BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF040F07

Length=933
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011091828.1|  PREDICTED: F-box protein SKIP5                     413   5e-142   Sesamum indicum [beniseed]
ref|XP_009597488.1|  PREDICTED: F-box protein SKIP5                     410   7e-141   Nicotiana tomentosiformis
ref|NP_001234135.1|  SKIP5-like protein                                 408   9e-140   Solanum lycopersicum
ref|XP_006350998.1|  PREDICTED: F-box protein SKIP5-like                407   2e-139   Solanum tuberosum [potatoes]
ref|XP_009788949.1|  PREDICTED: F-box protein SKIP5                     406   4e-139   Nicotiana sylvestris
gb|EYU36858.1|  hypothetical protein MIMGU_mgv1a022539mg                395   5e-135   Erythranthe guttata [common monkey flower]
gb|EYU42952.1|  hypothetical protein MIMGU_mgv1a012165mg                393   7e-134   Erythranthe guttata [common monkey flower]
ref|XP_004516505.1|  PREDICTED: F-box protein SKIP5-like                392   2e-133   Cicer arietinum [garbanzo]
ref|XP_007148969.1|  hypothetical protein PHAVU_005G029600g             393   2e-133   Phaseolus vulgaris [French bean]
ref|XP_002269519.1|  PREDICTED: F-box protein SKIP5 isoform X1          391   4e-133   Vitis vinifera
ref|XP_006590332.1|  PREDICTED: uncharacterized protein LOC100808...    388   8e-132   
ref|XP_003598631.1|  F-box protein SKIP5                                387   9e-132   Medicago truncatula
emb|CDP18131.1|  unnamed protein product                                385   6e-131   Coffea canephora [robusta coffee]
gb|AFK33567.1|  unknown                                                 382   1e-129   Lotus japonicus
ref|XP_010554478.1|  PREDICTED: F-box protein SKIP5                     382   1e-129   Tarenaya hassleriana [spider flower]
gb|EPS72918.1|  hypothetical protein M569_01839                         380   3e-129   Genlisea aurea
gb|KHN21305.1|  F-box protein SKIP5                                     381   6e-129   Glycine soja [wild soybean]
ref|XP_002513076.1|  conserved hypothetical protein                     377   5e-128   Ricinus communis
ref|XP_008348371.1|  PREDICTED: F-box protein SKIP5 isoform X1          377   1e-127   
ref|XP_010067744.1|  PREDICTED: F-box protein SKIP5                     377   1e-127   Eucalyptus grandis [rose gum]
ref|XP_006420750.1|  hypothetical protein CICLE_v10005678mg             375   3e-127   Citrus clementina [clementine]
ref|XP_007218829.1|  hypothetical protein PRUPE_ppa010167mg             375   4e-127   Prunus persica
gb|KJB74631.1|  hypothetical protein B456_012G017000                    375   5e-127   Gossypium raimondii
ref|XP_004307123.1|  PREDICTED: F-box protein SKIP5 isoform X1          372   7e-126   Fragaria vesca subsp. vesca
ref|XP_009354454.1|  PREDICTED: F-box protein SKIP5 isoform X1          372   8e-126   Pyrus x bretschneideri [bai li]
ref|XP_008813420.1|  PREDICTED: F-box protein SKIP5                     372   8e-126   Phoenix dactylifera
ref|XP_006403571.1|  hypothetical protein EUTSA_v10010628mg             371   5e-125   Eutrema salsugineum [saltwater cress]
ref|XP_010095957.1|  hypothetical protein L484_023946                   369   1e-124   Morus notabilis
ref|XP_010999613.1|  PREDICTED: F-box protein SKIP5-like isoform X1     367   4e-124   Populus euphratica
gb|KDP40515.1|  hypothetical protein JCGZ_24514                         367   7e-124   Jatropha curcas
ref|XP_010427150.1|  PREDICTED: F-box protein SKIP5                     368   8e-124   Camelina sativa [gold-of-pleasure]
ref|XP_010999614.1|  PREDICTED: F-box protein SKIP5-like isoform X2     367   8e-124   Populus euphratica
gb|KFK34691.1|  hypothetical protein AALP_AA5G179200                    367   9e-124   Arabis alpina [alpine rockcress]
ref|XP_010504251.1|  PREDICTED: F-box protein SKIP5-like                367   1e-123   Camelina sativa [gold-of-pleasure]
gb|KJB74633.1|  hypothetical protein B456_012G017000                    366   2e-123   Gossypium raimondii
ref|XP_010515975.1|  PREDICTED: F-box protein SKIP5                     367   2e-123   Camelina sativa [gold-of-pleasure]
ref|NP_566999.1|  SKP1/ASK-interacting protein 5                        367   2e-123   Arabidopsis thaliana [mouse-ear cress]
gb|AAG21980.1|  SKP1 interacting partner 5                              366   2e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010938589.1|  PREDICTED: F-box protein SKIP5                     366   2e-123   Elaeis guineensis
ref|XP_007011111.1|  SKP1/ASK-interacting protein 5 isoform 1           366   2e-123   
ref|XP_002877981.1|  skp1-interacting partner 5                         366   3e-123   Arabidopsis lyrata subsp. lyrata
ref|XP_011000542.1|  PREDICTED: F-box protein SKIP5-like                365   4e-123   Populus euphratica
ref|XP_006658920.1|  PREDICTED: F-box protein SKIP5-like                364   1e-122   Oryza brachyantha
ref|XP_006292685.1|  hypothetical protein CARUB_v10018930mg             364   2e-122   Capsella rubella
emb|CDX78238.1|  BnaA09g34330D                                          364   2e-122   
ref|XP_004958577.1|  PREDICTED: F-box protein SKIP5-like                362   6e-122   Setaria italica
ref|XP_002461155.1|  hypothetical protein SORBIDRAFT_02g041860          362   9e-122   Sorghum bicolor [broomcorn]
ref|XP_009116131.1|  PREDICTED: F-box protein SKIP5-like                362   9e-122   Brassica rapa
ref|XP_002299213.2|  SKP1-INTERACTING PARTNER 5 family protein          361   1e-121   
ref|XP_010670456.1|  PREDICTED: F-box protein SKIP5                     361   5e-121   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009139236.1|  PREDICTED: F-box protein SKIP5-like isoform X2     361   7e-121   Brassica rapa
gb|KJB74634.1|  hypothetical protein B456_012G017000                    360   1e-120   Gossypium raimondii
emb|CDX76144.1|  BnaA04g04080D                                          359   2e-120   
ref|XP_008653434.1|  PREDICTED: F-box protein SKIP5                     357   7e-120   Zea mays [maize]
ref|XP_004142419.1|  PREDICTED: F-box protein SKIP5-like                354   1e-118   Cucumis sativus [cucumbers]
ref|XP_010659170.1|  PREDICTED: F-box protein SKIP5 isoform X2          353   1e-118   Vitis vinifera
gb|EEE67747.1|  hypothetical protein OsJ_25443                          363   7e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009387040.1|  PREDICTED: F-box protein SKIP5                     352   1e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003559852.1|  PREDICTED: F-box protein SKIP5                     350   2e-117   Brachypodium distachyon [annual false brome]
ref|XP_008446937.1|  PREDICTED: F-box protein SKIP5 isoform X1          351   3e-117   Cucumis melo [Oriental melon]
ref|XP_011469379.1|  PREDICTED: F-box protein SKIP5 isoform X2          351   9e-117   Fragaria vesca subsp. vesca
ref|XP_006830359.1|  hypothetical protein AMTR_s00116p00090490          337   4e-112   Amborella trichopoda
ref|NP_001242768.1|  uncharacterized protein LOC100808414               333   5e-111   
ref|XP_008446939.1|  PREDICTED: F-box protein SKIP5 isoform X2          315   2e-103   
ref|XP_008348378.1|  PREDICTED: F-box protein SKIP5 isoform X2          311   1e-102   
ref|XP_009354455.1|  PREDICTED: F-box protein SKIP5 isoform X2          307   7e-101   Pyrus x bretschneideri [bai li]
ref|XP_010999616.1|  PREDICTED: F-box protein SKIP5-like isoform X3     304   2e-99    Populus euphratica
ref|NP_001060527.1|  Os07g0659700                                       299   5e-97    
dbj|BAJ85981.1|  predicted protein                                      299   7e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADE75775.1|  unknown                                                 297   1e-95    Picea sitchensis
emb|CAB77568.1|  putative protein                                       295   3e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007011112.1|  SKP1/ASK-interacting protein 5 isoform 2           293   2e-94    
gb|EEC82615.1|  hypothetical protein OsI_27192                          273   4e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_010659171.1|  PREDICTED: F-box protein SKIP5 isoform X3          270   3e-87    
ref|XP_009139235.1|  PREDICTED: F-box protein SKIP5-like isoform X1     268   2e-84    
gb|EMT11615.1|  hypothetical protein F775_29980                         254   1e-79    
ref|XP_002976942.1|  hypothetical protein SELMODRAFT_175869             237   8e-73    Selaginella moellendorffii
ref|XP_002980686.1|  hypothetical protein SELMODRAFT_178289             237   1e-72    Selaginella moellendorffii
gb|KHG17417.1|  F-box SKIP5 -like protein                               227   6e-69    Gossypium arboreum [tree cotton]
ref|XP_001765023.1|  predicted protein                                  237   2e-66    
gb|AFK48081.1|  unknown                                                 214   1e-65    Lotus japonicus
gb|AAG40405.1|AF325053_1  T14E10.50                                     209   3e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003598632.1|  F-box protein SKIP5                                205   6e-62    
ref|XP_006494343.1|  PREDICTED: F-box protein SKIP5-like isoform X1     204   1e-61    Citrus sinensis [apfelsine]
gb|AFK39958.1|  unknown                                                 201   1e-60    Medicago truncatula
ref|XP_006494344.1|  PREDICTED: F-box protein SKIP5-like isoform X2     201   2e-60    Citrus sinensis [apfelsine]
gb|KJB74632.1|  hypothetical protein B456_012G017000                    198   7e-59    Gossypium raimondii
emb|CDY66691.1|  BnaC04g53050D                                          194   1e-57    Brassica napus [oilseed rape]
emb|CDY40005.1|  BnaC05g13100D                                          193   6e-57    Brassica napus [oilseed rape]
emb|CDX73483.1|  BnaC08g25200D                                          192   9e-57    
ref|XP_003598633.1|  F-box protein SKIP5                                189   2e-55    
ref|XP_008246248.1|  PREDICTED: F-box protein SKIP5-like                185   2e-54    
emb|CDY13209.1|  BnaC04g26260D                                          185   6e-54    Brassica napus [oilseed rape]
emb|CDX73477.1|  BnaC08g25260D                                          177   2e-51    
ref|XP_006431426.1|  hypothetical protein CICLE_v10002701mg             177   8e-51    
emb|CDY13210.1|  BnaC04g26250D                                          174   9e-50    Brassica napus [oilseed rape]
tpg|DAA63988.1|  TPA: hypothetical protein ZEAMMB73_319872              173   1e-49    
gb|EMS52646.1|  hypothetical protein TRIUR3_14698                       155   1e-40    Triticum urartu
ref|NP_567000.2|  SKP1/ASK-interacting protein 5                        134   5e-35    Arabidopsis thaliana [mouse-ear cress]
tpg|DAA41661.1|  TPA: hypothetical protein ZEAMMB73_083322              133   1e-34    
ref|XP_008246108.1|  PREDICTED: F-box protein SKIP5-like                132   2e-34    
ref|XP_006494345.1|  PREDICTED: F-box protein SKIP5-like isoform X3     132   7e-34    Citrus sinensis [apfelsine]
gb|EYU42992.1|  hypothetical protein MIMGU_mgv1a018998mg                130   2e-33    Erythranthe guttata [common monkey flower]
ref|XP_005651314.1|  hypothetical protein COCSUDRAFT_59281              119   1e-27    Coccomyxa subellipsoidea C-169
gb|AAG01324.1|AF276888_1  unknown                                       107   3e-25    Arabidopsis thaliana [mouse-ear cress]
gb|KIY98094.1|  F-box protein SKIP5                                   95.9    5e-19    Monoraphidium neglectum
ref|XP_006386008.1|  hypothetical protein POPTR_0003s19945g           88.6    7e-18    
ref|XP_011397893.1|  F-box protein SKIP5                              89.7    2e-17    Auxenochlorella protothecoides
ref|XP_010497120.1|  PREDICTED: F-box protein SKIP5-like              79.3    2e-15    
ref|XP_010248139.1|  PREDICTED: F-box protein SKIP5-like              79.0    7e-15    
ref|XP_005852278.1|  hypothetical protein CHLNCDRAFT_133681           77.8    1e-12    Chlorella variabilis
ref|XP_006386002.1|  hypothetical protein POPTR_0003s19900g           62.0    8e-09    
ref|XP_008904960.1|  hypothetical protein PPTG_11400                  54.7    8e-05    Phytophthora parasitica INRA-310
ref|WP_038557082.1|  hypothetical protein                             53.1    2e-04    Draconibacterium orientale
tpg|DAA63986.1|  TPA: hypothetical protein ZEAMMB73_319872            48.5    5e-04    
gb|ETP17406.1|  hypothetical protein F441_08176                       52.0    6e-04    Phytophthora parasitica CJ01A1
gb|ETI47607.1|  hypothetical protein F443_08200                       52.0    6e-04    Phytophthora parasitica P1569
gb|ETL94122.1|  hypothetical protein L917_07851                       52.0    6e-04    Phytophthora parasitica
gb|ETP45417.1|  hypothetical protein F442_08141                       52.0    7e-04    Phytophthora parasitica P10297
gb|ETO76325.1|  hypothetical protein F444_08256                       52.0    7e-04    Phytophthora parasitica P1976
gb|ETM47366.1|  hypothetical protein L914_07913                       52.0    7e-04    Phytophthora parasitica
gb|ETL40964.1|  hypothetical protein L916_07950                       52.0    7e-04    Phytophthora parasitica
gb|ETK87535.1|  hypothetical protein L915_08027                       52.0    7e-04    Phytophthora parasitica



>ref|XP_011091828.1| PREDICTED: F-box protein SKIP5 [Sesamum indicum]
Length=251

 Score =   413 bits (1062),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 198/229 (86%), Positives = 214/229 (93%), Gaps = 0/229 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLM IFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSV+D S PG++P+
Sbjct  22   INNLDDGCLMLIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVKDLSQPGVYPS  81

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IETAVS+ARPGDTILIA GG HR SNIQIKKPLCLIGAGE+PDDT L CSRGS+SALEFL
Sbjct  82   IETAVSAARPGDTILIAAGGIHRTSNIQIKKPLCLIGAGELPDDTTLICSRGSESALEFL  141

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS+AIV+TA++PR +   L
Sbjct  142  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSHAIVTTATAPRGIQPVL  201

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
            K  ADSV+V RTRIEGGAKAVLTSGTL+LQQVRVIY+RTSLFFWFNVE+
Sbjct  202  KNTADSVTVTRTRIEGGAKAVLTSGTLSLQQVRVIYTRTSLFFWFNVEE  250



>ref|XP_009597488.1| PREDICTED: F-box protein SKIP5 [Nicotiana tomentosiformis]
Length=262

 Score =   410 bits (1055),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 217/242 (90%), Gaps = 0/242 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHP+LWLRVDRS +D S PG++PN
Sbjct  18   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPQLWLRVDRSAKDLSQPGVYPN  77

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTILIA GGSHRVSNI+I+KPLCLIGAGE PDDT L CSR SDSALEF+
Sbjct  78   IEIAVSAARPGDTILIAAGGSHRVSNIKIEKPLCLIGAGESPDDTTLICSRSSDSALEFM  137

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAI+STA +   + + L
Sbjct  138  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIISTAGASEVVSSAL  197

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQDGSSTPQAPSG  99
            KT  +SVSVLRTRIEGGAKAVLTSGTL+LQ+VRVIY+RTSLFFWF VE    +T Q+ S 
Sbjct  198  KTCINSVSVLRTRIEGGAKAVLTSGTLSLQRVRVIYTRTSLFFWFEVEGGDKNTVQSASV  257

Query  98   EV  93
            E+
Sbjct  258  EL  259



>ref|NP_001234135.1| SKIP5-like protein [Solanum lycopersicum]
 gb|AAL05932.1| SKIP5-like protein [Solanum lycopersicum]
Length=265

 Score =   408 bits (1048),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 193/242 (80%), Positives = 217/242 (90%), Gaps = 0/242 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            IN+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDR+V+D S PG++PN
Sbjct  21   INSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRAVKDLSQPGVYPN  80

