG-GSEAGPKIEEVD  225
            QG G D G +M +D PS G GS AGPKIEEVD
Sbjct  299  QGGGADAGASMDEDGPSAGAGSGAGPKIEEVD  330



>emb|CAA67588.1| 70 kD heatshockprotein [Medicago sativa]
Length=214

 Score =   357 bits (915),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  3    SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  62

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSE+ +HKKKVEAKNALENY+YNMRN
Sbjct  63   DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEETEHKKKVEAKNALENYAYNMRN  122

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+  DKKKIEDAIE  IQWLDGNQL E+DEFEDKMKELEGICNPII KMY
Sbjct  123  TIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQLGEADEFEDKMKELEGICNPIIGKMY  182

Query  317  QgaggdmggamgddAPSHG-GSEAGPKIEEVD  225
            QGAGGD GGAM +D P+ G GS AGPKIEEVD
Sbjct  183  QGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD  214



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   371 bits (953),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 196/211 (93%), Positives = 203/211 (96%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKLAPADKKKIEDAI+Q IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGSKLAPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGGAM DD P+ GGS AGPKIEEVD
Sbjct  618  QGAGGDMGGAMDDDVPA-GGSGAGPKIEEVD  647



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   371 bits (953),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 193/211 (91%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL PADKKKIEDAI+  IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGSKLDPADKKKIEDAIDGAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG M +DAP  GGS AGPKIEEVD
Sbjct  618  QGAGADMGGGMDEDAPPTGGSSAGPKIEEVD  648



>gb|EAY81899.1| hypothetical protein OsI_37065 [Oryza sativa Indica Group]
Length=434

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  223  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  282

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  283  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  342

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDAI+Q IQWLDGNQLAE+DEF+DKMKELEGICNPIIAKMY
Sbjct  343  TIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMY  402

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG    GG   DDAP  GGS AGPKIEEVD
Sbjct  403  QGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD  434



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score =   371 bits (952),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDAIE +IQWLD NQLAESDEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIASKLPAADKKKIEDAIEASIQWLDANQLAESDEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGG+      + APSHGGS AGPKIEEVD
Sbjct  618  QGAGGEAPMDDDEAAPSHGGSTAGPKIEEVD  648



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score =   370 bits (951),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 199/211 (94%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TVND+KIG+KL+ ADKKKIEDAIEQ IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVNDEKIGAKLSQADKKKIEDAIEQAIQWLDANQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG   D  P+ GGS AGPKIEEVD
Sbjct  618  QGAGADMGGGADDSVPA-GGSGAGPKIEEVD  647



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   370 bits (951),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMV+EAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVEEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL PADKKKIEDAI+Q I WLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGSKLNPADKKKIEDAIDQAIHWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG G DMGG M +DAPS GGS AGPKIEEVD
Sbjct  618  QGDGADMGGRMDEDAPSTGGSGAGPKIEEVD  648



>gb|KJB20110.1| hypothetical protein B456_003G133400 [Gossypium raimondii]
Length=648

 Score =   370 bits (951),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG+KL PADKK+IEDA+EQTI WLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVKDEKIGAKLNPADKKRIEDAVEQTINWLDSNQLAEADEFEDKMKELENMCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGG+       +AP  GGS AGPKIEEVD
Sbjct  618  QGAGGEPAAGKAGEAPPAGGSGAGPKIEEVD  648



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   370 bits (950),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL PADKKKIEDAI+Q IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGG M DDAP  GGS AGPKIEEVD
Sbjct  618  QGAGGDMGGGMDDDAPPAGGSAAGPKIEEVD  648



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   370 bits (949),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAIEQ IQWLD NQLAE+DEFEDKMKELEGICNPIIA+MY
Sbjct  558  TIKDDKIASKLPAADKKKIEDAIEQAIQWLDNNQLAEADEFEDKMKELEGICNPIIARMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG D+ G MGDD+P  GGS AGPKIEEVD
Sbjct  618  QGAGADVAGGMGDDSPPAGGSGAGPKIEEVD  648



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   369 bits (946),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  407  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  466

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  467  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  526

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKLA ADKKKIEDAI+Q IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  527  TIKDEKISSKLAAADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  586

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG M DD P  GGS AGPKIEEVD
Sbjct  587  QGAGADMGGGMEDDVPPAGGSGAGPKIEEVD  617



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   369 bits (947),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 201/211 (95%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG+KL+PADKKKIEDAIE  IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGAKLSPADKKKIEDAIESAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGG+MG  M +DAP+ GGS AGPKIEEVD
Sbjct  618  QGAGGEMGAGMDEDAPA-GGSGAGPKIEEVD  647



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   369 bits (946),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL+P DKK+IEDAIE+ IQWLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVKDEKIGSKLSPDDKKRIEDAIEEAIQWLDSNQLAEADEFEDKMKELESVCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGG+M +DAP  GGS AGPKIEEVD
Sbjct  618  QGAGGDMGGSMDEDAPPSGGSGAGPKIEEVD  648



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   369 bits (946),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV DDKI SKL   DKKKIEDAIEQ IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDDKISSKLTAEDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMG  M DDAPS GGS +GPKIEEVD
Sbjct  618  QGAGADMGAGMNDDAPSAGGSGSGPKIEEVD  648



>ref|XP_004142750.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156713.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=613

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  403  SDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  462

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEK+VQEAEK+K+EDE+HKKKVE+KNALENY+YNMRN
Sbjct  463  DKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFKAEDEEHKKKVESKNALENYAYNMRN  522

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KLAPADKKKIEDA+EQ IQWLD NQLAESDEFEDKMKELE ICNPIIAKMY
Sbjct  523  TIRDEKIGGKLAPADKKKIEDAVEQAIQWLDSNQLAESDEFEDKMKELESICNPIIAKMY  582

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG     G AM DDAP  GGS AGPKIEEVD
Sbjct  583  QGGADMGGAAMNDDAPPSGGSGAGPKIEEVD  613



>gb|ABG22609.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=544

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  333  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  392

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  393  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  452

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDAI+Q IQWLDGNQLAE+DEF+DKMKELEGICNPIIAKMY
Sbjct  453  TIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMY  512

Query  317  Q-gaggdmggamgddAPSHGGSEAGPKIEEVD  225
            Q       GG   DDAP  GGS AGPKIEEVD
Sbjct  513  QGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD  544



>gb|KJB16979.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=648

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL+P DKKKIEDAIE+ IQWLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVKDEKIGSKLSPDDKKKIEDAIEEAIQWLDSNQLAEADEFEDKMKELESVCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGG+M +DAP  GGS AGPKIEEVD
Sbjct  618  QGAGGDMGGSMDEDAPPSGGSGAGPKIEEVD  648



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKLA  DKKKIEDAIEQ IQWL+GNQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  558  TIKDDKISSKLAADDKKKIEDAIEQAIQWLEGNQLAEADEFEDKMKELEGICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DM   M DDAP+ GGS +GPKIEEVD
Sbjct  618  QGAGPDMADGMNDDAPAAGGSGSGPKIEEVD  648



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGS+L+PADKKKIEDAI+Q IQWLD NQLAE DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGSQLSPADKKKIEDAIDQAIQWLDSNQLAEVDEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG+M +D PS GGS AGPKIEEVD
Sbjct  618  QGAGPDMGGSMDEDIPSTGGSGAGPKIEEVD  648



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156712.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEK+VQEAEK+K+EDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFKAEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KLAPADKKKIEDA+EQ IQWLD NQLAESDEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIRDEKIGGKLAPADKKKIEDAVEQAIQWLDSNQLAESDEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG     G AM DDAP  GGS AGPKIEEVD
Sbjct  618  QGGADMGGAAMNDDAPPSGGSGAGPKIEEVD  648



>ref|XP_008784528.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFD+DANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDMDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTT QKNKITITNDKGRLSKEEIEKMVQEAEKYK EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTSQKNKITITNDKGRLSKEEIEKMVQEAEKYKGEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDA+EQ IQWLDGNQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  558  TIRDEKIASKLPAADKKKIEDAVEQAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG D  G M +D PS GGS+AGPKIEEVD
Sbjct  618  QGAGADAAGGMDEDGPSAGGSDAGPKIEEVD  648



>gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 193/211 (91%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYSYNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG+KL+PADKKKIEDAIE  IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGAKLSPADKKKIEDAIEAAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGGA  DD    G S AGPKIEEVD
Sbjct  618  QGAGGDMGGAAMDDDAPAGASGAGPKIEEVD  648



>ref|XP_008812042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   368 bits (945),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQ+AEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQDAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAIEQ IQWLDGNQLAE+DEFEDKMKELEG CNPIIAKMY
Sbjct  558  TIKDDKIASKLPAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELEGTCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG  M G MGDD+PS G S AGPKIEEVD
Sbjct  618  QGAGAGMAGGMGDDSPSGGDSGAGPKIEEVD  648



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
 gb|KJB67650.1| hypothetical protein B456_010G202100 [Gossypium raimondii]
Length=648

 Score =   368 bits (944),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIGSKL PADKKKIEDAI+  IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIGSKLDPADKKKIEDAIDGAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG M +DAP  GGS AGPKIEEVD
Sbjct  618  QGAGADMGGGMDEDAPPTGGSGAGPKIEEVD  648



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   368 bits (944),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGS+L+PADKKKIEDAI+Q IQWLD NQLAE DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGSQLSPADKKKIEDAIDQAIQWLDSNQLAEVDEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG+M +D PS GGS AGPKIEEVD
Sbjct  618  QGAGPDMGGSMDEDIPSTGGSGAGPKIEEVD  648



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   368 bits (944),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKLA  DKKKIEDAI+Q IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKISSKLATDDKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG D+GG+M DD P  GGS AGPKIEEVD
Sbjct  618  QGAGADVGGSMDDDVPPAGGSGAGPKIEEVD  648



>gb|AEO13403.1| heat shock 70 [Glycine max]
Length=560

 Score =   365 bits (936),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 199/212 (94%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  349  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  408

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKN LENY+YNMRN
Sbjct  409  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNTLENYAYNMRN  468

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+  DKKKIEDAIEQ IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  469  TIKDDKIASKLSADDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  528

Query  317  QgaggdmggamgddAPSHG-GSEAGPKIEEVD  225
            QGAGGD GGAM +D P+ G GS AGPKIEEVD
Sbjct  529  QGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD  560



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score =   367 bits (943),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 200/212 (94%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  435  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  494

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  495  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  554

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+  DKKKIEDAIEQ IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  555  TIKDDKIASKLSSDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  614

Query  317  QgaggdmggamgddAPSHG-GSEAGPKIEEVD  225
            QGAGGD GGAM +D P+ G GS AGPKIEEVD
Sbjct  615  QGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD  646



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   367 bits (943),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG+KL PADKKKIEDAI+Q IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIGAKLTPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG M DD P   GS AGPKIEEVD
Sbjct  618  QGAGPDMGGPMEDDVPPASGSGAGPKIEEVD  648



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   367 bits (943),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 192/212 (91%), Positives = 201/212 (95%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+  DKKKIEDAI+Q IQWLDGNQLAE+DEFEDKMKELEGICNPIIA+MY
Sbjct  558  TIKDDKIASKLSTDDKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELEGICNPIIARMY  617

Query  317  QgaggdmggamgddAPSHG-GSEAGPKIEEVD  225
            QGAGGD GGAM +D P+ G GS AGPKIEEVD
Sbjct  618  QGAGGDAGGAMDEDGPTTGSGSGAGPKIEEVD  649



>dbj|BAA34919.1| heat shock protein 70 cognate [Salix gilgiana]
Length=408

 Score =   359 bits (922),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  198  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  257

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE+KN+LENY+YNMRN
Sbjct  258  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRN  317

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKL   DKKKIEDAI+Q IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  318  TVKDEKISSKLGADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  377

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG M DDAP  G S AGPKIEEVD
Sbjct  378  QGAGADMGGGMEDDAPPSGSSGAGPKIEEVD  408



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   367 bits (942),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 200/212 (94%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+  DKKKIEDAIEQ IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKIASKLSSDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHG-GSEAGPKIEEVD  225
            QGAGGD GGAM +D P+ G GS AGPKIEEVD
Sbjct  618  QGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD  649



>gb|ABP01597.1| heat shock protein 70 [Ageratina adenophora]
Length=301

 Score =   355 bits (912),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  90   SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  149

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  150  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  209

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG KL P DKKKIEDAI++ I WLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  210  TVKDEKIGEKLTPGDKKKIEDAIDEAIAWLDANQLAEADEFEDKMKELENVCNPIIAKMY  269

Query  317  Qgaggdmggamgd-dAPSHGGSEAGPKIEEVD  225
            QG  GD  GA G  + P+  G  AGPKIEEVD
Sbjct  270  QGGAGDAAGAGGMDEEPAPSGGGAGPKIEEVD  301



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   367 bits (942),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG KL PADKKKIEDA+EQTIQWLD NQL E+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGGKLDPADKKKIEDAVEQTIQWLDSNQLGEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG  G   G   DD    GGS AGPKIEEVD
Sbjct  618  QGGAGPDMGGGMDDDVPAGGSGAGPKIEEVD  648



>ref|XP_009407484.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
 ref|XP_009407485.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=649

 Score =   367 bits (942),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  439  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  498

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDEDHKKKVEAKNALENY+YNMRN
Sbjct  499  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEDHKKKVEAKNALENYAYNMRN  558

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI +KL  ADKKKIEDAIE+ I WLDGNQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  559  TIKDEKIAAKLPAADKKKIEDAIEKAISWLDGNQLAEADEFEDKMKELEGICNPIIAKMY  618

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DM G M +D P+ GGS AGPKIEEVD
Sbjct  619  QGAGADMAGGMDEDGPTTGGSSAGPKIEEVD  649



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   367 bits (942),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL PA+KKKIEDAI+Q I WLD NQLAE+DEFEDKMKE+E ICNPIIAK+Y
Sbjct  558  TVKDEKIGSKLNPAEKKKIEDAIDQAIHWLDSNQLAEADEFEDKMKEVESICNPIIAKIY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG G DMGG M +DAPS GGS AGPKIEEVD
Sbjct  618  QGDGADMGGRMDEDAPSTGGSGAGPKIEEVD  648



>ref|XP_007144451.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16445.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=648

 Score =   367 bits (942),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG KL PADKKKIEDA+EQTIQWLD NQL E+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVKDEKIGGKLDPADKKKIEDAVEQTIQWLDTNQLGEADEFEDKMKELESLCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG  G   G   DD    GGS AGPKIEEVD
Sbjct  618  QGGAGPDMGGAMDDDVPAGGSGAGPKIEEVD  648



>ref|XP_008371627.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   367 bits (941),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAI+Q IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgaggdmggamgd--dAPSHGGSEAGPKIEEVD  225
            QG  G      G   D P  GGS AGPKIEEVD
Sbjct  618  QGGAGGPDVGGGMDEDVPPAGGSSAGPKIEEVD  650



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   367 bits (941),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAI+Q IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgaggdmggamgd--dAPSHGGSEAGPKIEEVD  225
            QG  G      G   D P  GGS AGPKIEEVD
Sbjct  618  QGGAGGPDVGGGMDEDVPPAGGSSAGPKIEEVD  650



