BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF040H17

Length=859
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009759318.1|  PREDICTED: tip elongation aberrant protein 3...    320   8e-101   Nicotiana sylvestris
ref|XP_009629069.1|  PREDICTED: acyl-CoA-binding domain-containin...    319   7e-100   Nicotiana tomentosiformis
ref|XP_006342764.1|  PREDICTED: acyl-CoA-binding domain-containin...    311   7e-97    Solanum tuberosum [potatoes]
ref|XP_010321161.1|  PREDICTED: acyl-CoA-binding domain-containin...    308   2e-95    Solanum lycopersicum
ref|XP_011090921.1|  PREDICTED: acyl-CoA-binding domain-containin...    300   3e-92    Sesamum indicum [beniseed]
gb|KDO75101.1|  hypothetical protein CISIN_1g0050432mg                  271   5e-85    Citrus sinensis [apfelsine]
ref|XP_008223119.1|  PREDICTED: acyl-CoA-binding domain-containin...    280   1e-84    Prunus mume [ume]
ref|XP_009369118.1|  PREDICTED: acyl-CoA-binding domain-containin...    278   5e-84    Pyrus x bretschneideri [bai li]
ref|XP_009339843.1|  PREDICTED: acyl-CoA-binding domain-containin...    278   6e-84    Pyrus x bretschneideri [bai li]
ref|XP_007222490.1|  hypothetical protein PRUPE_ppa004126mg             272   1e-83    
ref|XP_008340834.1|  PREDICTED: acyl-CoA-binding domain-containin...    275   5e-83    
emb|CDO98898.1|  unnamed protein product                                274   1e-82    Coffea canephora [robusta coffee]
ref|XP_003631976.1|  PREDICTED: acyl-CoA-binding domain-containin...    273   3e-82    Vitis vinifera
emb|CAN77820.1|  hypothetical protein VITISV_043441                     273   2e-80    Vitis vinifera
ref|XP_006489135.1|  PREDICTED: acyl-CoA-binding domain-containin...    266   2e-79    Citrus sinensis [apfelsine]
ref|XP_006419645.1|  hypothetical protein CICLE_v10004439mg             266   2e-79    Citrus clementina [clementine]
ref|XP_010243563.1|  PREDICTED: acyl-CoA-binding domain-containin...    265   5e-79    Nelumbo nucifera [Indian lotus]
ref|XP_007035506.1|  Galactose oxidase/kelch repeat superfamily p...    260   2e-77    
ref|XP_011462696.1|  PREDICTED: acyl-CoA-binding domain-containin...    258   1e-76    Fragaria vesca subsp. vesca
gb|KJB38636.1|  hypothetical protein B456_006G264600                    256   3e-76    Gossypium raimondii
ref|XP_010241693.1|  PREDICTED: acyl-CoA-binding domain-containin...    257   3e-76    Nelumbo nucifera [Indian lotus]
gb|KHG00526.1|  Acyl-CoA-binding domain-containing 4 -like protein      257   4e-76    Gossypium arboreum [tree cotton]
ref|XP_010904790.1|  PREDICTED: acyl-CoA-binding domain-containin...    257   6e-76    Elaeis guineensis
gb|KJB38635.1|  hypothetical protein B456_006G264600                    256   8e-76    Gossypium raimondii
ref|XP_004229210.1|  PREDICTED: acyl-CoA-binding domain-containin...    254   2e-75    Solanum lycopersicum
ref|XP_006342766.1|  PREDICTED: acyl-CoA-binding domain-containin...    254   2e-75    Solanum tuberosum [potatoes]
ref|XP_010904791.1|  PREDICTED: acyl-CoA-binding domain-containin...    254   6e-75    
ref|XP_010241717.1|  PREDICTED: acyl-CoA-binding domain-containin...    253   7e-75    Nelumbo nucifera [Indian lotus]
ref|XP_010904789.1|  PREDICTED: acyl-CoA-binding domain-containin...    253   1e-74    Elaeis guineensis
ref|XP_010241724.1|  PREDICTED: acyl-CoA-binding domain-containin...    253   1e-74    Nelumbo nucifera [Indian lotus]
gb|KJB72601.1|  hypothetical protein B456_011G187500                    250   6e-74    Gossypium raimondii
ref|XP_011012826.1|  PREDICTED: acyl-CoA-binding domain-containin...    249   7e-74    Populus euphratica
gb|KJB72596.1|  hypothetical protein B456_011G187500                    250   2e-73    Gossypium raimondii
gb|KJB72599.1|  hypothetical protein B456_011G187500                    250   2e-73    Gossypium raimondii
ref|XP_011015377.1|  PREDICTED: acyl-CoA-binding domain-containin...    249   3e-73    Populus euphratica
ref|XP_011005541.1|  PREDICTED: acyl-CoA-binding domain-containin...    249   3e-73    Populus euphratica
ref|XP_011012822.1|  PREDICTED: acyl-CoA-binding domain-containin...    249   5e-73    Populus euphratica
gb|KHG01869.1|  Acyl-CoA-binding domain-containing protein 4            248   6e-73    Gossypium arboreum [tree cotton]
ref|XP_008813362.1|  PREDICTED: acyl-CoA-binding domain-containin...    249   6e-73    Phoenix dactylifera
gb|KHG01870.1|  Acyl-CoA-binding domain-containing protein 4            249   7e-73    Gossypium arboreum [tree cotton]
ref|XP_010524753.1|  PREDICTED: acyl-CoA-binding domain-containin...    248   9e-73    
ref|XP_008438824.1|  PREDICTED: acyl-CoA-binding domain-containin...    247   1e-72    Cucumis melo [Oriental melon]
gb|EYU43915.1|  hypothetical protein MIMGU_mgv1a002202mg                247   2e-72    Erythranthe guttata [common monkey flower]
ref|XP_004134196.1|  PREDICTED: acyl-CoA-binding domain-containin...    245   8e-72    Cucumis sativus [cucumbers]
ref|XP_006380198.1|  hypothetical protein POPTR_0008s22830g             244   2e-71    
gb|KDP40010.1|  hypothetical protein JCGZ_02008                         244   3e-71    Jatropha curcas
ref|XP_002516884.1|  acyl-CoA binding protein, putative                 243   6e-71    Ricinus communis
ref|XP_010024637.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...    243   7e-71    
ref|XP_010492874.1|  PREDICTED: acyl-CoA-binding domain-containin...    241   6e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010454111.1|  PREDICTED: acyl-CoA-binding domain-containin...    240   9e-70    
ref|XP_008804572.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...    239   2e-69    
ref|XP_010420634.1|  PREDICTED: acyl-CoA-binding domain-containin...    238   6e-69    Camelina sativa [gold-of-pleasure]
gb|KJB72598.1|  hypothetical protein B456_011G187500                    236   1e-68    Gossypium raimondii
ref|XP_010420635.1|  PREDICTED: acyl-CoA-binding domain-containin...    234   2e-67    Camelina sativa [gold-of-pleasure]
dbj|BAH19562.1|  AT5G18590                                              234   2e-67    Arabidopsis thaliana [mouse-ear cress]
ref|NP_197360.2|  kelch repeat-containing protein                       234   2e-67    Arabidopsis thaliana [mouse-ear cress]
gb|AAM78582.1|  RanGAP1 interacting protein                             233   2e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010683938.1|  PREDICTED: acyl-CoA-binding domain-containin...    233   3e-67    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002873905.1|  kelch repeat-containing protein                    231   2e-66    
ref|XP_006400408.1|  hypothetical protein EUTSA_v10012828mg             230   3e-66    Eutrema salsugineum [saltwater cress]
ref|XP_010931595.1|  PREDICTED: tip elongation aberrant protein 3...    231   3e-66    Elaeis guineensis
ref|XP_010931592.1|  PREDICTED: tip elongation aberrant protein 3...    229   8e-66    Elaeis guineensis
ref|XP_010931596.1|  PREDICTED: tip elongation aberrant protein 3...    227   2e-65    
gb|EPS74438.1|  hypothetical protein M569_00314                         222   3e-65    Genlisea aurea
gb|KEH32273.1|  acyl-CoA-binding domain protein                         228   3e-65    Medicago truncatula
gb|AES91803.2|  acyl-CoA-binding domain protein                         228   3e-65    Medicago truncatula
ref|XP_003609606.1|  Acyl-CoA-binding domain-containing protein         228   4e-65    
ref|XP_010931593.1|  PREDICTED: tip elongation aberrant protein 3...    226   1e-64    
ref|XP_010931591.1|  PREDICTED: tip elongation aberrant protein 3...    226   1e-64    Elaeis guineensis
ref|XP_007147881.1|  hypothetical protein PHAVU_006G162800g             225   3e-64    Phaseolus vulgaris [French bean]
ref|XP_004486044.1|  PREDICTED: acyl-CoA-binding domain-containin...    222   8e-64    Cicer arietinum [garbanzo]
ref|XP_006597533.1|  PREDICTED: acyl-CoA-binding domain-containin...    224   8e-64    
ref|XP_003550179.1|  PREDICTED: acyl-CoA-binding domain-containin...    223   1e-63    Glycine max [soybeans]
ref|XP_006597532.1|  PREDICTED: acyl-CoA-binding domain-containin...    223   1e-63    
ref|XP_004486293.1|  PREDICTED: uncharacterized protein LOC101494304    210   2e-63    
gb|KHN03383.1|  Acyl-CoA-binding domain-containing protein 4            223   2e-63    Glycine soja [wild soybean]
ref|XP_004486043.1|  PREDICTED: acyl-CoA-binding domain-containin...    222   4e-63    Cicer arietinum [garbanzo]
ref|XP_007154239.1|  hypothetical protein PHAVU_003G102100g             221   1e-62    Phaseolus vulgaris [French bean]
ref|XP_009120961.1|  PREDICTED: acyl-CoA-binding domain-containin...    221   1e-62    Brassica rapa
emb|CDX92598.1|  BnaA10g16370D                                          218   1e-61    
ref|XP_002315566.1|  hypothetical protein POPTR_0010s02240g             216   5e-61    
emb|CDY13903.1|  BnaC09g39230D                                          214   2e-60    Brassica napus [oilseed rape]
gb|KJB72597.1|  hypothetical protein B456_011G187500                    213   3e-60    Gossypium raimondii
gb|KHN02994.1|  Acyl-CoA-binding domain-containing protein 4            211   3e-59    Glycine soja [wild soybean]
ref|XP_006594495.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   7e-58    Glycine max [soybeans]
ref|XP_009393228.1|  PREDICTED: acyl-CoA-binding domain-containin...    208   7e-58    
gb|KHN47303.1|  hypothetical protein glysoja_020171                     196   2e-57    Glycine soja [wild soybean]
gb|AES91804.2|  acyl-CoA-binding domain protein                         206   4e-57    Medicago truncatula
ref|XP_003609607.1|  Acyl-CoA-binding domain-containing protein         206   4e-57    
gb|AES64218.2|  acyl-CoA-binding domain protein                         204   2e-56    Medicago truncatula
ref|XP_003593967.1|  Acyl-CoA-binding domain-containing protein         203   6e-56    
ref|XP_009402527.1|  PREDICTED: kelch repeat-containing protein 1...    201   2e-55    
ref|XP_006594496.1|  PREDICTED: acyl-CoA-binding domain-containin...    200   3e-55    Glycine max [soybeans]
ref|XP_011005544.1|  PREDICTED: acyl-CoA-binding domain-containin...    196   8e-54    Populus euphratica
ref|XP_011015380.1|  PREDICTED: acyl-CoA-binding domain-containin...    196   9e-54    Populus euphratica
ref|XP_004508300.1|  PREDICTED: acyl-CoA-binding domain-containin...    194   4e-53    Cicer arietinum [garbanzo]
ref|XP_010098333.1|  hypothetical protein L484_023581                   194   5e-53    
ref|XP_004508299.1|  PREDICTED: acyl-CoA-binding domain-containin...    194   6e-53    Cicer arietinum [garbanzo]
ref|XP_004508297.1|  PREDICTED: acyl-CoA-binding domain-containin...    194   9e-53    
ref|XP_004508298.1|  PREDICTED: acyl-CoA-binding domain-containin...    194   9e-53    
ref|XP_006855461.1|  hypothetical protein AMTR_s00057p00182130          188   7e-51    
ref|XP_007035508.1|  Galactose oxidase/kelch repeat superfamily p...    187   2e-50    
gb|KDO75103.1|  hypothetical protein CISIN_1g0050432mg                  179   9e-50    Citrus sinensis [apfelsine]
ref|XP_007035509.1|  Galactose oxidase/kelch repeat superfamily p...    170   1e-44    
ref|XP_010237468.1|  PREDICTED: uncharacterized protein LOC100836...    167   1e-43    
ref|XP_003577276.1|  PREDICTED: acyl-CoA-binding domain-containin...    167   1e-43    Brachypodium distachyon [annual false brome]
ref|NP_001068393.1|  Os11g0657000                                       166   2e-43    
gb|EEC68565.1|  hypothetical protein OsI_36893                          166   3e-43    Oryza sativa Indica Group [Indian rice]
gb|EEE52499.1|  hypothetical protein OsJ_34700                          165   8e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663088.1|  PREDICTED: acyl-CoA-binding domain-containin...    164   2e-42    
ref|XP_006663087.1|  PREDICTED: acyl-CoA-binding domain-containin...    164   2e-42    Oryza brachyantha
ref|XP_010904792.1|  PREDICTED: tip elongation aberrant protein 3...    163   4e-42    
ref|XP_004979880.1|  PREDICTED: acyl-CoA-binding domain-containin...    163   4e-42    Setaria italica
ref|XP_008677101.1|  PREDICTED: uncharacterized protein LOC100279...    158   3e-40    Zea mays [maize]
ref|XP_003575710.1|  PREDICTED: acyl-CoA-binding domain-containin...    155   2e-39    Brachypodium distachyon [annual false brome]
ref|XP_006664610.1|  PREDICTED: acyl-CoA-binding domain-containin...    150   2e-37    Oryza brachyantha
dbj|BAJ86800.1|  predicted protein                                      150   2e-37    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK00700.1|  predicted protein                                      150   2e-37    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002442260.1|  hypothetical protein SORBIDRAFT_08g017180          146   3e-36    
dbj|BAK00043.1|  predicted protein                                      141   3e-36    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001066944.1|  Os12g0538800                                       146   5e-36    
gb|EEC69433.1|  hypothetical protein OsI_38606                          146   5e-36    Oryza sativa Indica Group [Indian rice]
gb|AFW60227.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...    145   1e-35    
ref|NP_001145999.1|  uncharacterized protein LOC100279529               145   2e-35    
ref|XP_004962833.1|  PREDICTED: acyl-CoA-binding domain-containin...    144   2e-35    Setaria italica
ref|XP_004962837.1|  PREDICTED: acyl-CoA-binding domain-containin...    144   2e-35    
ref|NP_001146281.1|  uncharacterized protein LOC100279856               144   3e-35    Zea mays [maize]
gb|EMT26901.1|  hypothetical protein F775_29769                         134   3e-32    
gb|AFW60226.1|  hypothetical protein ZEAMMB73_572222                    128   1e-29    
ref|XP_002977452.1|  hypothetical protein SELMODRAFT_417505             125   1e-28    Selaginella moellendorffii
ref|XP_002975032.1|  hypothetical protein SELMODRAFT_415315             125   1e-28    Selaginella moellendorffii
gb|EMS52652.1|  Acyl-CoA-binding domain-containing protein 4            125   2e-28    Triticum urartu
gb|EMT25879.1|  hypothetical protein F775_10881                         115   4e-25    
gb|EMS62709.1|  Acyl-CoA-binding domain-containing protein 4            114   1e-24    Triticum urartu
ref|XP_001759823.1|  predicted protein                                  114   2e-24    
ref|XP_001760924.1|  predicted protein                                  108   1e-22    
ref|XP_001751751.1|  predicted protein                                97.8    5e-19    
ref|XP_001761501.1|  predicted protein                                83.6    1e-15    
gb|ABA95166.1|  Kelch motif family protein, expressed                 86.7    2e-15    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002449932.1|  hypothetical protein SORBIDRAFT_05g025915        82.8    2e-14    
emb|CDY02611.1|  BnaC02g08240D                                        72.4    5e-13    
gb|ABR25493.1|  rangap1 interacting protein                           69.3    5e-12    Oryza sativa Indica Group [Indian rice]
ref|XP_001765510.1|  predicted protein                                67.0    3e-09    
gb|EEE53353.1|  hypothetical protein OsJ_36377                        66.2    6e-09    Oryza sativa Japonica Group [Japonica rice]
gb|KDO75105.1|  hypothetical protein CISIN_1g0050432mg                48.9    8e-04    Citrus sinensis [apfelsine]



>ref|XP_009759318.1| PREDICTED: tip elongation aberrant protein 3-like [Nicotiana 
sylvestris]
Length=634

 Score =   320 bits (819),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 189/260 (73%), Positives = 221/260 (85%), Gaps = 4/260 (2%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDS--K  686
            LL DP+SV+GNVSLRKQF N+E+   K+PK+S DES SQ  E+G +QLD G++   S  K
Sbjct  377  LLVDPSSVSGNVSLRKQFSNDEDAGAKIPKTSGDESPSQ--EQGAKQLDVGIKTSSSGGK  434

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTA  506
             + EE+ TI ESG++  H +Q SGNF  D+DDFVFQESD K G++A  G  Q YEAKL+A
Sbjct  435  IVTEEMSTITESGHLPNHYRQASGNFFQDTDDFVFQESDYKAGLTASSGACQQYEAKLSA  494

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L+RKN +LEGQLAAALA+REAA+K+LSSALKSKQD EK++ D +KE++LLKEKLA VELA
Sbjct  495  LMRKNEILEGQLAAALANREAAEKNLSSALKSKQDMEKRMGDTVKEVELLKEKLASVELA  554

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
            QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH+TRG+L GERARAFQLQVEVFHL
Sbjct  555  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHTTRGVLAGERARAFQLQVEVFHL  614

Query  145  KQRLQSLENRAPTPRKPFHV  86
            KQRLQSLENR+PTPRKPFHV
Sbjct  615  KQRLQSLENRSPTPRKPFHV  634



>ref|XP_009629069.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nicotiana 
tomentosiformis]
Length=707

 Score =   319 bits (818),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 189/260 (73%), Positives = 220/260 (85%), Gaps = 4/260 (2%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDS--K  686
            LL DP+SV+GNVSLRKQF N+E+   K PK+S DES SQ  E+G +QLD G++   S  K
Sbjct  450  LLVDPSSVSGNVSLRKQFSNDEDAGAKRPKTSGDESPSQ--EQGAKQLDIGIKTSSSGGK  507

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTA  506
             + EE+ TI ESG++  H +Q SGNF  D+DDFVFQESD K G++A  G  Q YEAKL+A
Sbjct  508  IVTEEMSTITESGHLPNHYRQASGNFFQDTDDFVFQESDYKAGLTASSGACQQYEAKLSA  567

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L+RKN +LEGQLAAALA+REAA+K+LSSALKSKQD EK++ D +KE++LLKEKLA VELA
Sbjct  568  LMRKNEILEGQLAAALANREAAEKNLSSALKSKQDVEKRMGDTVKEVELLKEKLASVELA  627

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
            QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH+TRG+L GERARAFQLQVEVFHL
Sbjct  628  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHTTRGVLAGERARAFQLQVEVFHL  687

Query  145  KQRLQSLENRAPTPRKPFHV  86
            KQRLQSLENR+PTPRKPFHV
Sbjct  688  KQRLQSLENRSPTPRKPFHV  707



>ref|XP_006342764.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006342765.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Solanum tuberosum]
Length=701

 Score =   311 bits (797),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 171/261 (66%), Positives = 199/261 (76%), Gaps = 12/261 (5%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDS---  689
            LL DP+SV+GNVSLRKQF N+E+ S KM K+S DES SQ  E+G +QLD G     S   
Sbjct  450  LLIDPSSVSGNVSLRKQFSNDEDASAKMTKTSGDESPSQ--EQGAKQLDIGGPKTSSNGG  507

Query  688  KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLT  509
            K + EE+ TI ESG++ TH +Q S NF  D+DDFVFQE D K G+ A  G  Q YEAKL+
Sbjct  508  KIMSEEMSTISESGHLPTHYRQASANFFQDTDDFVFQEGDYKAGLPASSGACQQYEAKLS  567

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
            +L+RKN                A     +A+KSKQD EKK+ADA+KE++LLKEKLA VE+
Sbjct  568  SLMRKN-------GILEGQLATALAGREAAVKSKQDMEKKMADAVKEMELLKEKLASVEM  620

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  149
            AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELH+TRG+L GERARAFQLQVEVFH
Sbjct  621  AQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHTTRGVLAGERARAFQLQVEVFH  680

Query  148  LKQRLQSLENRAPTPRKPFHV  86
            LKQRLQSLENR+PTPRKPFHV
Sbjct  681  LKQRLQSLENRSPTPRKPFHV  701



>ref|XP_010321161.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010321165.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
Length=700

 Score =   308 bits (788),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/260 (65%), Positives = 202/260 (78%), Gaps = 11/260 (4%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDS--K  686
            LL DP+SV+GNVSLRKQF N+E+TS KM K+S DES SQ  E+G +QLD GL+   +  K
Sbjct  450  LLIDPSSVSGNVSLRKQFSNDEDTSAKMTKTSGDESPSQ--EQGAKQLDIGLKTCSNGGK  507

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTA  506
             + EE+ TI ESG++ TH +Q S NF  D+DDFV QE D K G+ A  G  Q +EAKL++
Sbjct  508  IMSEEMSTISESGHLPTHYRQASANFFQDTDDFVSQEGDYKAGLPASSGACQQHEAKLSS  567