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTILIA GGSH VSNIQI+KPLCLIGAGE PDDT L CSRGSDSALEF+
Sbjct  81   IEMAVSAARPGDTILIAAGGSHHVSNIQIEKPLCLIGAGESPDDTTLICSRGSDSALEFM  140

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTVR ELGCCLLHRSG+LT+DGCILQCESNPLDHLSYAI+STA +   +P+ L
Sbjct  141  STCKLANLTVRTELGCCLLHRSGKLTVDGCILQCESNPLDHLSYAIISTAGAAEVIPSAL  200

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQDGSSTPQAPSG  99
            KT +D+VSVL+T+I GGAKAVLTSGTL+LQ+VRVIY+RTSLFFWF VE    +T Q+   
Sbjct  201  KTCSDAVSVLKTQIAGGAKAVLTSGTLSLQRVRVIYTRTSLFFWFEVEGSDKNTVQSAPV  260

Query  98   EV  93
            E+
Sbjct  261  EL  262



>ref|XP_006350998.1| PREDICTED: F-box protein SKIP5-like [Solanum tuberosum]
Length=265

 Score =   407 bits (1046),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 194/242 (80%), Positives = 215/242 (89%), Gaps = 0/242 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            IN LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDR+V+D S PG++PN
Sbjct  21   INRLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRAVKDLSQPGVYPN  80

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTILIA GGSH VSNIQI+KPLCLIGAGE PDDT L CSR SDSALEF+
Sbjct  81   IEMAVSAARPGDTILIAAGGSHHVSNIQIEKPLCLIGAGESPDDTTLICSRSSDSALEFM  140

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTVR ELGCCLLHR G+LTIDGCILQCESNPLDHLSYAI+STA +   +P+ L
Sbjct  141  STCKLANLTVRTELGCCLLHRRGKLTIDGCILQCESNPLDHLSYAIISTAGAAEVIPSAL  200

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQDGSSTPQAPSG  99
            KT ++ VSVL+TRIEGGAKAVLTSGTL+LQ+VRVIY+RTSLFFWF VE    +T Q+ S 
Sbjct  201  KTCSNGVSVLKTRIEGGAKAVLTSGTLSLQRVRVIYTRTSLFFWFEVEGSDKNTVQSASV  260

Query  98   EV  93
            E+
Sbjct  261  EL  262



>ref|XP_009788949.1| PREDICTED: F-box protein SKIP5 [Nicotiana sylvestris]
Length=262

 Score =   406 bits (1044),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCH WRFLACHP+LWLRVDRSV+D S PG++PN
Sbjct  18   INNLDDGCLMHIFSFLSPIPDRYNTALVCHGWRFLACHPQLWLRVDRSVKDLSQPGVYPN  77

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTIL+A GGSHRVSNI+I+KPLCLIGAGE PDDT L CSR SDSALEF+
Sbjct  78   IEIAVSAARPGDTILVAAGGSHRVSNIKIEKPLCLIGAGESPDDTTLICSRSSDSALEFM  137

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAI+STA +   + + L
Sbjct  138  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIISTAGASEVVSSAL  197

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQDGSSTPQAPS  102
            KT  +SVSVLRTRIEGGAKAVLTSGTL+LQ+VRVIY+R SLFFWF VE    +T Q+ S
Sbjct  198  KTCINSVSVLRTRIEGGAKAVLTSGTLSLQRVRVIYTRASLFFWFEVEGADKNTVQSAS  256



>gb|EYU36858.1| hypothetical protein MIMGU_mgv1a022539mg [Erythranthe guttata]
Length=259

 Score =   395 bits (1016),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 193/234 (82%), Positives = 208/234 (89%), Gaps = 4/234 (2%)
 Frame = -2

Query  821  DINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFP  642
             IN LDDGCLM IFSFLSPIPDRYNTALVC RWRFLACHP+ WLRVDRSV++ + PG++P
Sbjct  25   QINRLDDGCLMLIFSFLSPIPDRYNTALVCRRWRFLACHPQHWLRVDRSVKELTEPGVYP  84

Query  641  NIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEF  462
            +IETAVS+ARPGDTILIA GG HR SNIQIKKPLCLIGAGEIPDDT L CSRGSDSALEF
Sbjct  85   SIETAVSAARPGDTILIAAGGIHRTSNIQIKKPLCLIGAGEIPDDTTLICSRGSDSALEF  144

Query  461  LSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDL---  291
            LSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS+AIV+TA+S   L   
Sbjct  145  LSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSHAIVTTATSSDQLSLS  204

Query  290  -PTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
             P     NAD V+V+RTRIEGGAKAVLTSGTL+LQQVRVIY+RTSLFFWFNV Q
Sbjct  205  QPVMKNNNADCVTVMRTRIEGGAKAVLTSGTLSLQQVRVIYARTSLFFWFNVVQ  258



>gb|EYU42952.1| hypothetical protein MIMGU_mgv1a012165mg [Erythranthe guttata]
Length=259

 Score =   393 bits (1009),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 192/234 (82%), Positives = 207/234 (88%), Gaps = 4/234 (2%)
 Frame = -2

Query  821  DINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFP  642
             IN LDDGCLM IFSFLSPIPDRYNTALVC RWRFLACHP+ WLRVDRSV++ + PG++P
Sbjct  25   QINRLDDGCLMLIFSFLSPIPDRYNTALVCRRWRFLACHPQHWLRVDRSVKELTEPGVYP  84

Query  641  NIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEF  462
            +IETAVS+ARPGDTILIA GG HR SNIQIKKPLCLIGAGEIPDDT L CSRGSDSALEF
Sbjct  85   SIETAVSAARPGDTILIAAGGIHRTSNIQIKKPLCLIGAGEIPDDTTLICSRGSDSALEF  144

Query  461  LSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDL---  291
            LSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS+AIV+TA+S   L   
Sbjct  145  LSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSHAIVTTATSSDQLSHS  204

Query  290  -PTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
             P     N D V+V+RTRIEGGAKAVLTSGTL+LQQVRVIY+RTSLFFWFNV Q
Sbjct  205  QPVIKNNNGDCVTVMRTRIEGGAKAVLTSGTLSLQQVRVIYARTSLFFWFNVVQ  258



>ref|XP_004516505.1| PREDICTED: F-box protein SKIP5-like [Cicer arietinum]
Length=264

 Score =   392 bits (1007),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/237 (81%), Positives = 209/237 (88%), Gaps = 3/237 (1%)
 Frame = -2

Query  839  YCYSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSS  660
            +CYS   INNLDDGCLMHIFSFL PIPDR+NTALVCHRW +LACHPRLWLRVDRSV+D S
Sbjct  29   FCYS--PINNLDDGCLMHIFSFLPPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKDLS  86

Query  659  LPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGS  480
             PG+FPNIETAVS++RPGDTILIA GG+HRVSNIQI KPLCLIGAG+IPDDT+LTC RGS
Sbjct  87   EPGVFPNIETAVSASRPGDTILIAAGGTHRVSNIQINKPLCLIGAGDIPDDTMLTCPRGS  146

Query  479  DSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSP  300
            DSALEFLSTCKLANLTV+AELGCCLLHRSGRLTID C+LQCESNPLD LS  IVSTASS 
Sbjct  147  DSALEFLSTCKLANLTVKAELGCCLLHRSGRLTIDACVLQCESNPLDFLSCPIVSTASSS  206

Query  299  RDLPTTLKT-NADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
            + +P   K+ N D V V +TRIEGGAKAVLTSG L LQ+VRVIY RTSL FWF+VEQ
Sbjct  207  KAIPLKTKSNNGDGVFVSQTRIEGGAKAVLTSGDLALQRVRVIYQRTSLLFWFDVEQ  263



>ref|XP_007148969.1| hypothetical protein PHAVU_005G029600g, partial [Phaseolus vulgaris]
 gb|ESW20963.1| hypothetical protein PHAVU_005G029600g, partial [Phaseolus vulgaris]
Length=303

 Score =   393 bits (1010),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 188/229 (82%), Positives = 207/229 (90%), Gaps = 0/229 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            I NLDDGCLMHIFSFL PIPDR+NTALVCHRW +LACHPRLWLRVDRSV+DSS PG+FPN
Sbjct  64   ITNLDDGCLMHIFSFLPPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKDSSEPGVFPN  123

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IETAVS++RPGDTILIA GGSH V+NIQI+KPLCLIGAGE+PDDT L CSRGSDSALEF+
Sbjct  124  IETAVSASRPGDTILIAAGGSHHVANIQIRKPLCLIGAGELPDDTTLVCSRGSDSALEFI  183

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTVRAELGCCLLHR GRLTIDGCILQCESNPLD+LS  IVSTASS   LP+  
Sbjct  184  STCKLANLTVRAELGCCLLHRKGRLTIDGCILQCESNPLDYLSCPIVSTASSSEVLPSQT  243

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
            K+++D V V +TRIEGGAKAVLTSG L LQ+VRVIY+RTSL FWF+VEQ
Sbjct  244  KSSSDGVFVSQTRIEGGAKAVLTSGDLALQRVRVIYARTSLLFWFDVEQ  292



>ref|XP_002269519.1| PREDICTED: F-box protein SKIP5 isoform X1 [Vitis vinifera]
 emb|CBI35143.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   391 bits (1004),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 186/228 (82%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  815  NNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNI  636
            +NLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRSV+DSS PG+FP+I
Sbjct  26   HNLDDGCLMHIFSFLSPIPDRYNTALVCHRWHYLACHPRLWLRVDRSVKDSSEPGVFPSI  85

Query  635  ETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLS  456
            E AVS+ARPGDTILIA GGSH  SNIQIKKPLCLIG GE+PDDT L CSRGSDSALEFLS
Sbjct  86   EMAVSAARPGDTILIAAGGSHLASNIQIKKPLCLIGGGELPDDTTLLCSRGSDSALEFLS  145

Query  455  TCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTLK  276
            TCK+ANLTV+AELGCCLLHRSGRLTIDGCILQCESNPLD+LS  IVSTA+ P  L +++K
Sbjct  146  TCKVANLTVKAELGCCLLHRSGRLTIDGCILQCESNPLDYLSCPIVSTAAGPEILTSSVK  205

Query  275  TNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
            ++ DSVSV RTRIEGGAKAV+TSG+L LQ+VRVIY+RTS+FFWF+V++
Sbjct  206  SHGDSVSVSRTRIEGGAKAVVTSGSLALQRVRVIYARTSIFFWFDVDR  253



>ref|XP_006590332.1| PREDICTED: uncharacterized protein LOC100808414 isoform X1 [Glycine 
max]
Length=266

 Score =   388 bits (996),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 188/230 (82%), Positives = 207/230 (90%), Gaps = 1/230 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIF+FL PIPDR+NTALVCHRW +LACHPRLWLRVDRSV++ S PG+FPN
Sbjct  26   INNLDDGCLMHIFNFLPPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKELSEPGVFPN  85

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IETAVS++RPGDTILIA GG+HRV+NIQI+KPLCLIGAGE+PDDT L CSRGSDSALEFL
Sbjct  86   IETAVSASRPGDTILIAAGGTHRVANIQIRKPLCLIGAGEVPDDTTLVCSRGSDSALEFL  145

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTVRAELGCCLLHR GRLTIDGCILQCESNPLD+LS  IVSTASS   LP+  
Sbjct  146  STCKLANLTVRAELGCCLLHRKGRLTIDGCILQCESNPLDYLSCPIVSTASSSVVLPSQT  205

Query  278  KT-NADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
            K+ N D V V +TRIEGGAKAVLTSG L LQ+VRVIY+RTSL FWF+VEQ
Sbjct  206  KSNNGDGVFVSQTRIEGGAKAVLTSGDLALQRVRVIYARTSLLFWFDVEQ  255



>ref|XP_003598631.1| F-box protein SKIP5 [Medicago truncatula]
 gb|AES68882.1| F-box SKIP5-like protein [Medicago truncatula]
Length=260

 Score =   387 bits (995),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 208/236 (88%), Gaps = 3/236 (1%)
 Frame = -2

Query  836  CYSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSL  657
            CYSR  INNLDDGCLMHIFSFLSPIPDR+NTALVCHRW +LACHPRLWLRVDRSV+D S 
Sbjct  26   CYSR--INNLDDGCLMHIFSFLSPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKDLSE  83

Query  656  PGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSD  477
            PG+FPNIETAVS++RPGDTILIA GG HRV+NIQI KPLCLIGAGEIPDDT+LTCSRG D
Sbjct  84   PGVFPNIETAVSASRPGDTILIAAGGIHRVANIQINKPLCLIGAGEIPDDTMLTCSRGLD  143

Query  476  SALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPR  297
            SA EFLS CKL+NLTV+AELGCCLLHRSGRLTIDGC+LQCESNPLD LS  I+STA+S  
Sbjct  144  SAFEFLSNCKLSNLTVKAELGCCLLHRSGRLTIDGCVLQCESNPLDFLSCPIISTANSSD  203

Query  296  DLPT-TLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
             +P+ T   N D V V +TRIEGGAKAVLTSG L LQ+VRV+Y+RTSL FWF+VEQ
Sbjct  204  MVPSQTNSNNGDGVFVSQTRIEGGAKAVLTSGDLALQRVRVVYARTSLLFWFDVEQ  259



>emb|CDP18131.1| unnamed protein product [Coffea canephora]
Length=254

 Score =   385 bits (989),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 186/232 (80%), Positives = 205/232 (88%), Gaps = 2/232 (1%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFL P PDRYNTALVCHRW FLACHPRLWLRVDRSV++ S PG+FP+
Sbjct  21   INNLDDGCLMHIFSFLCPKPDRYNTALVCHRWHFLACHPRLWLRVDRSVKNLSKPGVFPS  80

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IETAV++ARPGDTILIA GGSH  SNIQIKKPLCLIGAGE+PDDT L CSRG DSALEF 
Sbjct  81   IETAVAAARPGDTILIASGGSHLASNIQIKKPLCLIGAGELPDDTTLVCSRGFDSALEFS  140

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRD--LPT  285
            STCKLANLTVRAELGCCLLHRSGRL ID CILQCESNPLDHLSYAIVSTAS+     +P+
Sbjct  141  STCKLANLTVRAELGCCLLHRSGRLIIDSCILQCESNPLDHLSYAIVSTASATEYEVVPS  200

Query  284  TLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
             +K+ +DSVSV +TRIEGGAKAVL SG L+LQQVRVIY+R S+FFWF++E  
Sbjct  201  AVKSCSDSVSVSQTRIEGGAKAVLASGALSLQQVRVIYARASVFFWFDMEHQ  252



>gb|AFK33567.1| unknown [Lotus japonicus]
Length=268

 Score =   382 bits (982),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/231 (81%), Positives = 203/231 (88%), Gaps = 2/231 (1%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFL PIPDR+NTALVCHRW +LACHPRLWLRVDRSV+D S PG+FPN
Sbjct  37   INNLDDGCLMHIFSFLPPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKDLSQPGVFPN  96

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IETAVS++RPGDTILIA GGSH  SNIQIKKPLCLIGAGE+PDDT L CSRGSDSALE L
Sbjct  97   IETAVSASRPGDTILIAAGGSHHTSNIQIKKPLCLIGAGELPDDTTLICSRGSDSALELL  156

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTV+AELGCCLLHR GRLT+DGCILQCESNPLD LS  IVSTA+S   LP+  
Sbjct  157  STCKLANLTVKAELGCCLLHRKGRLTVDGCILQCESNPLDFLSCPIVSTANSSEVLPSQT  216

Query  278  KTN--ADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
            K+N   D V V +TRIEGGAKAV+TSG L LQ+VRVIY+RTSL FWF+VEQ
Sbjct  217  KSNGGGDGVFVSQTRIEGGAKAVVTSGDLALQRVRVIYARTSLLFWFDVEQ  267



>ref|XP_010554478.1| PREDICTED: F-box protein SKIP5 [Tarenaya hassleriana]
Length=274

 Score =   382 bits (982),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/260 (72%), Positives = 210/260 (81%), Gaps = 19/260 (7%)
 Frame = -2

Query  878  HPTTASELEAAPYYCYSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPR  699
             P    ++E+ P +       NNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPR
Sbjct  20   EPRKKQKMESDPLF-------NNLDDGCLMHIFSFLSPIPDRYNTALVCHRWHYLACHPR  72

Query  698  LWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGE  519
            LWLRVDRSV+D S PG+FPNIE+AVS+ARPGDTILI  GGSHRVSNIQIKKPLCLIG GE
Sbjct  73   LWLRVDRSVKDLSQPGVFPNIESAVSAARPGDTILIGAGGSHRVSNIQIKKPLCLIGGGE  132

Query  518  IPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLD  339
            +PD+T L CSRGSDSALE LSTCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCESNPLD
Sbjct  133  LPDETTLICSRGSDSALELLSTCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCESNPLD  192