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   366 bits (940),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEK+VQEAEK+K+EDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFKAEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI  KLAPADKKKIEDA+EQ IQWLD NQLAESDEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIRDEKISGKLAPADKKKIEDAVEQAIQWLDSNQLAESDEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG       AM DDAP  GGS AGPKIEEVD
Sbjct  618  QGGADMGSAAMNDDAPPSGGSGAGPKIEEVD  648



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   366 bits (940),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 193/211 (91%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENYSYNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKLA  DKKKIEDAI+Q IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGG M DDAP   GS AGPKIEEVD
Sbjct  618  QGAGGDMGGGMDDDAPPASGSAAGPKIEEVD  648



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   366 bits (940),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAIEQ IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKIASKLDAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgaggdmggamg-ddAPSHGGSEAGPKIEEVD  225
            QGAGG   G    +D P  GGS AGPKIEEVD
Sbjct  618  QGAGGPDVGGGMDEDVPPAGGSGAGPKIEEVD  649



>gb|ABG22608.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=602

 Score =   365 bits (936),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  391  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  450

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  451  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  510

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDAI+Q IQWLDGNQLAE+DEF+DKMKELEGICNPIIAKMY
Sbjct  511  TIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMY  570

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG    GG   DDAP  GGS AGPKIEEVD
Sbjct  571  QGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD  602



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   366 bits (939),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 200/211 (95%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG+KL  ADKKKIEDAIEQ IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGAKLPAADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGG M +D P+ GGS AGPKIEEVD
Sbjct  618  QGAGGDMGGGMDEDVPA-GGSGAGPKIEEVD  647



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   366 bits (939),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAI+Q IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgaggdmggamgd--dAPSHGGSEAGPKIEEVD  225
            QG  G      G   D P  GGS AGPKIEEVD
Sbjct  618  QGGAGGPDVGGGMDEDVPPAGGSGAGPKIEEVD  650



>ref|XP_009357719.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X2 [Pyrus 
x bretschneideri]
Length=649

 Score =   366 bits (939),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  437  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  496

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  497  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  556

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAI+Q IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  557  TIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  616

Query  317  Qgaggdmggamgd--dAPSHGGSEAGPKIEEVD  225
            QG  G      G   D P  GGS AGPKIEEVD
Sbjct  617  QGGAGGPDVGGGMDEDVPPAGGSGAGPKIEEVD  649



>ref|XP_001783063.1| predicted protein [Physcomitrella patens]
 gb|EDQ52132.1| predicted protein, partial [Physcomitrella patens]
Length=220

 Score =   351 bits (900),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 188/217 (87%), Gaps = 10/217 (5%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  8    SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  67

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDEDHKKK+EAKN+LENY+YNMRN
Sbjct  68   DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEDHKKKIEAKNSLENYAYNMRN  127

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI + L  ADKKKIEDA+E  IQWLD NQLAESDEFEDKMKELE +CNPIIA+MY
Sbjct  128  TIRDDKIAANLDAADKKKIEDAVEAAIQWLDHNQLAESDEFEDKMKELESVCNPIIARMY  187

Query  317  QgaggdmggamgddAPSHGG------SEAGPKIEEVD  225
            Q       G     APS+GG      S AGPKIEEVD
Sbjct  188  Q----GGAGGAAGGAPSYGGDDDAAPSGAGPKIEEVD  220



>ref|XP_010042813.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c, partial [Eucalyptus grandis]
Length=415

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  205  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAE  264

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  265  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  324

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI +KL  ADKKKIEDAIE+ I WLDGNQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  325  TIKDEKISAKLPAADKKKIEDAIEEAIHWLDGNQLAEADEFEDKMKELEGICNPIIAKMY  384

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG M +D P  GGS AGPKIEEVD
Sbjct  385  QGAGPDMGGGMDEDVPPAGGSGAGPKIEEVD  415



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 199/212 (94%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIED I+Q IQWLDGNQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  558  TIKDDKIASKLDAADKKKIEDTIDQAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMY  617

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGG D+GG M DD P  GGS AGPKIEEVD
Sbjct  618  QGAGGPDVGGXMDDDVPXAGGSGAGPKIEEVD  649



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKLA  DKKKIEDAI+Q IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGG + DDAP   GS AGPKIEEVD
Sbjct  618  QGAGGDMGGGVDDDAPPASGSAAGPKIEEVD  648



>gb|KHN48981.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=585

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  375  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  434

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYSYNMRN
Sbjct  435  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRN  494

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL PADKKKIEDAIEQ IQWLD NQL E+DEFEDKMKELE ICNPIIAKMY
Sbjct  495  TIKDEKIGGKLDPADKKKIEDAIEQAIQWLDSNQLGEADEFEDKMKELESICNPIIAKMY  554

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG  G   G   DD     GS AGPKIEEVD
Sbjct  555  QGGAGPDVGGAMDDDVPAAGSGAGPKIEEVD  585



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score =   365 bits (936),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIGSKL+P DKKKIEDAI+Q I WLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIGSKLSPDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGG+ G  M DDAP  GGS AGPKIEEVD
Sbjct  618  QGAGGEAGAPMDDDAPPAGGSGAGPKIEEVD  648



>gb|AAK59628.2| putative dnaK-type molecular chaperone hsc70.1 protein [Arabidopsis 
thaliana]
Length=215

 Score =   350 bits (897),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 194/216 (90%), Gaps = 7/216 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  2    SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  61

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  62   DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  121

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED+IEQ IQWL+GNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  122  TIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMY  181

Query  317  QgaggdmggamgddA-----PSHGGSEAGPKIEEVD  225
            QGAGG+ GG           P+ GG  AGPKIEEVD
Sbjct  182  QGAGGEAGGPGASGMDDDAPPASGG--AGPKIEEVD  215



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   365 bits (936),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIGSKL+P DKKKIEDAI++ I WLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIGSKLSPDDKKKIEDAIDEAISWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DM G M +D PS G S AGPKIEEVD
Sbjct  618  QGAGPDMAGGMDEDGPSAGASGAGPKIEEVD  648



>gb|KJB46580.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46581.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46582.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
Length=647

 Score =   365 bits (936),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 193/211 (91%), Positives = 199/211 (94%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG+KL  ADKKKIEDAIEQ IQWLD NQLAESDEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGAKLPAADKKKIEDAIEQAIQWLDSNQLAESDEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGG M +D  + GGS AGPKIEEVD
Sbjct  618  QGAGGDMGGGMDEDV-TAGGSGAGPKIEEVD  647



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   365 bits (936),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 199/212 (94%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKN LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNTLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+  DKKKIEDAIEQ IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKIASKLSADDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHG-GSEAGPKIEEVD  225
            QGAGGD GGAM +D P+ G GS AGPKIEEVD
Sbjct  618  QGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD  649



>gb|EAZ19310.1| hypothetical protein OsJ_34853 [Oryza sativa Japonica Group]
Length=632

 Score =   364 bits (934),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  421  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  480

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  481  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  540

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDAI+Q IQWLDGNQLAE+DEF+DKMKELEGICNPIIAKMY
Sbjct  541  TIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMY  600

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG    GG   DDAP  GGS AGPKIEEVD
Sbjct  601  QGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD  632



>ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group]
 gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza 
sativa Japonica Group]
 gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group]
Length=649

 Score =   364 bits (934),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDAI+Q IQWLDGNQLAE+DEF+DKMKELEGICNPIIAKMY
Sbjct  558  TIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMY  617

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG    GG   DDAP  GGS AGPKIEEVD
Sbjct  618  QGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD  649



>ref|XP_006663128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   364 bits (934),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDAI+Q IQWLDGNQLAE+DEF+DKMKELEGICNPIIAKMY
Sbjct  558  TIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMY  617

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG    GG   DDAP  GGS AGPKIEEVD
Sbjct  618  QGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD  649



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   364 bits (934),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL+PADKKKIEDAI+Q I WLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGSKLSPADKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Q-gaggdmggamgddAPSHGGSEAGPKIEEVD  225
            Q   G   GGAM DDAPS G S AGPKIEEVD
Sbjct  618  QGAGGDMGGGAMDDDAPSGGSSGAGPKIEEVD  649



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   364 bits (934),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 199/212 (94%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+  DKKKIEDAIE  IQWLDGNQL E+DEFEDKMKELEGICNPIIA+MY
Sbjct  558  TIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQLGEADEFEDKMKELEGICNPIIARMY  617

Query  317  QgaggdmggamgddAPSHG-GSEAGPKIEEVD  225
            QGAGGD GGAM +D P+ G GS AGPKIEEVD
Sbjct  618  QGAGGDAGGAMDEDGPTAGSGSGAGPKIEEVD  649



>gb|AAP42157.1|AF509339_1 heat shock protein 70 [Saussurea medusa]
Length=427

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 193/212 (91%), Gaps = 3/212 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  218  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  277

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  278  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  337

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG KL P DKKKIEDAI++ I WLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  338  TVKDEKIGEKLTPGDKKKIEDAIDEAISWLDSNQLAEADEFEDKMKELENVCNPIIAKMY  397

Query  317  Qgaggdmggam-gddAPSHGGSEAGPKIEEVD  225
            QG  GD  G M  D APS GG  AGPKIEEVD
Sbjct  398  QGGAGDAAGGMDEDAAPSGGG--AGPKIEEVD  427



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   363 bits (933),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVETKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKLA  DKKKIEDAI+Q IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGG + DDAP   GS AGPKIEEVD
Sbjct  618  QGAGGDMGGGVDDDAPPASGSAAGPKIEEVD  648



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   363 bits (933),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 195/211 (92%), Gaps = 2/211 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG+KL PADKKKIEDAIEQ IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGAKLPPADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            Q   G   G M +D P+ GG+ AGPKIEEVD
Sbjct  618  Q-GAGADMGGMDEDVPA-GGNGAGPKIEEVD  646



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   363 bits (933),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 195/211 (92%), Gaps = 2/211 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKL  ADKKKIEDAIE +IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIASKLPAADKKKIEDAIESSIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGD+       APS  GS AGPKIEEVD
Sbjct  618  QGAGGDVPMDDDAPAPS--GSGAGPKIEEVD  646



>gb|KEH30132.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=578

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 199/212 (94%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  367  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  426

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HK+KVEAKNALENY+YNMRN
Sbjct  427  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKRKVEAKNALENYAYNMRN  486

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+  DKKKIEDAIE  IQWLDGNQL E+DEFEDKMKELEGICNPIIA+MY
Sbjct  487  TIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQLGEADEFEDKMKELEGICNPIIARMY  546

Query  317  QgaggdmggamgddAPSHG-GSEAGPKIEEVD  225
            QGAGGD GGAM +D P+ G GS AGPKIEEVD
Sbjct  547  QGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD  578



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   363 bits (933),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 199/212 (94%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  AD+KKIE+AIEQ IQWLD NQLAESDEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIASKLPEADRKKIEEAIEQAIQWLDANQLAESDEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPS-HGGSEAGPKIEEVD  225
            QGAGGDMG  MGDD P+  GGS AGPKIEEVD
Sbjct  618  QGAGGDMGADMGDDGPAPSGGSGAGPKIEEVD  649



>ref|XP_006341042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   363 bits (932),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 199/212 (94%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  AD+KKIE+AIEQ IQWLD NQLAESDEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIASKLPEADRKKIEEAIEQAIQWLDANQLAESDEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPS-HGGSEAGPKIEEVD  225
            QGAGGDMG  MGDD P+  GGS AGPKIEEVD
Sbjct  618  QGAGGDMGADMGDDGPAPSGGSGAGPKIEEVD  649



>gb|AEX55235.1| heat shock protein 70 [Allium sativum]
Length=367

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  157  SDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  216

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KN LENY+YNMRN
Sbjct  217  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNTLENYAYNMRN  276

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+  DKKKIEDAI++ IQWLD NQLAE+DEF+DKMKELE +CNPIIAKMY
Sbjct  277  TIKDDKIASKLSGEDKKKIEDAIDEAIQWLDSNQLAEADEFDDKMKELESLCNPIIAKMY  336

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGG   D     GGS AGPKIEEVD
Sbjct  337  QGAGGDMGGMDEDGPAPSGGSGAGPKIEEVD  367



>ref|XP_003521330.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
 gb|KHN09419.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=653

 Score =   363 bits (932),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 190/216 (88%), Gaps = 5/216 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV DDKIG KL PADKKKIEDAIEQ IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDDKIGEKLDPADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgag-----gdmggamgddAPSHGGSEAGPKIEEVD  225
            QG       G         AP  GGS AGPKIEEVD
Sbjct  618  QGGAGPDVGGAGAAEDEYAAPPSGGSGAGPKIEEVD  653



>ref|XP_006488297.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
Length=649

 Score =   363 bits (931),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+ED++HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI +KL  ADKKKIEDAIE+ IQWLDGNQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  558  TIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHG-GSEAGPKIEEVD  225
            QG G D G +M +D PS G GS AGPKIEEVD
Sbjct  618  QGGGADAGASMDEDGPSAGAGSGAGPKIEEVD  649



>ref|XP_009785159.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
 dbj|BAM24707.1| Heat shock protein 70 [Nicotiana tabacum]
Length=649

 Score =   363 bits (931),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 195/212 (92%), Positives = 200/212 (94%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKL  ADKKKIEDAIE  IQWLD NQLAESDEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVKDEKIASKLPEADKKKIEDAIEAAIQWLDANQLAESDEFEDKMKELESVCNPIIAKMY  617

Query  317  QgaggdmggamgddAPS-HGGSEAGPKIEEVD  225
            QGAGGDMGGAM DDAP+  GGS AGPKIEEVD
Sbjct  618  QGAGGDMGGAMDDDAPAPSGGSGAGPKIEEVD  649



>ref|XP_004307529.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   363 bits (931),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDEDHKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEDHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SK+ P+DKKKIEDAIE+ I WLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TIKDDKIASKIDPSDKKKIEDAIEEAIHWLDNNQLAEADEFEDKMKELESLCNPIIAKMY  617

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QG    DM G    D P  GGS AGPKIEEVD
Sbjct  618  QGGAAPDMSGGADADVPPSGGSGAGPKIEEVD  649



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   363 bits (931),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDEDHKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEDHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL+  DKKKIEDAI+Q I WLD NQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  558  TVKDEKIGSKLSVDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELEGICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGD G  M DD P  G S AGPKIEEVD
Sbjct  618  QGAGGDAGAPMDDDVPPAGASSAGPKIEEVD  648



>ref|XP_006424799.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
 gb|ESR38039.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
Length=649

 Score =   363 bits (931),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+ED++HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI +KL  ADKKKIEDAIE+ IQWLDGNQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  558  TIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHG-GSEAGPKIEEVD  225
            QG G D G +M +D PS G GS AGPKIEEVD
Sbjct  618  QGGGADAGASMDEDGPSAGAGSGAGPKIEEVD  649



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score =   362 bits (930),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIGSKL+  DKKKIEDAI+Q I WLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGG+ G  M DDAP  GGS AGPKIEEVD
Sbjct  618  QGAGGEAGAPMDDDAPPAGGSSAGPKIEEVD  648



>ref|XP_007139236.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
 gb|ESW11230.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
Length=647