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L+RKN               AA     +A++SKQD EKK++DA+KE++LLKEKLA VE+A
Sbjct  568  LMRKN-------GILEGQLAAALAGREAAVRSKQDMEKKMSDAVKEMELLKEKLASVEMA  620

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
            QEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELHSTRG+L GERARAFQLQVEVFHL
Sbjct  621  QEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHSTRGVLAGERARAFQLQVEVFHL  680

Query  145  KQRLQSLENRAPTPRKPFHV  86
            KQRLQSLENR+PTPRKPFHV
Sbjct  681  KQRLQSLENRSPTPRKPFHV  700



>ref|XP_011090921.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090922.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090923.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
Length=712

 Score =   300 bits (767),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 184/260 (71%), Positives = 213/260 (82%), Gaps = 3/260 (1%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETS-LKMPKSSDDESSSQVMERGTRQLDSGLE-HIDSK  686
            LL DP+S  GNVSLRKQFYNEEE +     KSS+D + S++ME+ T+ LDSG+       
Sbjct  454  LLVDPHSAPGNVSLRKQFYNEEENADATTTKSSEDTNLSRMMEQNTKPLDSGIGVSYSGD  513

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTA  506
             I EE   + ES N+    K GSG+  L+S+D VFQE+D K  ISAP G+YQ YEAKL +
Sbjct  514  RITEETSLVSESDNL-NLDKHGSGSLSLESEDLVFQETDGKSRISAPSGVYQIYEAKLAS  572

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            LLRKNG+LEGQLAAALA+REAA+K+LS A+KS+QD E+KL +AM+EI+LLKEKLA VELA
Sbjct  573  LLRKNGILEGQLAAALAAREAAEKNLSLAIKSRQDMERKLGEAMREIELLKEKLASVELA  632

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
            QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHL
Sbjct  633  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHL  692

Query  145  KQRLQSLENRAPTPRKPFHV  86
            KQRLQ+LE RAPTPRKPFHV
Sbjct  693  KQRLQTLETRAPTPRKPFHV  712



>gb|KDO75101.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
 gb|KDO75102.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=365

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 171/263 (65%), Positives = 205/263 (78%), Gaps = 9/263 (3%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQLDSGLEH---I  695
            L DPN ++GNVSL KQF NEEE  T++KM K+S+DE+S  Q  E    Q D G +    +
Sbjct  106  LVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQTTENRKNQSDLGAQTSICV  165

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAK  515
                I E      E+ N      QG GNF +D+D+ +F ++D    +S P  +YQ YE+K
Sbjct  166  GKTNIDEAPLFDYENSNPLV---QGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYESK  222

Query  514  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  335
            + AL+RKNG+LEGQLAAAL +REAA+K+ SS LKS+Q+ EKKLAD++KE++LLKEKLAG+
Sbjct  223  MAALIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGL  282

Query  334  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  155
            ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEV
Sbjct  283  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEV  342

Query  154  FHLKQRLQSLENRAPTPRKPFHV  86
            FHLKQRLQSLENRAPTPRKPF+V
Sbjct  343  FHLKQRLQSLENRAPTPRKPFNV  365



>ref|XP_008223119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Prunus 
mume]
Length=714

 Score =   280 bits (715),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 176/262 (67%), Positives = 215/262 (82%), Gaps = 7/262 (3%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQLDSGLEH--I  695
            LL DPN V+GNVSLRKQF+N+EE  T++K+ KSS+DESS SQ  E+   Q DSG++   +
Sbjct  454  LLVDPNPVSGNVSLRKQFHNDEEYNTTVKVVKSSEDESSFSQPTEKKNSQSDSGVQTNVL  513

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEA  518
             S+   EE+ +  E  N + H   G GN  +D++D +F E+D K G +SAP  +Y  YE+
Sbjct  514  GSRLYSEEMLSGYEYEN-SNHHNHGIGNLSVDNNDAMFLETDSKPGALSAPSSIYHYYES  572

Query  517  KLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAG  338
            K+ +L+RKNG+LEGQLAAAL SREAA+K+LSSALKS+Q+ E+KLAD  KE++LLKEK+AG
Sbjct  573  KMASLIRKNGILEGQLAAALTSREAAEKNLSSALKSRQEMERKLADTAKEMELLKEKVAG  632

Query  337  VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVE  158
            VE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE
Sbjct  633  VEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVE  692

Query  157  VFHLKQRLQSLENRAPTPRKPF  92
            VFHLKQRLQS+ENRAPTPRKPF
Sbjct  693  VFHLKQRLQSMENRAPTPRKPF  714



>ref|XP_009369118.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009369119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   278 bits (711),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 170/262 (65%), Positives = 212/262 (81%), Gaps = 7/262 (3%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQLDSGLEH--I  695
            LL DPN V+GNVSLRKQF+NEEE  T++K+ KS++DESS SQ +E+ T Q DSG++    
Sbjct  451  LLVDPNPVSGNVSLRKQFHNEEEFNTTVKVAKSTEDESSFSQPIEKKTSQSDSGVQTNIY  510

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEA  518
              +   EEI +  +  N   H   G+GN  +D++D VF E+D K G +S    +Y  YE+
Sbjct  511  GGRLFSEEILSGYDFENSNPHH-HGTGNLSMDNNDAVFPENDSKLGALSTASSMYHYYES  569

Query  517  KLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAG  338
            K+ AL+RKNG+LEG+LA  +AS+EAA+K+LSSALKS+Q+ E+KL+D+ KE++ LKEK+AG
Sbjct  570  KMAALIRKNGILEGKLATVMASQEAAEKNLSSALKSRQEMERKLSDSAKEMEFLKEKVAG  629

Query  337  VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVE  158
            VE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE
Sbjct  630  VEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVE  689

Query  157  VFHLKQRLQSLENRAPTPRKPF  92
            VFHLKQRLQS+ENRAPTPRKPF
Sbjct  690  VFHLKQRLQSMENRAPTPRKPF  711



>ref|XP_009339843.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009339844.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   278 bits (710),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 169/262 (65%), Positives = 212/262 (81%), Gaps = 7/262 (3%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQLDSGLEH--I  695
            LL DPN V+GNVSLRKQF+NEEE  T++K+ KS++DESS SQ +E+ T Q DSG++    
Sbjct  451  LLVDPNPVSGNVSLRKQFHNEEEFNTTVKVAKSTEDESSFSQPIEKKTSQSDSGVQTNIY  510

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEA  518
              +   EEI +  +  N   H   G+GN  +D++D VF E+D K G +S    +Y  YE+
Sbjct  511  GGRLFSEEILSGYDFENSNPHH-HGTGNLSMDNNDAVFPENDSKLGALSTASSMYHYYES  569

Query  517  KLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAG  338
            K+ AL+RKNG+LEG+LA  +A++EAA+K+LSSALKS+Q+ E+KL+D+ KE++ LKEK+AG
Sbjct  570  KMAALIRKNGILEGKLATVMANQEAAEKNLSSALKSRQEMERKLSDSAKEMEFLKEKVAG  629

Query  337  VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVE  158
            VE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE
Sbjct  630  VEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVE  689

Query  157  VFHLKQRLQSLENRAPTPRKPF  92
            VFHLKQRLQS+ENRAPTPRKPF
Sbjct  690  VFHLKQRLQSMENRAPTPRKPF  711



>ref|XP_007222490.1| hypothetical protein PRUPE_ppa004126mg [Prunus persica]
 gb|EMJ23689.1| hypothetical protein PRUPE_ppa004126mg [Prunus persica]
Length=528

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 173/262 (66%), Positives = 212/262 (81%), Gaps = 7/262 (3%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQLDSGLEH--I  695
            LL DPN V+GNVSLRKQF+N+EE  T++K+ KSS+DESS SQ  E+   + DSG++   +
Sbjct  268  LLVDPNPVSGNVSLRKQFHNDEEYNTTVKVVKSSEDESSFSQPTEKKNSRSDSGVQTNVL  327

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEA  518
             ++   EE+ +  E  N + H   G GN  +D++D +F E+D K G +SAP  +Y  YE+
Sbjct  328  GNRLYSEEMLSGYEYEN-SNHHNHGIGNLSVDNNDAMFLETDSKPGALSAPSSIYHYYES  386

Query  517  KLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAG  338
            K+   +RKNG+LEGQLAAAL SREAA+K+LSSALKS+Q+ E+KLAD  KE++LLKEK AG
Sbjct  387  KMATQIRKNGILEGQLAAALTSREAAEKNLSSALKSRQEMERKLADTAKEMELLKEKAAG  446

Query  337  VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVE  158
            VE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE
Sbjct  447  VEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVE  506

Query  157  VFHLKQRLQSLENRAPTPRKPF  92
            VFHLKQRLQS+ENRAPTPRKPF
Sbjct  507  VFHLKQRLQSMENRAPTPRKPF  528



>ref|XP_008340834.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Malus 
domestica]
Length=715

 Score =   275 bits (704),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 170/262 (65%), Positives = 209/262 (80%), Gaps = 7/262 (3%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQLDSGLEH--I  695
            LL DPN V+GNVSLRKQF+NEEE  T++K+ KSS+DESS SQ +E+ T Q DSG++    
Sbjct  455  LLVDPNPVSGNVSLRKQFHNEEEFNTTVKVAKSSEDESSFSQPIEKKTSQSDSGVQTNIY  514

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEA  518
              +   EEI +  +  N   H   G+GN   D++D VF E+D K G +S    +Y  YE+
Sbjct  515  GGRLFSEEILSGYDFENSNPHX-HGTGNLSXDNNDAVFPENDSKLGALSTASSMYHYYES  573

Query  517  KLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAG  338
            K+  L+RKNG+LEG+LA  +AS+EAA+K+LSSALKS+Q+ E+KL+D  KE++ LKEK+AG
Sbjct  574  KMAXLIRKNGILEGKLATVMASQEAAEKNLSSALKSRQEMERKLSDTAKEMEFLKEKVAG  633

Query  337  VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVE  158
            VE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE
Sbjct  634  VEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVE  693

Query  157  VFHLKQRLQSLENRAPTPRKPF  92
            VFHLKQRLQS+ENRAPTPRKPF
Sbjct  694  VFHLKQRLQSMENRAPTPRKPF  715



>emb|CDO98898.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 179/262 (68%), Positives = 218/262 (83%), Gaps = 9/262 (3%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDD-ESSSQVMERGTRQLDSGLEHIDSKT  683
            LL DPNS  GNVSLRKQF+++E+ +  +P  S   E   ++ + G+ Q  + +++ ++K 
Sbjct  454  LLIDPNSSAGNVSLRKQFHDKEDPTNNVPNFSKGVEQKPRIHDTGS-QAYTNVDNYNAK-  511

Query  682  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQ---SYEAKL  512
               EI +  ESGN+ TH++QGSG+  LDSDD +FQESD K G+S P  ++Q   SYE KL
Sbjct  512  ---EISSASESGNLETHRRQGSGSLSLDSDDLLFQESDGKAGVSVPSNVHQFHQSYELKL  568

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
             AL+RKNG+LEGQLAAA++SRE+A+K+LS+A+KS+Q+ EKKLADAMKE++LLKEKLAGVE
Sbjct  569  GALIRKNGILEGQLAAAISSRESAEKNLSTAVKSRQEMEKKLADAMKEMELLKEKLAGVE  628

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  152
            LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVF
Sbjct  629  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVF  688

Query  151  HLKQRLQSLENRAPTPRKPFHV  86
            HLKQRLQSLENRAPTPRKPFHV
Sbjct  689  HLKQRLQSLENRAPTPRKPFHV  710



>ref|XP_003631976.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Vitis 
vinifera]
 emb|CBI26099.3| unnamed protein product [Vitis vinifera]
Length=717

 Score =   273 bits (699),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 173/263 (66%), Positives = 206/263 (78%), Gaps = 7/263 (3%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDES-SSQVMERGTRQLDSGLEH--ID  692
            L DPN   GNVSLRKQF+NEEE  T++K  +S +DE  SSQ  E   +  D+G+      
Sbjct  456  LVDPNPAPGNVSLRKQFHNEEEYNTAVKTLRSLEDECYSSQASEHRMKLFDTGIHGSLAG  515

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAK  515
             K   +EI ++ +S N   +  QG+GN  +D+DD VF ES  K    SAP  +YQ YE K
Sbjct  516  CKINVDEIPSVLDSENSNAYN-QGNGNLLVDNDDEVFPESHGKSVAFSAPSSIYQLYETK  574

Query  514  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  335
            + AL+RKNG+LEGQL AALASREA +K+LSS LK++Q+ EKKLAD +KE+++LKEKLAGV
Sbjct  575  MAALIRKNGILEGQLTAALASREAVEKNLSSVLKNRQEMEKKLADTLKEMEMLKEKLAGV  634

Query  334  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  155
            ELAQEEAN+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEV
Sbjct  635  ELAQEEANNLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEV  694

Query  154  FHLKQRLQSLENRAPTPRKPFHV  86
            FHLKQRLQS+ENRAPTPRKPFHV
Sbjct  695  FHLKQRLQSMENRAPTPRKPFHV  717



>emb|CAN77820.1| hypothetical protein VITISV_043441 [Vitis vinifera]
Length=1034

 Score =   273 bits (698),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 173/263 (66%), Positives = 205/263 (78%), Gaps = 7/263 (3%)
 Frame = -1

Query  856   LSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDES-SSQVMERGTRQLDSGLEH--ID  692
             L DPN   GNVSLRKQF+NEEE  T++K  +S +DE  SSQ  E   +  D+G+      
Sbjct  773   LVDPNPAPGNVSLRKQFHNEEEYNTAVKTLRSLEDECYSSQASEHRMKLFDTGIHGSLAG  832

Query  691   SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAK  515
              K   + I ++ +S N   +  QG+GN  +D+DD VF ES  K    SAP  +YQ YE K
Sbjct  833   CKINVDXIPSVLDSENSNAYN-QGNGNLLVDNDDEVFPESHGKSVAFSAPSSIYQLYETK  891

Query  514   LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  335
             + AL+RKNG+LEGQL AALASREA +K+LSS LK++Q+ EKKLAD +KE+++LKEKLAGV
Sbjct  892   MAALIRKNGILEGQLTAALASREAVEKNLSSVLKNRQEMEKKLADTLKEMEMLKEKLAGV  951

Query  334   ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  155
             ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEV
Sbjct  952   ELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEV  1011

Query  154   FHLKQRLQSLENRAPTPRKPFHV  86
             FHLKQRLQS+ENRAPTPRKPFHV
Sbjct  1012  FHLKQRLQSMENRAPTPRKPFHV  1034



>ref|XP_006489135.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Citrus sinensis]
Length=717

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 170/263 (65%), Positives = 203/263 (77%), Gaps = 9/263 (3%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQLDSGLEH---I  695
            L DPN ++GNVSL KQF NEEE  T++KM K+S+DE+S  Q  E    Q D G +    +
Sbjct  458  LVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQTTENRKNQSDLGAQTSICV  517

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAK  515
                I E      E+ N      QG GNF +D+D+ +F ++D    +S P  +YQ YE K
Sbjct  518  GKTNIDEAPLFDYENSNPLV---QGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYETK  574

Query  514  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  335
            +  L+RKNG+LEGQLAAAL +REAA+K+ SS LKS+Q+ EKKLAD++KE++LLKEKLAG+
Sbjct  575  MADLIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGL  634

Query  334  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  155
            ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEV
Sbjct  635  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEV  694

Query  154  FHLKQRLQSLENRAPTPRKPFHV  86
            FHLKQRLQSLENRAPTPRKPF+V
Sbjct  695  FHLKQRLQSLENRAPTPRKPFNV  717



>ref|XP_006419645.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
 gb|ESR32885.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
Length=717

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 170/263 (65%), Positives = 203/263 (77%), Gaps = 9/263 (3%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQLDSGLEH---I  695
            L DPN ++GNVSL KQF NEEE  T++KM K+S+DE+S  Q  E    Q D G +    +
Sbjct  458  LVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQTTENRKNQSDLGAQTSICV  517

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAK  515
                I E      E+ N      QG GNF +D+D+ +F ++D    +S P  +YQ YE K
Sbjct  518  GKTNIDEAPLFDYENSNPLV---QGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYETK  574

Query  514  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  335
            +  L+RKNG+LEGQLAAAL +REAA+K+ SS LKS+Q+ EKKLAD++KE++LLKEKLAG+
Sbjct  575  MADLIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGL  634

Query  334  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  155
            ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEV
Sbjct  635  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEV  694

Query  154  FHLKQRLQSLENRAPTPRKPFHV  86
            FHLKQRLQSLENRAPTPRKPF+V
Sbjct  695  FHLKQRLQSLENRAPTPRKPFNV  717



>ref|XP_010243563.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nelumbo 
nucifera]
Length=707

 Score =   265 bits (676),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 170/263 (65%), Positives = 206/263 (78%), Gaps = 14/263 (5%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS----QVMERGTRQLDSGLEHI  695
            L D N  +GNVSLRKQF+NEEE  TSLK+ K+ +DE+SS    +V++ G +   +GL   
Sbjct  453  LLDTNPTSGNVSLRKQFHNEEECNTSLKILKNIEDENSSSQRTKVLDMGVQTDIAGL---  509

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAK  515
               +  EE   + +S N    +KQ + N   +SD+    E+D   G SAP  +YQ Y++K
Sbjct  510  --MSSAEETPFVFDSENTRPLQKQANVNLLSESDEIAIPETD---GKSAPSNVYQLYDSK  564

Query  514  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  335
            + AL+RKNG+LE QLAA+LA REAA+K+LSS +KS+QD EKKLAD MKE+++LKEKLAGV
Sbjct  565  IAALVRKNGILEAQLAASLAGREAAEKNLSSVIKSRQDIEKKLADTMKEMEMLKEKLAGV  624

Query  334  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  155
            ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEV
Sbjct  625  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEV  684

Query  154  FHLKQRLQSLENRAPTPRKPFHV  86
            FHLKQRLQS+ENRAPTPRKPFH+
Sbjct  685  FHLKQRLQSVENRAPTPRKPFHM  707



>ref|XP_007035506.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007035507.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06432.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06433.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
Length=716

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 165/261 (63%), Positives = 203/261 (78%), Gaps = 8/261 (3%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQLDSGLE--HIDSK  686
            D N ++GN SLRKQF+NEEE  T+ K+ K  +DESS  Q  E    Q D+ ++     +K
Sbjct  458  DQNPLSGNFSLRKQFHNEEEYNTTFKITKCLEDESSIVQATEPKPNQSDTSIQINAPGTK  517

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLT  509
               +E       G++   + +G  N P+D+D+FVF E+D K   +SAP  +YQ YE ++ 
Sbjct  518  ISSDESFLFEPEGSIP--QIEGIANVPVDNDNFVFPEADGKSAALSAPSSIYQFYETRMA  575

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
            AL RKNG+LE QLAAALASR+ ++++L+SALKSK++ EK+ AD MKE++LLKEKLAG+EL
Sbjct  576  ALSRKNGILEVQLAAALASRDTSERNLASALKSKEEMEKRFADTMKEMELLKEKLAGIEL  635

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  149
            AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFH
Sbjct  636  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFH  695

Query  148  LKQRLQSLENRAPTPRKPFHV  86
            LKQRLQSLENRAPTPRKPF+V
Sbjct  696  LKQRLQSLENRAPTPRKPFNV  716



>ref|XP_011462696.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Fragaria 
vesca subsp. vesca]
Length=709

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 176/263 (67%), Positives = 210/263 (80%), Gaps = 14/263 (5%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS-QVMERGTRQLDSGLE---H  698
            LL D N V GNVSLRKQF+N+EE  T++K+ K S+DESS  Q  E+   Q +S ++   H
Sbjct  454  LLVDANPVPGNVSLRKQFHNDEEYNTAVKVTKGSEDESSLLQPSEKKNSQSESAVQTNIH  513

Query  697  IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYE  521
               +   E+I +  E  N  ++   G GNFP+D++D +F ESD K G +SAP  +YQ YE
Sbjct  514  -GGRLYSEDILSAYEFEN--SNHNHGLGNFPVDNNDALFPESDGKPGALSAPSSMYQYYE  570

Query  520  AKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLA  341
                 L+RKNG+LEGQLAAALASREAA+K+LSSALKS+Q+ EKKLAD+ KEI+LLK+KLA
Sbjct  571  K----LIRKNGVLEGQLAAALASREAAEKNLSSALKSRQEIEKKLADSGKEIELLKDKLA  626

Query  340  GVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQV  161
            GVELAQEEAN+LS+IVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQV
Sbjct  627  GVELAQEEANNLSSIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQV  686

Query  160  EVFHLKQRLQSLENRAPTPRKPF  92
            EVFHLKQRLQS+ENRAPTPRKPF
Sbjct  687  EVFHLKQRLQSMENRAPTPRKPF  709



>gb|KJB38636.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=632

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 161/264 (61%), Positives = 206/264 (78%), Gaps = 9/264 (3%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEE--ETSLKMPKSSDDESSS-QVMERGTRQLDSGLEHIDSK  686
            L+D N ++GNVSLRKQF+N+E   TS+++ KSS+D SS  Q  E+ T Q D+G+E     
Sbjct  371  LADQNPLSGNVSLRKQFHNKEGYNTSVRITKSSEDLSSILQATEQKTNQTDTGVEVNAPG  430

Query  685  T---IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEA  518
            T     E      E+ N +  + +G  + P+ +D+FVF E + K G +SAP  +Y  YE 
Sbjct  431  TKIRSDESFLYECENSNPSNPRVEGITSIPVGNDNFVFPEMEGKAGALSAPSSIY--YEM  488