Query  338  HLSYAIVSTA------------SSPRDLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLT  195
            +LS  IV+TA            + P +     KT  DSVSVL+TRIEGGAKAVLT+G L 
Sbjct  193  YLSCPIVTTAGKENILVAPAVKAQPENGTVVEKTRGDSVSVLQTRIEGGAKAVLTNGDLV  252

Query  194  LQQVRVIYSRTSLFFWFNVE  135
            LQ+VRVIYSR  L+FWF+V+
Sbjct  253  LQRVRVIYSRAYLYFWFDVD  272



>gb|EPS72918.1| hypothetical protein M569_01839, partial [Genlisea aurea]
Length=246

 Score =   380 bits (977),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/240 (77%), Positives = 212/240 (88%), Gaps = 9/240 (4%)
 Frame = -2

Query  836  CYSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSL  657
            CY    I +LDDGCLM IFSFLSPIPDRYNTALVC RWRFLACHPRLWLRVDRSV+DSS 
Sbjct  10   CY----IKDLDDGCLMLIFSFLSPIPDRYNTALVCRRWRFLACHPRLWLRVDRSVKDSSF  65

Query  656  PGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSD  477
            PG++P IE AV +ARPGDTILIA GG H+ S+IQIKKPLCLIGAGE+PD+T L CS GS+
Sbjct  66   PGVYPTIEDAVVAARPGDTILIAAGGVHQASDIQIKKPLCLIGAGELPDETTLVCSNGSE  125

Query  476  SALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTA----  309
            SALEF+STCKLANLTV AELGCCLLHRSGRLT+DGC+LQCESNPLDHLS+AIV+TA    
Sbjct  126  SALEFMSTCKLANLTVIAELGCCLLHRSGRLTVDGCVLQCESNPLDHLSHAIVTTATANI  185

Query  308  SSPRDLPTTL-KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
            S+   +P+ L K++AD V+VLRTRIEGGAKAVLTSG+LTL++VRV+Y+RTSLFFWFNVE+
Sbjct  186  STQDKIPSLLTKSSADCVTVLRTRIEGGAKAVLTSGSLTLRRVRVMYTRTSLFFWFNVEE  245



>gb|KHN21305.1| F-box protein SKIP5 [Glycine soja]
Length=275

 Score =   381 bits (978),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 188/238 (79%), Positives = 207/238 (87%), Gaps = 9/238 (4%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIF+FL PIPDR+NTALVCHRW +LACHPRLWLRVDRSV++ S PG+FPN
Sbjct  27   INNLDDGCLMHIFNFLPPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKELSEPGVFPN  86

Query  638  IETAVSSAR--------PGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRG  483
            IETAVS++R        PGDTILIA GG+HRV+NIQI+KPLCLIGAGE+PDDT L CSRG
Sbjct  87   IETAVSASRHVELMLFVPGDTILIAAGGTHRVANIQIRKPLCLIGAGEVPDDTTLVCSRG  146

Query  482  SDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASS  303
            SDSALEFLSTCKLANLTVRAELGCCLLHR GRLTIDGCILQCESNPLD+LS  IVSTASS
Sbjct  147  SDSALEFLSTCKLANLTVRAELGCCLLHRKGRLTIDGCILQCESNPLDYLSCPIVSTASS  206

Query  302  PRDLPTTLKT-NADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
               LP+  K+ N D V V +TRIEGGAKAVLTSG L LQ+VRVIY+RTSL FWF+VEQ
Sbjct  207  SVVLPSQTKSNNGDGVFVSQTRIEGGAKAVLTSGDLALQRVRVIYARTSLLFWFDVEQ  264



>ref|XP_002513076.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49579.1| conserved hypothetical protein [Ricinus communis]
Length=250

 Score =   377 bits (969),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 202/227 (89%), Gaps = 0/227 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW FLACHPRLWLRVDRS++D+S PG+FP+
Sbjct  21   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWHFLACHPRLWLRVDRSIKDTSQPGVFPS  80

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTILI+ GGSH  SNIQI KPLCLIG GE+PD+T+L CSRGSDSALEFL
Sbjct  81   IEMAVSAARPGDTILISAGGSHLASNIQINKPLCLIGGGELPDETMLLCSRGSDSALEFL  140

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTV+AELGCCLLHRSG+LTID C+LQCES+PLD+LS  IVSTA     L   +
Sbjct  141  STCKLANLTVKAELGCCLLHRSGKLTIDSCVLQCESDPLDYLSCPIVSTAGKHEVLSAPM  200

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNV  138
            KTN DSV+V +TRIEGGAKAVLT+G L LQ+VRVIYSRT ++FWF+V
Sbjct  201  KTNGDSVTVSQTRIEGGAKAVLTNGDLVLQRVRVIYSRTYVYFWFDV  247



>ref|XP_008348371.1| PREDICTED: F-box protein SKIP5 isoform X1 [Malus domestica]
Length=263

 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 201/230 (87%), Gaps = 0/230 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRSV+D   PG+FPN
Sbjct  34   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWLYLACHPRLWLRVDRSVKDXLEPGVFPN  93

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            +ETAV +ARPGDTILIA GG H   NIQIKK LCLIGAGE PD+T + CSRGSDSALE L
Sbjct  94   LETAVEAARPGDTILIAAGGRHLAYNIQIKKRLCLIGAGEQPDETTIYCSRGSDSALELL  153

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTV+AELGCCLLHRSGR+TI+GC+LQCE+NPLDHLS  IVSTAS+   + + +
Sbjct  154  STCKLANLTVKAELGCCLLHRSGRVTIEGCVLQCETNPLDHLSCPIVSTASAQTVISSXV  213

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
            K + D VSV RTRIEGGAKAVLTSG LTLQ+VRVIY+RTS+FFWF+VE  
Sbjct  214  KCSNDGVSVFRTRIEGGAKAVLTSGDLTLQRVRVIYARTSIFFWFDVEHQ  263



>ref|XP_010067744.1| PREDICTED: F-box protein SKIP5 [Eucalyptus grandis]
 gb|KCW65929.1| hypothetical protein EUGRSUZ_G03245 [Eucalyptus grandis]
Length=257

 Score =   377 bits (967),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/228 (80%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRSVRDSS PG+FPN
Sbjct  27   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVDRSVRDSSEPGVFPN  86

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTILIA GGSH  SNIQIKKPLCLIG GE+PD+T+L CSRGSDSALEFL
Sbjct  87   IELAVSAARPGDTILIAAGGSHVASNIQIKKPLCLIGGGELPDETMLLCSRGSDSALEFL  146

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKL+NLTV+AELGCCLLHRSGRL IDGCILQCE++PLD+LS  IVSTA+  + + +  
Sbjct  147  STCKLSNLTVKAELGCCLLHRSGRLIIDGCILQCETDPLDYLSCPIVSTATGSKVVSSPN  206

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVE  135
              + D VSV RTRIEGGAKAVLTSG L LQ+VRVI +RTS+FFWF+VE
Sbjct  207  GCHGDGVSVSRTRIEGGAKAVLTSGDLALQRVRVICARTSMFFWFDVE  254



>ref|XP_006420750.1| hypothetical protein CICLE_v10005678mg [Citrus clementina]
 gb|ESR33990.1| hypothetical protein CICLE_v10005678mg [Citrus clementina]
Length=258

 Score =   375 bits (964),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/229 (79%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMH+FSFLSPIPDRYNTALVCHRW +LACHPRLWLRVD+SV+D S PG+FP+
Sbjct  30   INNLDDGCLMHVFSFLSPIPDRYNTALVCHRWNYLACHPRLWLRVDQSVKDLSEPGVFPD  89

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            ++TAVS ARPGDTILIA GGSH VSNIQIKK LCL+G GE+PD+T L CSRGSDSALEFL
Sbjct  90   LKTAVSVARPGDTILIAAGGSHPVSNIQIKKQLCLVGGGELPDETTLICSRGSDSALEFL  149

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTVRAELGCCLLHRSGRLTIDGC+LQCE+NPLD LS  IVSTA S     T +
Sbjct  150  STCKLANLTVRAELGCCLLHRSGRLTIDGCVLQCETNPLDFLSCPIVSTARSCIT-STPM  208

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
            K+N DSV+VL TRIEGGAKAVLTSG L LQ+VRVIY+RT L+FWF+V+ 
Sbjct  209  KSNGDSVTVLHTRIEGGAKAVLTSGDLVLQRVRVIYARTYLYFWFDVDH  257



>ref|XP_007218829.1| hypothetical protein PRUPE_ppa010167mg [Prunus persica]
 gb|EMJ20028.1| hypothetical protein PRUPE_ppa010167mg [Prunus persica]
Length=261

 Score =   375 bits (964),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 202/231 (87%), Gaps = 1/231 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDS-SLPGIFP  642
            INNLDDGCLMHIFSFL PIPDRYNTALVCHRW FLACHPRLWLRV+RSV+D    PG+FP
Sbjct  31   INNLDDGCLMHIFSFLPPIPDRYNTALVCHRWLFLACHPRLWLRVERSVKDRLEEPGVFP  90

Query  641  NIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEF  462
            +IETAV++ARPGDTILIA GG H  SNIQIKK LCLIG GE+PD+T L CSR SDSALE 
Sbjct  91   DIETAVAAARPGDTILIAAGGRHLASNIQIKKRLCLIGGGELPDETTLFCSRASDSALEL  150

Query  461  LSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTT  282
            LSTCKLANLTV+AELGCCLLHR+GRLTI+GC+LQCESNPLDHLS  IVSTAS+    P++
Sbjct  151  LSTCKLANLTVKAELGCCLLHRNGRLTIEGCVLQCESNPLDHLSCPIVSTASAQTVFPSS  210

Query  281  LKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
            +K + D VSV RTRIEGGAKAVLTSG LTLQ+VRVIY+RTS+FFWF+VE  
Sbjct  211  VKCSKDGVSVFRTRIEGGAKAVLTSGDLTLQRVRVIYARTSIFFWFDVEHQ  261



>gb|KJB74631.1| hypothetical protein B456_012G017000 [Gossypium raimondii]
Length=252

 Score =   375 bits (963),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 183/227 (81%), Positives = 200/227 (88%), Gaps = 1/227 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRSV+D S PG+FPN
Sbjct  24   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVDRSVQDFSEPGVFPN  83

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTILIA GGSH  SNIQIKKPLCLIG GE+PD+T + C RGSDSALEFL
Sbjct  84   IEEAVSAARPGDTILIAAGGSHLASNIQIKKPLCLIGGGELPDETTVICLRGSDSALEFL  143

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKL NLTV+AELGCCLLHRSGRL ID CILQCESNPLD+LS  I+STA S    P+ L
Sbjct  144  STCKLTNLTVKAELGCCLLHRSGRLIIDECILQCESNPLDYLSCPIMSTAGSGV-FPSNL  202

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNV  138
            K++ DS+SV  TRIEGGAKAVLTSG L LQQVRVIY+RTSL+FWF+V
Sbjct  203  KSDGDSISVSHTRIEGGAKAVLTSGDLALQQVRVIYARTSLYFWFDV  249



>ref|XP_004307123.1| PREDICTED: F-box protein SKIP5 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=261

 Score =   372 bits (956),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            IN LDDGCLMHIFSFLSPIPDRYNTALVCHRW FLACHPRLWLRV+RS++D   PG+FP+
Sbjct  32   INKLDDGCLMHIFSFLSPIPDRYNTALVCHRWLFLACHPRLWLRVERSIKDPLEPGVFPS  91

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IETAV++ARPGDTILI+ GG H  S+IQIKKPLCLIG GE+PD+T L CSRG+DSALEFL
Sbjct  92   IETAVAAARPGDTILISAGGRHLASDIQIKKPLCLIGGGELPDETTLICSRGADSALEFL  151

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTV+ ELGCCLLHRSGRLTIDGC+LQCESNPLD LS  IVSTAS+   L  ++
Sbjct  152  STCKLANLTVKTELGCCLLHRSGRLTIDGCVLQCESNPLDFLSVPIVSTASAQTVLSPSV  211

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
            K   D VSV RTRIEGGAKAV TSG LTLQ+VRVIY+RTSL FWF++EQ 
Sbjct  212  KGYKDGVSVSRTRIEGGAKAVSTSGDLTLQRVRVIYARTSLVFWFDMEQQ  261



>ref|XP_009354454.1| PREDICTED: F-box protein SKIP5 isoform X1 [Pyrus x bretschneideri]
Length=263

 Score =   372 bits (956),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRS +D   PG+FPN
Sbjct  34   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWLYLACHPRLWLRVDRSAKDLLEPGVFPN  93

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            +ETAV +ARPGDTILI+ GG H   NIQIKK LCLIGAGE PD+T + CSRGSDSALE L
Sbjct  94   LETAVEAARPGDTILISAGGRHLAYNIQIKKRLCLIGAGEQPDETTIYCSRGSDSALELL  153

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTV+AELGCCLLHRSGR+TI+GC+LQCE+NPLDHLS  IVSTAS+   + + +
Sbjct  154  STCKLANLTVKAELGCCLLHRSGRVTIEGCVLQCETNPLDHLSCPIVSTASAQTVISSPV  213

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
            K + D VSV RTRIEGGAKAVLTSG LTLQ+VRVIY+RTS+FFWF+VE  
Sbjct  214  KCSNDGVSVFRTRIEGGAKAVLTSGDLTLQRVRVIYARTSIFFWFDVEHQ  263



>ref|XP_008813420.1| PREDICTED: F-box protein SKIP5 [Phoenix dactylifera]
Length=258

 Score =   372 bits (955),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 202/234 (86%), Gaps = 1/234 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRV++ +++ + PG+F N
Sbjct  23   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVEKPMKNIAEPGVFIN  82

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            +E A+S+ARPGDTILIA GG H  SNIQI+KPLC++G GEIPDDTILTCSRGSDSALEFL
Sbjct  83   LEAAISAARPGDTILIAAGGDHVASNIQIQKPLCIMGGGEIPDDTILTCSRGSDSALEFL  142

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCK+ANLT+RAELGCCLLHRSG+LTI+GCILQCE NPLDHLS+ IVSTAS       ++
Sbjct  143  STCKVANLTIRAELGCCLLHRSGKLTIEGCILQCEENPLDHLSFPIVSTASGCSAFAPSV  202

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNV-EQDGSS  120
            K + DSV+V RTRIEGGAKAV TSG L LQ VR IYSRTS+FFWF V EQ  S+
Sbjct  203  KGHGDSVTVARTRIEGGAKAVRTSGNLVLQHVRAIYSRTSIFFWFEVGEQQVSA  256



>ref|XP_006403571.1| hypothetical protein EUTSA_v10010628mg [Eutrema salsugineum]
 gb|ESQ45024.1| hypothetical protein EUTSA_v10010628mg [Eutrema salsugineum]
Length=272

 Score =   371 bits (952),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 202/238 (85%), Gaps = 8/238 (3%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D + PG++P+
Sbjct  35   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLTKPGVYPS  94

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTILI  GG+HRVSNIQIKKPLCLIG GEIPD+T L CSRGSDSALE L
Sbjct  95   IEAAVSAARPGDTILIGAGGNHRVSNIQIKKPLCLIGGGEIPDETTLVCSRGSDSALELL  154

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLS  IVSTA +  D+ + +
Sbjct  155  STCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLSCPIVSTAGNEEDILSHV  214

Query  278  --------KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
                    K    SVSVL+TRIEGGAKAV TSG L LQ+VRV+YS+  L+FWF+V+ +
Sbjct  215  EVKEAVVEKIKGHSVSVLQTRIEGGAKAVSTSGDLVLQRVRVMYSKAYLYFWFDVDHE  272



>ref|XP_010095957.1| hypothetical protein L484_023946 [Morus notabilis]
 gb|EXB62650.1| hypothetical protein L484_023946 [Morus notabilis]
Length=258

 Score =   369 bits (947),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 197/230 (86%), Gaps = 0/230 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDG LMHIFSFLSPIPDRYNTALVCHRW++LACHPRLWLRVDRSV D S PG FP+
Sbjct  29   INNLDDGSLMHIFSFLSPIPDRYNTALVCHRWKYLACHPRLWLRVDRSVTDLSEPGAFPS  88

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IETAV++AR GDTILIA GG H  SNIQIKKPLCLIG GE+PD+T L CSRGSDSALEFL
Sbjct  89   IETAVAAARAGDTILIAAGGKHLASNIQIKKPLCLIGGGELPDETTLICSRGSDSALEFL  148

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTV+AELGCCLLHRSGRLTID C+LQCESNPLD LS  IVSTAS      +  
Sbjct  149  STCKLANLTVKAELGCCLLHRSGRLTIDDCVLQCESNPLDFLSCPIVSTASGQVFSSSMK  208