 Score =   362 bits (930),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+  DK KI++AIEQ IQWLD NQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  558  TIKDDKISSKLSSEDKTKIDNAIEQAIQWLDSNQLAEADEFEDKMKELEGICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG  G  G    D  P+ GGS AGPKIEEVD
Sbjct  618  QGGAGAGGDVDDDAPPA-GGSGAGPKIEEVD  647



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   362 bits (929),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKLA  DKKKIEDAIEQ I WLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKISSKLAADDKKKIEDAIEQAIHWLDANQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG+G DM G M +DAP  GGS AGPKIEEVD
Sbjct  618  QGSGPDMAGGMDEDAPPAGGSSAGPKIEEVD  648



>gb|AIU34470.1| putative heat shock protein, partial [Taraxacum brevicorniculatum]
Length=646

 Score =   362 bits (929),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 193/211 (91%), Gaps = 2/211 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG KL PADKKKIEDAI++ I WLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVKDEKIGEKLTPADKKKIEDAIDEAIAWLDTNQLAEADEFEDKMKELENVCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG  G+  G   + APS GG  AGPKIEEVD
Sbjct  618  QGGAGEAAGMDEEPAPSGGG--AGPKIEEVD  646



>ref|XP_009622753.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=649

 Score =   362 bits (929),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 194/212 (92%), Positives = 199/212 (94%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKL  ADKKKIE+AIE  IQWLD NQLAESDEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIASKLPEADKKKIEEAIESAIQWLDANQLAESDEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPS-HGGSEAGPKIEEVD  225
            QGAGGDM GAM DDAP+  GGS AGPKIEEVD
Sbjct  618  QGAGGDMDGAMDDDAPAPSGGSGAGPKIEEVD  649



>gb|KEH30133.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   362 bits (929),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 199/212 (94%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HK+KVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKRKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+  DKKKIEDAIE  IQWLDGNQL E+DEFEDKMKELEGICNPIIA+MY
Sbjct  558  TIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQLGEADEFEDKMKELEGICNPIIARMY  617

Query  317  QgaggdmggamgddAPSHG-GSEAGPKIEEVD  225
            QGAGGD GGAM +D P+ G GS AGPKIEEVD
Sbjct  618  QGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD  649



>gb|AFA51946.1| heat shock protein 70 [Paeonia suffruticosa]
Length=650

 Score =   362 bits (928),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 199/213 (93%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKK E+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKAESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKIG+KL PADKKKIED+I+Q IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIRDDKIGAKLEPADKKKIEDSIDQAIQWLDANQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPS--HGGSEAGPKIEEVD  225
            QGAGGDMGGA  DD  +   GGS AGPKIEEVD
Sbjct  618  QGAGGDMGGAAMDDDDAVPAGGSGAGPKIEEVD  650



>ref|XP_008223380.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X2 
[Prunus mume]
Length=648

 Score =   362 bits (928),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYKSEDEDHKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL PADKKKIED++E  IQWLDGNQLAE DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVRDEKIGSKLNPADKKKIEDSVEDAIQWLDGNQLAECDEFEDKMKELENLCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG + GG   DD      S AGPKIEEVD
Sbjct  618  QGAGAEAGGGGVDDDAPPAASGAGPKIEEVD  648



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   362 bits (928),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIGSKL+  DKKKIEDAI+Q I WLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGG+ G  M DDAP  GGS AGPKIEEVD
Sbjct  618  QGAGGEAGAPMDDDAPPAGGSGAGPKIEEVD  648



>gb|AAN86276.1| cell-autonomous heat shock cognate protein 70 [Cucurbita maxima]
Length=650

 Score =   362 bits (928),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TVND+KIG+KL+PADKKKIEDAIEQ+IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVNDEKIGAKLSPADKKKIEDAIEQSIQWLDANQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPS--HGGSEAGPKIEEVD  225
            QGAG DMGGA  D  P+   GGS AGPKIEEVD
Sbjct  618  QGAGADMGGAGDDSIPTGASGGSGAGPKIEEVD  650



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   362 bits (928),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 194/213 (91%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAIEQ IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKISSKLPAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Q-gaggdmggamgddAPS-HGGSEAGPKIEEVD  225
            Q   G   GG M +D PS  GGS AGPKIEEVD
Sbjct  618  QGAGGDMGGGDMDEDGPSVGGGSGAGPKIEEVD  650



>ref|XP_004156719.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=547

 Score =   358 bits (920),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 191/215 (89%), Gaps = 4/215 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  333  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  392

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK++DE+HKKKVEAKN+LENY+YNMRN
Sbjct  393  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRN  452

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+K  SKL PADKKKIEDAIEQ +QWLD NQLAE+DEFEDKMKELE ICNPI+AKMY
Sbjct  453  TVRDEKFSSKLDPADKKKIEDAIEQAVQWLDNNQLAEADEFEDKMKELESICNPIVAKMY  512

Query  317  Qgaggdmggamgd----dAPSHGGSEAGPKIEEVD  225
            QGAGG   G          P  GGS AGPKIEEVD
Sbjct  513  QGAGGPGMGGGAMDDDDAPPPSGGSGAGPKIEEVD  547



>emb|CAA47948.2| heat shock protein 70 [Oryza sativa Indica Group]
Length=648

 Score =   361 bits (927),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 196/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  437  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  496

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQ AEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  497  DKTTGQKNKITITNDKGRLSKEEIEKMVQGAEKYKSEDEEHKKKVESKNALENYAYNMRN  556

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDAI+Q IQWLDGNQLAE+DEF+DKMKELEGICNPIIAKMY
Sbjct  557  TIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMY  616

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG    GG   DDAP  GGS AGPKIEEVD
Sbjct  617  QGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD  648



>ref|XP_006486093.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
Length=1046

 Score =   371 bits (953),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -2

Query  857   SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
             SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  836   SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  895

Query  677   DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
             DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  896   DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRN  955

Query  497   TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
             TV D+KIGSKL PADKKKIEDAI+Q IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  956   TVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  1015

Query  317   QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
             QGAGGDMGG M DDAP  GGS AGPKIEEVD
Sbjct  1016  QGAGGDMGGGMDDDAPPAGGSAAGPKIEEVD  1046



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   361 bits (927),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKK++AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKIDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKL+P DKKKIEDAIEQ IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKISSKLSPDDKKKIEDAIEQAIQWLDANQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgaggdmggamgdd-APSHGGSEAGPKIEEVD  225
            QGAGG   G   D+  P  GGS AGPKIEEVD
Sbjct  618  QGAGGPDMGGGMDEDVPPAGGSGAGPKIEEVD  649



>gb|KHG00348.1| Heat shock 70 kDa 4 -like protein [Gossypium arboreum]
Length=570

 Score =   358 bits (920),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 198/213 (93%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  358  SDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAE  417

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN LENY+YNMRN
Sbjct  418  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNGLENYAYNMRN  477

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDAIEQ IQWLDGNQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  478  TIKDEKISSKLPAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMY  537

Query  317  Qgaggdmgga-mgddAPS-HGGSEAGPKIEEVD  225
            QGAGGDMG   M DD PS  GGS AGPKIEEVD
Sbjct  538  QGAGGDMGAGPMDDDGPSVGGGSGAGPKIEEVD  570



>gb|ADD71975.1| heat shock protein 70 [Rhododendron calophytum]
Length=651

 Score =   361 bits (927),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 187/214 (87%), Positives = 193/214 (90%), Gaps = 3/214 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HK+KVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKRKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL PADKKKIEDAI+  I WLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGSKLDPADKKKIEDAIDGAISWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Q---gaggdmggamgddAPSHGGSEAGPKIEEVD  225
            Q   GA     G   DDAP  GGS AGPKIEEVD
Sbjct  618  QGAGGADMGGAGMDDDDAPPAGGSGAGPKIEEVD  651



>ref|XP_011027667.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Populus euphratica]
Length=515

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  305  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  364

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE+KN+LENY+YNMRN
Sbjct  365  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRN  424

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKL   DKKKIEDAI+Q IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  425  TVKDEKISSKLGADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  484

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG M +DAP  G   AGPKIEEVD
Sbjct  485  QGAGADMGGGMEEDAPPAGSGGAGPKIEEVD  515



>ref|XP_006378714.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP56511.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   360 bits (925),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE+KN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKLA  DKKKIEDAI+Q IQWLD NQLAE+DEF+DKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFDDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG M DDAP  GGS AGPKIEEVD
Sbjct  618  QGAGPDMGGGMDDDAPPSGGSGAGPKIEEVD  648



>ref|XP_007207204.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
 gb|EMJ08403.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
Length=649

 Score =   360 bits (925),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYKSEDEDHKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL PADKKKIED++E  IQWLDGNQLAE DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVRDEKIGSKLNPADKKKIEDSVEDAIQWLDGNQLAECDEFEDKMKELENLCNPIIAKMY  617

Query  317  Qgaggdmggamg-ddAPSHGGSEAGPKIEEVD  225
            QGAG + GG    DDAP    S AGPKIEEVD
Sbjct  618  QGAGAEAGGGGVDDDAPPPAASGAGPKIEEVD  649



>ref|XP_006436017.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
 ref|XP_006486087.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
 gb|ESR49257.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
Length=653

 Score =   360 bits (925),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 190/216 (88%), Gaps = 5/216 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DD+IGSKL+ ADKK+IED IE+ +QWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDQIGSKLSAADKKRIEDTIEEAMQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgaggdmggamgd-----dAPSHGGSEAGPKIEEVD  225
            QG      G          AP  GGS AGPKIEEVD
Sbjct  618  QGGVAPGAGPAPGPGMDESAPPSGGSSAGPKIEEVD  653



>gb|AEK70336.1| heat shock protein 70 [Paeonia lactiflora]
Length=650

 Score =   360 bits (924),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 199/213 (93%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKK E+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKAESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKIG+KL PADKKKIED+I+Q IQWLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TIRDDKIGAKLDPADKKKIEDSIDQAIQWLDANQLAEADEFEDKMKELESVCNPIIAKMY  617

Query  317  QgaggdmggamgddAPS--HGGSEAGPKIEEVD  225
            QGAGGDMGGA  DD  +   GGS AGPKIEEVD
Sbjct  618  QGAGGDMGGAAMDDDDAVPAGGSGAGPKIEEVD  650



>ref|XP_008802766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   360 bits (924),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  437  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAE  496

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  497  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRN  556

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI +KL  ADKKKIEDAIEQ I WLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  557  TIRDEKIAAKLPQADKKKIEDAIEQAINWLDGNQLAEADEFEDKMKELESICNPIIAKMY  616

Query  317  QgaggdmggamgddAPSHGGSE-AGPKIEEVD  225
            QGAG  M G M +D P+ GGS  AGPKIEEVD
Sbjct  617  QGAGAGMAGGMDEDIPAAGGSSGAGPKIEEVD  648



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   360 bits (924),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE+KN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKLA  DKKKIEDAI+Q IQWLD NQLAE+DEF+DKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFDDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG M DDAP  GGS AGPKIEEVD
Sbjct  618  QGAGPDMGGGMDDDAPPAGGSGAGPKIEEVD  648



>gb|AAB65162.1| heat shock cognate protein [Solanum commersonii]
Length=339

 Score =   350 bits (897),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  128  SDNQPGVLIQVYEGERPRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  187

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  188  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVEAKNALENYAYNMRN  247

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL   DKKKIEDAI+Q I WLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  248  TIKDDKISSKLGAEDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESLCNPIIAKMY  307

Query  317  Qgaggdmgg-amgddAPSHGGSEAGPKIEEVD  225
            QGAGG+ G     DDAP  G + AGPKIEEVD
Sbjct  308  QGAGGEAGAPMDDDDAPPAGSTGAGPKIEEVD  339



>gb|KJB55903.1| hypothetical protein B456_009G100400 [Gossypium raimondii]
Length=650

 Score =   360 bits (923),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 199/213 (93%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDAIEQ IQWLDGNQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  558  TIKDEKINSKLPAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMY  617

Query  317  Qgaggdmgga-mgddAPS-HGGSEAGPKIEEVD  225
            QGAGGDMG   M DD PS  GGS AGPKIEEVD
Sbjct  618  QGAGGDMGAGPMDDDGPSVGGGSGAGPKIEEVD  650



>gb|AAP04522.1| heat shock protein 70 [Nicotiana tabacum]
Length=648

 Score =   360 bits (923),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTR NNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRANNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIGSKL+  DKKKIEDAI+Q I WLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGG+ G  M DDAP  GGS AGPKIEEVD
Sbjct  618  QGAGGEAGAPMDDDAPPAGGSSAGPKIEEVD  648



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   360 bits (923),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 191/211 (91%), Gaps = 2/211 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDAIE +IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIASKLPAADKKKIEDAIESSIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            Q  G      M DD P+ G S  GPKIEEVD
Sbjct  618  Q--GAGGEAPMDDDGPAPGASGPGPKIEEVD  646



>ref|XP_010520113.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=650

 Score =   359 bits (922),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFEL+GIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELTGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIGSKL+P DKKKIED I++ IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIRDEKIGSKLSPDDKKKIEDTIDEAIQWLDNNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgaggdmg--gamgddAPSHGGSEAGPKIEEVD  225
            QG+         +  DAP  GGS AGPKIEEVD
Sbjct  618  QGSAASTEGNADVDADAPPSGGSTAGPKIEEVD  650



>ref|XP_010095013.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58119.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=648

 Score =   359 bits (922),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKL  ADKKKIEDAI+  IQWLDGNQLAESDEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVKDEKIASKLDAADKKKIEDAIDAAIQWLDGNQLAESDEFEDKMKELESVCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGGAM DD P  GGS AGPKIEEVD
Sbjct  618  QGAGGDMGGAMDDDVPPSGGSGAGPKIEEVD  648



>ref|XP_007207158.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
 gb|EMJ08357.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
Length=635

 Score =   358 bits (920),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 196/211 (93%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  426  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  485

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  486  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  545

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG+KL PADKKKIED+IE  IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  546  TIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  605

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG D  G + D+AP+ G S  GPKIEEVD
Sbjct  606  QGAGADGAGPVDDEAPA-GASGPGPKIEEVD  635



>ref|XP_008241192.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Prunus mume]
Length=647

 Score =   359 bits (921),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 196/211 (93%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG+KL PADKKKIED+IE  IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG D  G + D+AP+ G S  GPKIEEVD
Sbjct  618  QGAGADGAGPVDDEAPA-GASGPGPKIEEVD  647



>gb|AAA62445.1| heat shock protein [Spinacia oleracea]
 gb|AAB88134.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=647

 Score =   359 bits (921),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 200/211 (95%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG+KL+ ADKKKIE+AI+ +IQWLDGNQLAE+DEF+DKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGAKLSEADKKKIEEAIDASIQWLDGNQLAEADEFDDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGG M D+ P+ GG  AGPKIEEVD
Sbjct  618  QGAGGDMGGGMEDEGPTSGGG-AGPKIEEVD  647



>gb|AAS57914.1| 70 kDa heat shock cognate protein 3 [Vigna radiata]
Length=650

 Score =   359 bits (921),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 185/215 (86%), Positives = 192/215 (89%), Gaps = 5/215 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  437  SDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  496

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  497  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  556

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV DDKIG KL PADKKKIEDAIEQ IQWLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  557  TVKDDKIGGKLDPADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKELESVCNPIIAKMY  616

Query  317  Qgaggdmggam----gddAPSHGGSEAGPKIEEVD  225
            QG  G   G       +  PS GGS AGPKIEEVD
Sbjct  617  QGGAGPDMGGAPPADDEYTPS-GGSGAGPKIEEVD  650



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   359 bits (921),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKK EAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKAEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL+P DKKKIEDAI+  +QWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGSKLSPDDKKKIEDAIDGAVQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgag-gdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG    G  M DD P  GGS AGPKIEEVD
Sbjct  618  QGAGPDMGGAGMADDIPPAGGSGAGPKIEEVD  649



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   359 bits (921),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 194/214 (91%), Gaps = 3/214 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKL+P+DKKKIEDAI+  IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKISSKLSPSDKKKIEDAIDGAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgag---gdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG       G   DD P  GGS AGPKIEEVD
Sbjct  618  QGAGGPDVGGAGMDEDDVPPAGGSGAGPKIEEVD  651



>gb|ABP35942.1| heat shock protein 70 [Cyclamen persicum]
Length=650

 Score =   358 bits (920),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 194/213 (91%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVY GERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYGGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYSYNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAI+  IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKISSKLDAADKKKIEDAIDGAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgaggd--mggamgddAPSHGGSEAGPKIEEVD  225
            QGAGG   MGG   DD P  GGS AGPKIEEVD
Sbjct  618  QGAGGAPDMGGMDDDDVPPAGGSGAGPKIEEVD  650



>ref|XP_002532297.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30081.1| heat shock protein, putative [Ricinus communis]
Length=652

 Score =   358 bits (920),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 186/215 (87%), Positives = 193/215 (90%), Gaps = 4/215 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKL  ADKK+IEDAI+  IQWLDGNQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVKDEKISSKLDAADKKRIEDAIDGAIQWLDGNQLAEADEFEDKMKELESVCNPIIAKMY  617

Query  317  Qgaggdmggamgdd----APSHGGSEAGPKIEEVD  225
            QGAG   G  +G      AP  G S AGPKIEEVD
Sbjct  618  QGAGAGAGADVGAGMEEDAPPPGASGAGPKIEEVD  652



>gb|ACB70177.1| 70 kDa heat shock protein [Capparis spinosa]
Length=649

 Score =   358 bits (920),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 199/212 (94%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFEL+GIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIGSKL PADKKKIEDAI+Q IQWLDGNQLAE+DEF+DKMKELE ICNPIIA+MY
Sbjct  558  TIKDEKIGSKLDPADKKKIEDAIDQAIQWLDGNQLAEADEFKDKMKELESICNPIIARMY  617

Query  317  QgaggdmggamgddAPS-HGGSEAGPKIEEVD  225
            QGAGGDMGGA G D  S  GGS AGPKIEEVD
Sbjct  618  QGAGGDMGGAGGADDASPAGGSGAGPKIEEVD  649



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 193/213 (91%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPP+PRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPSPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIGSKL+P DKKKIEDAI+Q I WLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIGSKLSPDDKKKIEDAIDQAISWLDANQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgaggd--mggamgddAPSHGGSEAGPKIEEVD  225
            Q  G    M G M +D PS G S AGPKIEEVD
Sbjct  618  QDGGAGPDMAGGMDEDGPSAGASGAGPKIEEVD  650



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGERTRTRDNNLLGKFEL+GIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERTRTRDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIE+MVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL+ ADKKKIEDAIEQ +QWLDGNQLAE+DEF+DKMKELEGICNPIIAKMY
Sbjct  558  TIKDEKISSKLSEADKKKIEDAIEQAVQWLDGNQLAEADEFDDKMKELEGICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG+    G    D     G S AGPKIEEVD
Sbjct  618  QGSADMGGQMDEDGPAPGGASGAGPKIEEVD  648



>ref|XP_008458906.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis 
melo]
Length=652

 Score =   358 bits (918),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 183/215 (85%), Positives = 191/215 (89%), Gaps = 4/215 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK++DE+HKKKVEAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+K  SKL PADKKKIEDAIEQ IQWLD NQLAE+DEFEDKMKELE ICNPI+AKMY
Sbjct  558  TVRDEKFSSKLDPADKKKIEDAIEQAIQWLDNNQLAEADEFEDKMKELESICNPIVAKMY  617

Query  317  Qgaggdmggamgd----dAPSHGGSEAGPKIEEVD  225
            QGAGG   G          P  GGS AGPKIEEVD
Sbjct  618  QGAGGPGMGGGAMDDDDVPPPSGGSGAGPKIEEVD  652



>ref|XP_003552695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
 gb|KHN13895.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=647

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 191/211 (91%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEGKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL+  DK KI++AIEQ IQWLD NQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  558  TIKDEKISSKLSSEDKTKIDNAIEQAIQWLDTNQLAEADEFEDKMKELEGICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG  G  G    D  P+ GGS AGPKIEEVD
Sbjct  618  QGGAGTGGDVDDDAPPA-GGSGAGPKIEEVD  647



>ref|XP_010553033.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=652

 Score =   358 bits (918),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 187/215 (87%), Positives = 195/215 (91%), Gaps = 4/215 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIE+MVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG KL  ADKKKIEDAIEQ IQWL+GNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGEKLPAADKKKIEDAIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddA----PSHGGSEAGPKIEEVD  225
            QGAGGDMGG          P  GGS AGPKIEEVD
Sbjct  618  QGAGGDMGGGAPTGMDDDVPPSGGSGAGPKIEEVD  652



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 196/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIGSKL+P DKKKI+DAIE +IQWLD NQLAE+DEFEDKMKELEG+CNPIIAKMY
Sbjct  558  TIKDEKIGSKLSPEDKKKIDDAIEASIQWLDSNQLAEADEFEDKMKELEGLCNPIIAKMY  617

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QG G  DM G M DD P  G S AGPKIEEVD
Sbjct  618  QGGGAPDMAGGMNDDVPPSGSSGAGPKIEEVD  649



>ref|XP_011027180.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=649

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV DDKI SKLA  DKKKIEDAI+Q IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Q-gaggdmggamgddAPSHGGSEAGPKIEEVD  225
            Q   GGDMGG M DD P   GS AGPKIEEVD
Sbjct  618  QGAGGGDMGGGMDDDTPPASGSGAGPKIEEVD  649



>ref|XP_004142745.1| PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis sativus]
 gb|KGN51286.1| Heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 191/215 (89%), Gaps = 4/215 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK++DE+HKKKVEAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+K  SKL PADKKKIEDAIEQ +QWLD NQLAE+DEFEDKMKELE ICNPI+AKMY
Sbjct  558  TVRDEKFSSKLDPADKKKIEDAIEQAVQWLDNNQLAEADEFEDKMKELESICNPIVAKMY  617

Query  317  Qgaggdmggamgd----dAPSHGGSEAGPKIEEVD  225
            QGAGG   G          P  GGS AGPKIEEVD
Sbjct  618  QGAGGPGMGGGAMDDDDAPPPSGGSGAGPKIEEVD  652



>gb|EAY98319.1| hypothetical protein OsI_20227 [Oryza sativa Indica Group]
Length=410

 Score =   350 bits (897),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 194/211 (92%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  201  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAE  260

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  261  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  320

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKLA  DKK+IEDAI+  I WLD NQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  321  TIKDEKIASKLAADDKKRIEDAIDGAISWLDTNQLAEADEFEDKMKELEGICNPIIAKMY  380

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG G DM G M +DAP+ GGS AGPKIEEVD
Sbjct  381  QGPGADMAGGMDEDAPA-GGSGAGPKIEEVD  410



>emb|CAB72129.1| heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 191/215 (89%), Gaps = 4/215 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK++DE+HKKKVEAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+K  SKL PADKKKIEDAIEQ +QWLD NQLAE+DEFEDKMKELE ICNPI+AKMY
Sbjct  558  TVRDEKFSSKLDPADKKKIEDAIEQAVQWLDNNQLAEADEFEDKMKELESICNPIVAKMY  617

Query  317  Qgaggdmggamgd----dAPSHGGSEAGPKIEEVD  225
            QGAGG   G          P  GGS AGPKIEEVD
Sbjct  618  QGAGGPGMGGGAMDDDDAPPPSGGSGAGPKIEEVD  652



>gb|AAL85887.1|AF479058_1 70 kDa heat shock protein [Sandersonia aurantiaca]
Length=336

 Score =   347 bits (890),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  126  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  185

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  186  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  245

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAI+Q IQWLD NQLAE+DEF+DKMKELE ICNPIIAKMY
Sbjct  246  TIKDDKIASKLPAADKKKIEDAIDQAIQWLDNNQLAEADEFDDKMKELESICNPIIAKMY  305

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG          A + G S AGPKIEEVD
Sbjct  306  QGAGAGGVEEDDVPAAAGGSSGAGPKIEEVD  336



>gb|KHN02428.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=654

 Score =   357 bits (917),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 192/218 (88%), Gaps = 8/218 (4%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV DDKIG KL P DKKKIEDAIEQ IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDDKIGEKLDPTDKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgaggdmggamgd-------dAPSHGGSEAGPKIEEVD  225
            QG  G   G  G         APS GGS AGPKIEEVD
Sbjct  618  QGGAGPDMGGAGAGAAEDDYAAPS-GGSGAGPKIEEVD  654



>ref|XP_007162654.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
 gb|ESW34648.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
Length=651

 Score =   357 bits (916),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 184/215 (86%), Positives = 193/215 (90%), Gaps = 5/215 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK++IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG KL PADKKKIEDAIEQ+IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGGKLDPADKKKIEDAIEQSIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgaggdmggam----gddAPSHGGSEAGPKIEEVD  225
            QG  G   G       +  PS GGS AGPKIEEVD
Sbjct  618  QGGAGPDMGGAPPADTEYTPS-GGSGAGPKIEEVD  651



>ref|XP_010918390.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=649

 Score =   357 bits (916),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 194/213 (91%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNV+AE
Sbjct  437  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVTAE  496

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKK+EAKNALENY+YNMRN
Sbjct  497  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKIEAKNALENYAYNMRN  556

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI +KL PADKKKIED+IE+ I WLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  557  TIRDEKIAAKLPPADKKKIEDSIEEAINWLDGNQLAEADEFEDKMKELESICNPIIAKMY  616

Query  317  QgaggdmggamgddAPSHGGSE--AGPKIEEVD  225
            QGAG  M   M +D P+  GS   AGPKIEEVD
Sbjct  617  QGAGAGMADGMDEDVPTAAGSSGGAGPKIEEVD  649



>gb|AAM48131.1|AF509336_1 heat shock protein 70 [Saussurea medusa]
Length=647

 Score =   357 bits (916),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 193/212 (91%), Gaps = 3/212 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG KL P DKKKIEDAI++ I WLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVKDEKIGEKLTPGDKKKIEDAIDEAISWLDSNQLAEADEFEDKMKELENVCNPIIAKMY  617

Query  317  Qgaggdmggam-gddAPSHGGSEAGPKIEEVD  225
            QG  GD  G M  D APS GG  AGPKIEEVD
Sbjct  618  QGGAGDAAGGMDEDAAPSGGG--AGPKIEEVD  647



>gb|AGZ15406.1| heat shock cognate 70 kDa protein [Phaseolus vulgaris]
Length=651

 Score =   357 bits (916),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 184/215 (86%), Positives = 193/215 (90%), Gaps = 5/215 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK++IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG KL PADKKKIEDAIEQ+IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGGKLDPADKKKIEDAIEQSIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgag----gdmggamgddAPSHGGSEAGPKIEEVD  225
            QG      G    A  +  PS GGS AGPKIEEVD
Sbjct  618  QGGAGPDMGGAPPADTEYTPS-GGSGAGPKIEEVD  651



>ref|XP_004156718.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
Length=659

 Score =   357 bits (916),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 191/215 (89%), Gaps = 4/215 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  445  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  504

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK++DE+HKKKVEAKN+LENY+YNMRN
Sbjct  505  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRN  564

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+K  SKL PADKKKIEDAIEQ +QWLD NQLAE+DEFEDKMKELE ICNPI+AKMY
Sbjct  565  TVRDEKFSSKLDPADKKKIEDAIEQAVQWLDNNQLAEADEFEDKMKELESICNPIVAKMY  624

Query  317  Qgaggdmggamgd----dAPSHGGSEAGPKIEEVD  225
            QGAGG   G          P  GGS AGPKIEEVD
Sbjct  625  QGAGGPGMGGGAMDDDDAPPPSGGSGAGPKIEEVD  659



>dbj|BAP90755.1| heat shock protein 70 [Chrysanthemum x morifolium]
Length=647

 Score =   357 bits (915),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 188/211 (89%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG KL P DKKKIEDAI++ I WLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVKDEKIGEKLTPGDKKKIEDAIDEAIAWLDSNQLAEADEFEDKMKELENVCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            Q  G        D+ P+  G  AGPKIEEVD
Sbjct  618  Q-GGAGDAAGGMDEEPAPSGGGAGPKIEEVD  647



>ref|XP_009374678.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=647

 Score =   357 bits (915),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 195/211 (92%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG+KL PADKKKIED+IE  IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGD  G + DDAP    S  GPKIEEVD
Sbjct  618  QGAGGDGAGPVDDDAPPS-ASGPGPKIEEVD  647



>ref|XP_004302715.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Fragaria vesca subsp. vesca]
Length=647

 Score =   357 bits (915),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 193/211 (91%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIEDAIE  IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIGEKLPGADKKKIEDAIEAAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG+G D  G + DD P+  G  AGPKIEEVD
Sbjct  618  QGSGPDGAGPVDDDVPAGSGG-AGPKIEEVD  647



>emb|CAA55184.1| heat shock protein 70 kDa [Zea mays]
Length=219

 Score =   342 bits (876),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  8    SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  67

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVE+KN+LENY+YNMRN
Sbjct  68   DKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVESKNSLENYAYNMRN  127

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKLA  DKKKIEDAI+  I WLD NQLAE+DEF+DKMKELE + NPIIAKMY
Sbjct  128  TIKDEKIASKLAADDKKKIEDAIDAAISWLDANQLAEADEFDDKMKELESLSNPIIAKMY  187

Query  317  QgaggdmggamgddAPSHGGSEA-GPKIEEVD  225
            QGAG DMGGA G D  +  GS A GPKIEEVD
Sbjct  188  QGAGADMGGAGGMDEDAPAGSGAPGPKIEEVD  219



>ref|XP_002805956.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Macaca mulatta]
Length=224

 Score =   342 bits (877),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  10   SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  69

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HK+KVE+KN+LENY+YNMRN
Sbjct  70   DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKRKVESKNSLENYAYNMRN  129

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI +K+ P+DKKKI+DAIEQ IQWLD NQLAE+DEF+DKMKELE ICNPIIAKMY
Sbjct  130  TIKDEKIAAKVDPSDKKKIDDAIEQAIQWLDNNQLAEADEFDDKMKELESICNPIIAKMY  189

Query  317  Q  315
            Q
Sbjct  190  Q  190



>gb|ABX76301.1| heat shock protein 70 [Ageratina adenophora]
Length=649

 Score =   356 bits (914),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG KL P DKKKIEDAI++ I WLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVKDEKIGEKLTPGDKKKIEDAIDEAIAWLDANQLAEADEFEDKMKELENVCNPIIAKMY  617