Query  517  KLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAG  338
            ++ AL R+NG+LE QL AA+ASR+  +++L+SALKSK++ EK+LAD +KE+DLLKEKLAG
Sbjct  489  RMAALSRRNGILEVQLGAAMASRDTIERNLASALKSKEEMEKRLADTVKEMDLLKEKLAG  548

Query  337  VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVE  158
            +ELAQEEAN++SNIVHSDNVRLEHDVAF+KAVLDDTQKELHSTRG+L GERARAFQLQVE
Sbjct  549  IELAQEEANNISNIVHSDNVRLEHDVAFVKAVLDDTQKELHSTRGVLAGERARAFQLQVE  608

Query  157  VFHLKQRLQSLENRAPTPRKPFHV  86
            VFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  609  VFHLKQRLQSMENRAPTPRKPFNV  632



>ref|XP_010241693.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241702.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241709.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
Length=710

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 164/260 (63%), Positives = 201/260 (77%), Gaps = 10/260 (4%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS---QVMERGTRQLDSGLEHIDSK  686
            DPN  TGN+SL KQF+NEEE   S KM K+ +DESSS    VM++  + LD G++  D  
Sbjct  456  DPNPTTGNISLYKQFHNEEEFNMSFKMLKNLEDESSSSQFHVMKQRAKALDMGVQ-TDIA  514

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTA  506
             I  E   + +SGN +  +KQ S N   ++D+ V  E+  K   S P  + Q YE+K+ A
Sbjct  515  GIAGETPFVFDSGN-SKLQKQASANLLSENDEIVIMETGDK---SVPSNVSQLYESKMAA  570

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L++KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKLAD +KE+++LKEKLAGVELA
Sbjct  571  LIKKNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKLADTIKEVEILKEKLAGVELA  630

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
            QEEANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEVF L
Sbjct  631  QEEANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEVFQL  690

Query  145  KQRLQSLENRAPTPRKPFHV  86
            KQRLQ++EN+APTPRKPFH+
Sbjct  691  KQRLQTVENQAPTPRKPFHM  710



>gb|KHG00526.1| Acyl-CoA-binding domain-containing 4 -like protein [Gossypium 
arboreum]
Length=703

 Score =   257 bits (656),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 209/262 (80%), Gaps = 8/262 (3%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS-QVMERGTRQLDSGLE-HIDS  689
            L+D N ++GNVSLRKQF+N+EE  TS+++ KSS+D SS  Q  E+ T Q D+G+E +   
Sbjct  445  LADQNPLSGNVSLRKQFHNKEEYNTSVRITKSSEDLSSILQATEQKTNQTDTGVEVNAPG  504

Query  688  KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKL  512
              I  +   + E  N +  + +G  + P+ +D+FVF E + K G +SAP  +Y  YE ++
Sbjct  505  TKIRSDESFLYECEN-SNPRVEGITSVPVGNDNFVFPEVEGKAGALSAPSSIY--YEMRM  561

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
             AL RKNG+LE QL AA+ASR++ +++L+SALKSK++ EK+LAD +KE+DL+KEKLAG+E
Sbjct  562  AALSRKNGILEVQLGAAMASRDSIERNLASALKSKEEMEKRLADTVKEMDLVKEKLAGIE  621

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  152
            LAQEEAN++SNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVF
Sbjct  622  LAQEEANNISNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVF  681

Query  151  HLKQRLQSLENRAPTPRKPFHV  86
            HLKQRLQS+ENRAPTPRKPF+V
Sbjct  682  HLKQRLQSMENRAPTPRKPFNV  703



>ref|XP_010904790.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Elaeis guineensis]
Length=729

 Score =   257 bits (656),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 162/269 (60%), Positives = 201/269 (75%), Gaps = 14/269 (5%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEET--SLKMPKSSDDES------------SSQVMERGTRQLD  713
            DP+S +GNVSLRKQF++EE+   +LKM KS  D+             SSQ ME+ +++ +
Sbjct  461  DPHSTSGNVSLRKQFHHEEDYNLALKMQKSPRDDKYKEGGDCLLSNPSSQAMEQRSKKHE  520

Query  712  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLY  533
            + ++   +  +      + +S N   ++KQG+ N   DS+     E D +  ++ P  LY
Sbjct  521  TAIQMDIAGILASTEENLLDSENSNLYQKQGNNNLVSDSNHVAPPEIDNRSVLTNPSNLY  580

Query  532  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  353
            Q YE K+  L RKN LLE QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE++LLK
Sbjct  581  QLYETKILTLTRKNVLLEEQLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKEVELLK  640

Query  352  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  173
            EKLAGVELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAF
Sbjct  641  EKLAGVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAF  700

Query  172  QLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            QLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  701  QLQVEVFHLKQRLQSMENRAPTPRKPFHM  729



>gb|KJB38635.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
 gb|KJB38637.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=706

 Score =   256 bits (654),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 161/264 (61%), Positives = 206/264 (78%), Gaps = 9/264 (3%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEE--ETSLKMPKSSDDESSS-QVMERGTRQLDSGLEHIDSK  686
            L+D N ++GNVSLRKQF+N+E   TS+++ KSS+D SS  Q  E+ T Q D+G+E     
Sbjct  445  LADQNPLSGNVSLRKQFHNKEGYNTSVRITKSSEDLSSILQATEQKTNQTDTGVEVNAPG  504

Query  685  T---IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEA  518
            T     E      E+ N +  + +G  + P+ +D+FVF E + K G +SAP  +Y  YE 
Sbjct  505  TKIRSDESFLYECENSNPSNPRVEGITSIPVGNDNFVFPEMEGKAGALSAPSSIY--YEM  562

Query  517  KLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAG  338
            ++ AL R+NG+LE QL AA+ASR+  +++L+SALKSK++ EK+LAD +KE+DLLKEKLAG
Sbjct  563  RMAALSRRNGILEVQLGAAMASRDTIERNLASALKSKEEMEKRLADTVKEMDLLKEKLAG  622

Query  337  VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVE  158
            +ELAQEEAN++SNIVHSDNVRLEHDVAF+KAVLDDTQKELHSTRG+L GERARAFQLQVE
Sbjct  623  IELAQEEANNISNIVHSDNVRLEHDVAFVKAVLDDTQKELHSTRGVLAGERARAFQLQVE  682

Query  157  VFHLKQRLQSLENRAPTPRKPFHV  86
            VFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  683  VFHLKQRLQSMENRAPTPRKPFNV  706



>ref|XP_004229210.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 isoform 
X2 [Solanum lycopersicum]
Length=661

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 176/258 (68%), Gaps = 46/258 (18%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTI  680
            LL DP+SV+GNVSLRKQF N+E+TS KM K+S DES SQ  E+G +QLD GL+       
Sbjct  450  LLIDPSSVSGNVSLRKQFSNDEDTSAKMTKTSGDESPSQ--EQGAKQLDIGLK-------  500

Query  679  PEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALL  500
                C+                              D K G+ A  G  Q +EAKL++L+
Sbjct  501  ---TCS---------------------------NGGDYKAGLPASSGACQQHEAKLSSLM  530

Query  499  RKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQE  320
            RKN               AA     +A++SKQD EKK++DA+KE++LLKEKLA VE+AQE
Sbjct  531  RKN-------GILEGQLAAALAGREAAVRSKQDMEKKMSDAVKEMELLKEKLASVEMAQE  583

Query  319  EANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQ  140
            EANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELHSTRG+L GERARAFQLQVEVFHLKQ
Sbjct  584  EANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQ  643

Query  139  RLQSLENRAPTPRKPFHV  86
            RLQSLENR+PTPRKPFHV
Sbjct  644  RLQSLENRSPTPRKPFHV  661



>ref|XP_006342766.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Solanum tuberosum]
Length=662

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 171/258 (66%), Gaps = 45/258 (17%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTI  680
            LL DP+SV+GNVSLRKQF N+E+ S KM K+S DES SQ  E+G +QLD G     S   
Sbjct  450  LLIDPSSVSGNVSLRKQFSNDEDASAKMTKTSGDESPSQ--EQGAKQLDIGGPKTSS---  504

Query  679  PEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALL  500
                                                D K G+ A  G  Q YEAKL++L+
Sbjct  505  ---------------------------------NGGDYKAGLPASSGACQQYEAKLSSLM  531

Query  499  RKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQE  320
            RKN                A     +A+KSKQD EKK+ADA+KE++LLKEKLA VE+AQE
Sbjct  532  RKN-------GILEGQLATALAGREAAVKSKQDMEKKMADAVKEMELLKEKLASVEMAQE  584

Query  319  EANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQ  140
            EANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELH+TRG+L GERARAFQLQVEVFHLKQ
Sbjct  585  EANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHTTRGVLAGERARAFQLQVEVFHLKQ  644

Query  139  RLQSLENRAPTPRKPFHV  86
            RLQSLENR+PTPRKPFHV
Sbjct  645  RLQSLENRSPTPRKPFHV  662



>ref|XP_010904791.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Elaeis guineensis]
Length=706

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 163/272 (60%), Positives = 202/272 (74%), Gaps = 17/272 (6%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEET--SLKMPKSSDDES------------SSQV---MERGTR  722
            DP+S +GNVSLRKQF++EE+   +LKM KS  D+             SSQV   ME+ ++
Sbjct  435  DPHSTSGNVSLRKQFHHEEDYNLALKMQKSPRDDKYKEGGDCLLSNPSSQVSNAMEQRSK  494

Query  721  QLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPI  542
            + ++ ++   +  +      + +S N   ++KQG+ N   DS+     E D +  ++ P 
Sbjct  495  KHETAIQMDIAGILASTEENLLDSENSNLYQKQGNNNLVSDSNHVAPPEIDNRSVLTNPS  554

Query  541  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  362
             LYQ YE K+  L RKN LLE QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE++
Sbjct  555  NLYQLYETKILTLTRKNVLLEEQLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKEVE  614

Query  361  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  182
            LLKEKLAGVELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  615  LLKEKLAGVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  674

Query  181  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            RAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  675  RAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  706



>ref|XP_010241717.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Nelumbo nucifera]
Length=705

 Score =   253 bits (647),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 162/257 (63%), Positives = 199/257 (77%), Gaps = 9/257 (4%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIP  677
            DPN  TGN+SL KQF+NEEE   S KM K+ +DESSS   ++  + LD G++  D   I 
Sbjct  456  DPNPTTGNISLYKQFHNEEEFNMSFKMLKNLEDESSSS--QQRAKALDMGVQ-TDIAGIA  512

Query  676  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  497
             E   + +SGN +  +KQ S N   ++D+ V  E+  K   S P  + Q YE+K+ AL++
Sbjct  513  GETPFVFDSGN-SKLQKQASANLLSENDEIVIMETGDK---SVPSNVSQLYESKMAALIK  568

Query  496  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  317
            KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKLAD +KE+++LKEKLAGVELAQEE
Sbjct  569  KNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKLADTIKEVEILKEKLAGVELAQEE  628

Query  316  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  137
            ANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEVF LKQR
Sbjct  629  ANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEVFQLKQR  688

Query  136  LQSLENRAPTPRKPFHV  86
            LQ++EN+APTPRKPFH+
Sbjct  689  LQTVENQAPTPRKPFHM  705



>ref|XP_010904789.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=732

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 163/272 (60%), Positives = 202/272 (74%), Gaps = 17/272 (6%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEET--SLKMPKSSDDES------------SSQV---MERGTR  722
            DP+S +GNVSLRKQF++EE+   +LKM KS  D+             SSQV   ME+ ++
Sbjct  461  DPHSTSGNVSLRKQFHHEEDYNLALKMQKSPRDDKYKEGGDCLLSNPSSQVSNAMEQRSK  520

Query  721  QLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPI  542
            + ++ ++   +  +      + +S N   ++KQG+ N   DS+     E D +  ++ P 
Sbjct  521  KHETAIQMDIAGILASTEENLLDSENSNLYQKQGNNNLVSDSNHVAPPEIDNRSVLTNPS  580

Query  541  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  362
             LYQ YE K+  L RKN LLE QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE++
Sbjct  581  NLYQLYETKILTLTRKNVLLEEQLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKEVE  640

Query  361  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  182
            LLKEKLAGVELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  641  LLKEKLAGVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  700

Query  181  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            RAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  701  RAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  732



>ref|XP_010241724.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Nelumbo nucifera]
Length=704

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 162/257 (63%), Positives = 198/257 (77%), Gaps = 10/257 (4%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIP  677
            DPN  TGN+SL KQF+NEEE   S KM K+ +DESSS    +  + LD G++  D   I 
Sbjct  456  DPNPTTGNISLYKQFHNEEEFNMSFKMLKNLEDESSSS---QRAKALDMGVQ-TDIAGIA  511

Query  676  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  497
             E   + +SGN +  +KQ S N   ++D+ V  E+  K   S P  + Q YE+K+ AL++
Sbjct  512  GETPFVFDSGN-SKLQKQASANLLSENDEIVIMETGDK---SVPSNVSQLYESKMAALIK  567

Query  496  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  317
            KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKLAD +KE+++LKEKLAGVELAQEE
Sbjct  568  KNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKLADTIKEVEILKEKLAGVELAQEE  627

Query  316  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  137
            ANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEVF LKQR
Sbjct  628  ANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEVFQLKQR  687

Query  136  LQSLENRAPTPRKPFHV  86
            LQ++EN+APTPRKPFH+
Sbjct  688  LQTVENQAPTPRKPFHM  704



>gb|KJB72601.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=665

 Score =   250 bits (639),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 163/260 (63%), Positives = 199/260 (77%), Gaps = 10/260 (4%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT-  683
            D N  + NVSLRKQF  EEE  T++++ K+SDD SS  Q  E  T Q ++G+      T 
Sbjct  411  DQNHPSENVSLRKQFRIEEEHNTTVRITKNSDDSSSILQATEEKTNQSETGVRISAPGTK  470

Query  682  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTA  506
            I  E  T  E  N      +G  N P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +
Sbjct  471  ISSEFGT--ECLNPLV---EGIANDPIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMAS  525

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA
Sbjct  526  LSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFADAMKEMELLKEKLAGIELA  585

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
             EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHL
Sbjct  586  HEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHL  645

Query  145  KQRLQSLENRAPTPRKPFHV  86
            KQRLQS+ENRAPTPRKPF+V
Sbjct  646  KQRLQSMENRAPTPRKPFNV  665



>ref|XP_011012826.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=616

 Score =   249 bits (636),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 196/262 (75%), Gaps = 6/262 (2%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSLKMPKS---SDDESSSQVMERGTRQLDSGLE-HID  692
            L  DPNS + NVS RK+F++EEE  +    +    +D SSS   E  +   D  ++ +  
Sbjct  356  LFVDPNSASRNVSHRKEFHHEEENRIAAKTARNLENDNSSSPAAEHQSNHSDISIQPNNQ  415

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  512
               I  E+ +I E     +H  QG GN  +D++D V  +SDC  G  A   +YQ YE K+
Sbjct  416  VGKINAEMTSIFEMETPNSHN-QGIGNVSVDNEDVVSLDSDCTTG-GARASIYQLYETKI  473

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
             AL+RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E+DLLKEKLAGVE
Sbjct  474  AALIRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMDLLKEKLAGVE  533

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  152
            LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVF
Sbjct  534  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVF  593

Query  151  HLKQRLQSLENRAPTPRKPFHV  86
            HLKQRLQS+ENR  TPRKPFHV
Sbjct  594  HLKQRLQSMENRTSTPRKPFHV  615



>gb|KJB72596.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
 gb|KJB72600.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=709

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 163/260 (63%), Positives = 199/260 (77%), Gaps = 10/260 (4%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT-  683
            D N  + NVSLRKQF  EEE  T++++ K+SDD SS  Q  E  T Q ++G+      T 
Sbjct  455  DQNHPSENVSLRKQFRIEEEHNTTVRITKNSDDSSSILQATEEKTNQSETGVRISAPGTK  514

Query  682  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTA  506
            I  E  T  E  N      +G  N P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +
Sbjct  515  ISSEFGT--ECLNPLV---EGIANDPIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMAS  569

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA
Sbjct  570  LSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFADAMKEMELLKEKLAGIELA  629

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
             EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHL
Sbjct  630  HEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHL  689

Query  145  KQRLQSLENRAPTPRKPFHV  86
            KQRLQS+ENRAPTPRKPF+V
Sbjct  690  KQRLQSMENRAPTPRKPFNV  709



>gb|KJB72599.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=706

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 163/260 (63%), Positives = 199/260 (77%), Gaps = 10/260 (4%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT-  683
            D N  + NVSLRKQF  EEE  T++++ K+SDD SS  Q  E  T Q ++G+      T 
Sbjct  452  DQNHPSENVSLRKQFRIEEEHNTTVRITKNSDDSSSILQATEEKTNQSETGVRISAPGTK  511

Query  682  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTA  506
            I  E  T  E  N      +G  N P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +
Sbjct  512  ISSEFGT--ECLNPLV---EGIANDPIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMAS  566

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA
Sbjct  567  LSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFADAMKEMELLKEKLAGIELA  626

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
             EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHL
Sbjct  627  HEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHL  686

Query  145  KQRLQSLENRAPTPRKPFHV  86
            KQRLQS+ENRAPTPRKPF+V
Sbjct  687  KQRLQSMENRAPTPRKPFNV  706



>ref|XP_011015377.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015378.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015379.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score =   249 bits (637),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 194/262 (74%), Gaps = 6/262 (2%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSGLEHID--  692
            LL DPNS +GNVS  K F+++EE  T+ K  K+ D   +S   E      D  ++  +  
Sbjct  460  LLVDPNSASGNVSRHKDFHHKEENTTAAKTAKNLDGNFASLATELQRNHSDVSVQPSNPV  519

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  512
             K   EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+
Sbjct  520  GKIHAEEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKI  577

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
             AL RKN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VE
Sbjct  578  AALTRKNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVE  637

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  152
            LAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+EVF
Sbjct  638  LAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQIEVF  697

Query  151  HLKQRLQSLENRAPTPRKPFHV  86
            HLKQRLQS+ENR PTPRKPFHV
Sbjct  698  HLKQRLQSMENRTPTPRKPFHV  719



>ref|XP_011005541.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005542.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005543.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score =   249 bits (637),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 195/262 (74%), Gaps = 6/262 (2%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSGLEHID--  692
            LL DPNS +GNVS  K F+++EE  T+ K+ K+ D   +S   E      D  ++  +  
Sbjct  460  LLVDPNSASGNVSRHKDFHHKEENTTAGKIAKNLDGNFASLATELQRNHSDVSVQPSNPV  519

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  512
             K   EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+
Sbjct  520  GKIHAEEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKI  577

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
             AL RKN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VE
Sbjct  578  AALTRKNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVE  637

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  152
            LAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+EVF
Sbjct  638  LAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQIEVF  697

Query  151  HLKQRLQSLENRAPTPRKPFHV  86
            HLKQRLQS+ENR PTPRKPFHV
Sbjct  698  HLKQRLQSMENRTPTPRKPFHV  719



>ref|XP_011012822.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012823.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012825.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=721

 Score =   249 bits (635),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 196/262 (75%), Gaps = 6/262 (2%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSLKMPKS---SDDESSSQVMERGTRQLDSGLEHIDS  689
            L  DPNS + NVS RK+F++EEE  +    +    +D SSS   E  +   D  ++  + 
Sbjct  461  LFVDPNSASRNVSHRKEFHHEEENRIAAKTARNLENDNSSSPAAEHQSNHSDISIQPNNQ  520

Query  688  -KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  512
               I  E+ +I E     +H  QG GN  +D++D V  +SDC  G  A   +YQ YE K+
Sbjct  521  VGKINAEMTSIFEMETPNSHN-QGIGNVSVDNEDVVSLDSDCTTG-GARASIYQLYETKI  578

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
             AL+RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E+DLLKEKLAGVE
Sbjct  579  AALIRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMDLLKEKLAGVE  638

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  152
            LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVF
Sbjct  639  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVF  698

Query  151  HLKQRLQSLENRAPTPRKPFHV  86
            HLKQRLQS+ENR  TPRKPFHV
Sbjct  699  HLKQRLQSMENRTSTPRKPFHV  720



>gb|KHG01869.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=709

 Score =   248 bits (634),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 162/260 (62%), Positives = 199/260 (77%), Gaps = 10/260 (4%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT-  683
            D N  + NVSLRKQF  EEE  T++++ K+SDD SS  Q  E    Q ++G+      T 
Sbjct  455  DQNHPSENVSLRKQFRIEEEHNTTVRITKNSDDSSSILQATEEKMNQSETGVRISAPGTK  514

Query  682  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTA  506
            I  E  T  E  N      +G  N P+D+D+FVF E+D + G +SAP  +YQ Y+ ++ +
Sbjct  515  ISSEFGT--ECLNPLV---EGIANDPVDNDNFVFPEADDRSGALSAPTSIYQFYDTRMAS  569

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L RKNG+LE QLA ALASR+ A+++L++ALKSK++ EKK ADAMKE++LLKEKL G+ELA
Sbjct  570  LSRKNGILEVQLATALASRDTAERTLAAALKSKEEMEKKFADAMKEMELLKEKLTGIELA  629

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
             EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHL
Sbjct  630  HEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHL  689

Query  145  KQRLQSLENRAPTPRKPFHV  86
            KQRLQS+ENRAPTPRKPF+V
Sbjct  690  KQRLQSMENRAPTPRKPFNV  709



>ref|XP_008813362.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
 ref|XP_008813363.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
Length=728

 Score =   249 bits (635),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 163/272 (60%), Positives = 203/272 (75%), Gaps = 21/272 (8%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEET--SLKMPKSSDDES------------SSQVMERGTRQLD  713
            DP+SV GNV LRKQF++EE+   +LKM KS  D+             SSQ ME+ +++ +
Sbjct  461  DPHSV-GNVLLRKQFHHEEDYNLALKMQKSPRDDKYKERCDYLLSNPSSQAMEQRSKKQE  519