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
            K + DSVSV +TRIEGGAKAV TSG L LQ+VRVIY+RTSLFFWF++E  
Sbjct  209  KYHRDSVSVSQTRIEGGAKAVSTSGDLALQRVRVIYARTSLFFWFDMEHQ  258



>ref|XP_010999613.1| PREDICTED: F-box protein SKIP5-like isoform X1 [Populus euphratica]
 ref|XP_010999615.1| PREDICTED: F-box protein SKIP5-like isoform X1 [Populus euphratica]
Length=251

 Score =   367 bits (943),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRV++S +D S PG+FP+
Sbjct  22   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVEQSAKDLSEPGVFPS  81

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTILIA GG H  SNIQI KPLCLIG GE+PD+T L CSRGSDSALEF+
Sbjct  82   IEKAVSAARPGDTILIAAGGRHLASNIQINKPLCLIGGGELPDETTLLCSRGSDSALEFI  141

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTV+AELGCCLLH+SGRLTID CILQCE++PLD+LS  I+STA     + + +
Sbjct  142  STCKLANLTVKAELGCCLLHKSGRLTIDSCILQCEASPLDYLSCPIISTAGGNEVVSSAV  201

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVE  135
            KT  + VSV +TRIEGGAKAVLTSG LTLQQVRVIY+RTS++FWF+V+
Sbjct  202  KTKGNRVSVSQTRIEGGAKAVLTSGDLTLQQVRVIYARTSVYFWFDVD  249



>gb|KDP40515.1| hypothetical protein JCGZ_24514 [Jatropha curcas]
Length=252

 Score =   367 bits (942),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 195/229 (85%), Gaps = 0/229 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            IN LDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDR+V+D S PG++P+
Sbjct  23   INTLDDGCLMHIFSFLSPIPDRYNTALVCHRWHYLACHPRLWLRVDRAVKDLSEPGVYPS  82

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTILI+ GG+H  SNIQI KPLCLIG GE+PD T L CSRGSDSALEFL
Sbjct  83   IEMAVSAARPGDTILISAGGNHVASNIQINKPLCLIGGGELPDQTTLLCSRGSDSALEFL  142

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTV+ ELGCCLLHRSGRLTIDGCILQCESNPLD+LS  IVSTA       +++
Sbjct  143  STCKLANLTVKTELGCCLLHRSGRLTIDGCILQCESNPLDYLSCPIVSTAGENEIFSSSV  202

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
            KT+ D V V +TRIEGGAKAVLT G L L +VRVIYSR  ++FWF+VE 
Sbjct  203  KTDGDGVHVSQTRIEGGAKAVLTKGDLALHRVRVIYSRAYVYFWFDVEH  251



>ref|XP_010427150.1| PREDICTED: F-box protein SKIP5 [Camelina sativa]
Length=273

 Score =   368 bits (944),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 199/237 (84%), Gaps = 7/237 (3%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +NNLDDGCLMHI SFL+PIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D + PG+F N
Sbjct  37   LNNLDDGCLMHILSFLAPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLTQPGVFRN  96

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCL+G GEIPD+T L CSRGSDSALE L
Sbjct  97   IESAVSAARPGDTILIGAGGNHHVSNIQIKKPLCLVGGGEIPDETTLICSRGSDSALELL  156

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPR------  297
            STCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLSY IVSTA          
Sbjct  157  STCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLSYPIVSTAGDEDILGHVE  216

Query  296  -DLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
             D     K   +SV+VL+TRIEGGAKAV TSG L LQ+VRV+YS+  L+FWF+V+ +
Sbjct  217  VDETVVEKIKGNSVTVLQTRIEGGAKAVSTSGDLVLQRVRVMYSKAYLYFWFDVDYE  273



>ref|XP_010999614.1| PREDICTED: F-box protein SKIP5-like isoform X2 [Populus euphratica]
Length=268

 Score =   367 bits (943),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRV++S +D S PG+FP+
Sbjct  39   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVEQSAKDLSEPGVFPS  98

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTILIA GG H  SNIQI KPLCLIG GE+PD+T L CSRGSDSALEF+
Sbjct  99   IEKAVSAARPGDTILIAAGGRHLASNIQINKPLCLIGGGELPDETTLLCSRGSDSALEFI  158

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTV+AELGCCLLH+SGRLTID CILQCE++PLD+LS  I+STA     + + +
Sbjct  159  STCKLANLTVKAELGCCLLHKSGRLTIDSCILQCEASPLDYLSCPIISTAGGNEVVSSAV  218

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVE  135
            KT  + VSV +TRIEGGAKAVLTSG LTLQQVRVIY+RTS++FWF+V+
Sbjct  219  KTKGNRVSVSQTRIEGGAKAVLTSGDLTLQQVRVIYARTSVYFWFDVD  266



>gb|KFK34691.1| hypothetical protein AALP_AA5G179200 [Arabis alpina]
Length=269

 Score =   367 bits (943),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 202/238 (85%), Gaps = 8/238 (3%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +++LDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D SLPG+F N
Sbjct  32   LHDLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDPSLPGVFRN  91

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE+AVS+ARPGDTILI  GGSH VSNIQI+KPLCL+G GEIPD+T L CSRGSDSALE L
Sbjct  92   IESAVSAARPGDTILIGAGGSHHVSNIQIEKPLCLVGGGEIPDETTLVCSRGSDSALELL  151

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDL--PT  285
            STCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLS  IVSTA +  D+  P 
Sbjct  152  STCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLSCPIVSTAVNEEDILDPV  211

Query  284  TL------KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
             +      K   +SVSV +TRIEGGAKAV TSG L LQ+VRV+YS+  L+FWF+V+ +
Sbjct  212  EVKDTVVEKIKGNSVSVFQTRIEGGAKAVATSGDLVLQRVRVMYSKAYLYFWFDVDHE  269



>ref|XP_010504251.1| PREDICTED: F-box protein SKIP5-like [Camelina sativa]
Length=273

 Score =   367 bits (942),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 199/237 (84%), Gaps = 7/237 (3%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +NNLDDGCLMHI SFL+PIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D + PG+F N
Sbjct  37   LNNLDDGCLMHILSFLAPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLTQPGVFRN  96

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCL+G GEIPD+T L CSRGSDSALE L
Sbjct  97   IESAVSAARPGDTILIGAGGNHHVSNIQIKKPLCLVGGGEIPDETTLICSRGSDSALELL  156

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPR------  297
            STCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLSY IVSTA          
Sbjct  157  STCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLSYPIVSTAGDEDILGHVE  216

Query  296  -DLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
             D     K   +SV+VL+TRIEGGAKAV TSG L LQ+VRV+YS+  L+FWF+V+ +
Sbjct  217  VDETVVEKIRGNSVTVLQTRIEGGAKAVSTSGDLVLQRVRVMYSKAYLYFWFDVDYE  273



>gb|KJB74633.1| hypothetical protein B456_012G017000 [Gossypium raimondii]
Length=259

 Score =   366 bits (940),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/234 (78%), Positives = 199/234 (85%), Gaps = 8/234 (3%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRSV+D S PG+FPN
Sbjct  24   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVDRSVQDFSEPGVFPN  83

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDS-----  474
            IE AVS+ARPGDTILIA GGSH  SNIQIKKPLCLIG GE+PD+T + C RGSD      
Sbjct  84   IEEAVSAARPGDTILIAAGGSHLASNIQIKKPLCLIGGGELPDETTVICLRGSDRFANFL  143

Query  473  --ALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSP  300
              ALEFLSTCKL NLTV+AELGCCLLHRSGRL ID CILQCESNPLD+LS  I+STA S 
Sbjct  144  TIALEFLSTCKLTNLTVKAELGCCLLHRSGRLIIDECILQCESNPLDYLSCPIMSTAGSG  203

Query  299  RDLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNV  138
               P+ LK++ DS+SV  TRIEGGAKAVLTSG L LQQVRVIY+RTSL+FWF+V
Sbjct  204  V-FPSNLKSDGDSISVSHTRIEGGAKAVLTSGDLALQQVRVIYARTSLYFWFDV  256



>ref|XP_010515975.1| PREDICTED: F-box protein SKIP5 [Camelina sativa]
Length=273

 Score =   367 bits (941),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 199/237 (84%), Gaps = 7/237 (3%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +NNLDDGCLMHI SFL+PIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D + PG+F N
Sbjct  37   LNNLDDGCLMHILSFLAPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLTQPGVFRN  96

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCL+G GEIPD+T L CSRGSDSALE L
Sbjct  97   IESAVSAARPGDTILIGAGGNHHVSNIQIKKPLCLVGGGEIPDETTLICSRGSDSALELL  156

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPR------  297
            STCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLSY IVSTA          
Sbjct  157  STCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLSYPIVSTAGDEDILGHVE  216

Query  296  -DLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
             D     K   +SV+VL+TRIEGGAKAV TSG L LQ+VRV+YS+  L+FWF+V+ +
Sbjct  217  VDETVVEKIRGNSVTVLQTRIEGGAKAVSTSGDLVLQRVRVMYSKAYLYFWFDVDYE  273



>ref|NP_566999.1| SKP1/ASK-interacting protein 5 [Arabidopsis thaliana]
 sp|Q94FT2.1|SKIP5_ARATH RecName: Full=F-box protein SKIP5; AltName: Full=SKP1-interacting 
partner 5 [Arabidopsis thaliana]
 gb|AAK61345.1|AF347972_1 SKP1-interacting partner 5 [Arabidopsis thaliana]
 gb|AAM61599.1| SKP1 interacting partner SKIP5 [Arabidopsis thaliana]
 gb|AAO64798.1| At3g54480 [Arabidopsis thaliana]
 dbj|BAE99457.1| SKP1-interacting partner 5 [Arabidopsis thaliana]
 gb|AEE79236.1| SKP1/ASK-interacting protein 5 [Arabidopsis thaliana]
Length=274

 Score =   367 bits (941),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/246 (72%), Positives = 203/246 (83%), Gaps = 12/246 (5%)
 Frame = -2

Query  833  YSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLP  654
            YS   +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D S P
Sbjct  30   YSLTSLNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLSQP  89

Query  653  GIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDS  474
            G+F NIE+AVS+ARPGDTILI  GG++RVSNIQIKKPLCL+G GEIPD+T L C+RGSDS
Sbjct  90   GVFLNIESAVSAARPGDTILIVAGGNYRVSNIQIKKPLCLVGGGEIPDETTLVCARGSDS  149

Query  473  ALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRD  294
            ALE LSTCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLS  IVSTA    D
Sbjct  150  ALELLSTCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLSCPIVSTAGD-ED  208

Query  293  LPTTL-----------KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFW  147
            +   L           K  A+SV+VL+TRIEGGAKAV T G L LQ+VRV+YS+  L+FW
Sbjct  209  IENILSHVEVKETVTGKIKANSVTVLQTRIEGGAKAVSTRGDLVLQRVRVMYSKAYLYFW  268

Query  146  FNVEQD  129
            F+V+ +
Sbjct  269  FDVDYE  274



>gb|AAG21980.1| SKP1 interacting partner 5 [Arabidopsis thaliana]
Length=252

 Score =   366 bits (939),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/246 (72%), Positives = 203/246 (83%), Gaps = 12/246 (5%)
 Frame = -2

Query  833  YSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLP  654
            YS   +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D S P
Sbjct  8    YSLTSLNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLSQP  67

Query  653  GIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDS  474
            G+F NIE+AVS+ARPGDTILI  GG++RVSNIQIKKPLCL+G GEIPD+T L C+RGSDS
Sbjct  68   GVFLNIESAVSAARPGDTILIVAGGNYRVSNIQIKKPLCLVGGGEIPDETTLVCARGSDS  127

Query  473  ALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRD  294
            ALE LSTCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLS  IVSTA    D
Sbjct  128  ALELLSTCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLSCPIVSTAGD-ED  186

Query  293  LPTTL-----------KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFW  147
            +   L           K  A+SV+VL+TRIEGGAKAV T G L LQ+VRV+YS+  L+FW
Sbjct  187  IENILSHVEVKETVTGKIKANSVTVLQTRIEGGAKAVSTRGDLVLQRVRVMYSKAYLYFW  246

Query  146  FNVEQD  129
            F+V+ +
Sbjct  247  FDVDYE  252



>ref|XP_010938589.1| PREDICTED: F-box protein SKIP5 [Elaeis guineensis]
Length=258

 Score =   366 bits (939),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 201/234 (86%), Gaps = 2/234 (1%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLM IFSFLSPIPDRYNTALVCHRW +LACHPRLWLRV+R +++   PG+FPN
Sbjct  24   INNLDDGCLMQIFSFLSPIPDRYNTALVCHRWHYLACHPRLWLRVERPMKNIE-PGVFPN  82

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            +E A+S+ARPGDTILIA GG+H  SNIQI+KPLC++G GE+PDDTILTCSRGSDSALEFL
Sbjct  83   VEAAISAARPGDTILIAAGGNHVASNIQIQKPLCIMGGGELPDDTILTCSRGSDSALEFL  142

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCK+ANLT+RAELGCCLLHRSG+LTI+GCILQCE NPLD+LS+ IVSTAS       ++
Sbjct  143  STCKVANLTIRAELGCCLLHRSGKLTIEGCILQCEENPLDYLSFPIVSTASGCGAFTPSV  202

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNV-EQDGSS  120
            K + D V+V RTRIEGGAKAV TSG L LQ VR IYSRTS+FFWF V EQ  S+
Sbjct  203  KGHGDCVTVARTRIEGGAKAVRTSGNLVLQHVRAIYSRTSIFFWFEVGEQQVSA  256



>ref|XP_007011111.1| SKP1/ASK-interacting protein 5 isoform 1 [Theobroma cacao]
 gb|EOY19921.1| SKP1/ASK-interacting protein 5 isoform 1 [Theobroma cacao]
Length=263

 Score =   366 bits (940),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 201/229 (88%), Gaps = 2/229 (1%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            IN+LDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHP+LWLRVDRS++D S PG+FPN
Sbjct  34   INSLDDGCLMHIFSFLSPIPDRYNTALVCHRWHYLACHPQLWLRVDRSLKDFSEPGVFPN  93

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTILIA GGSH  SNIQI+KPLCLIG GE+PD+T L C RGSDSALEFL
Sbjct  94   IEEAVSAARPGDTILIAAGGSHLASNIQIRKPLCLIGGGELPDETTLLCLRGSDSALEFL  153

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKL NLTV+AELGCCLLHRSGRL ID CILQCESNPLD+LS  IVSTA S    P+ L
Sbjct  154  STCKLTNLTVKAELGCCLLHRSGRLIIDECILQCESNPLDYLSCPIVSTAGS-EVFPSNL  212

Query  278  KTN-ADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVE  135
            K++ +D VSV  TRIEGGAKAVLTSG L LQ+VRVIY+RTSL+FWF+V+
Sbjct  213  KSHRSDCVSVSHTRIEGGAKAVLTSGDLALQRVRVIYARTSLYFWFDVD  261



>ref|XP_002877981.1| skp1-interacting partner 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54240.1| skp1-interacting partner 5 [Arabidopsis lyrata subsp. lyrata]
Length=274

 Score =   366 bits (940),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/244 (73%), Positives = 202/244 (83%), Gaps = 12/244 (5%)
 Frame = -2

Query  833  YSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLP  654
            +S   INNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D S P
Sbjct  30   HSLTSINNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLSQP  89

Query  653  GIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDS  474
            G+F NIE+AVS+ARPGDTILI  GG+HR SNIQIKKPLCL+G GEIPD+T L C+RGSDS
Sbjct  90   GVFHNIESAVSAARPGDTILIGAGGNHRASNIQIKKPLCLVGGGEIPDETTLVCARGSDS  149

Query  473  ALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRD  294
            ALE LSTCKLANLTV+AELGCCLLHRSGR+TIDGC+LQCE+NPLDHLS  IVSTA    D
Sbjct  150  ALELLSTCKLANLTVKAELGCCLLHRSGRVTIDGCVLQCETNPLDHLSCPIVSTAGD-ED  208

Query  293  LPTTL-----------KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFW  147
            +   L           K  A+SV+VL+TRIEGGAKAV TSG L LQ+VRV+YS+  L+FW
Sbjct  209  IEDILSHVEVKETVAEKIRANSVTVLQTRIEGGAKAVSTSGDLVLQRVRVMYSKAYLYFW  268

Query  146  FNVE  135
            F+V+
Sbjct  269  FDVD  272



>ref|XP_011000542.1| PREDICTED: F-box protein SKIP5-like [Populus euphratica]
Length=251

 Score =   365 bits (937),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRV++S +D S PG+FP+
Sbjct  22   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVEQSAKDLSEPGVFPS  81

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTILIA GG H  SNIQI KPLCLIG GE+PD+T L CSRGSDSALEF+
Sbjct  82   IEKAVSAARPGDTILIAAGGRHLASNIQINKPLCLIGGGELPDETTLLCSRGSDSALEFI  141

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTV+AELGCCLLH+SGRLTID CILQCE++PLD+LS  I+STA     + + +
Sbjct  142  STCKLANLTVKAELGCCLLHKSGRLTIDSCILQCEASPLDYLSCPIISTAGGNEVVSSAV  201

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVE  135
            KT  + VSV +TRIEGGAKAVLTSG LTLQQVRVIY+RT ++FWF+V+
Sbjct  202  KTKGNRVSVSQTRIEGGAKAVLTSGDLTLQQVRVIYARTFVYFWFDVD  249



>ref|XP_006658920.1| PREDICTED: F-box protein SKIP5-like [Oryza brachyantha]
Length=245

 Score =   364 bits (934),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 198/230 (86%), Gaps = 1/230 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +N+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R +R+   PG++PN
Sbjct  17   VNSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERPIRNIIEPGVYPN  76

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            +E AVS+ARPGDTILIA GG+H   NIQIKKPLC+IG GE+PDDT+LTCSRGSD+ALEFL
Sbjct  77   LEAAVSAARPGDTILIAAGGTHVACNIQIKKPLCIIGGGELPDDTVLTCSRGSDNALEFL  136

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCK+ NLT+RAELGCCLLHRSGRLTI+ C+LQCE NPLD+LS+ I+STA      P +L
Sbjct  137  STCKIVNLTIRAELGCCLLHRSGRLTIEECLLQCEQNPLDYLSFPIISTAIEYNSFP-SL  195

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
            K     V+V+RTRIEGGAKAV T+GTL LQ+VR IYSR+S+FFWF V + 
Sbjct  196  KEQGHGVTVVRTRIEGGAKAVRTNGTLALQRVRAIYSRSSVFFWFEVGEK  245



>ref|XP_006292685.1| hypothetical protein CARUB_v10018930mg [Capsella rubella]
 gb|EOA25583.1| hypothetical protein CARUB_v10018930mg [Capsella rubella]
Length=271

 Score =   364 bits (935),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 197/237 (83%), Gaps = 7/237 (3%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR  +D + PG+F N
Sbjct  35   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFAKDLTQPGVFHN  94

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE+AV++ARPGDTILI  GG+H VSNIQIKKPLCL+G GEIPD+T L CSRGSDSALE L
Sbjct  95   IESAVAAARPGDTILIGAGGNHHVSNIQIKKPLCLVGGGEIPDETTLICSRGSDSALELL  154

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPR------  297
            STCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLSY IVSTA          
Sbjct  155  STCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLSYPIVSTAGDEDILGHVE  214

Query  296  -DLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
             D     K    SV+VL+TRIEGGAKAV TSG L LQ+VRV+YS+  L+FWF+V+ +
Sbjct  215  VDETVVEKIKGHSVTVLQTRIEGGAKAVSTSGDLVLQRVRVMYSKAYLYFWFDVDYE  271



>emb|CDX78238.1| BnaA09g34330D [Brassica napus]
Length=270

 Score =   364 bits (934),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/240 (73%), Positives = 203/240 (85%), Gaps = 10/240 (4%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVD  V+D SLPG+F +
Sbjct  31   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDPFVKDLSLPGVFHS  90

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCLIG+GEIPD+T L CSRGSDSALE L
Sbjct  91   IESAVSAARPGDTILIGAGGNHHVSNIQIKKPLCLIGSGEIPDETTLVCSRGSDSALELL  150

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPR------  297
            STCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLS  IVSTA   +      
Sbjct  151  STCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLSCPIVSTAGRDKEEDNLS  210

Query  296  --DLPTTL--KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
              ++  T+  K   +SV+VL+TRIEGGAKAV TSG L LQ+VRV+YS+  L+FWF+V+ +
Sbjct  211  LVEVKETVVEKIKGNSVAVLQTRIEGGAKAVATSGDLVLQRVRVMYSKDYLYFWFDVDHE  270



>ref|XP_004958577.1| PREDICTED: F-box protein SKIP5-like [Setaria italica]
Length=253

 Score =   362 bits (929),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 196/230 (85%), Gaps = 1/230 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +N+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R +RD   PG++PN
Sbjct  19   VNSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERPIRDVMEPGVYPN  78

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            +E AVS+ARPGDTIL+A GG+H   NIQIKK +C+IG GE+PDDT+LTCSRGSD+ALEFL
Sbjct  79   LEAAVSAARPGDTILVAAGGTHVACNIQIKKTICIIGGGELPDDTVLTCSRGSDNALEFL  138

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCK+ANLT+RAELGCCLLHRSGRLTI  C+LQCE NPLD+LS+ I+STA      P +L
Sbjct  139  STCKIANLTIRAELGCCLLHRSGRLTIQECLLQCEQNPLDYLSFPIISTAIEYNSFP-SL  197

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
            K     V+V+RTRIEGGAKAV T+GTL LQ VR IYSR+S+FFWF V + 
Sbjct  198  KGQGHGVTVVRTRIEGGAKAVRTNGTLALQHVRAIYSRSSVFFWFEVGEK  247



>ref|XP_002461155.1| hypothetical protein SORBIDRAFT_02g041860 [Sorghum bicolor]
 gb|EER97676.1| hypothetical protein SORBIDRAFT_02g041860 [Sorghum bicolor]
Length=248

 Score =   362 bits (928),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 197/230 (86%), Gaps = 1/230 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +N+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R +RD   PG++PN
Sbjct  20   MNSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERPIRDVMEPGVYPN  79

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            +E AVS+ARPGDTILIA GGSH   NIQIKKP+C+IG G++PDDT+LTCSRG D+ALEFL
Sbjct  80   LEAAVSAARPGDTILIAAGGSHVACNIQIKKPICIIGGGDLPDDTVLTCSRGFDNALEFL  139

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCK+ANLT+RAELGCCLLHRSG+LTI  C+LQCE NPLD+LS+ I+STA      P +L
Sbjct  140  STCKIANLTIRAELGCCLLHRSGKLTIQECLLQCEQNPLDYLSFPIISTAIEYNSFP-SL  198

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
            K     V+V+RTRIEGGAKAV T+GTL LQ+VR IYSR+S+FFWF V + 
Sbjct  199  KEQGHGVTVVRTRIEGGAKAVRTNGTLALQRVRAIYSRSSVFFWFEVGEK  248



>ref|XP_009116131.1| PREDICTED: F-box protein SKIP5-like [Brassica rapa]
Length=270

 Score =   362 bits (930),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 177/240 (74%), Positives = 203/240 (85%), Gaps = 10/240 (4%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVD  V+D SLPG+F +
Sbjct  31   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDPFVKDLSLPGVFHS  90

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCLIG+GEIPD+T L CSRGSDSALE L
Sbjct  91   IESAVSAARPGDTILIGAGGNHHVSNIQIKKPLCLIGSGEIPDETTLVCSRGSDSALELL  150

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTAS--------S  303
            STCKLANLTVRAELGCCLLHRSGRLTIDGC+LQCE+NPLDHLS  I+STA         S
Sbjct  151  STCKLANLTVRAELGCCLLHRSGRLTIDGCVLQCETNPLDHLSCPILSTAGRDEEEDNLS  210

Query  302  PRDLPTTL--KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
              ++  T+  K   +SV+VL+TRIEGGAKAV TSG L LQ+VRV+YS+  L+FWF+V+ +
Sbjct  211  LVEVKETVVEKIKGNSVTVLQTRIEGGAKAVATSGDLVLQRVRVMYSKDYLYFWFDVDHE  270



>ref|XP_002299213.2| SKP1-INTERACTING PARTNER 5 family protein [Populus trichocarpa]
 gb|EEE84018.2| SKP1-INTERACTING PARTNER 5 family protein [Populus trichocarpa]
Length=251

 Score =   361 bits (927),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/228 (75%), Positives = 198/228 (87%), Gaps = 0/228 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRV++S +D S PG+FP+
Sbjct  22   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVEQSAKDLSEPGVFPS  81

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTILIA GG H  SNIQI KPLCLIG GE+PD+T L CSRGSDSALEF+
Sbjct  82   IEKAVSAARPGDTILIAAGGRHLASNIQINKPLCLIGGGELPDETTLLCSRGSDSALEFI  141

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            +TCKLANLTV+AELGCCLLHRSGRLTID CILQCE++PLD+LS  I+ TA     + + +
Sbjct  142  NTCKLANLTVKAELGCCLLHRSGRLTIDSCILQCEASPLDYLSCPIICTAGGNEVVSSAV  201

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVE  135
            KT  + +SV +TRIEGGAKAVLTSG LTLQQVRVIY+RT ++FWF+V+
Sbjct  202  KTKGNRISVSQTRIEGGAKAVLTSGDLTLQQVRVIYARTFVYFWFDVD  249



>ref|XP_010670456.1| PREDICTED: F-box protein SKIP5 [Beta vulgaris subsp. vulgaris]
Length=278

 Score =   361 bits (926),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/232 (74%), Positives = 198/232 (85%), Gaps = 2/232 (1%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            IN LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDR+++D S PG+F +
Sbjct  47   INTLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRTIKDLSEPGVFSS  106

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            I+ AVS+A+PGDTILIA GG H  SNIQIKKPLCLIGAGE+P++T L CSRGSDSALE+ 
Sbjct  107  IDAAVSAAQPGDTILIAAGGVHITSNIQIKKPLCLIGAGELPEETTLLCSRGSDSALEYF  166

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            ST K+ANLTV+AELGCCLLHRSGRL ID CILQCE++PLD+LS  IVST+  P+ LP++L
Sbjct  167  STSKIANLTVKAELGCCLLHRSGRLIIDSCILQCETDPLDYLSCPIVSTSVGPKKLPSSL  226

Query  278  K--TNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
               T  D V+V  TRIEGGAKAV TSGTL LQ+VRVIY R+S+ FWF+VE  
Sbjct  227  SSTTLGDGVTVSHTRIEGGAKAVSTSGTLVLQRVRVIYGRSSVLFWFDVEHQ  278



>ref|XP_009139236.1| PREDICTED: F-box protein SKIP5-like isoform X2 [Brassica rapa]
Length=292

 Score =   361 bits (926),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 199/238 (84%), Gaps = 9/238 (4%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHP LWLRVDR V+D S PG+F +
Sbjct  54   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPLLWLRVDRFVKDLSQPGVFHD  113

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCLIG GE PD+T L CSRGSDSALE L
Sbjct  114  IESAVSAARPGDTILIGAGGNHLVSNIQIKKPLCLIGGGETPDETTLVCSRGSDSALELL  173

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPR------  297
            STCKLANLTV+AELGCCLLHRSGR+TIDGC+LQCE+NPLDHLS  IV+TA          
Sbjct  174  STCKLANLTVKAELGCCLLHRSGRVTIDGCVLQCETNPLDHLSCPIVTTAGDEEEDILSH  233

Query  296  -DLPTTL--KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
             ++  T+  K   +SVSVL+TRIEGGAKAVLTSG L LQ+VRVIYS+  L+FWF+V+ 
Sbjct  234  VEVKETVVEKIKGNSVSVLQTRIEGGAKAVLTSGDLVLQRVRVIYSKAYLYFWFDVDH  291



>gb|KJB74634.1| hypothetical protein B456_012G017000 [Gossypium raimondii]
Length=279

 Score =   360 bits (924),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/254 (72%), Positives = 200/254 (79%), Gaps = 28/254 (11%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRSV+D S PG+FPN
Sbjct  24   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVDRSVQDFSEPGVFPN  83

Query  638  IETAVSSAR---------------------------PGDTILIAGGGSHRVSNIQIKKPL  540
            IE AVS+AR                           PGDTILIA GGSH  SNIQIKKPL
Sbjct  84   IEEAVSAARYIKLLLICGLGLYGILLRPYLQTLPFRPGDTILIAAGGSHLASNIQIKKPL  143

Query  539  CLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQ  360
            CLIG GE+PD+T + C RGSDSALEFLSTCKL NLTV+AELGCCLLHRSGRL ID CILQ
Sbjct  144  CLIGGGELPDETTVICLRGSDSALEFLSTCKLTNLTVKAELGCCLLHRSGRLIIDECILQ  203

Query  359  CESNPLDHLSYAIVSTASSPRDLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVR  180
            CESNPLD+LS  I+STA S    P+ LK++ DS+SV  TRIEGGAKAVLTSG L LQQVR
Sbjct  204  CESNPLDYLSCPIMSTAGSGV-FPSNLKSDGDSISVSHTRIEGGAKAVLTSGDLALQQVR  262

Query  179  VIYSRTSLFFWFNV  138
            VIY+RTSL+FWF+V
Sbjct  263  VIYARTSLYFWFDV  276



>emb|CDX76144.1| BnaA04g04080D [Brassica napus]
Length=271

 Score =   359 bits (922),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/240 (73%), Positives = 199/240 (83%), Gaps = 11/240 (5%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D S PG+F +
Sbjct  31   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLSQPGVFHD  90

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCLIG GE PD+T L CSRGSDSALE L
Sbjct  91   IESAVSAARPGDTILIGAGGNHLVSNIQIKKPLCLIGGGETPDETTLVCSRGSDSALELL  150

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTAS---------  306
            STCKLANLTV+AELGCCLLHRSGR+TIDGC+LQCE+NPLDHLS  IVSTA          
Sbjct  151  STCKLANLTVKAELGCCLLHRSGRVTIDGCVLQCETNPLDHLSCPIVSTAGEEEEEEDML  210

Query  305  SPRDLPTTL--KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
            S  ++  TL  K   +SVSV +TRIEGGAKAV TSG L LQ+VRV+YS+  L+FWF+V+ 
Sbjct  211  SHVEVKETLVEKIKGNSVSVFQTRIEGGAKAVSTSGDLVLQRVRVMYSKAYLYFWFDVDH  270



>ref|XP_008653434.1| PREDICTED: F-box protein SKIP5 [Zea mays]
 tpg|DAA63987.1| TPA: hypothetical protein ZEAMMB73_319872 [Zea mays]
Length=254

 Score =   357 bits (916),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 169/241 (70%), Positives = 200/241 (83%), Gaps = 1/241 (0%)
 Frame = -2

Query  854  EAAPYYCYSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRS  675
            E AP        +N+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R 
Sbjct  8    ELAPVVEELISPMNSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERP  67

Query  674  VRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILT  495
            +RD+  PG++P++E AVS+ARPGDTILIA GGSH   NIQIKKP+C+IG G++PDDT+LT
Sbjct  68   IRDAMEPGVYPDLEAAVSAARPGDTILIAAGGSHVACNIQIKKPICIIGGGDLPDDTVLT  127

Query  494  CSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVS  315
            CSRG D+ALEFLSTCK+ANLT+RAELGCCLLHR GRLTI  C+LQCE NPLDHLS+ I+S
Sbjct  128  CSRGFDNALEFLSTCKIANLTIRAELGCCLLHRGGRLTIQECLLQCEQNPLDHLSFPIIS  187

Query  314  TASSPRDLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVE  135
            TA    D  ++LK     V+V+RTRIEGGA+AV T+GTL L+ VR IYSR+S+FFWF V 
Sbjct  188  TAIE-YDPFSSLKEQGHGVTVVRTRIEGGARAVRTNGTLALRHVRAIYSRSSVFFWFEVG  246

Query  134  Q  132
            +
Sbjct  247  E  247



>ref|XP_004142419.1| PREDICTED: F-box protein SKIP5-like [Cucumis sativus]
 gb|KGN52308.1| hypothetical protein Csa_5G623720 [Cucumis sativus]
Length=272

 Score =   354 bits (909),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 194/226 (86%), Gaps = 1/226 (0%)
 Frame = -2

Query  809  LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIET  630
            LDDGCLMHIFSFLSPIPDRYNTALVCHRWR+LACHPRLWLRV+RS++D S PG+FP IE 
Sbjct  44   LDDGCLMHIFSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVERSIKDLSEPGVFPTIEA  103

Query  629  AVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTC  450
            AV++ARPGDTILIA GG H  SNIQI KPLCLIG GE+P++T L C+RGS+SALEFLST 
Sbjct  104  AVAAARPGDTILIATGGVHSASNIQITKPLCLIGGGELPEETTLFCTRGSESALEFLSTS  163

Query  449  KLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTLKTN  270
            KL+NLTV+AELGCCLLHR GRL +DGC+LQCESNPLD+LS  IV TAS  + LP+++K  
Sbjct  164  KLSNLTVKAELGCCLLHRKGRLIVDGCVLQCESNPLDYLSCPIVCTASPDKLLPSSVKGG  223