Query  317  Qgaggdmggamgd-dAPSHGGSEAGPKIEEVD  225
            QG  GD  GA G  + P+  G  AGPKIEEVD
Sbjct  618  QGGAGDAAGAGGMDEEPAPSGGGAGPKIEEVD  649



>emb|CCJ09763.1| putative heat shock protein-70kDa, partial [Hirudo medicinalis]
Length=229

 Score =   342 bits (877),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  20   SDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  79

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  80   DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  139

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+ ADKKKIED+IE  IQWL+GNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  140  TIKDDKIASKLSAADKKKIEDSIESAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMY  199



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   356 bits (914),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE+KN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKL   DKKKIEDAI+Q IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKISSKLGADDKKKIEDAIDQAIQWLDTNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DMGG M +DAP  G   AGPKIEEVD
Sbjct  618  QGAGADMGGGMEEDAPPAGSGGAGPKIEEVD  648



>ref|XP_008369876.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Malus domestica]
Length=648

 Score =   356 bits (914),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG+KL PADKKKIED+IE  IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGG   G + DD      S  GPKIEEVD
Sbjct  618  QGAGGXGAGPVDDDDAPPSASGPGPKIEEVD  648



>ref|XP_009353695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X1 
[Pyrus x bretschneideri]
Length=649

 Score =   356 bits (914),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYK+EDEDHKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKAEDEDHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL PADKKKIEDA+E  IQWLDGNQL + DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVRDEKIGSKLNPADKKKIEDAVEDAIQWLDGNQLGDCDEFEDKMKELENLCNPIIAKMY  617

Query  317  Qgaggdmggam-gddAPSHGGSEAGPKIEEVD  225
            QGAG D+GG    +DAP      AGPKIEEVD
Sbjct  618  QGAGADVGGGAPDEDAPPAASGGAGPKIEEVD  649



>ref|XP_009388623.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGI+NVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGIINVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKIT+TNDKGRLSK EIEKMVQEAEKYK EDE+HKKK+EAKNALENYSYNMRN
Sbjct  498  DKTTGQKNKITVTNDKGRLSKGEIEKMVQEAEKYKGEDEEHKKKIEAKNALENYSYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI +KL   DKKKIEDA+EQ I WLDGNQLAE+DEFED+MKELE ICNPIIAKMY
Sbjct  558  TIRDEKIAAKLPAEDKKKIEDAVEQAISWLDGNQLAEADEFEDRMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSE-AGPKIEEVD  225
            QGAGG MGG M +D PS GGS  AGPKIEEVD
Sbjct  618  QGAGGGMGGGMDEDIPSTGGSSGAGPKIEEVD  649



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFD+DANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDMDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL   DKKKIEDAI+Q IQWLDGNQL E+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TIKDEKIASKLPAEDKKKIEDAIDQAIQWLDGNQLGEADEFEDKMKELESLCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHG-GSEAGPKIEEVD  225
            QGAGG+ GGAM +D P+ G GS AGPKIEEVD
Sbjct  618  QGAGGEAGGAMDEDGPASGSGSTAGPKIEEVD  649



>ref|XP_004307259.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Fragaria vesca subsp. vesca]
Length=649

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKK+EDAIEQ IQWLDGNQLAE++E++DK+KELEGICNPIIAKMY
Sbjct  558  TIKDDKIASKLDAADKKKVEDAIEQAIQWLDGNQLAEAEEYDDKVKELEGICNPIIAKMY  617

Query  317  Qgag-gdmggamgddAPSHGGSEAGPKIEEVD  225
            QG    DM G + ++ P  GGS AGPKIEEVD
Sbjct  618  QGGAPPDMAGGIDEEVPPSGGSGAGPKIEEVD  649



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   356 bits (913),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 185/215 (86%), Positives = 197/215 (92%), Gaps = 7/215 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMV+EAEKYK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVEEAEKYKAEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG+KL PADKKKIEDAI+Q IQWLDGNQLAE+DEFEDKMKELEGICNPIIA+MY
Sbjct  558  TIKDEKIGAKLDPADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELEGICNPIIARMY  617

Query  317  Qga----ggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG+    GG  GG   D APS G   AGPKIEEVD
Sbjct  618  QGSGADMGGAGGGMDDDGAPSGG---AGPKIEEVD  649



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   355 bits (912),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV DDKI SKLA  DKKKIEDAI+Q IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Q-gaggdmggamgddAPSHGGSEAGPKIEEVD  225
            Q   GGDMGGAM DD P   GS AGPKIEEVD
Sbjct  618  QGAGGGDMGGAMDDDTPPASGSGAGPKIEEVD  649



>gb|AAV97978.1| heat shock protein hsp70 [Saussurea medusa]
Length=647

 Score =   355 bits (912),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 193/212 (91%), Gaps = 3/212 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVC+DIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCYDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG KL P DKKKIEDAI++ I WLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVKDEKIGEKLTPGDKKKIEDAIDEAISWLDSNQLAEADEFEDKMKELENVCNPIIAKMY  617

Query  317  Qgaggdmggam-gddAPSHGGSEAGPKIEEVD  225
            QG  GD  G M  D APS GG  AGPKIEEVD
Sbjct  618  QGGAGDAAGGMDEDAAPSGGG--AGPKIEEVD  647



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score =   355 bits (912),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/215 (87%), Positives = 194/215 (90%), Gaps = 4/215 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL P DKKKIEDAI+  IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGSKLDPTDKKKIEDAIDGAIQWLDNNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgaggdmggamgdd----APSHGGSEAGPKIEEVD  225
            QGAG DMG  MG      AP  GGS AGPKIEEVD
Sbjct  618  QGAGADMGADMGAGMDDDAPPAGGSGAGPKIEEVD  652



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   355 bits (911),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+ KKKVEAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEELKKKVEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL+  DKKKIEDA++Q I WL+ NQLAE DEFEDKMKELEGICNPIIAKMY
Sbjct  558  TVKDEKIGSKLSSDDKKKIEDAVDQAISWLESNQLAEVDEFEDKMKELEGICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGD G  M DDAP  GGS AGPKIEEVD
Sbjct  618  QGAGGDAGVPMDDDAPPSGGSSAGPKIEEVD  648



>gb|ABR13285.1| putative dnaK-type molecular chaperone hsc70.1 [Prunus dulcis]
Length=179

 Score =   339 bits (869),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  1    SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  60

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKV AKNALENY+YNMRN
Sbjct  61   DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVGAKNALENYAYNMRN  120

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKM  321
            T+ D+KIG+KL PADKKKIED+IE  IQWLD NQLAE+DEFEDKMKELE ICNPIIAKM
Sbjct  121  TIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPIIAKM  179



>gb|EAY89450.1| hypothetical protein OsI_10982 [Oryza sativa Indica Group]
Length=438

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 195/213 (92%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  226  SDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  285

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK+EDE+HKKKV+AKN+LENY+YNMRN
Sbjct  286  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVDAKNSLENYAYNMRN  345

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAI+  I WLD NQLAE++EFEDKMKELEG+CNPIIAKMY
Sbjct  346  TIKDDKIASKLPEADKKKIEDAIDGAISWLDSNQLAEAEEFEDKMKELEGVCNPIIAKMY  405

Query  317  QgaggdmggamgddAPSHGG--SEAGPKIEEVD  225
            QGAG DM G M +DAP+  G  S  GPKIEEVD
Sbjct  406  QGAGADMAGGMDEDAPAAAGGSSGPGPKIEEVD  438



>ref|XP_003554320.2| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
Length=721

 Score =   357 bits (917),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 192/218 (88%), Gaps = 8/218 (4%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  505  SDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  564

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  565  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  624

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV DDKIG KL P DKKKIEDAIEQ IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  625  TVKDDKIGEKLDPTDKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  684

Query  317  Qgaggdmggamgd-------dAPSHGGSEAGPKIEEVD  225
            QG  G   G  G         APS GGS AGPKIEEVD
Sbjct  685  QGGAGPDMGGAGAGAAEDDYAAPS-GGSGAGPKIEEVD  721



>ref|XP_004493886.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Cicer arietinum]
Length=650

 Score =   355 bits (911),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 181/214 (85%), Positives = 191/214 (89%), Gaps = 4/214 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGERTRTRDNNLLGKFEL+GIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERTRTRDNNLLGKFELTGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI  KL  ADKKKIED+IEQ IQWLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TIKDDKIAGKLDSADKKKIEDSIEQAIQWLDSNQLAEADEFEDKMKELESVCNPIIAKMY  617

Query  317  Qgag---gdmggamgddAPSHGGSEAGPKIEEVD  225
            QG          A  + APS GGS AGPKIEEVD
Sbjct  618  QGGAGPDMGGAAADEEYAPS-GGSGAGPKIEEVD  650



>ref|XP_001767839.1| predicted protein [Physcomitrella patens]
 gb|EDQ67353.1| predicted protein [Physcomitrella patens]
Length=649

 Score =   355 bits (911),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 189/216 (88%), Gaps = 9/216 (4%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDEDHKKK+EAKN LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEDHKKKIEAKNGLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI S L  ADKKKIEDA+E  IQWLD NQLAESDEFEDKMKELEG+CNPIIA+MY
Sbjct  558  TIKDEKIASNLDAADKKKIEDAVEAAIQWLDQNQLAESDEFEDKMKELEGVCNPIIARMY  617

Query  317  QgaggdmggamgddAPSHGGSE-----AGPKIEEVD  225
            Q       G     APS+GG++     AGPKIEEVD
Sbjct  618  Q----GGAGGGEGAAPSYGGTDSPPSGAGPKIEEVD  649



>ref|XP_009338761.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=656

 Score =   355 bits (911),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  446  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  505

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  506  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  565

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG+KL PADKKKIED+IE  IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  566  TIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  625

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGD  G + DD      S  GPKIEEVD
Sbjct  626  QGAGGDGAGPVDDDDAPPSASGPGPKIEEVD  656



>gb|AIA22210.1| heat shock protein 70 [Chrysanthemum indicum]
Length=647

 Score =   355 bits (910),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 187/211 (89%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            D+TTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DRTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG KL P DKKKIEDAI++ I WLD NQLAE+DEFEDKMKELE +CNPII KMY
Sbjct  558  TVKDEKIGEKLTPGDKKKIEDAIDEAIAWLDSNQLAEADEFEDKMKELENVCNPIIVKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            Q  G        D+ P+  G  AGPKIEEVD
Sbjct  618  Q-GGAGDAAGGMDEEPAPSGGGAGPKIEEVD  647



>emb|CAA83548.1| PsHSC71.0 [Pisum sativum]
Length=647

 Score =   355 bits (910),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  437  SDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  496

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK++IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  497  DKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  556

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI  KL   DKKKIED IEQ IQWLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  557  TIKDDKIAGKLDSEDKKKIEDTIEQAIQWLDSNQLAEADEFEDKMKELESVCNPIIAKMY  616

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG  G   GA  DD    GGS AGPKIEEVD
Sbjct  617  QGGAGPDMGAAADDDAPTGGSGAGPKIEEVD  647



>gb|EEC71767.1| hypothetical protein OsI_04375 [Oryza sativa Indica Group]
Length=423

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  212  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  271

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  272  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  331

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+  DKKKIEDAI+  I WLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  332  TIKDDKIASKLSADDKKKIEDAIDGAINWLDSNQLAEADEFEDKMKELESICNPIIAKMY  391

Query  317  QgaggdmggamgddAPS-HGGSEAGPKIEEVD  225
            QGAG DMGGA G D  +  GGS AGPKIEEVD
Sbjct  392  QGAGADMGGAAGMDEDAPAGGSGAGPKIEEVD  423



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score =   355 bits (910),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 191/216 (88%), Gaps = 5/216 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFEL+GIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIGSKL P DKKKIEDAIEQ IQWLDGNQLAE+DEFEDKMKELE ICNPIIA+MY
Sbjct  558  TIRDEKIGSKLKPEDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAQMY  617

Query  317  Qgaggdmggamgdd----APSHGGSE-AGPKIEEVD  225
            QG  G      G      APS GG   AGPKIEEVD
Sbjct  618  QGGAGADMDGAGGMDDDCAPSAGGGRGAGPKIEEVD  653



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   354 bits (909),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFE SGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFEXSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVE+KN LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVESKNTLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKLA  DKKKIEDAI+Q IQWL+ NQLAE+DEF+DKMKELEGICNPIIAKMY
Sbjct  558  TIKDEKIASKLAADDKKKIEDAIDQAIQWLESNQLAEADEFDDKMKELEGICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            Q   G   G M DD P+ GGS AGPKIEEVD
Sbjct  618  Q-GAGPDMGGMPDDIPTGGGSSAGPKIEEVD  647



>ref|XP_004492129.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=542

 Score =   351 bits (900),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  333  SDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  392

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKN+LENY+YNMRN
Sbjct  393  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNSLENYAYNMRN  452

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+P+DKK IEDAIEQ IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  453  TIKDDKISSKLSPSDKKLIEDAIEQAIQWLDANQLAEADEFEDKMKELETICNPIIAKMY  512

Query  317  Q  315
            Q
Sbjct  513  Q  513



>ref|XP_006664117.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   354 bits (908),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 195/213 (92%), Gaps = 3/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVE+KN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVESKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDA+E  IQWLDGNQLAE+DEF+DKMKELE +CNPIIAKMY
Sbjct  558  TIKDEKIASKLPAADKKKIEDAVEAAIQWLDGNQLAEADEFDDKMKELESLCNPIIAKMY  617

Query  317  Q--gaggdmggamgddAPSHGGSEAGPKIEEVD  225
            Q  GA    GG   DDAPS GGS AGPKIEEVD
Sbjct  618  QGAGADMGAGGMDDDDAPS-GGSGAGPKIEEVD  649



>gb|AAN86275.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=652

 Score =   354 bits (908),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 181/215 (84%), Positives = 190/215 (88%), Gaps = 4/215 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK++DE+HKKKVEAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+K  SKL PADKKKIEDAIE  +QWLD NQLAE+DEFEDKMKELE ICNPI+AKMY
Sbjct  558  TVRDEKFSSKLDPADKKKIEDAIEGAVQWLDNNQLAEADEFEDKMKELESICNPIVAKMY  617

Query  317  Qgaggdmggamgd----dAPSHGGSEAGPKIEEVD  225
            QGAGG   G          P  GGS AGPKIEEVD
Sbjct  618  QGAGGPGMGGAAMDDDDVPPPSGGSGAGPKIEEVD  652



>ref|XP_009786102.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana sylvestris]
Length=648

 Score =   354 bits (908),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 193/211 (91%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYSYNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKL+  DKKKIEDAIE+ IQWLDGNQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  558  TVKDEKIASKLSAEDKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGGAM D+ P+  G  AGPKIEEVD
Sbjct  618  QGAGGDMGGAMDDEGPAPSGGGAGPKIEEVD  648



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   353 bits (907),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 186/211 (88%), Gaps = 14/211 (7%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDAIE  IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKISSKLPAADKKKIEDAIEGAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG              + G  E+GPKIEEVD
Sbjct  618  QG--------------AGGPDESGPKIEEVD  634