Query  712  SGLEHIDSKTI---PEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPI  542
            + ++ +D   I    EE     ES N+  ++KQG+ N   DS+     E++ +  ++ P 
Sbjct  520  TAIQ-MDIAGILASTEENLFDSESSNL--YQKQGNNNLMSDSNHIAPPETENRSMLTNPS  576

Query  541  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  362
             +YQ YE K+  L RKN LLE QL  A+AS+EA +K+LSSA+KS+QD EKK+ADAMKE++
Sbjct  577  NIYQLYETKIVTLTRKNVLLEEQLNVAMASQEATEKNLSSAIKSRQDMEKKIADAMKEVE  636

Query  361  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  182
            LLKEKLA VELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  637  LLKEKLASVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  696

Query  181  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            RAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  697  RAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  728



>gb|KHG01870.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=733

 Score =   249 bits (635),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 162/260 (62%), Positives = 199/260 (77%), Gaps = 10/260 (4%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT-  683
            D N  + NVSLRKQF  EEE  T++++ K+SDD SS  Q  E    Q ++G+      T 
Sbjct  479  DQNHPSENVSLRKQFRIEEEHNTTVRITKNSDDSSSILQATEEKMNQSETGVRISAPGTK  538

Query  682  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTA  506
            I  E  T  E  N      +G  N P+D+D+FVF E+D + G +SAP  +YQ Y+ ++ +
Sbjct  539  ISSEFGT--ECLNPLV---EGIANDPVDNDNFVFPEADDRSGALSAPTSIYQFYDTRMAS  593

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L RKNG+LE QLA ALASR+ A+++L++ALKSK++ EKK ADAMKE++LLKEKL G+ELA
Sbjct  594  LSRKNGILEVQLATALASRDTAERTLAAALKSKEEMEKKFADAMKEMELLKEKLTGIELA  653

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
             EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHL
Sbjct  654  HEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHL  713

Query  145  KQRLQSLENRAPTPRKPFHV  86
            KQRLQS+ENRAPTPRKPF+V
Sbjct  714  KQRLQSMENRAPTPRKPFNV  733



>ref|XP_010524753.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524754.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524755.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
Length=698

 Score =   248 bits (632),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 194/262 (74%), Gaps = 20/262 (8%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEET-------SLKMPKSSDDESSSQVMERGTRQLDSGLEHID  692
            D N  +GNVSLRKQF NEEE         L +P+++DD +   +   G      G   I 
Sbjct  450  DQNPSSGNVSLRKQFNNEEEYRAVIEEEELPLPRTADDRT--HINNSG------GANKIT  501

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  512
            S+  P        S N+   +KQ    FP+++ D +F E+D     S+ +  YQ +EAK+
Sbjct  502  SEKTPSMSSDREFSSNL---QKQCPETFPMENADGIFLETDTSLASSSSV--YQFHEAKM  556

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
             AL+R+NG+LEGQL AALA REAA+++LS A+++KQ+TEKKLADAM+E++L+KEKL G+E
Sbjct  557  AALIRRNGILEGQLTAALAGREAAERNLSVAMRTKQETEKKLADAMREVELMKEKLTGLE  616

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  152
            LAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVF
Sbjct  617  LAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVF  676

Query  151  HLKQRLQSLENRAPTPRKPFHV  86
            HLKQRLQSLENRA TPRKPFHV
Sbjct  677  HLKQRLQSLENRAATPRKPFHV  698



>ref|XP_008438824.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis 
melo]
Length=677

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 163/261 (62%), Positives = 203/261 (78%), Gaps = 13/261 (5%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEE--ETSLKMPKSS-DDESSSQVMERGTRQLDSGLEHIDSK  686
            L DPN + GN+SLRKQF+N+E  + + K+ K++ DD S+SQV E    Q  SG E    +
Sbjct  426  LVDPNPIPGNISLRKQFHNDEAFDKTTKIAKTAEDDSSTSQVTENKLTQ--SGGE-FHGE  482

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG-LYQSYEAKLT  509
            T+P       ES N     K+G G  P+D+ D +F E+  K   S+    +YQ YEAK+ 
Sbjct  483  TLPS--VYEYESSNPF---KEGVGYHPIDNTD-LFSENSGKIVTSSTFSSIYQFYEAKMA  536

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
            AL+RKNG+LEGQLAAA ASREA +K+LSSALK +Q+ EK++AD +KE+++L++KLAGVE+
Sbjct  537  ALIRKNGVLEGQLAAATASREAVEKNLSSALKIRQEMEKRIADMIKEMEMLRDKLAGVEI  596

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  149
            A+EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER+RAFQLQVEVFH
Sbjct  597  AKEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERSRAFQLQVEVFH  656

Query  148  LKQRLQSLENRAPTPRKPFHV  86
            LKQRLQS+ENRAPTPRKPFH+
Sbjct  657  LKQRLQSMENRAPTPRKPFHM  677



>gb|EYU43915.1| hypothetical protein MIMGU_mgv1a002202mg [Erythranthe guttata]
Length=702

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 160/260 (62%), Positives = 198/260 (76%), Gaps = 14/260 (5%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETS-LKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKT  683
            LL DPN   GNVSLRKQFYNEEE +     K S D++S Q ME  T+  DSG        
Sbjct  455  LLVDPNPGPGNVSLRKQFYNEEENADATTTKISVDKNSFQTMEPNTKLSDSGG-------  507

Query  682  IPEEICTIPESGNMATHKKQ-GSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTA  506
                   +  +G+ +T ++   S +   +++D + QE+D K  ++AP G+YQ  EAKL +
Sbjct  508  -----VGVSYNGDRSTEERSYASESDKQETEDLILQENDGKSRMTAPPGVYQVSEAKLAS  562

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L+RKNG+LEGQLAAALA+REAA+K+LS+A++S+ + EKKL +AMKE+++L+EK+  VELA
Sbjct  563  LMRKNGILEGQLAAALAAREAAEKNLSAAIRSRLEMEKKLGEAMKEMEMLREKVTSVELA  622

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
            QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE  RAFQLQVEVFHL
Sbjct  623  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGEHGRAFQLQVEVFHL  682

Query  145  KQRLQSLENRAPTPRKPFHV  86
            KQRLQSLE RAPTPRKP+HV
Sbjct  683  KQRLQSLEPRAPTPRKPYHV  702



>ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 ref|XP_004171907.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 gb|KGN57083.1| hypothetical protein Csa_3G152100 [Cucumis sativus]
Length=678

 Score =   245 bits (625),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 204/262 (78%), Gaps = 14/262 (5%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEE--ETSLKMPKSS-DDESSSQVMERGTRQLDSGLEHIDSK  686
            L DPN + GN+SLRKQF+N+E  + + K+ K++ DD S+SQV E    Q  SG E    +
Sbjct  426  LVDPNPIPGNISLRKQFHNDESFDKTTKIAKTAEDDSSTSQVTENKLTQ--SGGE-FHGE  482

Query  685  TIPEEICTIPESGNMATHKKQGSG-NFPLDSDDFVFQESDCKFGISAPIG-LYQSYEAKL  512
            T+P       ES N     K+G G + P+D+ D +F ES  K   S+    +YQ YEAK+
Sbjct  483  TLPS--VYEYESSNPF---KEGVGYHHPIDNTD-LFSESSGKIVTSSTFSSIYQFYEAKM  536

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
             AL+RKNG+LEGQLAAA ASREA +K+LSSALK +Q+ EK++AD +KE+++L++KLAGVE
Sbjct  537  AALIRKNGVLEGQLAAATASREAVEKNLSSALKIRQEMEKRIADMIKEMEMLRDKLAGVE  596

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  152
            +A+EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER+RAFQLQVEVF
Sbjct  597  IAKEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERSRAFQLQVEVF  656

Query  151  HLKQRLQSLENRAPTPRKPFHV  86
            HLKQRLQS+ENRAPTPRKPFH+
Sbjct  657  HLKQRLQSMENRAPTPRKPFHM  678



>ref|XP_006380198.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
 gb|ERP57995.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
Length=707

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 161/260 (62%), Positives = 196/260 (75%), Gaps = 16/260 (6%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLDSGLEHIDSK  686
            LL DPNS + NVS RK+F++EEE  +  K  ++ +D++SS        ++++        
Sbjct  461  LLVDPNSASRNVSHRKEFHHEEENRIAAKTARNLEDDNSSSPPNNPVSKINA--------  512

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTA  506
                E+ +I E     +H  QG GN  +D++D V  ESDC  G  A   +YQ YE K+ A
Sbjct  513  ----EMSSIFEMETPNSHN-QGIGNVSVDNEDVVSPESDCTTG-GARASIYQLYETKIAA  566

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L+RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E++LLKEKLAGVELA
Sbjct  567  LIRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMELLKEKLAGVELA  626

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
            QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHL
Sbjct  627  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHL  686

Query  145  KQRLQSLENRAPTPRKPFHV  86
            KQRLQS+ENR  TPRKPF V
Sbjct  687  KQRLQSMENRTSTPRKPFRV  706



>gb|KDP40010.1| hypothetical protein JCGZ_02008 [Jatropha curcas]
Length=709

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 166/261 (64%), Positives = 200/261 (77%), Gaps = 8/261 (3%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEEE-TSLKMPKSSDD-ESSSQVMERGTRQLDSGLEHIDS--  689
            L DPN   GNVSLRKQF++EE  T++KM K+ ++  SSS   E    Q    ++   S  
Sbjct  453  LVDPN--PGNVSLRKQFHDEEHGTAVKMVKNLEEGTSSSPAREHRMNQTHMPIQTNISIG  510

Query  688  KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLT  509
            K I EE     ES N+ + +    GN P+D+DD +  E+D   G  A   +YQ YE K+ 
Sbjct  511  KIIAEEASCGFESENLNS-QNPAIGNHPVDNDDVLVPETDGMAG-GAHSSIYQLYETKIA  568

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
            AL+RKNG+LEGQLAAAL+SR++A+K+LSS LKSKQ+ EKKL DA++E++LLKE+LA VEL
Sbjct  569  ALIRKNGVLEGQLAAALSSRDSAEKNLSSVLKSKQELEKKLTDALREMELLKERLASVEL  628

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  149
            AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFH
Sbjct  629  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFH  688

Query  148  LKQRLQSLENRAPTPRKPFHV  86
            LKQRLQS+ENR PTPRKPF+V
Sbjct  689  LKQRLQSMENRVPTPRKPFNV  709



>ref|XP_002516884.1| acyl-CoA binding protein, putative [Ricinus communis]
 gb|EEF45498.1| acyl-CoA binding protein, putative [Ricinus communis]
Length=713

 Score =   243 bits (620),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 165/261 (63%), Positives = 203/261 (78%), Gaps = 6/261 (2%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEEETS-LKMPKSSDDES-SSQVMERGTRQLDSGLEHIDS--  689
            L +PNSV+GNVSLRKQF+ EE ++ +KM K+ +D S SS  ++    Q D+  +   S  
Sbjct  455  LVEPNSVSGNVSLRKQFHEEEHSAAVKMAKNIEDGSFSSLAVDHRINQSDTSNQTNISIG  514

Query  688  KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLT  509
            K I EE   + +S N +  + QG  N  ++++D +  E D   G  A   +YQ YE K+ 
Sbjct  515  KIIAEETSCVFDSEN-SHSQNQGVENHLVENEDALVSEPDGMTG-GAHSSIYQLYETKIA  572

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
            +L+RKNG+LEGQLAAALASREAA+K+LSS LKS+Q+ E+KL D ++E++LLKEKLAGVEL
Sbjct  573  SLIRKNGVLEGQLAAALASREAAEKNLSSVLKSRQEIERKLTDTLREMELLKEKLAGVEL  632

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  149
            AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFH
Sbjct  633  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLTGERARAFQLQVEVFH  692

Query  148  LKQRLQSLENRAPTPRKPFHV  86
            LKQRLQS+ENR PTPRKPF+V
Sbjct  693  LKQRLQSMENRVPTPRKPFNV  713



>ref|XP_010024637.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 4 [Eucalyptus grandis]
Length=696

 Score =   243 bits (619),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 159/262 (61%), Positives = 195/262 (74%), Gaps = 21/262 (8%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLDSGLEHIDSKT  683
            L D N  +GNVSLRKQF NEEE S   K+ K  +DE SS             L+  + K+
Sbjct  451  LIDLNPSSGNVSLRKQFSNEEEYSXTQKVAKHLEDEGSS-------------LQATECKS  497

Query  682  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP---IGLYQSYEAKL  512
            I EE     E  N++  +  G+ + P+++DD  + E++CK G  AP     + Q Y+ K+
Sbjct  498  IGEETALAFEDENLSP-RINGNDSLPVNNDDLAYAETNCKVG--APPSTSSICQLYKTKI  554

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
             +L+RKNG+LEGQLAAALA++EA +KS SS LKSKQ+ +KKLAD MKE+++LKEKLA +E
Sbjct  555  DSLIRKNGILEGQLAAALANQEATEKSFSSILKSKQEVDKKLADTMKEMEVLKEKLADLE  614

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  152
            + QEEANSL+NIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR FQLQVEVF
Sbjct  615  VTQEEANSLNNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARTFQLQVEVF  674

Query  151  HLKQRLQSLENRAPTPRKPFHV  86
            HLKQRLQS+ENRAPTPRKPFHV
Sbjct  675  HLKQRLQSIENRAPTPRKPFHV  696



>ref|XP_010492874.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
 ref|XP_010492875.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score =   241 bits (614),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 199/259 (77%), Gaps = 14/259 (5%)
 Frame = -1

Query  844  NSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEE  671
            N  +GNVSLRKQF  EEE    ++  K S++E S   + R     + G     +K   E+
Sbjct  457  NPSSGNVSLRKQFSTEEEYRAVIEPTKCSEEEVS---VPRTVDDNNGG-----AKITAEK  508

Query  670  ICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSYEAKLTAL  503
              ++  + +++  +KQGS  FPL++ D   +FQE D   F G  +   +YQ +EAK+TAL
Sbjct  509  TLSMVSNHDISNLQKQGSETFPLETVDGALIFQEMDNISFAGSMSSSSVYQFHEAKMTAL  568

Query  502  LRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQ  323
            +R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL G+ELAQ
Sbjct  569  IRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKLTGLELAQ  628

Query  322  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLK  143
            EEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLK
Sbjct  629  EEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLK  688

Query  142  QRLQSLENRAPTPRKPFHV  86
            QRLQSLENRA TPRKPFHV
Sbjct  689  QRLQSLENRAATPRKPFHV  707



>ref|XP_010454111.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score =   240 bits (612),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 160/259 (62%), Positives = 202/259 (78%), Gaps = 14/259 (5%)
 Frame = -1

Query  844  NSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEE  671
            N  +GNVSLRKQF  EEE    ++  KSS++E S   + R T + + G +  + KT+   
Sbjct  457  NPSSGNVSLRKQFSTEEEYRAVIEPTKSSEEEVS---VPRTTEENNGGAKITEEKTL---  510

Query  670  ICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKFGIS-APIGLYQSYEAKLTAL  503
              ++  + +++   KQ S  FPL++ D   +FQE D  KFG S +   +YQ +EAK+TAL
Sbjct  511  --SMVSNHDISNLHKQCSETFPLENVDGALIFQEMDNIKFGGSMSSSSVYQFHEAKMTAL  568

Query  502  LRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQ  323
            +R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL G+ELAQ
Sbjct  569  IRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKLTGLELAQ  628

Query  322  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLK  143
            EEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLK
Sbjct  629  EEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLK  688

Query  142  QRLQSLENRAPTPRKPFHV  86
            QRLQSLENRA T RKPFHV
Sbjct  689  QRLQSLENRAATHRKPFHV  707



>ref|XP_008804572.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 5 [Phoenix dactylifera]
Length=715

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 158/261 (61%), Positives = 201/261 (77%), Gaps = 9/261 (3%)
 Frame = -1

Query  853  SDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTI  680
            +D +S++  +SLRKQF++EE+ +L  +M KS +D+   + ME+ +++L++ +E +D   I
Sbjct  459  TDLHSISSTMSLRKQFHHEEDYNLAIRMLKSPEDDKH-KAMEQRSKKLETAVE-MDIAGI  516

Query  679  ---PEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLT  509
                EE     ES N+   +K G+ +   DS+     E+D   G+ A   +YQ YE K+ 
Sbjct  517  LASTEENLFDSESSNLC--QKLGNNDLMADSNHIAPPETDGISGLLANPYIYQLYETKIV  574

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
             L RKN LLE QL AALA++EAA+K+LSSALKS+QD EKKLADAMKE++LLKEKLAG+EL
Sbjct  575  TLTRKNVLLEEQLTAALANQEAAEKNLSSALKSRQDMEKKLADAMKEVELLKEKLAGMEL  634

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  149
            AQEEAN+LSN+ HSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FH
Sbjct  635  AQEEANNLSNMSHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFH  694

Query  148  LKQRLQSLENRAPTPRKPFHV  86
            LKQRLQS+ENRAPTPRKPFH+
Sbjct  695  LKQRLQSMENRAPTPRKPFHI  715



>ref|XP_010420634.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Camelina sativa]
Length=707

 Score =   238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 156/259 (60%), Positives = 199/259 (77%), Gaps = 14/259 (5%)
 Frame = -1

Query  844  NSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEE  671
            N  +GNVSLRKQF  EEE    ++  K S++E S       +R +D    +  +K   E+
Sbjct  457  NPSSGNVSLRKQFSTEEEYRAVIEPTKCSEEEVSV------SRTVDD--NNGGAKITAEK  508

Query  670  ICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSYEAKLTAL  503
              ++  + +++  +KQ S +FPL++ D   +FQE D   F G  +   +YQ +EAK+TAL
Sbjct  509  TLSMVSNHDISNLQKQCSESFPLENVDGALIFQEMDNINFAGSMSSSSVYQFHEAKMTAL  568

Query  502  LRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQ  323
            +R+NG+LEGQL  ALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL G+ELAQ
Sbjct  569  IRRNGILEGQLETALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKLTGLELAQ  628

Query  322  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLK  143
            EEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLK
Sbjct  629  EEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLK  688

Query  142  QRLQSLENRAPTPRKPFHV  86
            QRLQSLENRA TPRKPFHV
Sbjct  689  QRLQSLENRAATPRKPFHV  707



>gb|KJB72598.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=679

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 187/242 (77%), Gaps = 8/242 (3%)
 Frame = -1

Query  802  NEEETSLKMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT-IPEEICTIPESGNMATHK  629
            +E  T++++ K+SDD SS  Q  E  T Q ++G+      T I  E  T  E  N     
Sbjct  443  SEHNTTVRITKNSDDSSSILQATEEKTNQSETGVRISAPGTKISSEFGT--ECLNPLV--  498

Query  628  KQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  452
             +G  N P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA A AS
Sbjct  499  -EGIANDPIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFAS  557

Query  451  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  272
            R+ A+++L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRL
Sbjct  558  RDTAERTLASALKSKEEMEKKFADAMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRL  617

Query  271  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  92
            EHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  618  EHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  677

Query  91   HV  86
            +V
Sbjct  678  NV  679



>ref|XP_010420635.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Camelina sativa]
Length=691

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 153/257 (60%), Positives = 191/257 (74%), Gaps = 26/257 (10%)
 Frame = -1

Query  844  NSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEIC  665
            N  +GNVSLRKQF  EEE                   R T   ++G     +K   E+  
Sbjct  457  NPSSGNVSLRKQFSTEEEY------------------RATVDDNNG----GAKITAEKTL  494

Query  664  TIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSYEAKLTALLR  497
            ++  + +++  +KQ S +FPL++ D   +FQE D   F G  +   +YQ +EAK+TAL+R
Sbjct  495  SMVSNHDISNLQKQCSESFPLENVDGALIFQEMDNINFAGSMSSSSVYQFHEAKMTALIR  554

Query  496  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  317
            +NG+LEGQL  ALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL G+ELAQEE
Sbjct  555  RNGILEGQLETALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKLTGLELAQEE  614

Query  316  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  137
            ANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQR
Sbjct  615  ANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQR  674

Query  136  LQSLENRAPTPRKPFHV  86
            LQSLENRA TPRKPFHV
Sbjct  675  LQSLENRAATPRKPFHV  691



>dbj|BAH19562.1| AT5G18590 [Arabidopsis thaliana]
Length=708

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 191/257 (74%), Gaps = 9/257 (4%)
 Frame = -1

Query  844  NSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEIC  665
            N  +GNVSLRKQF  EEE    +  +   E    V    T     G     +K   E+  
Sbjct  457  NPPSGNVSLRKQFSTEEEYRAVIEPAKCSEEDISVPPPTTDDNTGG-----AKITAEKTL  511

Query  664  TIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSYEAKLTALLR  497
            ++     + + +KQ S  +PL++ D   +FQE D   F G ++   +YQ +EAK+TAL+R
Sbjct  512  SMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSSSVYQFHEAKMTALIR  571

Query  496  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  317
            +NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL G+ELAQEE
Sbjct  572  RNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKLTGLELAQEE  631

Query  316  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  137
            ANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQR
Sbjct  632  ANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQR  691

Query  136  LQSLENRAPTPRKPFHV  86
            LQSLENRA TPRKPFHV
Sbjct  692  LQSLENRAATPRKPFHV  708



>ref|NP_197360.2| kelch repeat-containing protein [Arabidopsis thaliana]
 ref|NP_850846.1| kelch repeat-containing protein [Arabidopsis thaliana]
 dbj|BAE98374.1| RanGAP1 interacting protein [Arabidopsis thaliana]
 gb|AED92582.1| kelch repeat-containing protein [Arabidopsis thaliana]
 gb|AED92583.1| kelch repeat-containing protein [Arabidopsis thaliana]
Length=708