Query  269  -ADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVE  135
                VSV  TRIEGGAKAVLTS  LTLQ VRVIY+RT+LFFWF+VE
Sbjct  224  YTHGVSVSHTRIEGGAKAVLTSEDLTLQHVRVIYARTALFFWFDVE  269



>ref|XP_010659170.1| PREDICTED: F-box protein SKIP5 isoform X2 [Vitis vinifera]
Length=236

 Score =   353 bits (905),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = -2

Query  758  DRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGG  579
            DRYNTALVCHRW +LACHPRLWLRVDRSV+DSS PG+FP+IE AVS+ARPGDTILIA GG
Sbjct  27   DRYNTALVCHRWHYLACHPRLWLRVDRSVKDSSEPGVFPSIEMAVSAARPGDTILIAAGG  86

Query  578  SHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLH  399
            SH  SNIQIKKPLCLIG GE+PDDT L CSRGSDSALEFLSTCK+ANLTV+AELGCCLLH
Sbjct  87   SHLASNIQIKKPLCLIGGGELPDDTTLLCSRGSDSALEFLSTCKVANLTVKAELGCCLLH  146

Query  398  RSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTLKTNADSVSVLRTRIEGGAKA  219
            RSGRLTIDGCILQCESNPLD+LS  IVSTA+ P  L +++K++ DSVSV RTRIEGGAKA
Sbjct  147  RSGRLTIDGCILQCESNPLDYLSCPIVSTAAGPEILTSSVKSHGDSVSVSRTRIEGGAKA  206

Query  218  VLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
            V+TSG+L LQ+VRVIY+RTS+FFWF+V++
Sbjct  207  VVTSGSLALQRVRVIYARTSIFFWFDVDR  235



>gb|EEE67747.1| hypothetical protein OsJ_25443 [Oryza sativa Japonica Group]
Length=586

 Score =   363 bits (933),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 169/227 (74%), Positives = 199/227 (88%), Gaps = 1/227 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +N+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R +R++  PG++PN
Sbjct  18   VNSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERPIRNTIEPGVYPN  77

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            +E+AVS+ARPGDTILIA GG+H   NIQIKKPLC+IG GE+PDDT+LTCSRGSD+ALEF 
Sbjct  78   LESAVSAARPGDTILIAAGGTHVARNIQIKKPLCIIGGGELPDDTVLTCSRGSDNALEFH  137

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCK+ANLT+RAELGCCLLHRSGRLTI+ C+LQCE NPLD+LS+ I+STA    D  ++L
Sbjct  138  STCKIANLTIRAELGCCLLHRSGRLTIEECLLQCEQNPLDYLSFPIISTAIE-YDSFSSL  196

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNV  138
            K     V+V+RTRIEGGAKAV T+GTL LQ VR IYSR+S+FFWF V
Sbjct  197  KEQGHGVTVVRTRIEGGAKAVRTNGTLALQHVRAIYSRSSVFFWFEV  243



>ref|XP_009387040.1| PREDICTED: F-box protein SKIP5 [Musa acuminata subsp. malaccensis]
Length=279

 Score =   352 bits (904),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 192/230 (83%), Gaps = 0/230 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            I++LDDGCLMHIFSFL+PIPDRY+ ALVCHRWR L CHPRLWLRV+ S+R+   PG+FPN
Sbjct  50   IHSLDDGCLMHIFSFLTPIPDRYSIALVCHRWRCLVCHPRLWLRVENSIRNMGEPGVFPN  109

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            +E A+S+ARPGDTILIA G  H   NIQIKKPLCLIG GE PDDT+LTCSRGS+SALEFL
Sbjct  110  LEAAISAARPGDTILIAPGLDHVACNIQIKKPLCLIGGGEHPDDTVLTCSRGSESALEFL  169

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCK+ NL +RAELGCCLLHRSGRLTI+GCILQCE NPLD+LS+ I+STA+     P  +
Sbjct  170  STCKITNLMIRAELGCCLLHRSGRLTIEGCILQCEENPLDYLSFPIMSTANGCHAFPQPV  229

Query  278  KTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
            K + D V+V RTRIEGGAKAV TSG L LQ+VR IYSRTS+FFWF V + 
Sbjct  230  KGHGDGVTVARTRIEGGAKAVWTSGNLVLQRVRAIYSRTSIFFWFEVAEQ  279



>ref|XP_003559852.1| PREDICTED: F-box protein SKIP5 [Brachypodium distachyon]
Length=248

 Score =   350 bits (899),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 197/229 (86%), Gaps = 1/229 (0%)
 Frame = -2

Query  815  NNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNI  636
            N LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R +R+ + PG++ N+
Sbjct  21   NGLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERPLRNVTEPGVYANL  80

Query  635  ETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLS  456
            E AVS+ARPGDTILIA GG++  SNIQIKKPLC+IG+G +PDDT+LTCSRGS++ALE LS
Sbjct  81   EAAVSAARPGDTILIAAGGNYVASNIQIKKPLCIIGSGVLPDDTVLTCSRGSENALELLS  140

Query  455  TCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTLK  276
            TCK+ANLT+RAELGCCLLHRSG+LTI+ C+LQCE NP+D+LS+ I+STA    D  + LK
Sbjct  141  TCKIANLTIRAELGCCLLHRSGKLTIEECLLQCEQNPMDYLSFPIISTAIE-YDAFSPLK  199

Query  275  TNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
                 V+V+RTRIEGGAKAV T+GTL+LQ+VR IY+R S+FFWF V + 
Sbjct  200  EQGHGVTVVRTRIEGGAKAVRTNGTLSLQRVRAIYARRSVFFWFEVGEK  248



>ref|XP_008446937.1| PREDICTED: F-box protein SKIP5 isoform X1 [Cucumis melo]
Length=272

 Score =   351 bits (900),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 193/226 (85%), Gaps = 1/226 (0%)
 Frame = -2

Query  809  LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIET  630
            LDDGCLMHIFSFLSPIPDRYNTALVCHRWR+LACHPRLWLRV+R+++D S PG+FP IE 
Sbjct  44   LDDGCLMHIFSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVERTIKDLSEPGVFPTIEA  103

Query  629  AVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTC  450
            AV++ARPGDTILIA GG H  SNIQI KPLCLIG GE+P++T L C+RGS+SALEFLST 
Sbjct  104  AVAAARPGDTILIATGGVHSASNIQITKPLCLIGGGELPEETTLFCTRGSESALEFLSTS  163

Query  449  KLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTLKTN  270
            KL+NLTV+AELGCCLLHR GRL +DGC+LQCESNPLD+LS  IV TAS  + LP+++K  
Sbjct  164  KLSNLTVKAELGCCLLHRKGRLIVDGCVLQCESNPLDYLSCPIVCTASPDKLLPSSVKGG  223

Query  269  -ADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVE  135
                VSV  TRIEGGAKAVLTS  LTLQ VRVIY+RT+L FWF+VE
Sbjct  224  YTHGVSVSHTRIEGGAKAVLTSEDLTLQHVRVIYARTALLFWFDVE  269



>ref|XP_011469379.1| PREDICTED: F-box protein SKIP5 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=306

 Score =   351 bits (900),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 179/275 (65%), Positives = 200/275 (73%), Gaps = 45/275 (16%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            IN LDDGCLMHIFSFLSPIPDRYNTALVCHRW FLACHPRLWLRV+RS++D   PG+FP+
Sbjct  32   INKLDDGCLMHIFSFLSPIPDRYNTALVCHRWLFLACHPRLWLRVERSIKDPLEPGVFPS  91

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCL-------------------------  534
            IETAV++ARPGDTILI+ GG H  S+IQIKKPLCL                         
Sbjct  92   IETAVAAARPGDTILISAGGRHLASDIQIKKPLCLVCLNVIKTIFACMHLSSSPLLGLNV  151

Query  533  --------------------IGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELG  414
                                IG GE+PD+T L CSRG+DSALEFLSTCKLANLTV+ ELG
Sbjct  152  SSPIPWSKPSYEDKLIYFVQIGGGELPDETTLICSRGADSALEFLSTCKLANLTVKTELG  211

Query  413  CCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTLKTNADSVSVLRTRIE  234
            CCLLHRSGRLTIDGC+LQCESNPLD LS  IVSTAS+   L  ++K   D VSV RTRIE
Sbjct  212  CCLLHRSGRLTIDGCVLQCESNPLDFLSVPIVSTASAQTVLSPSVKGYKDGVSVSRTRIE  271

Query  233  GGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
            GGAKAV TSG LTLQ+VRVIY+RTSL FWF++EQ 
Sbjct  272  GGAKAVSTSGDLTLQRVRVIYARTSLVFWFDMEQQ  306



>ref|XP_006830359.1| hypothetical protein AMTR_s00116p00090490 [Amborella trichopoda]
 gb|ERM97775.1| hypothetical protein AMTR_s00116p00090490 [Amborella trichopoda]
Length=248

 Score =   337 bits (864),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 193/238 (81%), Gaps = 9/238 (4%)
 Frame = -2

Query  839  YCYSRH-DINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDS  663
            YC S    +N LDDGCLMHIF+ LSPIPDRYNTALVC RWRFLACHPRLWLRV+ SV+  
Sbjct  12   YCSSSSAPVNALDDGCLMHIFALLSPIPDRYNTALVCRRWRFLACHPRLWLRVEGSVKSQ  71

Query  662  SLPGIFPNIETAVSSARPGDTILI-AGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSR  486
            S PG+FPN+++A+ +ARPGDTILI AG   H  +NIQIKKPLCL+G G++PDDTIL  SR
Sbjct  72   SDPGVFPNLDSAILAARPGDTILISAGEEEHVATNIQIKKPLCLMGGGDLPDDTILVSSR  131

Query  485  GSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTAS  306
            GSDSALEFLSTCK++NLTVR+ELGCCLLHRSGRLT++GCILQC  +PLDHLS  IVSTA 
Sbjct  132  GSDSALEFLSTCKVSNLTVRSELGCCLLHRSGRLTVEGCILQCIEHPLDHLSCPIVSTAG  191

Query  305  SPRDLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
                   T     + VSV RTRIEGGAKAVLTSG+L L  VRV+Y+RTSL+FWF+V Q
Sbjct  192  -------TYSPVQNGVSVARTRIEGGAKAVLTSGSLVLHSVRVLYARTSLYFWFDVSQ  242



>ref|NP_001242768.1| uncharacterized protein LOC100808414 [Glycine max]
 gb|ACU24216.1| unknown [Glycine max]
Length=227

 Score =   333 bits (855),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 178/200 (89%), Gaps = 1/200 (1%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIF+FL PIPDR+NTALVCHRW +LACHPRLWLRVDRSV++ S PG+FPN
Sbjct  26   INNLDDGCLMHIFNFLPPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKELSEPGVFPN  85

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IETAVS++RPGDTILIA GG+HRV+NIQI+KPLCLIGAGE+PDDT L CSRGSDSALEFL
Sbjct  86   IETAVSASRPGDTILIAAGGTHRVANIQIRKPLCLIGAGEVPDDTTLVCSRGSDSALEFL  145

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
            STCKLANLTVRAELGCCLLHR GRLTIDGCILQCESNPLD+LS  IVSTASS   LP+  
Sbjct  146  STCKLANLTVRAELGCCLLHRKGRLTIDGCILQCESNPLDYLSCPIVSTASSSVVLPSQT  205

Query  278  KT-NADSVSVLRTRIEGGAK  222
            K+ N D V V +TRIEG  K
Sbjct  206  KSNNGDGVFVSQTRIEGVPK  225



>ref|XP_008446939.1| PREDICTED: F-box protein SKIP5 isoform X2 [Cucumis melo]
Length=233

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 178/216 (82%), Gaps = 1/216 (0%)
 Frame = -2

Query  779  SFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDT  600
            +F     DRYNTALVCHRWR+LACHPRLWLRV+R+++D S PG+FP IE AV++ARPGDT
Sbjct  15   TFAIEFADRYNTALVCHRWRYLACHPRLWLRVERTIKDLSEPGVFPTIEAAVAAARPGDT  74

Query  599  ILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAE  420
            ILIA GG H  SNIQI KPLCLIG GE+P++T L C+RGS+SALEFLST KL+NLTV+AE
Sbjct  75   ILIATGGVHSASNIQITKPLCLIGGGELPEETTLFCTRGSESALEFLSTSKLSNLTVKAE  134

Query  419  LGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTLKTN-ADSVSVLRT  243
            LGCCLLHR GRL +DGC+LQCESNPLD+LS  IV TAS  + LP+++K      VSV  T
Sbjct  135  LGCCLLHRKGRLIVDGCVLQCESNPLDYLSCPIVCTASPDKLLPSSVKGGYTHGVSVSHT  194

Query  242  RIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVE  135
            RIEGGAKAVLTS  LTLQ VRVIY+RT+L FWF+VE
Sbjct  195  RIEGGAKAVLTSEDLTLQHVRVIYARTALLFWFDVE  230



>ref|XP_008348378.1| PREDICTED: F-box protein SKIP5 isoform X2 [Malus domestica]
Length=213

 Score =   311 bits (798),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = -2

Query  728  RWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIK  549
            RW +LACHPRLWLRVDRSV+D   PG+FPN+ETAV +ARPGDTILIA GG H   NIQIK
Sbjct  14   RWLYLACHPRLWLRVDRSVKDXLEPGVFPNLETAVEAARPGDTILIAAGGRHLAYNIQIK  73

Query  548  KPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGC  369
            K LCLIGAGE PD+T + CSRGSDSALE LSTCKLANLTV+AELGCCLLHRSGR+TI+GC
Sbjct  74   KRLCLIGAGEQPDETTIYCSRGSDSALELLSTCKLANLTVKAELGCCLLHRSGRVTIEGC  133

Query  368  ILQCESNPLDHLSYAIVSTASSPRDLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQ  189
            +LQCE+NPLDHLS  IVSTAS+   + + +K + D VSV RTRIEGGAKAVLTSG LTLQ
Sbjct  134  VLQCETNPLDHLSCPIVSTASAQTVISSXVKCSNDGVSVFRTRIEGGAKAVLTSGDLTLQ  193

Query  188  QVRVIYSRTSLFFWFNVEQD  129
            +VRVIY+RTS+FFWF+VE  
Sbjct  194  RVRVIYARTSIFFWFDVEHQ  213



>ref|XP_009354455.1| PREDICTED: F-box protein SKIP5 isoform X2 [Pyrus x bretschneideri]
Length=213

 Score =   307 bits (786),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 170/200 (85%), Gaps = 0/200 (0%)
 Frame = -2

Query  728  RWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIK  549
            RW +LACHPRLWLRVDRS +D   PG+FPN+ETAV +ARPGDTILI+ GG H   NIQIK
Sbjct  14   RWLYLACHPRLWLRVDRSAKDLLEPGVFPNLETAVEAARPGDTILISAGGRHLAYNIQIK  73

Query  548  KPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGC  369
            K LCLIGAGE PD+T + CSRGSDSALE LSTCKLANLTV+AELGCCLLHRSGR+TI+GC
Sbjct  74   KRLCLIGAGEQPDETTIYCSRGSDSALELLSTCKLANLTVKAELGCCLLHRSGRVTIEGC  133

Query  368  ILQCESNPLDHLSYAIVSTASSPRDLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQ  189
            +LQCE+NPLDHLS  IVSTAS+   + + +K + D VSV RTRIEGGAKAVLTSG LTLQ
Sbjct  134  VLQCETNPLDHLSCPIVSTASAQTVISSPVKCSNDGVSVFRTRIEGGAKAVLTSGDLTLQ  193

Query  188  QVRVIYSRTSLFFWFNVEQD  129
            +VRVIY+RTS+FFWF+VE  
Sbjct  194  RVRVIYARTSIFFWFDVEHQ  213



>ref|XP_010999616.1| PREDICTED: F-box protein SKIP5-like isoform X3 [Populus euphratica]
Length=222

 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 170/200 (85%), Gaps = 0/200 (0%)
 Frame = -2

Query  728  RWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIK  549
            RW +LACHPRLWLRV++S +D S PG+FP+IE AVS+ARPGDTILIA GG H  SNIQI 
Sbjct  23   RWCYLACHPRLWLRVEQSAKDLSEPGVFPSIEKAVSAARPGDTILIAAGGRHLASNIQIN  82

Query  548  KPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGC  369
            KPLCLIG GE+PD+T L CSRGSDSALEF+STCKLANLTV+AELGCCLLH+SGRLTID C
Sbjct  83   KPLCLIGGGELPDETTLLCSRGSDSALEFISTCKLANLTVKAELGCCLLHKSGRLTIDSC  142