>gb|ADB85350.1| putative heat shock cognate [Phyllostachys edulis]
Length=674

 Score =   355 bits (910),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 195/211 (92%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  19   SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  78

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN LENY+YNMRN
Sbjct  79   DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNTLENYAYNMRN  138

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDA+E  IQWLDGNQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  139  TIKDEKIASKLPAADKKKIEDAVEGAIQWLDGNQLAEADEFEDKMKELESLCNPIIAKMY  198

Query  317  QgaggdmggamgddAPS-HGGSEAGPKIEEV  228
            QGAG DMGGA G D  +  GGS AGPKIEEV
Sbjct  199  QGAGADMGGAAGMDEDAPAGGSGAGPKIEEV  229



>ref|XP_001783048.1| predicted protein [Physcomitrella patens]
 gb|EDQ52117.1| predicted protein [Physcomitrella patens]
Length=650

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 188/217 (87%), Gaps = 10/217 (5%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDEDHKKK+EAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEDHKKKIEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI + L  ADKKKIEDA+E  IQWLD NQLAESDEFEDKMKELE +CNPIIA+MY
Sbjct  558  TIRDDKIAANLDAADKKKIEDAVEAAIQWLDHNQLAESDEFEDKMKELESVCNPIIARMY  617

Query  317  QgaggdmggamgddAPSHGG------SEAGPKIEEVD  225
            Q       G     APS+GG      S AGPKIEEVD
Sbjct  618  Q----GGAGGAAGGAPSYGGDDDAAPSGAGPKIEEVD  650



>ref|XP_010558317.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=654

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 181/217 (83%), Positives = 192/217 (88%), Gaps = 6/217 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIE+MVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIEDAIE+ IQWL+GNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIRDEKIGEKLQAADKKKIEDAIEEAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Q------gaggdmggamgddAPSHGGSEAGPKIEEVD  225
            Q        G   G  M DD P  GGS AGPKIEEVD
Sbjct  618  QGGAGGDMGGAAAGAGMDDDVPPSGGSGAGPKIEEVD  654



>gb|KDO67650.1| hypothetical protein CISIN_1g0212722mg, partial [Citrus sinensis]
Length=206

 Score =   338 bits (868),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 181/206 (88%), Gaps = 5/206 (2%)
 Frame = -2

Query  827  VYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKI  648
            VYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKI
Sbjct  1    VYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKI  60

Query  647  TITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRNTVNDDKIGSK  468
            TITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRNT+ DD+IGSK
Sbjct  61   TITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDQIGSK  120

Query  467  LAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMYQgaggdmgga  288
            L+ ADKK+IED IE+ +QWLD NQLAE+DEFEDKMKELE ICNPIIAKMYQG      G 
Sbjct  121  LSAADKKRIEDTIEEAMQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQGGVAPGAGP  180

Query  287  mg-----ddAPSHGGSEAGPKIEEVD  225
                   + AP  GGS AGPKIEEVD
Sbjct  181  APGPGMDESAPPAGGSSAGPKIEEVD  206



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 196/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFD+DANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDMDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL   DKKKIEDAI+Q IQWLDGNQL E+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIASKLPADDKKKIEDAIDQAIQWLDGNQLGEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPS-HGGSEAGPKIEEVD  225
            QGAGGD GGAM +D P+   GS AGPKIEEVD
Sbjct  618  QGAGGDAGGAMDEDGPAPASGSGAGPKIEEVD  649



>gb|KJB73858.1| hypothetical protein B456_011G256600 [Gossypium raimondii]
Length=652

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 190/215 (88%), Gaps = 4/215 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIGSKL+P DKKKIEDAI+  I WLD NQ AE+DEFEDKMKELE +CNP+IAKMY
Sbjct  558  TIKDEKIGSKLSPDDKKKIEDAIDAAINWLDANQSAEADEFEDKMKELESLCNPVIAKMY  617

Query  317  QgaggdmggamgddA----PSHGGSEAGPKIEEVD  225
            QG  G   G  G  A    PS GG  AGPKIEEVD
Sbjct  618  QGGAGPDMGRAGGMADDVPPSRGGGGAGPKIEEVD  652



>gb|AAX07349.1| heat shock protein 70 [Zea mays]
Length=373

 Score =   344 bits (883),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  162  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  221

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVE+KN+LENY+YNMRN
Sbjct  222  DKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVESKNSLENYAYNMRN  281

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKLA  DKKKIEDAI+  I WLD NQLAE+DEF+DKMKELE +CNPIIAKMY
Sbjct  282  TIKDEKIASKLAADDKKKIEDAIDAAISWLDANQLAEADEFDDKMKELESLCNPIIAKMY  341

Query  317  QgaggdmggamgddAPSHGGSEA-GPKIEEVD  225
            QGAG DMGGA G D  +  GS   GPKIEEVD
Sbjct  342  QGAGADMGGAGGMDEDAPAGSGGPGPKIEEVD  373



>gb|EMS52605.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=647

 Score =   353 bits (906),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 193/211 (91%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYSYNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL   DKKKIEDAI+  IQWLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQLAEADEFEDKMKELEALCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DM G M DD P+  G  AGPKIEEVD
Sbjct  618  QGAGADMEGGMDDDTPAASGG-AGPKIEEVD  647



>ref|XP_006398709.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
 gb|ESQ40162.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
Length=651

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 194/216 (90%), Gaps = 7/216 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED+IEQ IQWL+GNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddA-----PSHGGSEAGPKIEEVD  225
            QGAGG+ GG           PS GG  AGPKIEEVD
Sbjct  618  QGAGGEAGGPGAAGMDDDAPPSSGG--AGPKIEEVD  651



>gb|AGL07711.1| heat shock protein 70 [Ziziphus jujuba]
Length=654

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 181/217 (83%), Positives = 190/217 (88%), Gaps = 6/217 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPG LIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGALIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKV+AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL+ ADKKKIEDAI+Q IQWLDGNQLAE+DEF DKMKELE ICNP+IAK Y
Sbjct  558  TIKDEKISSKLSDADKKKIEDAIDQAIQWLDGNQLAEADEFGDKMKELESICNPVIAKTY  617

Query  317  QgaggdmggamgddA------PSHGGSEAGPKIEEVD  225
            QGAG   GG            P  GGS AGPKIEEVD
Sbjct  618  QGAGAGAGGPDVGGGSDDDVPPPSGGSSAGPKIEEVD  654



>ref|XP_006574857.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
Length=586

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  375  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  434

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  435  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  494

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL+  DKKKIEDAIE  IQWLDGNQLAE+DEFEDKMKELE  CNPIIAKMY
Sbjct  495  TIKDEKIASKLSGDDKKKIEDAIESAIQWLDGNQLAEADEFEDKMKELESTCNPIIAKMY  554

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG  DM G M +D P  G   AGPKIEEVD
Sbjct  555  QGAGAPDMAGGMDEDVPPSGSGGAGPKIEEVD  586



>ref|XP_009597695.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana tomentosiformis]
Length=648

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYSYNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKL+  DKKKIEDAIE+ IQWLDGNQLAE+DEFEDKMKELEG+CNPIIAKMY
Sbjct  558  TVKDEKIASKLSAEDKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGLCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGGAM D+ P+  G  AGPKIEEVD
Sbjct  618  QGAGGDMGGAMDDEGPAPSGGGAGPKIEEVD  648



>ref|XP_010452091.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=340

 Score =   343 bits (879),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 192/217 (88%), Gaps = 8/217 (4%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  126  SDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  185

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            D+TTGQK+KITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YN+RN
Sbjct  186  DETTGQKSKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNLRN  245

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED+I + IQWL+GNQLAE+DEFEDKMKELEG+CNPIIAKMY
Sbjct  246  TIRDEKIGEKLPAADKKKIEDSIGEAIQWLEGNQLAEADEFEDKMKELEGVCNPIIAKMY  305

Query  317  QgaggdmggamgddA------PSHGGSEAGPKIEEVD  225
            QG  G   G  G  A      P+ GG  AGPKIEEVD
Sbjct  306  QGGAGGEAGGPGPHAMDEDAPPASGG--AGPKIEEVD  340



>ref|XP_009414319.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 196/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIE+MVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV DDKI SKL  ADKKKIEDA++Q IQWLD NQLAE DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TVKDDKIASKLPAADKKKIEDAVDQAIQWLDANQLAEVDEFEDKMKELENLCNPIIAKMY  617

Query  317  QgaggdmggamgddA-PSHGGSEAGPKIEEVD  225
            QGAGG M G M ++  PS+GG  AGPKIEEVD
Sbjct  618  QGAGGGMAGGMDEEEGPSNGGGGAGPKIEEVD  649



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 180/214 (84%), Positives = 190/214 (89%), Gaps = 3/214 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+ KKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEVKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAIEQ IQWLDGNQLAE++E++DK+KELEGICNPIIAKMY
Sbjct  558  TIKDDKIASKLDAADKKKIEDAIEQAIQWLDGNQLAEAEEYDDKVKELEGICNPIIAKMY  617

Query  317  Qgaggdmggamgdd---APSHGGSEAGPKIEEVD  225
            QG      G  G      P  GGS AGPKIEEVD
Sbjct  618  QGGAAPDMGMGGGMDEDVPPAGGSGAGPKIEEVD  651



>ref|XP_001785822.1| predicted protein [Physcomitrella patens]
 gb|EDQ49366.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 189/216 (88%), Gaps = 10/216 (5%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDEDHKKK+E+KN LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEDHKKKIESKNGLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI S L  ADKKKIEDA+E  IQWLD NQLAESDEF+DKMKELEG+CNPIIA+MY
Sbjct  558  TIKDEKIASNLDAADKKKIEDAVEAAIQWLDQNQLAESDEFDDKMKELEGVCNPIIARMY  617

Query  317  QgaggdmggamgddAPSHGGSE-----AGPKIEEVD  225
            Q      G      APS+GGS+     AGPKIEEVD
Sbjct  618  Q-----GGAGGEGGAPSNGGSDSSPSGAGPKIEEVD  648



>emb|CAA54419.1| heat shock cognate 70-1 [Arabidopsis thaliana]
Length=637

 Score =   352 bits (904),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 194/216 (90%), Gaps = 7/216 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  424  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  483

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNK+TITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  484  DKTTGQKNKVTITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  543

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED+IEQ IQWL+GNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  544  TIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMY  603

Query  317  QgaggdmggamgddA-----PSHGGSEAGPKIEEVD  225
            QGAGG+ GG           P+ GG  AGPKIEEVD
Sbjct  604  QGAGGEAGGPGASGMDDDAPPASGG--AGPKIEEVD  637



>ref|XP_006392363.1| hypothetical protein EUTSA_v10023343mg [Eutrema salsugineum]
 gb|ESQ29649.1| hypothetical protein EUTSA_v10023343mg [Eutrema salsugineum]
Length=633

 Score =   352 bits (903),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 194/216 (90%), Gaps = 7/216 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQIT+CFDIDANGILNVSAE
Sbjct  420  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITICFDIDANGILNVSAE  479

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  480  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  539

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED+IE+ IQWLDGNQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  540  TIRDEKIGEKLPAADKKKIEDSIEEVIQWLDGNQLAEADEFEDKMKELESVCNPIIAKMY  599

Query  317  QgaggdmggamgddA-----PSHGGSEAGPKIEEVD  225
            QGAGG+ GG           PS GG  AGPKIEEVD
Sbjct  600  QGAGGEPGGPAAGMDDDEAPPSSGG--AGPKIEEVD  633



>ref|XP_002873056.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49315.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
Length=650

 Score =   352 bits (904),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 193/215 (90%), Gaps = 6/215 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED+IEQ IQWL+GNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddA----PSHGGSEAGPKIEEVD  225
            QGAGG+ G           P+ GG  AGPKIEEVD
Sbjct  618  QGAGGEAGPGASGMDDDAPPASGG--AGPKIEEVD  650



>ref|XP_010452093.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Camelina sativa]
 ref|XP_010452094.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Camelina sativa]
 ref|XP_010490701.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Camelina sativa]
Length=651

 Score =   352 bits (904),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 194/216 (90%), Gaps = 7/216 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED+IEQ IQWL+GNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddA-----PSHGGSEAGPKIEEVD  225
            QGAGG+ GG           P+ GG  AGPKIEEVD
Sbjct  618  QGAGGEAGGPGAAGMDDDAPPASGG--AGPKIEEVD  651



>emb|CAA52684.1| heat shock protein 70 cognate [Arabidopsis thaliana]
Length=651

 Score =   352 bits (904),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 194/216 (90%), Gaps = 7/216 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED+IEQ IQWL+GNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddA-----PSHGGSEAGPKIEEVD  225
            QGAGG+ GG           P+ GG  AGPKIEEVD
Sbjct  618  QGAGGEAGGPGASGMDDDAPPASGG--AGPKIEEVD  651



>ref|XP_006287234.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
 gb|EOA20132.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
Length=651

 Score =   352 bits (904),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 194/216 (90%), Gaps = 7/216 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED+IEQ IQWL+GNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddA-----PSHGGSEAGPKIEEVD  225
            QGAGG+ GG           P+ GG  AGPKIEEVD
Sbjct  618  QGAGGEAGGPGAGGMDDDAPPASGG--AGPKIEEVD  651



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   352 bits (904),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKV+AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG+KL PADKKKIEDAIEQ IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGAKLPPADKKKIEDAIEQAIQWLDNNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Q  315
            Q
Sbjct  618  Q  618



>gb|AFU34347.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34348.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34349.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34350.1| 70-kDa heat shock protein [Ipomoea batatas]
Length=652

 Score =   352 bits (904),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 201/215 (93%), Gaps = 4/215 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL+  DKKKIEDAIEQ IQWL+GNQL E+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLGEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAP----SHGGSEAGPKIEEVD  225
            QGAGGDMGGAM +DAP    S  G+ AGPKIEEVD
Sbjct  618  QGAGGDMGGAMDEDAPHAGGSSAGASAGPKIEEVD  652



>ref|NP_195870.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 sp|P22953.3|MD37E_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37e; AltName: Full=Heat shock 70 kDa protein 1; 
AltName: Full=Heat shock cognate 70 kDa protein 1; AltName: 
Full=Heat shock cognate protein 70-1; Short=AtHsc70-1; AltName: 
Full=Heat shock protein 70-1; Short=AtHsp70-1; AltName: 
Full=Protein EARLY-RESPONSIVE TO DEHYDRATION 2 [Arabidopsis 
thaliana]
 emb|CAB85987.1| dnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAL09715.1| AT5g02500/T22P11_90 [Arabidopsis thaliana]
 gb|AAM53305.1| DnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAO22583.1| putative dnaK-type molecular chaperone hsc70.1 protein [Arabidopsis 
thaliana]
 gb|AED90480.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=651

 Score =   352 bits (904),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 194/216 (90%), Gaps = 7/216 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED+IEQ IQWL+GNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddA-----PSHGGSEAGPKIEEVD  225
            QGAGG+ GG           P+ GG  AGPKIEEVD
Sbjct  618  QGAGGEAGGPGASGMDDDAPPASGG--AGPKIEEVD  651