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 191/257 (74%), Gaps = 9/257 (4%)
 Frame = -1

Query  844  NSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEIC  665
            N  +GNVSLRKQF  EEE    +  +   E    V    T     G     +K   E+  
Sbjct  457  NPPSGNVSLRKQFSTEEEYRAVIEPAKCSEEDISVPPPTTDDNTGG-----AKITAEKTL  511

Query  664  TIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSYEAKLTALLR  497
            ++     + + +KQ S  +PL++ D   +FQE D   F G ++   +YQ +EAK+TAL+R
Sbjct  512  SMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSSSVYQFHEAKMTALIR  571

Query  496  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  317
            +NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL G+ELAQEE
Sbjct  572  RNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKLTGLELAQEE  631

Query  316  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  137
            ANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQR
Sbjct  632  ANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQR  691

Query  136  LQSLENRAPTPRKPFHV  86
            LQSLENRA TPRKPFHV
Sbjct  692  LQSLENRAATPRKPFHV  708



>gb|AAM78582.1| RanGAP1 interacting protein [Arabidopsis thaliana]
Length=708

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 191/257 (74%), Gaps = 9/257 (4%)
 Frame = -1

Query  844  NSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEIC  665
            N  +GNVSLRKQF  EEE    +  +   E    V    T     G     +K   E+  
Sbjct  457  NPPSGNVSLRKQFSTEEEYRAVIEPAKCSEEDISVPPPTTDDNTGG-----AKITAEKTL  511

Query  664  TIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSYEAKLTALLR  497
            ++     + + +KQ S  +PL++ D   +FQE D   F G ++   +YQ +EAK+TAL+R
Sbjct  512  SMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSSSVYQFHEAKMTALIR  571

Query  496  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  317
            +NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL G+ELAQEE
Sbjct  572  RNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKLTGLELAQEE  631

Query  316  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  137
            ANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQR
Sbjct  632  ANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQR  691

Query  136  LQSLENRAPTPRKPFHV  86
            LQSLENRA TPRKPFHV
Sbjct  692  LQSLENRAATPRKPFHV  708



>ref|XP_010683938.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Beta 
vulgaris subsp. vulgaris]
Length=708

 Score =   233 bits (595),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 166/258 (64%), Positives = 204/258 (79%), Gaps = 3/258 (1%)
 Frame = -1

Query  853  SDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESS-SQVMERGTRQLDSGLEHIDSKTIP  677
            +D ++V+G+VSLRKQF++EEE + K+ + SDDE+S SQ +E       + L     + I 
Sbjct  452  ADSSNVSGSVSLRKQFHSEEELTCKLTRHSDDENSFSQFLEERRPPEAACLAETSGRFIM  511

Query  676  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGI-SAPIGLYQSYEAKLTALL  500
            E+I ++ ESGN +      S  FPLD++  +F ES+ K G+ SAP  +YQ YE ++ AL+
Sbjct  512  EDIPSLSESGNFSV-PSCVSEKFPLDNEAIIFPESEDKCGVFSAPSSIYQLYETRMAALI  570

Query  499  RKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQE  320
            RKNG+LEGQLAAALASREAA+K++SS LKS+Q+TEKKL D  KE++LLKEKL G+ELAQE
Sbjct  571  RKNGMLEGQLAAALASREAAEKNVSSVLKSRQETEKKLVDTGKELELLKEKLGGLELAQE  630

Query  319  EANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQ  140
            EAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ERARAFQLQVEVFHLKQ
Sbjct  631  EANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGMLANERARAFQLQVEVFHLKQ  690

Query  139  RLQSLENRAPTPRKPFHV  86
            RLQSLENR  TPRKPF V
Sbjct  691  RLQSLENRTATPRKPFQV  708



>ref|XP_002873905.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50164.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=709

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 154/258 (60%), Positives = 190/258 (74%), Gaps = 10/258 (4%)
 Frame = -1

Query  844  NSVTGNVSLRKQFYNEEETSLKM-PKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEI  668
            N  +GNVSLRKQF  EEE    + P    +E  S  +         G     +K   E+ 
Sbjct  457  NPSSGNVSLRKQFSTEEEYRAVIEPAKCSEEELSVPLPTADDNNGGG-----AKITGEKT  511

Query  667  CTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSYEAKLTALL  500
             ++     +   +KQ S  FPL++ D   + QE D   F G ++   +YQ +EAK+TAL+
Sbjct  512  LSMVSDREVLNLQKQCSETFPLENVDGTLIIQEMDNINFAGSASSSSVYQFHEAKMTALI  571

Query  499  RKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQE  320
            R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL G+ELAQE
Sbjct  572  RRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKLTGLELAQE  631

Query  319  EANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQ  140
            EANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQ
Sbjct  632  EANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQ  691

Query  139  RLQSLENRAPTPRKPFHV  86
            RLQSLENRA TPRKPFHV
Sbjct  692  RLQSLENRAATPRKPFHV  709



>ref|XP_006400408.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
 gb|ESQ41861.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
Length=701

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 154/263 (59%), Positives = 188/263 (71%), Gaps = 28/263 (11%)
 Frame = -1

Query  844  NSVTGNVSLRKQFYNEEETSL-----KMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTI  680
            N  +GNVSLRKQF  EEE        K P++SDD+++                   +K  
Sbjct  457  NPSSGNVSLRKQFSTEEEYRAVVEPAKCPEASDDKNNG-----------------GAKIT  499

Query  679  PEEICTIPESGNMATHKKQGSGNFPLD--SDDFVFQESDCKFGISAPIG---LYQSYEAK  515
             E+  +      M+  +KQ S  FP     D  +F   D K  ++A      +YQ +EAK
Sbjct  500  AEKTLSTVSDREMSNLQKQCSETFPFAHIDDALIFPGMD-KTNLAANASSSSVYQFHEAK  558

Query  514  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  335
            +TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL DAM++++LLKEKL G+
Sbjct  559  MTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLCDAMRDVELLKEKLTGL  618

Query  334  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  155
            ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEV
Sbjct  619  ELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEV  678

Query  154  FHLKQRLQSLENRAPTPRKPFHV  86
            FHLKQRLQSLENRA TPRKPFHV
Sbjct  679  FHLKQRLQSLENRAATPRKPFHV  701



>ref|XP_010931595.1| PREDICTED: tip elongation aberrant protein 3 isoform X4 [Elaeis 
guineensis]
Length=717

 Score =   231 bits (588),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 154/261 (59%), Positives = 194/261 (74%), Gaps = 10/261 (4%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQ---LDSGLEHIDSK  686
            D +SV+G++SLRKQF  EE+ SL  +M KS +++    + ++  +Q   +   +  I + 
Sbjct  461  DLHSVSGSISLRKQFRAEEDYSLALRMQKSPEEDRYKAIEQKSKKQETVVQMDIAGIVA-  519

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLT  509
            +I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+ 
Sbjct  520  SIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIY  576

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
             L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+EL
Sbjct  577  TLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMEL  636

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  149
            AQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FH
Sbjct  637  AQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFH  696

Query  148  LKQRLQSLENRAPTPRKPFHV  86
            LKQRLQS+ENRAPTPRKPFH 
Sbjct  697  LKQRLQSMENRAPTPRKPFHT  717



>ref|XP_010931592.1| PREDICTED: tip elongation aberrant protein 3 isoform X2 [Elaeis 
guineensis]
Length=730

 Score =   229 bits (585),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 200/274 (73%), Gaps = 23/274 (8%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDE------------SSSQVMERGTRQLD  713
            D +SV+G++SLRKQF  EE+ SL  +M KS +++             SSQ +E+ +++ +
Sbjct  461  DLHSVSGSISLRKQFRAEEDYSLALRMQKSPEEDRYKVGDDCLSSNPSSQAIEQKSKKQE  520

Query  712  SGLEHID----SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-  548
            + ++ +D      +I E +C   ES N+  ++K G+ N   DS+     E+    G+   
Sbjct  521  TVVQ-MDIAGIVASIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQ  576

Query  547  PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  368
            P  + Q YE K+  L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE
Sbjct  577  PSNICQLYETKIYTLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKE  636

Query  367  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  188
            ++LLKEKLAG+ELAQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  637  VELLKEKLAGMELAQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  696

Query  187  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            RARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH 
Sbjct  697  RARAFQLQVEAFHLKQRLQSMENRAPTPRKPFHT  730



>ref|XP_010931596.1| PREDICTED: tip elongation aberrant protein 3 isoform X5 [Elaeis 
guineensis]
Length=629

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 194/275 (71%), Gaps = 24/275 (9%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDE----SSSQVMERGTRQLDSGLEHIDS  689
            D +SV+G++SLRKQF  EE+ SL  +M KS +++        +    + Q+++ +E    
Sbjct  357  DLHSVSGSISLRKQFRAEEDYSLALRMQKSPEEDRYKVGDDCLSSNPSSQVNNAIEQKSK  416

Query  688  K--------------TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGIS  551
            K              +I E +C   ES N+  ++K G+ N   DS+     E+    G+ 
Sbjct  417  KQETVVQMDIAGIVASIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLL  473

Query  550  A-PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAM  374
              P  + Q YE K+  L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AM
Sbjct  474  VQPSNICQLYETKIYTLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAM  533

Query  373  KEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLG  194
            KE++LLKEKLAG+ELAQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L 
Sbjct  534  KEVELLKEKLAGMELAQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLA  593

Query  193  GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  89
            GERARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH
Sbjct  594  GERARAFQLQVEAFHLKQRLQSMENRAPTPRKPFH  628



>gb|EPS74438.1| hypothetical protein M569_00314, partial [Genlisea aurea]
Length=449

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 185/269 (69%), Gaps = 41/269 (15%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKT-  683
            LL DPNS +GNVSLR+QFYNEE  S  + KSS+D++S +        LD  L+   S + 
Sbjct  210  LLIDPNSSSGNVSLRRQFYNEENGSNSLSKSSEDKTSFRAT------LDGNLKPSGSFSS  263

Query  682  ---IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  512
               + E +   P++             FP +SDD + Q              +  YE K+
Sbjct  264  DIHVEEVVGEHPDA-------------FPSESDDVLLQTRRS----------HHVYEEKI  300

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
             AL++K G+LEGQLAAA A+REAA+K+ +SA +S+Q+ EKKL D +KEIDLLKEKL+ VE
Sbjct  301  AALMKKTGILEGQLAAATAAREAAEKNSASATRSRQEMEKKLVDTLKEIDLLKEKLSSVE  360

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK--------ELHSTRGLLGGERARA  176
            ++QEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQK        ELHSTRG+L GERARA
Sbjct  361  ISQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKASWKQKRLELHSTRGVLAGERARA  420

Query  175  FQLQVEVFHLKQRLQSLENRAPTPRKPFH  89
            FQLQVEVFHLKQRLQSLE RAPTPRK FH
Sbjct  421  FQLQVEVFHLKQRLQSLETRAPTPRKQFH  449



>gb|KEH32273.1| acyl-CoA-binding domain protein [Medicago truncatula]
Length=718

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 159/259 (61%), Positives = 195/259 (75%), Gaps = 7/259 (3%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEETS--LKMPKSSDDESSSQVMERGTRQLDS-GLEHIDSKTI  680
            DPN    NVSLRKQF  +EE +  +KM K+SD  S  QV +  T + D   L +I    +
Sbjct  462  DPNYPPSNVSLRKQFDRDEEYNADVKMDKNSDGSSLPQVADHRTNENDRRKLMNISGAKV  521

Query  679  PEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALL  500
              E   +  SG M+  + Q   +  L+S+   F E+D K G  +   +YQ YE+K+ AL+
Sbjct  522  NIE-GQVLLSG-MSNQQNQVFESDALESEVVSFPEND-KSGSLSSTNIYQYYESKVAALI  578

Query  499  RKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQE  320
            RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQE
Sbjct  579  RKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMELLREKLAGLELAQE  638

Query  319  EANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQ  140
            EAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQ
Sbjct  639  EANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQ  698

Query  139  RLQSLENR-APTPRKPFHV  86
            RLQS+ENR + TPRKPFHV
Sbjct  699  RLQSMENRTSTTPRKPFHV  717



>gb|AES91803.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=719

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 159/259 (61%), Positives = 195/259 (75%), Gaps = 7/259 (3%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEETS--LKMPKSSDDESSSQVMERGTRQLDS-GLEHIDSKTI  680
            DPN    NVSLRKQF  +EE +  +KM K+SD  S  QV +  T + D   L +I    +
Sbjct  463  DPNYPPSNVSLRKQFDRDEEYNADVKMDKNSDGSSLPQVADHRTNENDRRKLMNISGAKV  522

Query  679  PEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALL  500
              E   +  SG M+  + Q   +  L+S+   F E+D K G  +   +YQ YE+K+ AL+
Sbjct  523  NIE-GQVLLSG-MSNQQNQVFESDALESEVVSFPEND-KSGSLSSTNIYQYYESKVAALI  579

Query  499  RKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQE  320
            RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQE
Sbjct  580  RKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMELLREKLAGLELAQE  639

Query  319  EANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQ  140
            EAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQ
Sbjct  640  EANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQ  699

Query  139  RLQSLENR-APTPRKPFHV  86
            RLQS+ENR + TPRKPFHV
Sbjct  700  RLQSMENRTSTTPRKPFHV  718



>ref|XP_003609606.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=743

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 159/259 (61%), Positives = 195/259 (75%), Gaps = 7/259 (3%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEETS--LKMPKSSDDESSSQVMERGTRQLDS-GLEHIDSKTI  680
            DPN    NVSLRKQF  +EE +  +KM K+SD  S  QV +  T + D   L +I    +
Sbjct  487  DPNYPPSNVSLRKQFDRDEEYNADVKMDKNSDGSSLPQVADHRTNENDRRKLMNISGAKV  546

Query  679  PEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALL  500
              E   +  SG M+  + Q   +  L+S+   F E+D K G  +   +YQ YE+K+ AL+
Sbjct  547  NIE-GQVLLSG-MSNQQNQVFESDALESEVVSFPEND-KSGSLSSTNIYQYYESKVAALI  603

Query  499  RKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQE  320
            RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQE
Sbjct  604  RKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMELLREKLAGLELAQE  663

Query  319  EANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQ  140
            EAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQ
Sbjct  664  EANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQ  723

Query  139  RLQSLENR-APTPRKPFHV  86
            RLQS+ENR + TPRKPFHV
Sbjct  724  RLQSMENRTSTTPRKPFHV  742



>ref|XP_010931593.1| PREDICTED: tip elongation aberrant protein 3 isoform X3 [Elaeis 
guineensis]
Length=727

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 194/276 (70%), Gaps = 24/276 (9%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDE----SSSQVMERGTRQLDSGLEHIDS  689
            D +SV+G++SLRKQF  EE+ SL  +M KS +++        +    + Q+++ +E    
Sbjct  455  DLHSVSGSISLRKQFRAEEDYSLALRMQKSPEEDRYKVGDDCLSSNPSSQVNNAIEQKSK  514

Query  688  K--------------TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGIS  551
            K              +I E +C   ES N+  ++K G+ N   DS+     E+    G+ 
Sbjct  515  KQETVVQMDIAGIVASIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLL  571

Query  550  A-PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAM  374
              P  + Q YE K+  L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AM
Sbjct  572  VQPSNICQLYETKIYTLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAM  631

Query  373  KEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLG  194
            KE++LLKEKLAG+ELAQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L 
Sbjct  632  KEVELLKEKLAGMELAQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLA  691

Query  193  GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            GERARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH 
Sbjct  692  GERARAFQLQVEAFHLKQRLQSMENRAPTPRKPFHT  727



>ref|XP_010931591.1| PREDICTED: tip elongation aberrant protein 3 isoform X1 [Elaeis 
guineensis]
Length=733

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 194/276 (70%), Gaps = 24/276 (9%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDE----SSSQVMERGTRQLDSGLEHIDS  689
            D +SV+G++SLRKQF  EE+ SL  +M KS +++        +    + Q+++ +E    
Sbjct  461  DLHSVSGSISLRKQFRAEEDYSLALRMQKSPEEDRYKVGDDCLSSNPSSQVNNAIEQKSK  520

Query  688  K--------------TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGIS  551
            K              +I E +C   ES N+  ++K G+ N   DS+     E+    G+ 
Sbjct  521  KQETVVQMDIAGIVASIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLL  577

Query  550  A-PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAM  374
              P  + Q YE K+  L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AM
Sbjct  578  VQPSNICQLYETKIYTLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAM  637

Query  373  KEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLG  194
            KE++LLKEKLAG+ELAQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L 
Sbjct  638  KEVELLKEKLAGMELAQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLA  697

Query  193  GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            GERARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH 
Sbjct  698  GERARAFQLQVEAFHLKQRLQSMENRAPTPRKPFHT  733



>ref|XP_007147881.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
 gb|ESW19875.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
Length=710

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 193/258 (75%), Gaps = 8/258 (3%)
 Frame = -1

Query  844  NSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQLDSG--LEHIDSKTI  680
            NS+   +SLR+QF + EE  T++++ K S+DESS  Q  +  T Q D G  +    +KT 
Sbjct  456  NSLPTKISLRRQFDHHEEYNTNVRIDKHSEDESSFPQAGDHRTSQNDPGNQMRSSGAKTN  515

Query  679  PEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALL  500
             EE  ++  SGN +  +  G GN  L+SDD  F E+     +SA   ++  YE K+ +L+
Sbjct  516  MEEQVSV--SGN-SNQQNLGFGNPFLESDDVSFPENSKSGSLSAASSIHHYYETKVASLM  572

Query  499  RKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQE  320
            RK G+LEGQL+AALASREAA+KSL+SA KS+Q+  KKLAD +KE++LL EKL   ELAQE
Sbjct  573  RKFGILEGQLSAALASREAAEKSLASAFKSRQEMGKKLADTLKEMELLSEKLVSAELAQE  632

Query  319  EANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQ  140
            EAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RAFQLQVEVFHLKQ
Sbjct  633  EANNLSNLVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRAFQLQVEVFHLKQ  692

Query  139  RLQSLENRAPTPRKPFHV  86
            RLQS+ENRAPTPRKPFHV
Sbjct  693  RLQSMENRAPTPRKPFHV  710



>ref|XP_004486044.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=610

 Score =   222 bits (566),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 193/263 (73%), Gaps = 8/263 (3%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESS-SQVMERGTRQLDSG--LEHI  695
            L+ D  S+  N+SL  QF +EE  ++  ++ K S+DESS  Q  +  T Q D G  +   
Sbjct  351  LVEDSGSLPTNISLHSQFDHEEAFNVHDRIGKHSEDESSFPQAADGRTNQNDPGHQMNTR  410

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAK  515
             +KT  E+   +  SG+ +  K  G GN  L+SD   F E+     +S    +Y  YE K
Sbjct  411  GAKTNIEQPVLV--SGD-SLQKNLGFGNSLLESDHESFPENSKSGSLSTASNIYDYYETK  467

Query  514  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  335
            +++L+RK G+LE QL AA+AS+EA++K+L+SA KS+Q+ + KL D +KEI+LL+EKLAG 
Sbjct  468  VSSLIRKFGILEAQLLAAIASKEASEKNLASAFKSRQEMDNKLTDTLKEIELLREKLAGA  527

Query  334  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  155
            ELAQE+A++LSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEV
Sbjct  528  ELAQEDASNLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEV  587

Query  154  FHLKQRLQSLENRAPTPRKPFHV  86
            FHLKQRLQS+ENRAPTPRKPFHV
Sbjct  588  FHLKQRLQSMENRAPTPRKPFHV  610



>ref|XP_006597533.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=711

 Score =   224 bits (571),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 193/263 (73%), Gaps = 8/263 (3%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETS--LKMPKSSDDESS-SQVMERGTRQLD--SGLEHI  695
            L+ D NS+  N+SLR+QF ++EE +  +++ K S+DESS  +  +  T Q D  + +   
Sbjct  452  LVQDSNSLPTNISLRRQFDHDEECNADVRIDKHSEDESSFPRAADHKTNQNDPRNHMSRS  511

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAK  515
             +KT  EE  ++  S N    K  G GN  L+SDD  F E+     +SA   ++  YE K
Sbjct  512  GAKTNMEEQVSVSRSSN---QKNLGFGNPVLESDDVSFPENSKSGSLSAASDIHHYYETK  568

Query  514  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  335
            + +L+RK G+LEGQLA ALASREA++KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   
Sbjct  569  VASLMRKFGILEGQLAVALASREASEKSLASAFKSRQEMERKLADTLKEMELLREKLVSA  628

Query  334  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  155
            EL QEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RAFQLQVEV
Sbjct  629  ELVQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRAFQLQVEV  688

Query  154  FHLKQRLQSLENRAPTPRKPFHV  86
            FHLKQRLQS+E RAPTPRKPF V
Sbjct  689  FHLKQRLQSMEKRAPTPRKPFQV  711



>ref|XP_003550179.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Glycine max]
Length=708

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 195/267 (73%), Gaps = 16/267 (6%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSG--LEHID  692
            L+ DPN    N SLRKQF ++EE  T LKM K+SD+ S  + ++  T + D G  +    
Sbjct  448  LVVDPNFPPTNTSLRKQFDHDEEYNTDLKMDKNSDENSFPRAVDHRTNENDHGKQMNSSG  507

Query  691  SKTIPEE----ICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSY  524
            +K I EE    +  IP   N+         N  L+SD+  F E + K G      +Y  Y
Sbjct  508  AKNITEEQQALLSGIPIQQNLVFE------NDMLESDNVSFTE-NIKSGSLTTSNVYHCY  560