Query  368  ILQCESNPLDHLSYAIVSTASSPRDLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQ  189
            ILQCE++PLD+LS  I+STA     + + +KT  + VSV +TRIEGGAKAVLTSG LTLQ
Sbjct  143  ILQCEASPLDYLSCPIISTAGGNEVVSSAVKTKGNRVSVSQTRIEGGAKAVLTSGDLTLQ  202

Query  188  QVRVIYSRTSLFFWFNVEQD  129
            QVRVIY+RTS++FWF+V+  
Sbjct  203  QVRVIYARTSVYFWFDVDSQ  222



>ref|NP_001060527.1| Os07g0659700 [Oryza sativa Japonica Group]
 dbj|BAF22441.1| Os07g0659700, partial [Oryza sativa Japonica Group]
Length=272

 Score =   299 bits (766),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 169/197 (86%), Gaps = 1/197 (1%)
 Frame = -2

Query  728  RWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIK  549
            RWRFLACHPRLWLRV+R +R++  PG++PN+E+AVS+ARPGDTILIA GG+H   NIQIK
Sbjct  74   RWRFLACHPRLWLRVERPIRNTIEPGVYPNLESAVSAARPGDTILIAAGGTHVARNIQIK  133

Query  548  KPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGC  369
            KPLC+IG GE+PDDT+LTCSRGSD+ALEF STCK+ANLT+RAELGCCLLHRSGRLTI+ C
Sbjct  134  KPLCIIGGGELPDDTVLTCSRGSDNALEFHSTCKIANLTIRAELGCCLLHRSGRLTIEEC  193

Query  368  ILQCESNPLDHLSYAIVSTASSPRDLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQ  189
            +LQCE NPLD+LS+ I+STA    D  ++LK     V+V+RTRIEGGAKAV T+GTL LQ
Sbjct  194  LLQCEQNPLDYLSFPIISTAIE-YDSFSSLKEQGHGVTVVRTRIEGGAKAVRTNGTLALQ  252

Query  188  QVRVIYSRTSLFFWFNV  138
             VR IYSR+S+FFWF V
Sbjct  253  HVRAIYSRSSVFFWFEV  269



>dbj|BAJ85981.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=268

 Score =   299 bits (765),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 169/201 (84%), Gaps = 1/201 (0%)
 Frame = -2

Query  728  RWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIK  549
            RWRFLACHPRLWLRV+R +RD   PG++PN+E A+S+ARPGDTILIA GG++   NIQIK
Sbjct  64   RWRFLACHPRLWLRVERPLRDVKEPGVYPNLEAAISAARPGDTILIAAGGTYLACNIQIK  123

Query  548  KPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGC  369
            KPLC+IG GE+PDDT+LTCSRGSD+ALEFLSTCK+ANLT++AELGCCLLHRSG+LTI  C
Sbjct  124  KPLCIIGGGELPDDTVLTCSRGSDNALEFLSTCKIANLTIKAELGCCLLHRSGKLTIQEC  183

Query  368  ILQCESNPLDHLSYAIVSTASSPRDLPTTLK-TNADSVSVLRTRIEGGAKAVLTSGTLTL  192
            +LQCE NPLD+LS+ IVSTA     LP++LK      V+V+RTRIEGGAKAV T+GTL L
Sbjct  184  LLQCEPNPLDYLSFPIVSTAIEYNSLPSSLKEQQGHGVTVVRTRIEGGAKAVRTNGTLAL  243

Query  191  QQVRVIYSRTSLFFWFNVEQD  129
            Q+VR IY+R S+FFWF V + 
Sbjct  244  QRVRAIYARRSVFFWFEVGEK  264



>gb|ADE75775.1| unknown [Picea sitchensis]
Length=305

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 178/233 (76%), Gaps = 3/233 (1%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            IN LDDGCLM I SFLSP+PDRY+ A VC+RWR LA  PR+WLRV++S    S  G+F  
Sbjct  59   INALDDGCLMRILSFLSPLPDRYSAAGVCYRWRHLASDPRMWLRVEKSCNALSESGVFST  118

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            +E AV +ARPGDTILI+ G  H   NIQI KP+CL+G G  PD+T+L C RG DSALEFL
Sbjct  119  VEDAVIAARPGDTILISTGVVHIARNIQIIKPVCLVGGGSSPDETVLVCPRGFDSALEFL  178

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASS---PRDLP  288
            ST K+ANLT++AELG CLLHR+GRLT++ C+LQCE +PL+HL   IV TA +   P    
Sbjct  179  STGKVANLTIKAELGSCLLHRNGRLTVESCVLQCEEHPLEHLCCPIVCTADALAPPSSTL  238

Query  287  TTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
            +++     S+SV+ TRIEGGAKAVLT+G+LTLQQVRV+Y+RT+LFFWFNV Q 
Sbjct  239  SSIMKGGSSMSVIHTRIEGGAKAVLTNGSLTLQQVRVMYARTALFFWFNVSQK  291



>emb|CAB77568.1| putative protein [Arabidopsis thaliana]
Length=262

 Score =   295 bits (754),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/260 (59%), Positives = 178/260 (68%), Gaps = 52/260 (20%)
 Frame = -2

Query  833  YSRHDINNLDDGCLMHIFSFLSPIP--------------DRYNTALVCHRWRFLACHPRL  696
            YS   +NNLDDGCLMHI SFLSPIP              DRYNTALVCHRWR+LACHPRL
Sbjct  30   YSLTSLNNLDDGCLMHILSFLSPIPVCFNAVLCISCEFADRYNTALVCHRWRYLACHPRL  89

Query  695  WLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEI  516
            WLRVDR V+D S PG+F NIE+AVS+ARPGDTILI  GG++RVSNIQIKKPLCL+G GEI
Sbjct  90   WLRVDRFVKDLSQPGVFLNIESAVSAARPGDTILIVAGGNYRVSNIQIKKPLCLVGGGEI  149

Query  515  PDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDH  336
            PD+T L C+RGSD                          RSGRLTIDGC+LQCE+NPLDH
Sbjct  150  PDETTLVCARGSD--------------------------RSGRLTIDGCVLQCETNPLDH  183

Query  335  LSYAIVSTASSPRDLPTTL-----------KTNADSVSVLRTRIEGGAKAVLTSGTLTLQ  189
            LS  IVSTA    D+   L           K  A+SV+VL+TRIEGGAKAV T G L LQ
Sbjct  184  LSCPIVSTAGD-EDIENILSHVEVKETVTGKIKANSVTVLQTRIEGGAKAVSTRGDLVLQ  242

Query  188  QVRVIYSRTSLFFWFNVEQD  129
            +VRV+YS+  L+FWF+V+ +
Sbjct  243  RVRVMYSKAYLYFWFDVDYE  262



>ref|XP_007011112.1| SKP1/ASK-interacting protein 5 isoform 2, partial [Theobroma 
cacao]
 gb|EOY19922.1| SKP1/ASK-interacting protein 5 isoform 2, partial [Theobroma 
cacao]
Length=280

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/229 (66%), Positives = 170/229 (74%), Gaps = 38/229 (17%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            IN+LDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHP+LWLRVDRS++D S PG+FPN
Sbjct  87   INSLDDGCLMHIFSFLSPIPDRYNTALVCHRWHYLACHPQLWLRVDRSLKDFSEPGVFPN  146

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            IE AVS+ARPGDTILIA GGSH  SNIQI+KPLCL                         
Sbjct  147  IEEAVSAARPGDTILIAAGGSHLASNIQIRKPLCL-------------------------  181

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL  279
                       AELGCCLLHRSGRL ID CILQCESNPLD+LS  IVSTA S    P+ L
Sbjct  182  -----------AELGCCLLHRSGRLIIDECILQCESNPLDYLSCPIVSTAGS-EVFPSNL  229

Query  278  KTN-ADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVE  135
            K++ +D VSV  TRIEGGAKAVLTSG L LQ+VRVIY+RTSL+FWF+V+
Sbjct  230  KSHRSDCVSVSHTRIEGGAKAVLTSGDLALQRVRVIYARTSLYFWFDVD  278



>gb|EEC82615.1| hypothetical protein OsI_27192 [Oryza sativa Indica Group]
Length=184

 Score =   273 bits (699),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +N+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R +R++  PG++PN
Sbjct  18   VNSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERPIRNTIEPGVYPN  77

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            +E+AVS+ARPGDTILIA GG+H   NIQIKKPLC+IG GE+PDDT+LTCSRGSD+ALEFL
Sbjct  78   LESAVSAARPGDTILIAAGGTHVARNIQIKKPLCIIGGGELPDDTVLTCSRGSDNALEFL  137

Query  458  STCKLANLTVRAELGCCLLHRSGRLTIDGCIL  363
            STCK+ANLT+RAELGCCLLHRSGRLTI+ C+L
Sbjct  138  STCKIANLTIRAELGCCLLHRSGRLTIEECLL  169



>ref|XP_010659171.1| PREDICTED: F-box protein SKIP5 isoform X3 [Vitis vinifera]
Length=168

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -2

Query  629  AVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTC  450
            AVS+ARPGDTILIA GGSH  SNIQIKKPLCLIG GE+PDDT L CSRGSDSALEFLSTC
Sbjct  2    AVSAARPGDTILIAAGGSHLASNIQIKKPLCLIGGGELPDDTTLLCSRGSDSALEFLSTC  61

Query  449  KLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTLKTN  270
            K+ANLTV+AELGCCLLHRSGRLTIDGCILQCESNPLD+LS  IVSTA+ P  L +++K++
Sbjct  62   KVANLTVKAELGCCLLHRSGRLTIDGCILQCESNPLDYLSCPIVSTAAGPEILTSSVKSH  121

Query  269  ADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
             DSVSV RTRIEGGAKAV+TSG+L LQ+VRVIY+RTS+FFWF+V++
Sbjct  122  GDSVSVSRTRIEGGAKAVVTSGSLALQRVRVIYARTSIFFWFDVDR  167



>ref|XP_009139235.1| PREDICTED: F-box protein SKIP5-like isoform X1 [Brassica rapa]
Length=310

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 178/259 (69%), Gaps = 33/259 (13%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHP LWLRVDR V+D S PG+F +
Sbjct  54   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPLLWLRVDRFVKDLSQPGVFHD  113

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDT---------ILTCSR  486
            IE+AVS+AR  +  L+    S   S ++++  L LI   +    T          + C  
Sbjct  114  IESAVSAARLVEARLLMKPPS---SVLEVQTGLELIFPFKSSSWTCSMSPCLCFFIYCKE  170

Query  485  GSD------------SALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPL  342
             S             SALE LSTCKLANLTV+AELGCCLLHRSGR+TIDGC+LQCE+NPL
Sbjct  171  NSLVYGFFLLLGFLCSALELLSTCKLANLTVKAELGCCLLHRSGRVTIDGCVLQCETNPL  230

Query  341  DHLSYAIVSTASSPR-------DLPTTL--KTNADSVSVLRTRIEGGAKAVLTSGTLTLQ  189
            DHLS  IV+TA           ++  T+  K   +SVSVL+TRIEGGAKAVLTSG L LQ
Sbjct  231  DHLSCPIVTTAGDEEEDILSHVEVKETVVEKIKGNSVSVLQTRIEGGAKAVLTSGDLVLQ  290

Query  188  QVRVIYSRTSLFFWFNVEQ  132
            +VRVIYS+  L+FWF+V+ 
Sbjct  291  RVRVIYSKAYLYFWFDVDH  309



>gb|EMT11615.1| hypothetical protein F775_29980 [Aegilops tauschii]
Length=231

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/267 (51%), Positives = 163/267 (61%), Gaps = 71/267 (27%)
 Frame = -2

Query  854  EAAPYYCYSRHDINNLDDGCLMHIFSFLSPIP------------------------DRYN  747
            EAAP+       +N+LDDGCLMHIFSFLSPIP                        DRYN
Sbjct  7    EAAPWGEAPGSPVNSLDDGCLMHIFSFLSPIPGSTATDGKLVYVRSYSLRTTLSESDRYN  66

Query  746  TALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRV  567
            TALVCHRWRFLACHPRLWLRV+R +RD   PG++P++E A+S+A                
Sbjct  67   TALVCHRWRFLACHPRLWLRVERPLRDVKEPGVYPDLEAAISAA----------------  110

Query  566  SNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGR  387
                                          SALEFLSTCK+ANLT++AELGCCLLHRSG+
Sbjct  111  ------------------------------SALEFLSTCKIANLTIKAELGCCLLHRSGK  140

Query  386  LTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTLK-TNADSVSVLRTRIEGGAKAVLT  210
            LTI  C+LQCE NPLD+LS+ IVSTA     LP++LK      V+V+RTRIEGGAKAV T
Sbjct  141  LTIQECLLQCEPNPLDYLSFPIVSTAIEYNPLPSSLKEQQGHGVTVVRTRIEGGAKAVRT  200

Query  209  SGTLTLQQVRVIYSRTSLFFWFNVEQD  129
            +GTL LQ+VR IY+R S+FFWF V + 
Sbjct  201  NGTLALQRVRAIYARRSVFFWFEVGEK  227



>ref|XP_002976942.1| hypothetical protein SELMODRAFT_175869 [Selaginella moellendorffii]
 gb|EFJ22052.1| hypothetical protein SELMODRAFT_175869 [Selaginella moellendorffii]
Length=271

 Score =   237 bits (605),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 158/244 (65%), Gaps = 11/244 (5%)
 Frame = -2

Query  827  RHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSL---  657
            R  IN LDDGCL+ +  FL+P PDR+N A VC RW  L    R+WLRV  +  +SS    
Sbjct  18   RPSINLLDDGCLVRVLGFLAPFPDRFNAASVCSRWHKLIADSRMWLRVQSATANSSYNSF  77

Query  656  --PGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRG  483
               G F  ++ AV++ARPGDTI I  G  H V+N+ I KPLCL+G G  P++T+L    G
Sbjct  78   IQSGEFATLQDAVNAARPGDTIFIGPGEVHAVANVAIDKPLCLMGGGSSPEETVLISPSG  137

Query  482  SDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTAS-  306
            S+SAL F +  K+ANLT++AELG CLLHR G LT+D C L+CE +PL++LS  IV+TA  
Sbjct  138  SESALVFSANGKIANLTIKAELGSCLLHRRGSLTVDRCALECEEHPLEYLSCPIVTTAGG  197

Query  305  -SPRDLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
             +   LP      +D +SV+ TRI GG  AV T G+L LQQVRV+YSR ++ FWF V Q 
Sbjct  198  LAAHHLP----GKSDGLSVIETRIVGGTCAVKTVGSLVLQQVRVLYSRAAVIFWFTVAQQ  253

Query  128  GSST  117
              S 
Sbjct  254  SKSA  257



>ref|XP_002980686.1| hypothetical protein SELMODRAFT_178289 [Selaginella moellendorffii]
 gb|EFJ18337.1| hypothetical protein SELMODRAFT_178289 [Selaginella moellendorffii]
Length=271

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 158/243 (65%), Gaps = 11/243 (5%)
 Frame = -2

Query  827  RHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSL---  657
            R  IN LDDGCL+ +  FL+P PDR+N A VC RW  L    R+WLRV  +  +SS    
Sbjct  18   RPSINLLDDGCLVRVLGFLAPFPDRFNAASVCSRWHKLIADSRMWLRVQSATANSSYNSF  77

Query  656  --PGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRG  483
               G F  ++ AV++ARPGDTI I  G  H V+N+ I KPLCL+G G  P++T+L    G
Sbjct  78   IQSGEFATLQDAVNAARPGDTIFIEPGEVHAVANVAIDKPLCLMGGGSSPEETVLISPSG  137

Query  482  SDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTAS-  306
            S+SAL F +  K+ANLT++AELG CLLHR G LT+D C L+CE +PL++LS  IV+TA  
Sbjct  138  SESALVFSANGKIANLTIKAELGSCLLHRRGSLTVDRCALECEEHPLEYLSCPIVTTAGG  197

Query  305  -SPRDLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
             +   LP      +D +SV+ TRI GG  AV T G+L LQQVRV+YSR ++ FWF V Q 
Sbjct  198  LAAHHLP----GKSDGLSVIETRIVGGTCAVKTVGSLVLQQVRVLYSRAAVIFWFTVAQQ  253

Query  128  GSS  120
              S
Sbjct  254  SKS  256



>gb|KHG17417.1| F-box SKIP5 -like protein [Gossypium arboreum]
Length=264

 Score =   227 bits (579),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = -2

Query  587  GGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCC  408
             GGSH  SNIQIKKPLCLIG GE+PD+T + C RGSDSALEFLSTCKL NLTV+AELGCC
Sbjct  113  AGGSHLASNIQIKKPLCLIGGGELPDETNVICLRGSDSALEFLSTCKLTNLTVKAELGCC  172