>ref|XP_006290203.1| hypothetical protein CARUB_v10003889mg [Capsella rubella]
 gb|EOA23101.1| hypothetical protein CARUB_v10003889mg [Capsella rubella]
Length=650

 Score =   352 bits (903),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 179/214 (84%), Positives = 193/214 (90%), Gaps = 5/214 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  439  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  498

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKV+AKNALENY+YNMRN
Sbjct  499  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRN  558

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  A+KKKIED+IE+ IQWLDGNQLAE+DEFEDKMKELEG+CNPIIAKMY
Sbjct  559  TIRDEKIGEKLPAAEKKKIEDSIEEAIQWLDGNQLAEADEFEDKMKELEGLCNPIIAKMY  618

Query  317  Qgaggdmggamg---ddAPSHGGSEAGPKIEEVD  225
            QG  G  G A     +  P+ GG  AGPKIEEVD
Sbjct  619  QGGAGGPGAAAMDEDEAPPASGG--AGPKIEEVD  650



>ref|XP_006407675.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49128.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=561

 Score =   349 bits (896),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 187/215 (87%), Gaps = 6/215 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  349  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  408

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIE+MVQEAEKYKSEDEDHKKKVEAKNALENY+YNMRN
Sbjct  409  DKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRN  468

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KLA  DKKKIED+IE  I+WLD NQLAE DEFEDKMKELE ICNPIIAKMY
Sbjct  469  TIRDEKIGEKLAADDKKKIEDSIEAAIEWLDANQLAECDEFEDKMKELESICNPIIAKMY  528

Query  317  QgaggdmggamgddA----PSHGGSEAGPKIEEVD  225
            QG       A G       PS GG  AGPKIEEVD
Sbjct  529  QGGEAGGPAAAGGMDEDVPPSAGG--AGPKIEEVD  561



>ref|XP_002884912.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61171.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   352 bits (903),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 193/213 (91%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDAI+Q I+WLDGNQLAE+DEFEDKMKELE ICNPIIA+MY
Sbjct  558  TIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKELESICNPIIARMY  617

Query  317  Qgag--gdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG        M DDAP+ G   AGPKIEEVD
Sbjct  618  QGAGPDMGGAAGMDDDAPASGSGGAGPKIEEVD  650



>ref|XP_010423853.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Camelina sativa]
Length=651

 Score =   352 bits (903),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 194/216 (90%), Gaps = 7/216 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED+IEQ IQWL+GNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIQDEKIGEKLPVADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddA-----PSHGGSEAGPKIEEVD  225
            QGAGG+ GG           P+ GG  AGPKIEEVD
Sbjct  618  QGAGGEAGGPGAAGMDDDAPPASGG--AGPKIEEVD  651



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   352 bits (903),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAIEQ IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKIASKLDAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Q  315
            Q
Sbjct  618  Q  618



>dbj|BAD94888.1| dnaK-type molecular chaperone hsc70.1 - like [Arabidopsis thaliana]
Length=404

 Score =   344 bits (882),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 189/218 (87%), Gaps = 9/218 (4%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  189  SDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  248

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTG+KNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  249  DKTTGKKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  308

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKK+ED+IE+ IQWLDGNQL E+DEFEDKMKELE +CNPII KMY
Sbjct  309  TIRDEKIGEKLPAADKKKVEDSIEEAIQWLDGNQLGEADEFEDKMKELESVCNPIIGKMY  368

Query  317  QgaggdmggamgddA-------PSHGGSEAGPKIEEVD  225
            QG  G   G  G          P+ GG  AGPKIEEVD
Sbjct  369  QGGAGGEAGGPGASGMDEDEAPPASGG--AGPKIEEVD  404



>gb|ADN03965.1| heat shock cognate 70 kDa protein [Phytolacca acinosa]
Length=588

 Score =   350 bits (897),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 194/214 (91%), Gaps = 3/214 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  375  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAE  434

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIE+MVQEAE+YKSEDE+HKKKVEAKN LENY+YNMRN
Sbjct  435  DKTTGQKNKITITNDKGRLSKEEIERMVQEAERYKSEDEEHKKKVEAKNGLENYAYNMRN  494

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI +KL   +KKKIEDAI+Q IQWLDGNQLAE DEFEDKMKELE +CNPIIAKMY
Sbjct  495  TIKDDKISAKLPADEKKKIEDAIDQAIQWLDGNQLAEVDEFEDKMKELESVCNPIIAKMY  554

Query  317  Q--gaggdmggamgddAPSHGGSE-AGPKIEEVD  225
            Q    GGDMGG M DD PS GG+  AGPKIEEVD
Sbjct  555  QGGAGGGDMGGHMDDDGPSAGGANGAGPKIEEVD  588



>gb|KHN13891.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   352 bits (902),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL+  DKKKIEDAIE  IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIASKLSDDDKKKIEDAIESAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG  DM G M +D P  G   AGPKIEEVD
Sbjct  618  QGAGAPDMAGGMDEDVPPSGSGGAGPKIEEVD  649



>ref|XP_003552691.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform 1 [Glycine 
max]
Length=649

 Score =   352 bits (902),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL+  DKKKIEDAIE  IQWLDGNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKIASKLSDDDKKKIEDAIESAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG  DM G M +D P  G   AGPKIEEVD
Sbjct  618  QGAGAPDMAGGMDEDVPPSGSGGAGPKIEEVD  649



>gb|AHW48175.1| heat shock protein 70, partial [Triticum aestivum]
Length=539

 Score =   348 bits (893),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 181/214 (85%), Positives = 194/214 (91%), Gaps = 3/214 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  326  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  385

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK+EDE+HKKKV++KNALENY+YNMRN
Sbjct  386  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVDSKNALENYAYNMRN  445

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAIE  I WLD NQLAE+DEF+DKMKELEGICNPIIAKMY
Sbjct  446  TIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADEFDDKMKELEGICNPIIAKMY  505

Query  317  QgaggdmggamgddAPSH---GGSEAGPKIEEVD  225
            QGAG +M G M +DAP+    G S  GPKIEEVD
Sbjct  506  QGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD  539



>gb|AEO22185.1| CytHSP70 [Triticum aestivum]
Length=540

 Score =   348 bits (893),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 181/214 (85%), Positives = 194/214 (91%), Gaps = 3/214 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  327  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  386

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK+EDE+HKKKV++KNALENY+YNMRN
Sbjct  387  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVDSKNALENYAYNMRN  446

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKIEDAIE  I WLD NQLAE+DEF+DKMKELEGICNPIIAKMY
Sbjct  447  TIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADEFDDKMKELEGICNPIIAKMY  506

Query  317  QgaggdmggamgddAPSH---GGSEAGPKIEEVD  225
            QGAG +M G M +DAP+    G S  GPKIEEVD
Sbjct  507  QGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD  540



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   351 bits (901),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+  DKKKIEDAI+Q I WLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TIKDDKISSKLSADDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESLCNPIIAKMY  617

Query  317  Qgaggdmgg-amgddAPSHGGSEAGPKIEEVD  225
            QGAGG+ G     DDAP  G + AGPKIEEVD
Sbjct  618  QGAGGEAGAPMDDDDAPPAGSTGAGPKIEEVD  649



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   351 bits (901),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YK+EDE+HKKKVEAKNALENYSYNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAERYKAEDEEHKKKVEAKNALENYSYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+  DKKKIEDAI+Q I WLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TIKDDKISSKLSAEDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESLCNPIIAKMY  617

Query  317  Qgaggdmgg-amgddAPSHGGSEAGPKIEEVD  225
            QGAGG+ G     DDAP  G + AGPKIEEVD
Sbjct  618  QGAGGEAGAPMDDDDAPPAGSTGAGPKIEEVD  649



>ref|XP_002468097.1| hypothetical protein SORBIDRAFT_01g039530 [Sorghum bicolor]
 gb|EER95095.1| hypothetical protein SORBIDRAFT_01g039530 [Sorghum bicolor]
Length=649

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFD+DANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDMDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL  ADKKKI+DAIE  I WLD NQLAE DEFEDKMKELEGICNPIIAKMY
Sbjct  558  TIRDDKIASKLPEADKKKIDDAIEGAINWLDNNQLAEVDEFEDKMKELEGICNPIIAKMY  617

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QGA G DM G M  DAP  GGS AGPKIEEVD
Sbjct  618  QGAAGPDMAGGMDQDAPPAGGSGAGPKIEEVD  649



>gb|KFK24738.1| hypothetical protein AALP_AA8G018100 [Arabis alpina]
Length=650

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 183/215 (85%), Positives = 193/215 (90%), Gaps = 6/215 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED+IEQ IQWL+GNQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddA----PSHGGSEAGPKIEEVD  225
            QGAGG+ G   G       PS GG   GPKIEEVD
Sbjct  618  QGAGGEAGPGAGGMDDDAPPSSGGP--GPKIEEVD  650



>ref|XP_010423825.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37c [Camelina sativa]
Length=658

 Score =   351 bits (901),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 193/220 (88%), Gaps = 9/220 (4%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  439  SDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  498

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  499  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  558

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED+IEQ IQWL+GNQLAE+DEFEDKMKELEG+CNPIIAK+Y
Sbjct  559  TIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAETDEFEDKMKELEGVCNPIIAKIY  618

Query  317  QgaggdmggamgddA-------PSHGGSEAGPKIEEVD*V  219
            QG  G   G  G          P+ GG  AGPKIEEVD V
Sbjct  619  QGGAGGEAGGPGAAGMDYDEAPPASGG--AGPKIEEVDXV  656



>gb|ABD32895.1| Heat shock protein Hsp70 [Medicago truncatula]
 gb|AES81705.2| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 189/213 (89%), Gaps = 3/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI  KL   DKKKIED IE  IQWLD NQLAE+DEFEDKMKELEG+CNPIIAKMY
Sbjct  558  TIKDEKIAGKLDSDDKKKIEDTIEAAIQWLDANQLAEADEFEDKMKELEGVCNPIIAKMY  617

Query  317  Qgagg--dmggamgddAPSHGGSEAGPKIEEVD  225
            QG  G         DDAPSH G  AGPKIEEVD
Sbjct  618  QGGAGPDMGAAPGDDDAPSHAGG-AGPKIEEVD  649



>gb|EMT07406.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=647

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYSYNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL   DKKKIEDAI+  IQWLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQLAEADEFEDKMKELEALCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DM G M DD P+  G   GPKIEEVD
Sbjct  618  QGAGADMEGGMDDDTPAASGG-PGPKIEEVD  647



>gb|KHN27222.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL+  DKKKIEDAIE  IQWLDGNQLAE+DEFEDKMKELE  CNPIIAKMY
Sbjct  558  TIKDEKIASKLSGDDKKKIEDAIESAIQWLDGNQLAEADEFEDKMKELESTCNPIIAKMY  617

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG  DM G M +D P  G   AGPKIEEVD
Sbjct  618  QGAGAPDMAGGMDEDVPPSGSGGAGPKIEEVD  649



>ref|XP_010253827.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=619

 Score =   350 bits (897),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 193/211 (91%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  409  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  468

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  469  DKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVESKNALENYAYNMRN  528

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI SKLA ADKKKIEDAIEQ IQWLD NQLAE+DEF+DKMKELE ICNPIIAKMY
Sbjct  529  TVRDEKIASKLAAADKKKIEDAIEQAIQWLDSNQLAEADEFDDKMKELESICNPIIAKMY  588

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMGG M DD PS GGS AGPKIEEVD
Sbjct  589  QGAGGDMGGGMSDDGPSAGGSGAGPKIEEVD  619



>gb|AAV98051.1| heat shock protein 70 [Medicago sativa]
Length=649

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 190/212 (90%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL+  DKK+IEDAIE  IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKISSKLSGGDKKQIEDAIEGAIQWLDANQLAEADEFEDKMKELETICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGS-EAGPKIEEVD  225
            QG  G+      D AP   GS  AGPKIEEVD
Sbjct  618  QGGAGEGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>ref|XP_003621886.1| Heat shock protein [Medicago truncatula]
 gb|AES78104.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   350 bits (899),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 190/212 (90%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL+  DKK+IEDAIE  IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKISSKLSGGDKKQIEDAIEGAIQWLDANQLAEADEFEDKMKELETICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGS-EAGPKIEEVD  225
            QG  G+      D AP   GS  AGPKIEEVD
Sbjct  618  QGGAGEGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score =   350 bits (899),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 191/213 (90%), Gaps = 4/213 (2%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMV+EAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVEEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIGSKL+P DKKKI+DAI+  IQWLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TIKDEKIGSKLSPEDKKKIDDAIDAAIQWLDSNQLAEADEFEDKMKELESLCNPIIAKMY  617

Query  317  Qgaggdmggamg--ddAPSHGGSEAGPKIEEVD  225
            QG G    G     +  P+ GG  AGPKIEEVD
Sbjct  618  QGGGAPDMGGGMDDEVPPAAGG--AGPKIEEVD  648



>ref|NP_001055754.1| Os05g0460000 [Oryza sativa Japonica Group]
 gb|AAT39165.1| putative hsp70 [Oryza sativa Japonica Group]
 dbj|BAF17668.1| Os05g0460000 [Oryza sativa Japonica Group]
 dbj|BAH01403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63984.1| hypothetical protein OsJ_18811 [Oryza sativa Japonica Group]
Length=646

 Score =   350 bits (899),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 194/211 (92%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAE
Sbjct  437  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAE  496

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  497  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  556

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKLA  DKK+IEDAI+  I WLD NQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  557  TIKDEKIASKLAADDKKRIEDAIDGAISWLDTNQLAEADEFEDKMKELEGICNPIIAKMY  616

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG G DM G M +DAP+ GGS AGPKIEEVD
Sbjct  617  QGPGADMAGGMDEDAPA-GGSGAGPKIEEVD  646



>ref|XP_004493999.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=661

 Score =   351 bits (900),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 188/209 (90%), Gaps = 2/209 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI  KL  ADKKKIED+IEQ IQWLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TIKDDKIAGKLDSADKKKIEDSIEQAIQWLDSNQLAEADEFEDKMKELESVCNPIIAKMY  617

Query  317  Qgagg--dmggamgddAPSHGGSEAGPKI  237
            QG  G    G A  ++ P  GGS AGPKI
Sbjct  618  QGGAGPDMGGAAADEEYPPSGGSGAGPKI  646



>ref|XP_004492128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=647

 Score =   350 bits (899),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+P+DKK IEDAIEQ IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKISSKLSPSDKKLIEDAIEQAIQWLDANQLAEADEFEDKMKELETICNPIIAKMY  617

Query  317  Q  315
            Q
Sbjct  618  Q  618



>gb|AAB88009.1| heat shock cognate protein HSC70 [Brassica napus]
Length=645

 Score =   350 bits (898),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 191/211 (91%), Gaps = 2/211 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  437  SDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  496

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITIT DKGRLSK++IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  497  DKTTGQKNKITITTDKGRLSKDDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  556

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIEDAIEQ IQWL+ NQL E+DEFEDKMKELE ICNPIIAKMY
Sbjct  557  TIQDEKIGEKLPAADKKKIEDAIEQAIQWLENNQLGEADEFEDKMKELESICNPIIAKMY  616

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGG+  G   D  P+ GG  AGPKIEEVD
Sbjct  617  QGAGGEAAGMDDDAPPASGG--AGPKIEEVD  645