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            E+KL +L+RKNG+LEGQLAA+LAS+EAA+KSL+S LKS+Q+ E+KLA++ KE++L++EKL
Sbjct  561  ESKLASLIRKNGILEGQLAASLASKEAAEKSLASVLKSRQEMERKLAESHKEMELMREKL  620

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
              +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERARAFQLQ
Sbjct  621  TSLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERARAFQLQ  680

Query  163  VEVFHLKQRLQSLENRAP-TPRKPFHV  86
             EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  681  YEVFHLKQRLQSMENRASTTPRKPFHV  707



>ref|XP_006597532.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
 gb|KHN33131.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 152/267 (57%), Positives = 193/267 (72%), Gaps = 12/267 (4%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETS--LKMPKSSDDESSS-----QVMERGTRQLD--SG  707
            L+ D NS+  N+SLR+QF ++EE +  +++ K S+DESS      Q  +  T Q D  + 
Sbjct  452  LVQDSNSLPTNISLRRQFDHDEECNADVRIDKHSEDESSFPRNSLQAADHKTNQNDPRNH  511

Query  706  LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQS  527
            +    +KT  EE  ++  S N    K  G GN  L+SDD  F E+     +SA   ++  
Sbjct  512  MSRSGAKTNMEEQVSVSRSSN---QKNLGFGNPVLESDDVSFPENSKSGSLSAASDIHHY  568

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            YE K+ +L+RK G+LEGQLA ALASREA++KSL+SA KS+Q+ E+KLAD +KE++LL+EK
Sbjct  569  YETKVASLMRKFGILEGQLAVALASREASEKSLASAFKSRQEMERKLADTLKEMELLREK  628

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            L   EL QEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RAFQL
Sbjct  629  LVSAELVQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRAFQL  688

Query  166  QVEVFHLKQRLQSLENRAPTPRKPFHV  86
            QVEVFHLKQRLQS+E RAPTPRKPF V
Sbjct  689  QVEVFHLKQRLQSMEKRAPTPRKPFQV  715



>ref|XP_004486293.1| PREDICTED: uncharacterized protein LOC101494304 [Cicer arietinum]
Length=201

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  646  NMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqla  467
            +++  K  G GN  L+SD   F E+     +S    +Y  YE K+++L+RK G+LE QL 
Sbjct  15   DISLQKNLGFGNSLLESDHESFPENSKSGSLSTASNIYDYYETKVSSLIRKFGILEAQLL  74

Query  466  aalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHS  287
            AA+AS+EA++K+L+SA KS+Q+ + KL D +KEI+LL+EKLAG ELAQE+A++LSNIVHS
Sbjct  75   AAIASKEASEKNLASAFKSRQEMDNKLTDTLKEIELLREKLAGAELAQEDASNLSNIVHS  134

Query  286  DNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPT  107
            DNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPT
Sbjct  135  DNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPT  194

Query  106  PRKPFHV  86
            PRKPFHV
Sbjct  195  PRKPFHV  201



>gb|KHN03383.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=736

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 195/267 (73%), Gaps = 16/267 (6%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSG--LEHID  692
            L+ DPN    N SLRKQF ++EE  T LKM K+SD+ S  + ++  T + D G  +    
Sbjct  476  LVVDPNFPPTNTSLRKQFDHDEEYNTDLKMDKNSDENSFPRAVDHRTNENDHGKQMNSSG  535

Query  691  SKTIPEE----ICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSY  524
            +K I EE    +  IP   N+         N  L+SD+  F E + K G      +Y  Y
Sbjct  536  AKNITEEQQALLSGIPIQQNLVFE------NDMLESDNVSFTE-NIKSGSLTTSNVYHCY  588

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            E+KL +L+RKNG+LEGQLAA+LAS+EAA+KSL+S LKS+Q+ E+KLA++ KE++L++EKL
Sbjct  589  ESKLASLIRKNGILEGQLAASLASKEAAEKSLASVLKSRQEMERKLAESHKEMELMREKL  648

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
              +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERARAFQLQ
Sbjct  649  TSLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERARAFQLQ  708

Query  163  VEVFHLKQRLQSLENRAP-TPRKPFHV  86
             EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  709  YEVFHLKQRLQSMENRASTTPRKPFHV  735



>ref|XP_004486043.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=709

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 193/263 (73%), Gaps = 8/263 (3%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESS-SQVMERGTRQLDSG--LEHI  695
            L+ D  S+  N+SL  QF +EE  ++  ++ K S+DESS  Q  +  T Q D G  +   
Sbjct  450  LVEDSGSLPTNISLHSQFDHEEAFNVHDRIGKHSEDESSFPQAADGRTNQNDPGHQMNTR  509

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAK  515
             +KT  E+   +  SG+ +  K  G GN  L+SD   F E+     +S    +Y  YE K
Sbjct  510  GAKTNIEQPVLV--SGD-SLQKNLGFGNSLLESDHESFPENSKSGSLSTASNIYDYYETK  566

Query  514  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  335
            +++L+RK G+LE QL AA+AS+EA++K+L+SA KS+Q+ + KL D +KEI+LL+EKLAG 
Sbjct  567  VSSLIRKFGILEAQLLAAIASKEASEKNLASAFKSRQEMDNKLTDTLKEIELLREKLAGA  626

Query  334  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  155
            ELAQE+A++LSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEV
Sbjct  627  ELAQEDASNLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEV  686

Query  154  FHLKQRLQSLENRAPTPRKPFHV  86
            FHLKQRLQS+ENRAPTPRKPFHV
Sbjct  687  FHLKQRLQSMENRAPTPRKPFHV  709



>ref|XP_007154239.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
 gb|ESW26233.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
Length=709

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 155/266 (58%), Positives = 196/266 (74%), Gaps = 15/266 (6%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSG--LEHID  692
            L+ DPN    N SLRKQF ++EE  T LKM K+SD+ S  +  +  T +   G  +    
Sbjct  450  LVVDPNFPPTNTSLRKQFDHDEEYNTDLKMDKNSDESSFPRSGDHRTNENHHGKQMNTCG  509

Query  691  SKTIPEE---ICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYE  521
            +KT  EE   +  IP   N+    +      P +SD+  F E++    +S+   +Y  YE
Sbjct  510  TKTNIEEQAMLSGIPNQQNLVFENE-----MP-ESDNLSFSENNKSASLSSS-NVYHYYE  562

Query  520  AKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLA  341
            +K+ +L+RKNG+LEGQLAA+LAS+EAA+KSL+S LKS+Q+ E+KLADA KE++L++EKLA
Sbjct  563  SKVASLIRKNGILEGQLAASLASKEAAEKSLTSVLKSRQEMERKLADAHKEMELMREKLA  622

Query  340  GVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQV  161
             +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERARAFQLQ 
Sbjct  623  SLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERARAFQLQY  682

Query  160  EVFHLKQRLQSLENRAP-TPRKPFHV  86
            EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  683  EVFHLKQRLQSMENRASTTPRKPFHV  708



>ref|XP_009120961.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Brassica 
rapa]
Length=700

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 151/262 (58%), Positives = 189/262 (72%), Gaps = 18/262 (7%)
 Frame = -1

Query  856  LSDP-NSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSK  686
             +DP N  +GNVSLRKQF  EEE    ++ P  S +E      E+ T +   G   I ++
Sbjct  452  FADPRNPSSGNVSLRKQFSTEEEYRAVIEPPAKSPEE------EKITDEDSGGGAKITAE  505

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLD--SDDFVFQESDCKFGISAPIGLYQSYEAKL  512
                   T+    +   HK Q S  FP     D  +F E D      +   +YQ +EAK+
Sbjct  506  K------TLSTVSDRELHK-QSSEPFPFAHIDDALIFPEMDNATLAPSSSSVYQFHEAKM  558

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
            TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DA+++++LLKEKL G+E
Sbjct  559  TALIRRNGVLEGQLEAALAGREAAERNVSVALRSKQETDKKLSDALRDVELLKEKLTGLE  618

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  152
            L+Q+EANSLSN+VHSDNVRLEHDVAFL+AVLDDTQKEL STRG+L GERARAFQLQVEVF
Sbjct  619  LSQDEANSLSNMVHSDNVRLEHDVAFLRAVLDDTQKELQSTRGVLAGERARAFQLQVEVF  678

Query  151  HLKQRLQSLENRAPTPRKPFHV  86
            HLKQRLQSLENRA TPRKPFHV
Sbjct  679  HLKQRLQSLENRAATPRKPFHV  700



>emb|CDX92598.1| BnaA10g16370D [Brassica napus]
Length=700

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 149/257 (58%), Positives = 186/257 (72%), Gaps = 17/257 (7%)
 Frame = -1

Query  844  NSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEE  671
            N  +GNVSLRKQF  EEE    ++ P  S +E      E+ T +   G   I ++     
Sbjct  457  NPSSGNVSLRKQFSTEEEYRAVIEPPAKSLEE------EKITDEDSGGGAKITAEK----  506

Query  670  ICTIPESGNMATHKKQGSGNFPLD--SDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  497
              T+    +   HK   S +FP     D  +F E D      +   +YQ +EAK+TAL+R
Sbjct  507  --TLSTVSDRELHKPP-SESFPFAHIDDALIFPEMDNATLAPSSSSVYQFHEAKMTALIR  563

Query  496  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  317
            +NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DA++++DLLKEKL G+EL+Q+E
Sbjct  564  RNGVLEGQLEAALAGREAAERNVSVALRSKQETDKKLSDALRDVDLLKEKLTGLELSQDE  623

Query  316  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  137
            ANSLSN+VHSDNVRLEHDVAFL+AVLDDTQKEL STRG+L GERARAFQLQVEVFHLKQR
Sbjct  624  ANSLSNMVHSDNVRLEHDVAFLRAVLDDTQKELQSTRGVLAGERARAFQLQVEVFHLKQR  683

Query  136  LQSLENRAPTPRKPFHV  86
            LQSLENRA TPRKPFHV
Sbjct  684  LQSLENRAATPRKPFHV  700



>ref|XP_002315566.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
 gb|EEF01737.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
Length=663

 Score =   216 bits (549),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 169/258 (66%), Gaps = 55/258 (21%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTI  680
            LL DPNS +GNVS RK F+++EE +                 +  + LD           
Sbjct  460  LLVDPNSASGNVSRRKDFHHKEENT--------------TAAKTAKNLD-----------  494

Query  679  PEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALL  500
                                 GNF           SDC  G  A   +Y+ YE K+ AL 
Sbjct  495  ---------------------GNFA--------SLSDCTTG-GARASIYRLYETKIAALT  524

Query  499  RKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQE  320
            RKN +LEGQLAAA   REAA+K++SSALKS+Q+ EKKL D ++E++LLKEKLA VELAQE
Sbjct  525  RKNRVLEGQLAAAFIGREAAEKNVSSALKSRQEMEKKLVDTVREMELLKEKLACVELAQE  584

Query  319  EANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQ  140
            EANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+EVFHLKQ
Sbjct  585  EANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQIEVFHLKQ  644

Query  139  RLQSLENRAPTPRKPFHV  86
            RLQS+ENR PTPRKPFHV
Sbjct  645  RLQSMENRTPTPRKPFHV  662



>emb|CDY13903.1| BnaC09g39230D [Brassica napus]
Length=674

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 141/252 (56%), Positives = 175/252 (69%), Gaps = 40/252 (16%)
 Frame = -1

Query  835  TGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEICTIP  656
            +GNVSLRKQF  EEE                                        + T+ 
Sbjct  461  SGNVSLRKQFSTEEEY-------------------------------------RAVKTLS  483

Query  655  ESGNMATHKKQGSGNFPLD--SDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgll  482
               +   H KQ S +FP     D  +F E D    +++   +YQ +EAK+TAL+R+NG+L
Sbjct  484  TVSDRELH-KQTSESFPFAHIDDALIFPEMDNAATLASSSSVYQFHEAKMTALIRRNGIL  542

Query  481  egqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLS  302
            EGQL AALA REAA++++S AL+SKQ+++KKL+DA+++++LLKEKL G+ELAQ+EANSLS
Sbjct  543  EGQLEAALAGREAAERNVSVALRSKQESDKKLSDALRDVELLKEKLTGLELAQDEANSLS  602

Query  301  NIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLE  122
            N+VHSDNVRLEHDVAFL+AVLDDTQKEL STRG+L GERARAFQLQVEVFHLKQRLQSLE
Sbjct  603  NMVHSDNVRLEHDVAFLRAVLDDTQKELQSTRGVLAGERARAFQLQVEVFHLKQRLQSLE  662

Query  121  NRAPTPRKPFHV  86
            NRA TPRKPFHV
Sbjct  663  NRAATPRKPFHV  674



>gb|KJB72597.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=606

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  559  GISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLAD  380
             +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK AD
Sbjct  449  ALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFAD  508

Query  379  AMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGL  200
            AMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+
Sbjct  509  AMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGV  568

Query  199  LGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  569  LAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  606



>gb|KHN02994.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 152/267 (57%), Positives = 196/267 (73%), Gaps = 11/267 (4%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSG--LEHID  692
            L+ DPN    N SLRKQF ++EE  T LKM K+SD+ S  + ++  T + D G  +   +
Sbjct  450  LVVDPNFPPTNTSLRKQFDHDEEYNTDLKMDKNSDERSFPRAVDHRTNKDDHGKQMNTSE  509

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQES---DCKFGISAPIGLYQSYE  521
             KT  EE  T+  SG +         + P +SD+ +F E+   +   G      +Y  YE
Sbjct  510  VKTNMEEQQTLL-SGILNQQNLVFENDMP-ESDNLLFSENINININSGSLTTSNVYYYYE  567

Query  520  AKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLA  341
            +KL +L+RKNG+LEGQLAA++AS+EAA+KSL+S LKS+Q+ ++KL ++ KE++L++EKLA
Sbjct  568  SKLASLIRKNGILEGQLAASIASKEAAEKSLTSVLKSRQEMDRKLTESEKEMELMREKLA  627

Query  340  GVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQV  161
            G+ELAQEE N+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERARAFQLQ 
Sbjct  628  GLELAQEETNNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERARAFQLQY  687

Query  160  EVFHLKQRLQSLE-NRAP-TPRKPFHV  86
            EVFHLKQRLQS+E NRA  TPRKPFHV
Sbjct  688  EVFHLKQRLQSMEKNRASTTPRKPFHV  714



>ref|XP_006594495.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
Length=710

 Score =   207 bits (528),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 190/263 (72%), Gaps = 8/263 (3%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEE--ETSLKMPKSSDDESS-SQVMERGTRQLD--SGLEHI  695
            L+   +S+  N+SLR+QF ++E     +++ K S+D+SS ++  +  T Q D  + +   
Sbjct  451  LVEYSDSLPTNISLRRQFDHDEGYNADVRIGKHSEDKSSLTRAADHRTNQNDPRNHMSRN  510

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAK  515
             +KT  EE   +  S N    +  G GN  L+SDD  F ++     +S    ++  YE K
Sbjct  511  GAKTNMEEQVLVSGSSN---QQNLGFGNPLLESDDVSFPDNSKLGSLSTDSNIHHYYETK  567

Query  514  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  335
            + +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   
Sbjct  568  VASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMERKLADTLKEMELLREKLVNA  627

Query  334  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  155
            ELAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RA QLQVEV
Sbjct  628  ELAQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRALQLQVEV  687

Query  154  FHLKQRLQSLENRAPTPRKPFHV  86
            FHLKQRLQS+ENR PTPRKPF V
Sbjct  688  FHLKQRLQSMENRVPTPRKPFQV  710



>ref|XP_009393228.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393229.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
Length=730

 Score =   208 bits (529),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -1

Query  577  ESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDT  398
            E+D +  ++ P  +YQ YE K+ +L RKN LLE QL AAL  REAA+K+LSSA+KSKQ+ 
Sbjct  542  ETDGRSVLTNPSNIYQLYETKIASLTRKNVLLEEQLKAALTCREAAEKNLSSAVKSKQEV  601

Query  397  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  218
            E KLAD +KE++LLKEKLAGVELAQEEANSLSNIVHS NVRLEHDVAFLKA+LDDTQKEL
Sbjct  602  ETKLADTVKEVELLKEKLAGVELAQEEANSLSNIVHSHNVRLEHDVAFLKAILDDTQKEL  661

Query  217  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV*SSIL  71
            +STRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  + + +L
Sbjct  662  YSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPIQICNDVL  710



>gb|KHN47303.1| hypothetical protein glysoja_020171 [Glycine soja]
Length=261

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 156/202 (77%), Gaps = 3/202 (1%)
 Frame = -1

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  512
            +KT  EE   +  S N    +  G GN  L+SDD  F ++     +S    ++  YE K+
Sbjct  63   AKTNMEEQVLVSGSSN---QQNLGFGNPLLESDDVSFPDNSKLGSLSTDSNIHHYYETKV  119

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
             +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   E
Sbjct  120  ASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMERKLADTLKEMELLREKLVNAE  179

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  152
            LAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RA QLQVEVF
Sbjct  180  LAQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRALQLQVEVF  239

Query  151  HLKQRLQSLENRAPTPRKPFHV  86
            HLKQRLQS+ENR PTPRKPF V
Sbjct  240  HLKQRLQSMENRVPTPRKPFQV  261



>gb|AES91804.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=711

 Score =   206 bits (523),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 152/259 (59%), Positives = 188/259 (73%), Gaps = 15/259 (6%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEETS--LKMPKSSDDESSSQVMERGTRQLDS-GLEHIDSKTI  680
            DPN    NVSLRKQF  +EE +  +KM K+SD  S  QV +  T + D   L +I    +
Sbjct  463  DPNYPPSNVSLRKQFDRDEEYNADVKMDKNSDGSSLPQVADHRTNENDRRKLMNISGAKV  522

Query  679  PEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALL  500
              E   +  SG M+  + Q   +  L+S+   F E+D K G  +   +YQ YE+K+ AL+
Sbjct  523  NIE-GQVLLSG-MSNQQNQVFESDALESEVVSFPEND-KSGSLSSTNIYQYYESKVAALI  579

Query  499  RKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQE  320
            RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQE
Sbjct  580  RKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMELLREKLAGLELAQE  639

Query  319  EANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQ  140
            EAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERARAFQL        Q
Sbjct  640  EANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERARAFQL--------Q  691

Query  139  RLQSLENR-APTPRKPFHV  86
            RLQS+ENR + TPRKPFHV
Sbjct  692  RLQSMENRTSTTPRKPFHV  710



>ref|XP_003609607.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=735

 Score =   206 bits (523),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 152/259 (59%), Positives = 188/259 (73%), Gaps = 15/259 (6%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEETS--LKMPKSSDDESSSQVMERGTRQLDS-GLEHIDSKTI  680
            DPN    NVSLRKQF  +EE +  +KM K+SD  S  QV +  T + D   L +I    +
Sbjct  487  DPNYPPSNVSLRKQFDRDEEYNADVKMDKNSDGSSLPQVADHRTNENDRRKLMNISGAKV  546

Query  679  PEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALL  500
              E   +  SG M+  + Q   +  L+S+   F E+D K G  +   +YQ YE+K+ AL+
Sbjct  547  NIE-GQVLLSG-MSNQQNQVFESDALESEVVSFPEND-KSGSLSSTNIYQYYESKVAALI  603

Query  499  RKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQE  320
            RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQE
Sbjct  604  RKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMELLREKLAGLELAQE  663

Query  319  EANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQ  140
            EAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERARAFQL        Q
Sbjct  664  EANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERARAFQL--------Q  715

Query  139  RLQSLENR-APTPRKPFHV  86
            RLQS+ENR + TPRKPFHV
Sbjct  716  RLQSMENRTSTTPRKPFHV  734



>gb|AES64218.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=699

 Score =   204 bits (518),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 145/260 (56%), Positives = 189/260 (73%), Gaps = 6/260 (2%)
 Frame = -1

Query  853  SDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESS-SQVMERGTRQLDSGLE-HIDSK  686
            S+  S++ ++ +  QF ++EE +   ++ +  +DESS  Q  ++ T Q D G + H    
Sbjct  441  SERKSLSESLFVHSQFDHDEEFNEDDRIDRHLEDESSFPQAADQRTNQNDPGHQMHTRGA  500

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTA  506
             I  E   +  SG+ +  K  G GN  ++SD     E+     +S    +Y  YE K+++
Sbjct  501  KINMEE-QVLASGD-SFRKNLGFGNPVVESDHGSLPENINSGSLSTASNIYNYYETKVSS  558

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L+ K G+LE QLAA+LAS+EAA+K+L+SA KSKQ+ +K +AD ++EI+LL+EKL G ELA
Sbjct  559  LITKFGILEAQLAASLASKEAAEKNLASAFKSKQEMDKTMADTLQEIELLREKLVGAELA  618

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
            QEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHL
Sbjct  619  QEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHL  678

Query  145  KQRLQSLENRAPTPRKPFHV  86
            KQRLQS+ENRAPTPRKPFHV
Sbjct  679  KQRLQSMENRAPTPRKPFHV  698



>ref|XP_003593967.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=764

 Score =   203 bits (516),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  631  KKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  452
            K  G GN  ++SD     E+     +S    +Y  YE K+++L+ K G+LE QLAA+LAS
Sbjct  582  KNLGFGNPVVESDHGSLPENINSGSLSTASNIYNYYETKVSSLITKFGILEAQLAASLAS  641

Query  451  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  272
            +EAA+K+L+SA KSKQ+ +K +AD ++EI+LL+EKL G ELAQEEAN+LSNIVHSDNVRL
Sbjct  642  KEAAEKNLASAFKSKQEMDKTMADTLQEIELLREKLVGAELAQEEANNLSNIVHSDNVRL  701

Query  271  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  92
            EHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  702  EHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  761

Query  91   HV  86
            HV
Sbjct  762  HV  763



>ref|XP_009402527.1| PREDICTED: kelch repeat-containing protein 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=733

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 137/279 (49%), Positives = 177/279 (63%), Gaps = 22/279 (8%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLDSGLEHIDSKT  683
            LSD   V+ ++S RK F+ +++  L  K+ +  +DE  +   +       S   H+ S  
Sbjct  455  LSDDPCVSTDISCRKLFHQDQDFGLATKVQRPLEDEKYTNDGQLMLNNPSSKKMHVFSNC  514

Query  682  ---------IPEEICTIP--------ESGNMATHKKQGSGNFPLDSDD---FVFQESDCK  563
                     I  ++  I         ESG    H K G G   L +D    F        
Sbjct  515  QRSKRQQPEIKMDVAGIQDSMEKMHVESGGTTVHHKHGIGISSLTADAEHLFPLGVDGGG  574

Query  562  FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLA  383
              ++ P  +YQ YE K  +L RKN LLE QL AA  SRE A+++LS  ++ KQD E+KLA
Sbjct  575  LVLTNPTDVYQVYETKTASLTRKNVLLEEQLKAATTSREIAERNLSCTVERKQDRERKLA  634

Query  382  DAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG  203
            DA++E++LLK+K+AG+E+AQEEAN LSNI HSDNVRLEHDVAFLKA+L+DTQKELHSTRG
Sbjct  635  DALREVELLKDKVAGMEVAQEEANGLSNIGHSDNVRLEHDVAFLKAILEDTQKELHSTRG  694

Query  202  LLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            +L GERARAFQLQVEVFHLKQRLQS ++RAPTPRKPF +
Sbjct  695  VLAGERARAFQLQVEVFHLKQRLQSGDHRAPTPRKPFQM  733



>ref|XP_006594496.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=699

 Score =   200 bits (509),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 187/263 (71%), Gaps = 19/263 (7%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEE--ETSLKMPKSSDDESS-SQVMERGTRQLD--SGLEHI  695
            L+   +S+  N+SLR+QF ++E     +++ K S+D+SS ++  +  T Q D  + +   
Sbjct  451  LVEYSDSLPTNISLRRQFDHDEGYNADVRIGKHSEDKSSLTRAADHRTNQNDPRNHMSRN  510

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAK  515
             +KT            NM   +  G GN  L+SDD  F ++     +S    ++  YE K
Sbjct  511  GAKT------------NM--EQNLGFGNPLLESDDVSFPDNSKLGSLSTDSNIHHYYETK  556

Query  514  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  335
            + +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   
Sbjct  557  VASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMERKLADTLKEMELLREKLVNA  616

Query  334  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  155
            ELAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RA QLQVEV
Sbjct  617  ELAQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRALQLQVEV  676

Query  154  FHLKQRLQSLENRAPTPRKPFHV  86
            FHLKQRLQS+ENR PTPRKPF V
Sbjct  677  FHLKQRLQSMENRVPTPRKPFQV  699



>ref|XP_011005544.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score =   196 bits (499),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 171/237 (72%), Gaps = 6/237 (3%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSGLEHID--  692
            LL DPNS +GNVS  K F+++EE  T+ K+ K+ D   +S   E      D  ++  +  
Sbjct  460  LLVDPNSASGNVSRHKDFHHKEENTTAGKIAKNLDGNFASLATELQRNHSDVSVQPSNPV  519

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  512
             K   EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+
Sbjct  520  GKIHAEEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKI  577

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
             AL RKN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VE
Sbjct  578  AALTRKNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVE  637

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQV  161
            LAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+
Sbjct  638  LAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQL  694



>ref|XP_011015380.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score =   196 bits (499),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 170/237 (72%), Gaps = 6/237 (3%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSGLEHID--  692
            LL DPNS +GNVS  K F+++EE  T+ K  K+ D   +S   E      D  ++  +  
Sbjct  460  LLVDPNSASGNVSRHKDFHHKEENTTAAKTAKNLDGNFASLATELQRNHSDVSVQPSNPV  519

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  512
             K   EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+
Sbjct  520  GKIHAEEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKI  577

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
             AL RKN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VE
Sbjct  578  AALTRKNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVE  637

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQV  161
            LAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+
Sbjct  638  LAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQL  694



>ref|XP_004508300.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Cicer arietinum]
Length=690

 Score =   194 bits (494),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 132/266 (50%), Positives = 177/266 (67%), Gaps = 15/266 (6%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE----TSLKMPKSSDDESSSQVMERGT----RQLDSGL  704
            L+ DPN +  N+    QF ++EE    T  KM K+S + S  Q           Q++ G 
Sbjct  431  LVVDPNCLRSNIFFCNQFDHDEEYNYNTYTKMDKNSKESSLPQAAVETNAIHGNQMNIGE  490

Query  703  EHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSY  524
              ID   + E+   + E   +   + Q S +  L+SD  +F E + K G      +Y  Y
Sbjct  491  AKID---MEEQQMLVSE---ILNQQNQISESNTLESDSELFPE-NSKAGSFFNTNIYHYY  543

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            E+++TAL +KN +LE QL A+LAS + A K+L S L+S+Q+ E+KL+D +KE+++++EKL
Sbjct  544  ESEVTALTKKNTILEAQLVASLASEDTATKNLESILRSRQEIEEKLSDTLKEMEVMREKL  603

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
            A +EL QEE N+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++  ER RAFQLQ
Sbjct  604  ASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVVARERGRAFQLQ  663

Query  163  VEVFHLKQRLQSLENRAPTPRKPFHV  86
             E FHL QRLQS+EN+A TPRKPFHV
Sbjct  664  CEAFHLNQRLQSMENQASTPRKPFHV  689



>ref|XP_010098333.1| hypothetical protein L484_023581 [Morus notabilis]
 gb|EXB74837.1| hypothetical protein L484_023581 [Morus notabilis]
Length=674

 Score =   194 bits (493),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 160/216 (74%), Gaps = 6/216 (3%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLDSGLEH--IDS  689
            L DPNSVT N+SLRKQF+NEEE  T++KM K+ D+ S SQ  E    Q DSG     +  
Sbjct  454  LIDPNSVTSNISLRKQFHNEEEYNTAIKMAKAEDESSFSQAAEHKISQSDSGTRTSTVGG  513

Query  688  KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKL  512
            K   E++  + E  N+  H  QGS N P+DS D VF  +D K G + AP  + Q YE K+
Sbjct  514  KLCTEDMVAVYEPENLNPHN-QGSANLPVDSSDSVFPVNDIKLGSVPAPSSVSQFYETKI  572

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
            T L+RKN +LEGQLAAA ASREA +K+LSSALKSKQ+ EKKLA+ MK ++LLKEKLAGVE
Sbjct  573  TQLIRKNAILEGQLAAAFASREAVEKNLSSALKSKQEMEKKLAEMMKGMELLKEKLAGVE  632

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  224
            LAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQK
Sbjct  633  LAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQK  668



>ref|XP_004508299.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Cicer arietinum]
Length=716

 Score =   194 bits (493),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 132/266 (50%), Positives = 177/266 (67%), Gaps = 15/266 (6%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE----TSLKMPKSSDDESSSQVMERGT----RQLDSGL  704
            L+ DPN +  N+    QF ++EE    T  KM K+S + S  Q           Q++ G 
Sbjct  457  LVVDPNCLRSNIFFCNQFDHDEEYNYNTYTKMDKNSKESSLPQAAVETNAIHGNQMNIGE  516

Query  703  EHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSY  524
              ID   + E+   + E   +   + Q S +  L+SD  +F E + K G      +Y  Y
Sbjct  517  AKID---MEEQQMLVSE---ILNQQNQISESNTLESDSELFPE-NSKAGSFFNTNIYHYY  569

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            E+++TAL +KN +LE QL A+LAS + A K+L S L+S+Q+ E+KL+D +KE+++++EKL
Sbjct  570  ESEVTALTKKNTILEAQLVASLASEDTATKNLESILRSRQEIEEKLSDTLKEMEVMREKL  629

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
            A +EL QEE N+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++  ER RAFQLQ
Sbjct  630  ASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVVARERGRAFQLQ  689

Query  163  VEVFHLKQRLQSLENRAPTPRKPFHV  86
             E FHL QRLQS+EN+A TPRKPFHV
Sbjct  690  CEAFHLNQRLQSMENQASTPRKPFHV  715



>ref|XP_004508297.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=782

 Score =   194 bits (492),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 132/266 (50%), Positives = 177/266 (67%), Gaps = 15/266 (6%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEE----TSLKMPKSSDDESSSQVMERGT----RQLDSGL  704
            L+ DPN +  N+    QF ++EE    T  KM K+S + S  Q           Q++ G 
Sbjct  523  LVVDPNCLRSNIFFCNQFDHDEEYNYNTYTKMDKNSKESSLPQAAVETNAIHGNQMNIGE  582

Query  703  EHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSY  524
              ID   + E+   + E   +   + Q S +  L+SD  +F E + K G      +Y  Y
Sbjct  583  AKID---MEEQQMLVSE---ILNQQNQISESNTLESDSELFPE-NSKAGSFFNTNIYHYY  635

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            E+++TAL +KN +LE QL A+LAS + A K+L S L+S+Q+ E+KL+D +KE+++++EKL
Sbjct  636  ESEVTALTKKNTILEAQLVASLASEDTATKNLESILRSRQEIEEKLSDTLKEMEVMREKL  695

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
            A +EL QEE N+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++  ER RAFQLQ
Sbjct  696  ASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVVARERGRAFQLQ  755

Query  163  VEVFHLKQRLQSLENRAPTPRKPFHV  86
             E FHL QRLQS+EN+A TPRKPFHV
Sbjct  756  CEAFHLNQRLQSMENQASTPRKPFHV  781



>ref|XP_004508298.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=776

 Score =   194 bits (492),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 173/260 (67%), Gaps = 9/260 (3%)
 Frame = -1

Query  859  LLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTR--QLDSGLEHIDSK  686
            L+ DPN +  N+    QF ++EE +       D  S + V        Q++ G   ID  
Sbjct  523  LVVDPNCLRSNIFFCNQFDHDEEYNYNTYTKMDKNSKAAVETNAIHGNQMNIGEAKID--  580

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTA  506
             + E+   + E   +   + Q S +  L+SD  +F E + K G      +Y  YE+++TA
Sbjct  581  -MEEQQMLVSE---ILNQQNQISESNTLESDSELFPE-NSKAGSFFNTNIYHYYESEVTA  635

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L +KN +LE QL A+LAS + A K+L S L+S+Q+ E+KL+D +KE+++++EKLA +EL 
Sbjct  636  LTKKNTILEAQLVASLASEDTATKNLESILRSRQEIEEKLSDTLKEMEVMREKLASLELT  695

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
            QEE N+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++  ER RAFQLQ E FHL
Sbjct  696  QEEVNNLSNVVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVVARERGRAFQLQCEAFHL  755

Query  145  KQRLQSLENRAPTPRKPFHV  86
             QRLQS+EN+A TPRKPFHV
Sbjct  756  NQRLQSMENQASTPRKPFHV  775



>ref|XP_006855461.1| hypothetical protein AMTR_s00057p00182130 [Amborella trichopoda]
 gb|ERN16928.1| hypothetical protein AMTR_s00057p00182130 [Amborella trichopoda]
Length=692

 Score =   188 bits (477),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 146/267 (55%), Positives = 187/267 (70%), Gaps = 18/267 (7%)
 Frame = -1

Query  844  NSVTGNVSLRKQFYNEEETS-LKMPKSSDDE---------SSSQVMERGTRQLDSGLEHI  695
            ++V+GNVSLRKQ + E+  S L++ ++  D          + +  + +  + LD G++ +
Sbjct  430  DTVSGNVSLRKQHHEEDHNSVLQIQRNHTDTVYGEPDDLITRTATLSQKNKSLDQGVQ-V  488

Query  694  D----SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQS  527
            D    +     E+  I E  N    K   +GN   D+ D      D    + AP   +Q 
Sbjct  489  DIARAASNSEAEMLGILEPENPRNLKI--TGNLQSDNGDSS-NILDIDGKVIAPANSHQE  545

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            YE K+ AL +KNG+LEGQL+AALA REA  K+LS+ LKS+QD EKKL++++KE+++L EK
Sbjct  546  YEIKVAALQKKNGVLEGQLSAALAGREAIAKNLSAVLKSRQDIEKKLSESLKEMEVLSEK  605

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            LA  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL STRG+L GERARAFQL
Sbjct  606  LAAAELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELQSTRGVLAGERARAFQL  665

Query  166  QVEVFHLKQRLQSLENRAPTPRKPFHV  86
            QVEVFHLKQRLQS+ENRAPTPRKP+H+
Sbjct  666  QVEVFHLKQRLQSVENRAPTPRKPYHI  692



>ref|XP_007035508.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
 gb|EOY06434.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
Length=679

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 167/224 (75%), Gaps = 8/224 (4%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQLDSGLE--HIDSK  686
            D N ++GN SLRKQF+NEEE  T+ K+ K  +DESS  Q  E    Q D+ ++     +K
Sbjct  458  DQNPLSGNFSLRKQFHNEEEYNTTFKITKCLEDESSIVQATEPKPNQSDTSIQINAPGTK  517

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLT  509
               +E       G++   + +G  N P+D+D+FVF E+D K   +SAP  +YQ YE ++ 
Sbjct  518  ISSDESFLFEPEGSIP--QIEGIANVPVDNDNFVFPEADGKSAALSAPSSIYQFYETRMA  575

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
            AL RKNG+LE QLAAALASR+ ++++L+SALKSK++ EK+ AD MKE++LLKEKLAG+EL
Sbjct  576  ALSRKNGILEVQLAAALASRDTSERNLASALKSKEEMEKRFADTMKEMELLKEKLAGIEL  635

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLL  197
            AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L
Sbjct  636  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVL  679



>gb|KDO75103.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=342

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 160/217 (74%), Gaps = 9/217 (4%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQLDSGLEH---I  695
            L DPN ++GNVSL KQF NEEE  T++KM K+S+DE+S  Q  E    Q D G +    +
Sbjct  106  LVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQTTENRKNQSDLGAQTSICV  165

Query  694  DSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAK  515
                I E      E+ N      QG GNF +D+D+ +F ++D    +S P  +YQ YE+K
Sbjct  166  GKTNIDEAPLFDYENSNPLV---QGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYESK  222

Query  514  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  335
            + AL+RKNG+LEGQLAAAL +REAA+K+ SS LKS+Q+ EKKLAD++KE++LLKEKLAG+
Sbjct  223  MAALIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGL  282

Query  334  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  224
            ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK
Sbjct  283  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  319



>ref|XP_007035509.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
 gb|EOY06435.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
Length=701

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 159/217 (73%), Gaps = 8/217 (4%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQLDSGLE--HIDSK  686
            D N ++GN SLRKQF+NEEE  T+ K+ K  +DESS  Q  E    Q D+ ++     +K
Sbjct  463  DQNPLSGNFSLRKQFHNEEEYNTTFKITKCLEDESSIVQATEPKPNQSDTSIQINAPGTK  522

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLT  509
               +E       G++   + +G  N P+D+D+FVF E+D K   +SAP  +YQ YE ++ 
Sbjct  523  ISSDESFLFEPEGSIP--QIEGIANVPVDNDNFVFPEADGKSAALSAPSSIYQFYETRMA  580

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
            AL RKNG+LE QLAAALASR+ ++++L+SALKSK++ EK+ AD MKE++LLKEKLAG+EL
Sbjct  581  ALSRKNGILEVQLAAALASRDTSERNLASALKSKEEMEKRFADTMKEMELLKEKLAGIEL  640

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  218
            AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK L
Sbjct  641  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKVL  677



>ref|XP_010237468.1| PREDICTED: uncharacterized protein LOC100836074 isoform X2 [Brachypodium 
distachyon]
Length=682

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 158/251 (63%), Gaps = 38/251 (15%)
 Frame = -1

Query  832  GNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEICTI  659
            GN SLR+QF  EEE SL  K+ K  DD+    V                     +E   +
Sbjct  462  GNSSLRRQFRQEEECSLAQKLQKPIDDDKYKDV---------------------DECSEL  500

Query  658  PESGNMATHKKQGSGNFPLDSDDFVFQESDCK---FGISAPIGLYQSYEAKLTALLRKNg  488
            P  GN             L  D +   ++D K    G S+   +   Y+ K+  L+R+N 
Sbjct  501  PSIGNQK-----------LRIDAYPSPDADAKAKRLGRSSS-DINHQYDTKIANLVRRNM  548

Query  487  llegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANS  308
             LE QL+AA+AS++ A+K+LS  + SK+D EK+L +  +E++ LKEK+ G ELAQEE+N+
Sbjct  549  ALEEQLSAAMASKDEAEKNLSLVIDSKEDLEKRLVERDREVEALKEKVTGFELAQEESNN  608

Query  307  LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  128
             +N VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQLQVEVFHLKQRL +
Sbjct  609  ATNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQVEVFHLKQRLPT  668

Query  127  LENRAPTPRKP  95
            ++ R+PTPRKP
Sbjct  669  MDGRSPTPRKP  679



>ref|XP_003577276.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Brachypodium distachyon]
Length=685

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 158/251 (63%), Gaps = 38/251 (15%)
 Frame = -1

Query  832  GNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEICTI  659
            GN SLR+QF  EEE SL  K+ K  DD+    V                     +E   +
Sbjct  465  GNSSLRRQFRQEEECSLAQKLQKPIDDDKYKDV---------------------DECSEL  503

Query  658  PESGNMATHKKQGSGNFPLDSDDFVFQESDCK---FGISAPIGLYQSYEAKLTALLRKNg  488
            P  GN             L  D +   ++D K    G S+   +   Y+ K+  L+R+N 
Sbjct  504  PSIGNQK-----------LRIDAYPSPDADAKAKRLGRSSS-DINHQYDTKIANLVRRNM  551

Query  487  llegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANS  308
             LE QL+AA+AS++ A+K+LS  + SK+D EK+L +  +E++ LKEK+ G ELAQEE+N+
Sbjct  552  ALEEQLSAAMASKDEAEKNLSLVIDSKEDLEKRLVERDREVEALKEKVTGFELAQEESNN  611

Query  307  LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  128
             +N VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQLQVEVFHLKQRL +
Sbjct  612  ATNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQVEVFHLKQRLPT  671

Query  127  LENRAPTPRKP  95
            ++ R+PTPRKP
Sbjct  672  MDGRSPTPRKP  682



>ref|NP_001068393.1| Os11g0657000 [Oryza sativa Japonica Group]
 dbj|BAF28756.1| Os11g0657000, partial [Oryza sativa Japonica Group]
Length=530

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  384  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  443

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER+RAFQL
Sbjct  444  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERSRAFQL  503

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  504  QVEVFHLKQRLQTMEGRSPTPRKP  527



>gb|EEC68565.1| hypothetical protein OsI_36893 [Oryza sativa Indica Group]
Length=685

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  539  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  598

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  659  QVEVFHLKQRLQTMEGRSPTPRKP  682



>gb|EEE52499.1| hypothetical protein OsJ_34700 [Oryza sativa Japonica Group]
Length=685

 Score =   165 bits (418),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  539  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  598

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER+RAFQL
Sbjct  599  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERSRAFQL  658

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  659  QVEVFHLKQRLQTMEGRSPTPRKP  682



>ref|XP_006663088.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Oryza brachyantha]
Length=684

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  538  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  597

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            L G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER RAFQ 
Sbjct  598  LTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERTRAFQF  657

Query  166  QVEVFHLKQRLQSLENRAPTPRKPFHV  86
            Q+EVFHLKQRLQ++E R+PTPRKP ++
Sbjct  658  QLEVFHLKQRLQTMEGRSPTPRKPLNL  684



>ref|XP_006663087.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Oryza brachyantha]
Length=690

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  544  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  603

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            L G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER RAFQ 
Sbjct  604  LTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERTRAFQF  663

Query  166  QVEVFHLKQRLQSLENRAPTPRKPFHV  86
            Q+EVFHLKQRLQ++E R+PTPRKP ++
Sbjct  664  QLEVFHLKQRLQTMEGRSPTPRKPLNL  690



>ref|XP_010904792.1| PREDICTED: tip elongation aberrant protein 3-like isoform X4 
[Elaeis guineensis]
Length=705

 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 158/228 (69%), Gaps = 17/228 (7%)
 Frame = -1

Query  850  DPNSVTGNVSLRKQFYNEEET--SLKMPKSSDDE------------SSSQV---MERGTR  722
            DP+S +GNVSLRKQF++EE+   +LKM KS  D+             SSQV   ME+ ++
Sbjct  461  DPHSTSGNVSLRKQFHHEEDYNLALKMQKSPRDDKYKEGGDCLLSNPSSQVSNAMEQRSK  520

Query  721  QLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPI  542
            + ++ ++   +  +      + +S N   ++KQG+ N   DS+     E D +  ++ P 
Sbjct  521  KHETAIQMDIAGILASTEENLLDSENSNLYQKQGNNNLVSDSNHVAPPEIDNRSVLTNPS  580

Query  541  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  362
             LYQ YE K+  L RKN LLE QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE++
Sbjct  581  NLYQLYETKILTLTRKNVLLEEQLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKEVE  640

Query  361  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  218
            LLKEKLAGVELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQK L
Sbjct  641  LLKEKLAGVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKSL  688



>ref|XP_004979880.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Setaria italica]
Length=685