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score =   350 bits (898),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 192/211 (91%), Gaps = 3/211 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIG KL+P DKKKIEDAI+  + WLD NQLAE+ EFEDKMKELE +CNPIIAKMY
Sbjct  558  TVKDEKIGEKLSPEDKKKIEDAIDGAVSWLDNNQLAEAGEFEDKMKELENVCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            Q  GG    AM DD P+ GGS AGPKIEEVD
Sbjct  618  Q--GGAGDAAMDDDVPA-GGSGAGPKIEEVD  645



>ref|XP_004287404.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   350 bits (898),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+ KKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEVKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL   DKKKIEDAIEQ IQWLDGNQLAE++E++DK+KELEGICNPIIAKMY
Sbjct  558  TIKDEKIASKLDAGDKKKIEDAIEQAIQWLDGNQLAEAEEYDDKVKELEGICNPIIAKMY  617

Query  317  Qgagg-dmggamgddAPSHGGSEAGPKIEEVD  225
            QG    DMGG M +D P  GGS AGPKIEEVD
Sbjct  618  QGGAAPDMGGGMDEDVPPAGGSGAGPKIEEVD  649



>ref|XP_001751923.1| predicted protein [Physcomitrella patens]
 gb|EDQ83358.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   350 bits (898),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 189/216 (88%), Gaps = 10/216 (5%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDEDHKKK+EAKN LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEDHKKKIEAKNGLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI S L  ADKKKIE+A+E  IQWLD NQLAESDEF+DKMKELEGICNPIIA+MY
Sbjct  558  TIKDEKIASNLDAADKKKIEEAVEAAIQWLDQNQLAESDEFDDKMKELEGICNPIIARMY  617

Query  317  QgaggdmggamgddAPSHGGSE-----AGPKIEEVD  225
            QG  G  G        S+GGS+     AGPKIEEVD
Sbjct  618  QGGAGGEGAPP-----SYGGSDSPPSGAGPKIEEVD  648



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score =   350 bits (897),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI +KL PADKKKIEDA+EQ IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TVKDEKISAKLPPADKKKIEDAVEQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMY  617

Query  317  Q  315
            Q
Sbjct  618  Q  618



>ref|XP_003563611.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=648

 Score =   349 bits (896),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 195/211 (92%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  439  SDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  498

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK++IEKMVQ+AEKYKSEDE+HKKKVEAKN LENY+YNMRN
Sbjct  499  DKTTGQKNKITITNDKGRLSKDDIEKMVQDAEKYKSEDEEHKKKVEAKNTLENYAYNMRN  558

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T++D+KI SKL   DKKKIEDA++Q IQWLD NQLAE DEFEDKMKELEG+CNPIIAKMY
Sbjct  559  TISDEKIASKLPADDKKKIEDAVDQAIQWLDNNQLAEVDEFEDKMKELEGLCNPIIAKMY  618

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DM G M +DAP+  G  AGPKIEEVD
Sbjct  619  QGAGADMPGGMDEDAPAASGG-AGPKIEEVD  648



>ref|XP_009122772.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37e [Brassica rapa]
Length=646

 Score =   349 bits (896),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 192/211 (91%), Gaps = 2/211 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK++IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIE++IEQ IQWL+ NQL E+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIQDEKIGEKLPAADKKKIEESIEQAIQWLENNQLGEADEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGG+  G   D  P+ GG  AGPKIEEVD
Sbjct  618  QGAGGEAAGMDDDAPPASGG--AGPKIEEVD  646



>ref|XP_009120551.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=650

 Score =   349 bits (896),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 191/213 (90%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL  ADKKKIEDAI+Q I+WL+GNQLAE+DEFEDKMKELE +CNPIIA+MY
Sbjct  558  TIKDEKIASKLDAADKKKIEDAIDQAIEWLEGNQLAEADEFEDKMKELESLCNPIIARMY  617

Query  317  Q--gaggdmggamgddAPSHGGSEAGPKIEEVD  225
            Q  G      G M DD P+ G   AGPKIEEVD
Sbjct  618  QGAGGDMGGAGGMDDDVPTGGSGGAGPKIEEVD  650



>ref|XP_010490742.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=654

 Score =   349 bits (896),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 178/218 (82%), Positives = 192/218 (88%), Gaps = 9/218 (4%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  439  SDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  498

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  499  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  558

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED+IEQ IQWL+GNQLAE+DE+EDKMKELEG+CNPIIAK+Y
Sbjct  559  TIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEYEDKMKELEGVCNPIIAKIY  618

Query  317  QgaggdmggamgddA-------PSHGGSEAGPKIEEVD  225
            QG  G   G  G          P+ GG  AGPKIEEVD
Sbjct  619  QGGAGGEAGGPGAAGMDYDEAPPASGG--AGPKIEEVD  654



>gb|EMT11425.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=648

 Score =   349 bits (896),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKLA  DKKKIEDAI+Q IQWLDGNQLAE+DEF+DKMKELEG+CNPIIAKMY
Sbjct  558  TIKDDKIASKLAADDKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGLCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG +M G M +D        AGPKIEEVD
Sbjct  618  QGAGANMAGGMDEDDAPPAAGGAGPKIEEVD  648



>gb|ACJ85522.1| unknown [Medicago truncatula]
 gb|AFK38758.1| unknown [Medicago truncatula]
Length=649

 Score =   349 bits (896),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 189/212 (89%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL+  DKK+IEDAIE   QWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDEKISSKLSGGDKKQIEDAIEGAFQWLDANQLAEADEFEDKMKELETICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGS-EAGPKIEEVD  225
            QG  G+      D AP   GS  AGPKIEEVD
Sbjct  618  QGGAGEGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>dbj|BAJ91305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=647

 Score =   349 bits (895),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYSYNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL   DKKKIE+AI+  IQWLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  558  TIKDEKIASKLPADDKKKIEEAIDAAIQWLDTNQLAEADEFEDKMKELEALCNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAG DM G M DD P+  G   GPKIEEVD
Sbjct  618  QGAGADMEGGMDDDTPAASGG-PGPKIEEVD  647



>tpg|DAA55190.1| TPA: heat shock protein70-4 [Zea mays]
Length=521

 Score =   345 bits (885),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  310  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  369

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVEAKN+LENYSYNMRN
Sbjct  370  DKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNSLENYSYNMRN  429

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KI SKL   DKKKIEDAI+  I WLD NQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  430  TIKDEKIASKLPADDKKKIEDAIDAAISWLDANQLAEADEFEDKMKELESLCNPIIAKMY  489

Query  317  QgaggdmggamgddAPSHGGSEA-GPKIEEVD  225
            QGAG DMGGA G D  +  GS   GPKIEEVD
Sbjct  490  QGAGEDMGGAGGMDEDAPAGSGGPGPKIEEVD  521



>sp|P29357.3|HSP7E_SPIOL RecName: Full=Chloroplast envelope membrane 70 kDa heat shock-related 
protein [Spinacia oleracea]
 emb|CAA43711.1| 70 kDa heat shock protein [Spinacia oleracea]
Length=653

 Score =   349 bits (895),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPP PRGVPQI VCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPGPRGVPQINVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKI ITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKIRITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
             V D+KIG+KL+ ADKKKIE+AI+ +IQWLDGNQLAE+DEF+DKMKELE ICNPIIAKMY
Sbjct  558  IVKDEKIGAKLSEADKKKIEEAIDASIQWLDGNQLAEADEFDDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEE  231
            QGAGGDMGG M D+ P+ GG  AGPKIEE
Sbjct  618  QGAGGDMGGGMEDEGPTSGGG-AGPKIEE  645



>ref|XP_010937656.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Elaeis guineensis]
Length=647

 Score =   349 bits (895),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNV+AE
Sbjct  437  SDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVTAE  496

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTG KNKITITNDKGRLSKEEIEK+V++AEKYK+EDE+H+KK++AKNALENY+YNMRN
Sbjct  497  DKTTGHKNKITITNDKGRLSKEEIEKLVRDAEKYKAEDEEHRKKIDAKNALENYAYNMRN  556

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL+P+DKKKIEDAIE+TIQWLDGNQLAE+DEFEDKMKELE +CNPIIAKMY
Sbjct  557  TIKDDKIASKLSPSDKKKIEDAIEKTIQWLDGNQLAEADEFEDKMKELESLCNPIIAKMY  616

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QG G  M G M +DAPS G   AGP+IEEVD
Sbjct  617  QGGGAGMAGGMDEDAPSGGAGGAGPRIEEVD  647



>ref|XP_006407676.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49129.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=650

 Score =   349 bits (895),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 187/215 (87%), Gaps = 6/215 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIE+MVQEAEKYKSEDEDHKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KLA  DKKKIED+IE  I+WLD NQLAE DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIRDEKIGEKLAADDKKKIEDSIEAAIEWLDANQLAECDEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddA----PSHGGSEAGPKIEEVD  225
            QG       A G       PS GG  AGPKIEEVD
Sbjct  618  QGGEAGGPAAAGGMDEDVPPSAGG--AGPKIEEVD  650



>ref|XP_004961848.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   349 bits (895),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 194/213 (91%), Gaps = 2/213 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  437  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  496

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENY+YNMRN
Sbjct  497  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRN  556

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKL   DKK+IE+AI+  I WLD NQLAE+DEFEDKMKELEGICNPIIAKMY
Sbjct  557  TIKDDKIASKLGADDKKRIEEAIDGAISWLDSNQLAEADEFEDKMKELEGICNPIIAKMY  616

Query  317  QgaggdmggamgddA--PSHGGSEAGPKIEEVD  225
            QGAG DMGGA G D   P+ G S AGPKIEEVD
Sbjct  617  QGAGADMGGAAGMDEDIPAGGSSGAGPKIEEVD  649



>dbj|BAJ34054.1| unnamed protein product [Thellungiella halophila]
Length=650

 Score =   349 bits (895),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 187/215 (87%), Gaps = 6/215 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIE+MVQEAEKYKSEDEDHKKKVEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KLA  DKKKIED+IE  I+WLD NQLAE DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIRDEKIGEKLAADDKKKIEDSIEAAIEWLDANQLAECDEFEDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddA----PSHGGSEAGPKIEEVD  225
            QG       A G       PS GG  AGPKIEEVD
Sbjct  618  QGGEAGGPAAAGGMDEDIPPSAGG--AGPKIEEVD  650



>gb|AIZ68155.1| heat shock protein 70 [Ornithogalum saundersiae]
Length=648

 Score =   348 bits (894),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI SKLA ADKKKIEDAI++ IQWLD NQLAE+DEF+DKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKIASKLAAADKKKIEDAIDEAIQWLDSNQLAEADEFDDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGDMG  M +D PS GGS AGPKIEEVD
Sbjct  618  QGAGGDMGAGMDEDGPSAGGSGAGPKIEEVD  648



>gb|ACR38891.1| heat shock protein 70 [Pellia endiviifolia (species B)]
 gb|ACR38900.1| heat shock protein 70 [Pellia endiviifolia (species B)]
Length=651

 Score =   348 bits (894),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 189/221 (86%), Gaps = 17/221 (8%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDEDH+KKVE+KN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEDHQKKVESKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KI S L PADKKKIE+A+E  I WLD NQLAESDEF+DKMKELE ICNPIIAKMY
Sbjct  558  TVRDEKIASSLDPADKKKIEEAVEAAISWLDNNQLAESDEFDDKMKELESICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGS----------EAGPKIEEVD  225
            Q       G  G   PS+GG+           AGPKIEEVD
Sbjct  618  Q-------GGAGGVPPSYGGAGDDDVPSGSGGAGPKIEEVD  651



>ref|XP_010555208.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=652

 Score =   348 bits (894),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 179/214 (84%), Positives = 188/214 (88%), Gaps = 3/214 (1%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  439  SDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  498

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIE+MVQEAEKYKSEDE+ KKKVEAKNALENY+YNMRN
Sbjct  499  DKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEELKKKVEAKNALENYAYNMRN  558

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL P DKKKIE+AIEQ IQWL+GNQLAE DE EDKMKELE ICNPIIAKMY
Sbjct  559  TIRDEKIGEKLGPEDKKKIEEAIEQAIQWLEGNQLAEVDELEDKMKELESICNPIIAKMY  618

Query  317  Qgaggdmggamgd---dAPSHGGSEAGPKIEEVD  225
            QG+ G    A G      P   GS AGPKIEEVD
Sbjct  619  QGSAGAPDMAGGMDDDHVPPSSGSGAGPKIEEVD  652



>emb|CCA29120.1| heat shock protein 70 isoform 1 [Solanum lycopersicum]
Length=648

 Score =   348 bits (894),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVC DIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCSDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITN KGRLSKEEIEKMVQEAEKYK+EDE+ KKKVEAKN+LENY+YNMRN
Sbjct  498  DKTTGQKNKITITNGKGRLSKEEIEKMVQEAEKYKAEDEELKKKVEAKNSLENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            TV D+KIGSKL+  DKKKIEDA++Q I WL+ NQLAE DEFEDKMKELEGICNPIIAKMY
Sbjct  558  TVKDEKIGSKLSSDDKKKIEDAVDQAISWLESNQLAEVDEFEDKMKELEGICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSEAGPKIEEVD  225
            QGAGGD G  M DDAP  GGS AGPKIEEVD
Sbjct  618  QGAGGDAGVPMDDDAPPSGGSSAGPKIEEVD  648



>ref|XP_010463615.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=652

 Score =   348 bits (894),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 194/216 (90%), Gaps = 7/216 (3%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  439  SDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  498

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRN
Sbjct  499  DKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRN  558

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ D+KIG KL  ADKKKIED I++ IQWLDGNQLAE+DEFEDKMKELEG+CNPIIAK+Y
Sbjct  559  TIRDEKIGEKLPAADKKKIEDLIDEAIQWLDGNQLAEADEFEDKMKELEGVCNPIIAKVY  618

Query  317  QgaggdmggamgddA-----PSHGGSEAGPKIEEVD  225
            QGAGG+ GG           P+ GGS  GPKIEEVD
Sbjct  619  QGAGGEAGGPGPHGMDEDAPPAPGGS--GPKIEEVD  652



>ref|XP_006833219.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   348 bits (894),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 189/223 (85%), Gaps = 15/223 (7%)
 Frame = -2

Query  857  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  678
            SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE
Sbjct  438  SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAE  497

Query  677  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYSYNMRN  498
            DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKK+VEAKNALENY+YNMRN
Sbjct  498  DKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKRVEAKNALENYAYNMRN  557

Query  497  TVNDDKIGSKLAPADKKKIEDAIEQTIQWLDGNQLAESDEFEDKMKELEGICNPIIAKMY  318
            T+ DDKI +KL  ADKKKIEDAIEQ IQWLD NQLAE+DEFEDKMKELE ICNPIIAKMY
Sbjct  558  TIKDDKIAAKLDAADKKKIEDAIEQAIQWLDNNQLAEADEFEDKMKELETICNPIIAKMY  617

Query  317  QgaggdmggamgddAPSHGGSE------------AGPKIEEVD  225
            Q          G   P  GG++            AGPKIEEVD
Sbjct  618  Q---AGGADMPGSAPPFAGGADMPGGESFSSGGGAGPKIEEVD  657



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1823856796800