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            ++ ++T L+R+N  LE QL+AAL +++ A+K+LS  + SK + EK+LA+  +E++ LKEK
Sbjct  539  HDTRITTLVRRNMALEEQLSAALTTKDEAEKNLSLVIDSKDELEKRLAERDREVEALKEK  598

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            + G+ELAQEE+N+LSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGLELAQEESNNLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQR+Q++E R+PTPRKP
Sbjct  659  QVEVFHLKQRVQTMEGRSPTPRKP  682



>ref|XP_008677101.1| PREDICTED: uncharacterized protein LOC100279529 isoform X1 [Zea 
mays]
Length=695

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -1

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQLQ
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  163  VEVFHLKQRLQSLENRAP-TPRKP  95
            VEVFHLKQRLQ++E R+P  PRKP
Sbjct  669  VEVFHLKQRLQTMEGRSPAAPRKP  692



>ref|XP_003575710.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237192.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237193.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
Length=693

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y +K+T L+R+N  LE QLAAALAS++ A+K+LS  + S++  EK+LA+  KE +LLKEK
Sbjct  547  YNSKITDLIRRNAALEDQLAAALASKDQAEKNLSLVINSREQLEKRLANKGKEAELLKEK  606

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            ++G+ELAQEE+N++SN VH+DNVRLE +VAFLKA+ D+TQKELHSTR +L GE++RAFQL
Sbjct  607  ISGLELAQEESNNISNTVHADNVRLEREVAFLKAITDETQKELHSTRRVLAGEQSRAFQL  666

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ +E RA TPRKP
Sbjct  667  QVEVFHLKQRLQLVEGRAGTPRKP  690



>ref|XP_006664610.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Oryza brachyantha]
Length=698

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y AK+T L++++  LE QLA ALAS++ A+K+LS  + S++  E++LA+  KE ++LKEK
Sbjct  554  YNAKITDLIKRSSALEDQLATALASKDQAEKNLSLVINSREQLERRLANKDKEAEVLKEK  613

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKELHSTR +L GE++RAFQL
Sbjct  614  IAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKELHSTRRVLAGEQSRAFQL  673

Query  166  QVEVFHLKQRLQSLENRAPTPRKPF  92
            QVEVFHLKQRLQ +E RA TP+ P 
Sbjct  674  QVEVFHLKQRLQMVEGRAGTPKNPL  698



>dbj|BAJ86800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            +  K+T L+R+N +LE QL AALAS+E A+KSLS  +  ++  EK+LA   +E +LLKEK
Sbjct  544  HNTKITDLIRRNAVLEDQLRAALASKEQAEKSLSLVMSGREQLEKRLASRGEEAELLKEK  603

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+T+KE+HSTR  L GE++RAFQL
Sbjct  604  IAGLELAQEESNSLSNAVHADNVRLEREVAFLKAVADETRKEMHSTRRALAGEQSRAFQL  663

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  664  QVEVFHLKQRLQTAEGRSLTPRKP  687



>dbj|BAK00700.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            +  K+T L+R+N +LE QL AALAS+E A+KSLS  +  ++  EK+LA   +E +LLKEK
Sbjct  544  HNTKITDLIRRNAVLEDQLGAALASKEQAEKSLSLVMSGREQLEKRLASRGEEAELLKEK  603

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+T+KE+HSTR  L GE++RAFQL
Sbjct  604  IAGLELAQEESNSLSNAVHADNVRLEREVAFLKAVADETRKEMHSTRRALAGEQSRAFQL  663

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  664  QVEVFHLKQRLQTAEGRSLTPRKP  687



>ref|XP_002442260.1| hypothetical protein SORBIDRAFT_08g017180 [Sorghum bicolor]
 gb|EES16098.1| hypothetical protein SORBIDRAFT_08g017180 [Sorghum bicolor]
Length=620

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y  K+  L+R+N  LE QL+ ALAS++  +KSLSS + S++  EK LA+  KE ++LKEK
Sbjct  475  YNTKIADLIRRNTTLEDQLSTALASKDQLEKSLSSVIHSREQLEKMLANKDKEAEMLKEK  534

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +A +ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++RAFQL
Sbjct  535  IACLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLAGEQSRAFQL  594

Query  166  QVEVFHLKQRLQSLENRAPTPRK  98
            QVEVFHLKQRLQ LE R+ TP K
Sbjct  595  QVEVFHLKQRLQILEGRSGTPTK  617



>dbj|BAK00043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 155/257 (60%), Gaps = 42/257 (16%)
 Frame = -1

Query  844  NSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEE  671
            NS  G  SLR+QF  EEE SL  K+ K  D+     V                     ++
Sbjct  55   NSKVGGSSLRRQFRQEEECSLAQKLQKPIDNGKYKDV---------------------DD  93

Query  670  ICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG-----LYQSYEAKLTA  506
               +P      T++KQ        SD +   ++D K   +  +G     +   ++ ++  
Sbjct  94   YSELPS----FTNQKQ-------QSDTYHSPDADAK---ANRVGRNSSDINHQHDTRIAN  139

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L+R+N  LE +L+AA+ S++ A+K+LS  + +K++ EKKLA+  +E+  LKEK+ G+E A
Sbjct  140  LVRRNMALEEKLSAAMVSKDEAEKNLSLVIDTKEELEKKLAERDREVVALKEKVGGLEQA  199

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
             E++N+ SN VH+DNVRLE +VAFLKAV+D+TQKELH TRG+L GERARAFQLQVEVFHL
Sbjct  200  HEDSNNASNTVHADNVRLEREVAFLKAVMDETQKELHLTRGVLAGERARAFQLQVEVFHL  259

Query  145  KQRLQSLENRAPTPRKP  95
            KQRLQS++  +   RKP
Sbjct  260  KQRLQSMDGLSSAQRKP  276



>ref|NP_001066944.1| Os12g0538800 [Oryza sativa Japonica Group]
 gb|ABA99338.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29963.1| Os12g0538800 [Oryza sativa Japonica Group]
Length=698

 Score =   146 bits (369),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = -1

Query  397  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  218
            E++LA+  KE ++LKEK+AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKEL
Sbjct  597  ERRLANKEKEAEMLKEKIAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKEL  656

Query  217  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
            HSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  657  HSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  696



>gb|EEC69433.1| hypothetical protein OsI_38606 [Oryza sativa Indica Group]
Length=698

 Score =   146 bits (368),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = -1

Query  397  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  218
            E++LA+  KE ++LKEK+AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKEL
Sbjct  597  ERRLANKEKEAEMLKEKIAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKEL  656

Query  217  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
            HSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  657  HSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  696



>gb|AFW60227.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_572222 [Zea 
mays]
Length=716

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 122/165 (74%), Gaps = 22/165 (13%)
 Frame = -1

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL-  167
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL 
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  166  --------------------QVEVFHLKQRLQSLENRAP-TPRKP  95
                                QVEVFHLKQRLQ++E R+P  PRKP
Sbjct  669  VRPYHARLSFFFFCSCLGLCQVEVFHLKQRLQTMEGRSPAAPRKP  713



>ref|NP_001145999.1| uncharacterized protein LOC100279529 [Zea mays]
 gb|ACL53010.1| unknown [Zea mays]
Length=717

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 122/166 (73%), Gaps = 23/166 (14%)
 Frame = -1

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL-  167
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL 
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  166  ---------------------QVEVFHLKQRLQSLENRAP-TPRKP  95
                                 QVEVFHLKQRLQ++E R+P  PRKP
Sbjct  669  VRPYHARLSFFLFFCSCLGLCQVEVFHLKQRLQTMEGRSPAAPRKP  714



>ref|XP_004962833.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Setaria italica]
 ref|XP_004962834.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Setaria italica]
 ref|XP_004962835.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X3 [Setaria italica]
 ref|XP_004962836.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X4 [Setaria italica]
Length=695

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y  K+  L+R+N +LE QL AALAS++  +KSLSS + S++  EK LA   KE ++LKEK
Sbjct  548  YNTKIADLIRRNAMLEDQLVAALASKDQLEKSLSSVIHSREQLEKMLASKDKEAEILKEK  607

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++R+F L
Sbjct  608  IAGLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLVGEQSRSFHL  667

Query  166  QVEVFHLKQRLQSLENRAPTPRKPFH  89
            QVEVFHLKQRLQ LE R+ TP K  H
Sbjct  668  QVEVFHLKQRLQILEGRSGTPTKQPH  693



>ref|XP_004962837.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X5 [Setaria italica]
Length=688

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y  K+  L+R+N +LE QL AALAS++  +KSLSS + S++  EK LA   KE ++LKEK
Sbjct  541  YNTKIADLIRRNAMLEDQLVAALASKDQLEKSLSSVIHSREQLEKMLASKDKEAEILKEK  600

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++R+F L
Sbjct  601  IAGLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLVGEQSRSFHL  660

Query  166  QVEVFHLKQRLQSLENRAPTPRKPFH  89
            QVEVFHLKQRLQ LE R+ TP K  H
Sbjct  661  QVEVFHLKQRLQILEGRSGTPTKQPH  686



>ref|NP_001146281.1| uncharacterized protein LOC100279856 [Zea mays]
 gb|ACL53624.1| unknown [Zea mays]
 gb|ACN34064.1| unknown [Zea mays]
 gb|AFW56517.1| hypothetical protein ZEAMMB73_667685 [Zea mays]
Length=690

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -1

Query  556  ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADA  377
             S+ +G    Y  K+  L+R+N  LE QLA ALAS++  DKSL+S + S+   EK LA+ 
Sbjct  535  CSSDVGQSHLYNTKIADLIRRNTTLEDQLATALASKDQLDKSLASVIHSRGQLEKMLANK  594

Query  376  MKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLL  197
             KE ++LKEK+A +ELAQEE+NSLSN VH+DNVRLE +VAFLKAV  +TQKELHSTR +L
Sbjct  595  DKEAEMLKEKIACLELAQEESNSLSNTVHADNVRLEREVAFLKAVTGETQKELHSTRRVL  654

Query  196  GGERARAFQLQVEVFHLKQRLQSLENRAPTPRK  98
             GE++RAFQLQVEVFHLKQRLQ LE R+ TP K
Sbjct  655  AGEQSRAFQLQVEVFHLKQRLQILEGRSGTPNK  687



>gb|EMT26901.1| hypothetical protein F775_29769 [Aegilops tauschii]
Length=612

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 120/171 (70%), Gaps = 27/171 (16%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            ++ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + +K++ E++LA+  +E+  LKEK
Sbjct  439  HDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDTKEELERRLAERDREVVALKEK  498

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK-------------------  224
            + G+E A E++N+ SN VH+DNVRLE +VAFLKAV+D+TQK                   
Sbjct  499  VGGLEQAHEDSNNASNTVHADNVRLEREVAFLKAVMDETQKAKNNNIPVISNCTSVYAVV  558

Query  223  --------ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
                    ELHSTRG+L GERARAFQLQVEVFHLKQRLQS++ R+PT RKP
Sbjct  559  LTILPPKQELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMDGRSPTQRKP  609



>gb|AFW60226.1| hypothetical protein ZEAMMB73_572222 [Zea mays]
Length=695

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQLQ
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  163  VEVFHLK  143
            V  +H +
Sbjct  669  VRPYHAR  675



>ref|XP_002977452.1| hypothetical protein SELMODRAFT_417505 [Selaginella moellendorffii]
 gb|EFJ21456.1| hypothetical protein SELMODRAFT_417505 [Selaginella moellendorffii]
Length=652

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  406  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  227
            Q  E KL    +E++ L+ KL   EL QEE+NSLSNIVHS+N+RLEHD++FLKAVL++TQ
Sbjct  560  QSAEAKLGLVTREVEGLRRKLEASELVQEESNSLSNIVHSENLRLEHDLSFLKAVLEETQ  619

Query  226  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  128
            KELHSTRG+L  ER RAFQLQVE+F LKQ LQS
Sbjct  620  KELHSTRGVLASERTRAFQLQVELFELKQTLQS  652



>ref|XP_002975032.1| hypothetical protein SELMODRAFT_415315 [Selaginella moellendorffii]
 gb|EFJ23817.1| hypothetical protein SELMODRAFT_415315 [Selaginella moellendorffii]
Length=652

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  406  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  227
            Q  E KL    +E++ L+ KL   EL QEE+NSLSNIVHS+N+RLEHD++FLKAVL++TQ
Sbjct  560  QSAEAKLGLVTREVEGLRRKLEASELVQEESNSLSNIVHSENLRLEHDLSFLKAVLEETQ  619

Query  226  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  128
            KELHSTRG+L  ER RAFQLQVE+F LKQ LQS
Sbjct  620  KELHSTRGVLASERTRAFQLQVELFELKQTLQS  652



>gb|EMS52652.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=1002

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 108/276 (39%), Positives = 152/276 (55%), Gaps = 65/276 (24%)
 Frame = -1

Query  844  NSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEE  671
            NS  G  SLR+QF  EEE SL  K+ K  DD+    V               D   +P  
Sbjct  596  NSKVGGSSLRRQFRQEEECSLAQKLQKPIDDDKYKDVG--------------DCSELP--  639

Query  670  ICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK---FGISAPIGLYQSYEAKLTALL  500
                    + A  K++        SD +   ++D K    G S+   +   ++ K+  L+
Sbjct  640  --------SFANQKQR--------SDTYHSPDADAKTKRVGRSSS-DINHQHDTKIANLV  682

Query  499  RKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQE  320
            R+N  LE +L+AA+AS++ A+K+LS  + +K++ EK+LA+  +E+  LKEK+ G+E A E
Sbjct  683  RRNMALEEKLSAAMASKDEAEKNLSLVIDTKEELEKRLAERDREVVALKEKVGGLEQAHE  742

Query  319  EANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK---------------------------E  221
            + N+ SN VH+DNVRLE +VAFLKAV+D+TQK                           E
Sbjct  743  DLNNASNTVHADNVRLEREVAFLKAVMDETQKAKKIKIPVISHCTSVYAVALTILPPKQE  802

Query  220  LHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRA  113
             +STRG+L GERARAFQLQVEVFHLKQRLQS++ R 
Sbjct  803  FYSTRGVLAGERARAFQLQVEVFHLKQRLQSMDGRG  838



>gb|EMT25879.1| hypothetical protein F775_10881 [Aegilops tauschii]
Length=758

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 19/144 (13%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y  K+T L+R+N  LE QLAAAL S+E A+K+LS  + S++  EK+LA   KE +LLKEK
Sbjct  631  YNTKITDLIRRNAALEDQLAAALESKEQAEKNLSLVMSSREQLEKRLASRGKEAELLKEK  690

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +AG+ELAQEE+NSLSN VH+DN                   E+HSTR +L GE++R FQL
Sbjct  691  IAGLELAQEESNSLSNAVHADN-------------------EMHSTRRVLAGEQSRTFQL  731

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  732  QVEVFHLKQRLQTAEGRSGTPRKP  755



>gb|EMS62709.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=641

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 102/144 (71%), Gaps = 19/144 (13%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y  K+T L+R+N  LE QLAAALAS+E A+K+LS  + S++  EK+LA   K+ +LLKEK
Sbjct  514  YNNKITDLIRRNAALEDQLAAALASKEQAEKNLSLVMSSREQLEKRLASRGKDAELLKEK  573

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +AG+ELAQEE+NSLSN VH+DN                   E+HSTR +L GE++R FQL
Sbjct  574  IAGLELAQEESNSLSNAVHADN-------------------EMHSTRRVLAGEQSRTFQL  614

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  615  QVEVFHLKQRLQTAEGRSVTPRKP  638



>ref|XP_001759823.1| predicted protein [Physcomitrella patens]
 gb|EDQ75327.1| predicted protein [Physcomitrella patens]
Length=1020

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -1

Query  532  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  353
            QS+E KL A +R+    EGQL   L  +E A+  L+SAL+++Q TE KLA A+ +   +K
Sbjct  863  QSFEIKLAAAVRRGEQAEGQLTTVLRGKEEAENRLASALQTRQQTESKLAVALTKQAEIK  922

Query  352  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  173
            E +AG E AQE++N+L N+VHS+N+RLEHD+AFLKAVL+DTQKEL STR  L  ERA++ 
Sbjct  923  EAVAGAERAQEDSNNLCNLVHSENLRLEHDLAFLKAVLEDTQKELDSTREALATERAKSS  982

Query  172  QLQVEVFHLKQRL  134
            QLQ+EVF+L +RL
Sbjct  983  QLQMEVFNLNKRL  995



>ref|XP_001760924.1| predicted protein [Physcomitrella patens]
 gb|EDQ74313.1| predicted protein, partial [Physcomitrella patens]
Length=617

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -1

Query  532  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  353
            QS+E KL A +R+  L EGQL+ AL  +E A+KSL  ALK++Q  E KLA ++K    LK
Sbjct  481  QSFEMKLAAAVRRGELAEGQLSTALKGKEEAEKSLQLALKTRQHAEGKLAASLKGQMDLK  540

Query  352  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  173
            E++A  E AQE++N+L N+VHS+N+RLEHD+AFLKAVL+DTQ EL STR LL  ER R+F
Sbjct  541  ERVAAAERAQEDSNNLCNVVHSENLRLEHDLAFLKAVLEDTQMELQSTRELLATERTRSF  600

Query  172  QLQVEVFHLKQRLQSL  125
             LQV V HL   L +L
Sbjct  601  NLQVTVDHLPPLLHAL  616



>ref|XP_001751751.1| predicted protein [Physcomitrella patens]
 gb|EDQ83186.1| predicted protein [Physcomitrella patens]
Length=1071

 Score = 97.8 bits (242),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -1

Query  532   QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  353
             QS+E KL A +R+    EGQ+  AL ++E     L+SALK +Q  E +LA A+     LK
Sbjct  915   QSFEMKLAAAVRRAEQAEGQVTTALRAKEEIANRLASALKMRQHAEGQLAAALTAQAELK  974

Query  352   EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  173
             E +A  E AQE++N+L ++VHS+N+RLEHD+AFLKAVL+DTQKEL STR  L  ER+++F
Sbjct  975   ETVAAAERAQEDSNNLCSVVHSENLRLEHDLAFLKAVLEDTQKELDSTREGLVTERSKSF  1034

Query  172   QLQVEVFHLKQR-LQSLENRAPTP  104
             +LQ+E+F LK++ L SL     TP
Sbjct  1035  KLQMEIFDLKKKTLLSLSEEDATP  1058



>ref|XP_001761501.1| predicted protein [Physcomitrella patens]
 gb|EDQ73569.1| predicted protein [Physcomitrella patens]
Length=230

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -1

Query  391  KLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHS  212
            KLA ++K    L+E+ A  + AQE++N+L N++H +N+RLEHD+AF KAVL+DTQK+L S
Sbjct  141  KLAASLKGRMDLEERSAAAKRAQEDSNNLRNVIHLENLRLEHDLAFFKAVLEDTQKDLQS  200

Query  211  TRGLLGGERARAFQLQVEVFHL  146
             R L+  +R R+F LQ+ V HL
Sbjct  201  NRELIATKRTRSFNLQLTVDHL  222



>gb|ABA95166.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
Length=647

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  545  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  604

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  224
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQK
Sbjct  605  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQK  645



>ref|XP_002449932.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
 gb|EES08920.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
Length=649

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -1

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            + ++T L+R+N  LE QL+AALAS++ A+K+LS  + SK + EK+LA+  +E++ LKEK 
Sbjct  548  DTRITTLIRRNMALEEQLSAALASKDEAEKNLSLVIDSKDELEKRLAEKDREVEALKEKA  607

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  224
             G+ELAQEE+N+LSN VH+DNVRLE +VAFLKAV+D+TQK
Sbjct  608  TGLELAQEESNNLSNTVHADNVRLEREVAFLKAVMDETQK  647



>emb|CDY02611.1| BnaC02g08240D [Brassica napus]
 emb|CDY02612.1| BnaC02g08230D [Brassica napus]
Length=63

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -1

Query  298  IVHSDNVRLEHDVAFLKAVLDDTQKE--LHSTRGLLGGERARAFQLQV  161
            +VH DNVRLEHDVA +K VLDD Q++  LHSTRG+L GERAR FQLQV
Sbjct  1    MVHFDNVRLEHDVALVKYVLDDKQRKMFLHSTRGVLAGERARMFQLQV  48



>gb|ABR25493.1| rangap1 interacting protein [Oryza sativa Indica Group]
Length=40

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  205  GLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
            G+L GER+RAFQLQVEVFHLKQRLQ++E R+PTPRKP
Sbjct  1    GVLAGERSRAFQLQVEVFHLKQRLQTMEGRSPTPRKP  37



>ref|XP_001765510.1| predicted protein [Physcomitrella patens]
 gb|EDQ69771.1| predicted protein [Physcomitrella patens]
Length=385

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 57/101 (56%), Gaps = 24/101 (24%)
 Frame = -1

Query  406  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  227
            Q  E K A ++K   + KE++A  E AQE++N+L N+VHS N+RLEHD AFLKAVL+DTQ
Sbjct  290  QHAEGKFAASLKA-QIEKERVAVAERAQEDSNNLCNVVHSGNLRLEHDFAFLKAVLEDTQ  348

Query  226  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTP  104
                                 +EVF LK++L       PTP
Sbjct  349  --------------------NMEVFDLKKKLLP---TIPTP  366



>gb|EEE53353.1| hypothetical protein OsJ_36377 [Oryza sativa Japonica Group]
Length=549

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = -1

Query  223  ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
            ELHSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  506  ELHSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  547



>gb|KDO75105.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=166

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = -1

Query  856  LSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQL  716
            L DPN ++GNVSL KQF NEEE  T++KM K+S+DE+S  QV  RG   L
Sbjct  106  LVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQVSFRGYNLL  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1823856796800