Query  407  LLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTLKTNADSVSVLRTRIEGG  228
            LLHRSGRL ID CILQCESNPLD+LS  IVSTA S    P+ LK++ DS+SV  TRIEGG
Sbjct  173  LLHRSGRLIIDECILQCESNPLDYLSCPIVSTAGSGV-FPSNLKSDGDSISVSHTRIEGG  231

Query  227  AKAVLTSGTLTLQQVRVIYSRTSLFFWFNVE  135
            AKAVLTSG L LQQVRVIY+RT L+FWF+V+
Sbjct  232  AKAVLTSGDLALQQVRVIYARTCLYFWFDVD  262



>ref|XP_001765023.1| predicted protein [Physcomitrella patens]
 gb|EDQ70239.1| predicted protein [Physcomitrella patens]
Length=1280

 Score =   237 bits (604),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 155/246 (63%), Gaps = 25/246 (10%)
 Frame = -2

Query  809  LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIET  630
            LDD CL+ I +FL+P+PDR+N A VC RW+ L    R+WL V   ++ S  P  F +++ 
Sbjct  17   LDDACLVRILTFLTPLPDRFNAARVCQRWQKLVSDKRMWLHVAPGLKSS--PNQFLSLQD  74

Query  629  AVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTC  450
            AV+SARPGDTILIA G +H   NI+I KPL L+G GE  DDT+L C RG DSALEFL+  
Sbjct  75   AVTSARPGDTILIAPGVTHVTPNIRINKPLFLVGGGETADDTVLLCPRGFDSALEFLANG  134

Query  449  KLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPTTLKTN  270
            KLANL + AELG CLLHR GRLT+D C LQC  +PLDHLSY I+STA    D P  +   
Sbjct  135  KLANLKITAELGSCLLHRKGRLTVDNCALQCVEHPLDHLSYPIMSTAD---DQPCPITNG  191

Query  269  ADSVSVLRTRIEGGAKAVLTSGTLTLQQ--------------------VRVIYSRTSLFF  150
            ++ VSV+ TRIEGG   V T+G L LQQ                    VRV+  + +  F
Sbjct  192  SNEVSVIETRIEGGISCVNTTGKLKLQQVSTVESPDRMETEFLTALLVVRVLCGKAAWTF  251

Query  149  WFNVEQ  132
            WF V +
Sbjct  252  WFQVAK  257



>gb|AFK48081.1| unknown [Lotus japonicus]
Length=152

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFL PIPDR+NTALVCHRW +LACHPRLWLRVDRSV+D S PG+FPN
Sbjct  37   INNLDDGCLMHIFSFLPPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKDLSQPGVFPN  96

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDS  474
            IETAVS++RPGDTILIA GGSH  SNIQIKKPLCLIGAGE+PDDT L CSRGSDS
Sbjct  97   IETAVSASRPGDTILIAAGGSHHTSNIQIKKPLCLIGAGELPDDTTLICSRGSDS  151



>gb|AAG40405.1|AF325053_1 T14E10.50 [Arabidopsis thaliana]
 gb|AAK61344.1|AF347971_1 SKP1-interacting partner 5 [Arabidopsis thaliana]
Length=156

 Score =   209 bits (531),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  833  YSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLP  654
            YS   +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D S P
Sbjct  30   YSLTSLNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLSQP  89

Query  653  GIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSD  477
            G+F NIE+AVS+ARPGDTILI  GG++RVSNIQIKKPLCL+G GEIPD+T L C+RGSD
Sbjct  90   GVFLNIESAVSAARPGDTILIVAGGNYRVSNIQIKKPLCLVGGGEIPDETTLVCARGSD  148



>ref|XP_003598632.1| F-box protein SKIP5 [Medicago truncatula]
Length=141

 Score =   205 bits (521),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 115/135 (85%), Gaps = 1/135 (1%)
 Frame = -2

Query  533  IGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCE  354
            IGAGEIPDDT+LTCSRG DSA EFLS CKL+NLTV+AELGCCLLHRSGRLTIDGC+LQCE
Sbjct  6    IGAGEIPDDTMLTCSRGLDSAFEFLSNCKLSNLTVKAELGCCLLHRSGRLTIDGCVLQCE  65

Query  353  SNPLDHLSYAIVSTASSPRDLPT-TLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRV  177
            SNPLD LS  I+STA+S   +P+ T   N D V V +TRIEGGAKAVLTSG L LQ+VRV
Sbjct  66   SNPLDFLSCPIISTANSSDMVPSQTNSNNGDGVFVSQTRIEGGAKAVLTSGDLALQRVRV  125

Query  176  IYSRTSLFFWFNVEQ  132
            +Y+RTSL FWF+VEQ
Sbjct  126  VYARTSLLFWFDVEQ  140



>ref|XP_006494343.1| PREDICTED: F-box protein SKIP5-like isoform X1 [Citrus sinensis]
Length=154

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMH+FSFLSPIPDRYNTALVCHRW +LACHPRLWLRVD+SV+D    G+FP+
Sbjct  30   INNLDDGCLMHVFSFLSPIPDRYNTALVCHRWNYLACHPRLWLRVDQSVKDLFETGVFPD  89

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  459
            ++TAVS ARPGDTILIA GGSH VSNIQIKK LCL+G GE+PD+T L CSRGSD  + FL
Sbjct  90   LKTAVSVARPGDTILIAAGGSHPVSNIQIKKQLCLVGGGELPDETTLICSRGSDRFVNFL  149



>gb|AFK39958.1| unknown [Medicago truncatula]
Length=141

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = -2

Query  533  IGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCE  354
            IGA EIPDDT+LTCSRG DSA EFLS CKL+NLTV+AELGCCLLHRSGRLTIDGC+LQCE
Sbjct  6    IGAREIPDDTMLTCSRGLDSAFEFLSNCKLSNLTVKAELGCCLLHRSGRLTIDGCVLQCE  65

Query  353  SNPLDHLSYAIVSTASSPRDLPT-TLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRV  177
            SNPLD LS  I+STA+S   +P+ T   N D V V +TRIEGGAKAVLTSG L LQ+VRV
Sbjct  66   SNPLDFLSCPIISTANSSDMVPSQTNSNNGDGVFVSQTRIEGGAKAVLTSGDLALQRVRV  125

Query  176  IYSRTSLFFWFNVEQ  132
            +Y+RTSL FWF+VEQ
Sbjct  126  VYARTSLLFWFDVEQ  140



>ref|XP_006494344.1| PREDICTED: F-box protein SKIP5-like isoform X2 [Citrus sinensis]
Length=147

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMH+FSFLSPIPDRYNTALVCHRW +LACHPRLWLRVD+SV+D    G+FP+
Sbjct  30   INNLDDGCLMHVFSFLSPIPDRYNTALVCHRWNYLACHPRLWLRVDQSVKDLFETGVFPD  89

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSD  477
            ++TAVS ARPGDTILIA GGSH VSNIQIKK LCL+G GE+PD+T L CSRGSD
Sbjct  90   LKTAVSVARPGDTILIAAGGSHPVSNIQIKKQLCLVGGGELPDETTLICSRGSD  143



>gb|KJB74632.1| hypothetical protein B456_012G017000 [Gossypium raimondii]
Length=183

 Score =   198 bits (504),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 109/157 (69%), Gaps = 27/157 (17%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRSV+D S PG+FPN
Sbjct  24   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVDRSVQDFSEPGVFPN  83

Query  638  IETAVSSA---------------------------RPGDTILIAGGGSHRVSNIQIKKPL  540
            IE AVS+A                           RPGDTILIA GGSH  SNIQIKKPL
Sbjct  84   IEEAVSAARYIKLLLICGLGLYGILLRPYLQTLPFRPGDTILIAAGGSHLASNIQIKKPL  143

Query  539  CLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTV  429
            CLIG GE+PD+T + C RGSD    FL+   L  L V
Sbjct  144  CLIGGGELPDETTVICLRGSDRFANFLTMFLLRMLNV  180



>emb|CDY66691.1| BnaC04g53050D, partial [Brassica napus]
Length=145

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 116/145 (80%), Gaps = 10/145 (7%)
 Frame = -2

Query  533  IGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCE  354
            IG+GEIPD+T L CSRGSDSALE LSTCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE
Sbjct  1    IGSGEIPDETTLVCSRGSDSALELLSTCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCE  60

Query  353  SNPLDHLSYAIVSTASSPR--------DLPTTL--KTNADSVSVLRTRIEGGAKAVLTSG  204
            +NPLDHLS  IVSTA            ++  T+  K   +SV+VL+TRIEGGAKAV TSG
Sbjct  61   TNPLDHLSCPIVSTAGGDEEDNLSRHVEVKETVDEKIKGNSVTVLQTRIEGGAKAVATSG  120

Query  203  TLTLQQVRVIYSRTSLFFWFNVEQD  129
             L LQ+VRV+YS+  L+FWF+V+Q+
Sbjct  121  DLVLQRVRVMYSKDYLYFWFDVDQE  145



>emb|CDY40005.1| BnaC05g13100D [Brassica napus]
Length=174

 Score =   193 bits (490),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 116/145 (80%), Gaps = 10/145 (7%)
 Frame = -2

Query  533  IGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCE  354
            IG+GEIPD+T L CSRGSDSALE LSTCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE
Sbjct  30   IGSGEIPDETTLVCSRGSDSALELLSTCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCE  89

Query  353  SNPLDHLSYAIVSTASSPR--------DLPTTL--KTNADSVSVLRTRIEGGAKAVLTSG  204
            +NPLDHLS  IVSTA   +        ++  T+  K   +SV+VL+TRIEGGAKAV TSG
Sbjct  90   TNPLDHLSCPIVSTAGRDKEEDNLSLVEVKETVVEKIKGNSVAVLQTRIEGGAKAVATSG  149

Query  203  TLTLQQVRVIYSRTSLFFWFNVEQD  129
             L LQ+VRV+YS+  L+FWF+V+ +
Sbjct  150  DLVLQRVRVMYSKDYLYFWFDVDHE  174



>emb|CDX73483.1| BnaC08g25200D [Brassica napus]
Length=161

 Score =   192 bits (488),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 115/145 (79%), Gaps = 10/145 (7%)
 Frame = -2

Query  533  IGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCE  354
            IG+GEIPD+T L CSRGSDSALE LSTCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE
Sbjct  17   IGSGEIPDETTLVCSRGSDSALELLSTCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCE  76

Query  353  SNPLDHLSYAIVSTASSPR--------DLPTTL--KTNADSVSVLRTRIEGGAKAVLTSG  204
            +NPLDHLS  IVSTA            ++  T+  K   +SV+VL+TRIEGGAKAV TSG
Sbjct  77   TNPLDHLSCPIVSTAGGDEEDNLSRHVEVKETVDEKIKGNSVTVLQTRIEGGAKAVATSG  136

Query  203  TLTLQQVRVIYSRTSLFFWFNVEQD  129
             L LQ+VRV+YS+  L+FWF+V+ +
Sbjct  137  DLVLQRVRVMYSKDYLYFWFDVDHE  161



>ref|XP_003598633.1| F-box protein SKIP5 [Medicago truncatula]
Length=170

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 94/102 (92%), Gaps = 2/102 (2%)
 Frame = -2

Query  836  CYSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSL  657
            CYSR  INNLDDGCLMHIFSFLSPIPDR+NTALVCHRW +LACHPRLWLRVDRSV+D S 
Sbjct  26   CYSR--INNLDDGCLMHIFSFLSPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKDLSE  83

Query  656  PGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLI  531
            PG+FPNIETAVS++RPGDTILIA GG HRV+NIQI KPLCL+
Sbjct  84   PGVFPNIETAVSASRPGDTILIAAGGIHRVANIQINKPLCLV  125



>ref|XP_008246248.1| PREDICTED: F-box protein SKIP5-like [Prunus mume]
Length=124

 Score =   185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  500  LTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAI  321
            + CS    SALE LSTCKLANLTV+AELGCCLLHR+GRLTI+GC+LQCESNPLDHLS  I
Sbjct  1    MHCSFCLSSALELLSTCKLANLTVKAELGCCLLHRNGRLTIEGCVLQCESNPLDHLSCPI  60

Query  320  VSTASSPRDLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFN  141
            VSTAS+    P+++K + D VSV RTRIEGGAKAVLTSG LTLQ+VRVIY+RTS+FFWF+
Sbjct  61   VSTASAQTVFPSSVKCSKDGVSVFRTRIEGGAKAVLTSGDLTLQRVRVIYARTSIFFWFD  120

Query  140  VEQD  129
            VE  
Sbjct  121  VEHQ  124



>emb|CDY13209.1| BnaC04g26260D [Brassica napus]
Length=157

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 112/148 (76%), Gaps = 13/148 (9%)
 Frame = -2

Query  536  LIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQC  357
            LI  GE PD+T L CSRGSDSALE LSTCKLANLTV+AELGCCLLHRSGR+TIDGC+LQC
Sbjct  9    LISGGETPDETTLVCSRGSDSALELLSTCKLANLTVKAELGCCLLHRSGRVTIDGCVLQC  68

Query  356  ESNPLDHLSYAIVSTAS-----------SPRDLPTTL--KTNADSVSVLRTRIEGGAKAV  216
            E+NPLDHLS  IVSTA            S  ++   L  K   +SVSVL+TRIEGGAK+V
Sbjct  69   ETNPLDHLSCPIVSTAGDEEEEEEEDILSHVEVKEALVEKIKGNSVSVLQTRIEGGAKSV  128

Query  215  LTSGTLTLQQVRVIYSRTSLFFWFNVEQ  132
             TSG L LQ+VRV+YS+  L+FWF+V+ 
Sbjct  129  STSGHLVLQRVRVMYSKAYLYFWFDVDH  156



>emb|CDX73477.1| BnaC08g25260D [Brassica napus]
Length=111

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVD  V+D SLPG+F +
Sbjct  9    LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDPFVKDLSLPGVFHS  68

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLI  531
            IE+AVS+ARPGDTILI  GGSHRVSNIQIKKPLCL+
Sbjct  69   IESAVSAARPGDTILIGAGGSHRVSNIQIKKPLCLV  104



>ref|XP_006431426.1| hypothetical protein CICLE_v10002701mg [Citrus clementina]
 gb|ESR44666.1| hypothetical protein CICLE_v10002701mg [Citrus clementina]
Length=167

 Score =   177 bits (449),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 119/178 (67%), Gaps = 18/178 (10%)
 Frame = -2

Query  662  SLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRG  483
            SL  +F ++E +    +P   + I    +   S+  I++ LC++                
Sbjct  8    SLNLLFRSVEVSFLMKQPSSVLEIRTEDTFNRSDTLIQQTLCMV----------------  51

Query  482  SDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASS  303
              SALEFLSTCKLANLTV+AELGCC LHRSGRLTIDGC+LQCE+NPLD LS  IVSTA S
Sbjct  52   -HSALEFLSTCKLANLTVKAELGCCFLHRSGRLTIDGCVLQCETNPLDFLSCPIVSTARS  110

Query  302  PRDLPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
                 T +K+N DSV+VL TRIEGGAKAVLTSG L LQ VRVIY+RT L+FWF+V+  
Sbjct  111  CIT-STPMKSNGDSVTVLHTRIEGGAKAVLTSGDLVLQLVRVIYARTYLYFWFDVDHQ  167



>emb|CDY13210.1| BnaC04g26250D [Brassica napus]
Length=146

 Score =   174 bits (440),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D   PG+F +
Sbjct  43   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLPQPGVFHD  102

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLI  531
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCL+
Sbjct  103  IESAVSAARPGDTILIGAGGNHLVSNIQIKKPLCLV  138



>tpg|DAA63988.1| TPA: hypothetical protein ZEAMMB73_319872 [Zea mays]
Length=135

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            +N+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R +RD+  PG++P+
Sbjct  20   MNSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERPIRDAMEPGVYPD  79

Query  638  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLI  531
            +E AVS+ARPGDTILIA GGSH   NIQIKKP+C++
Sbjct  80   LEAAVSAARPGDTILIAAGGSHVACNIQIKKPICIV  115



>gb|EMS52646.1| hypothetical protein TRIUR3_14698 [Triticum urartu]
Length=330

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = -2

Query  473  ALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRD  294
            ALEFLSTCK+ANLT++AELGCCLLHRSG+LTI  C+LQCE NPLD+LS+ IVSTA     
Sbjct  211  ALEFLSTCKIANLTIKAELGCCLLHRSGKLTIQECLLQCEPNPLDYLSFPIVSTAIEYNP  270

Query  293  LPTTLK-TNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNV  138
            L ++LK      V+V+RTRIEGGAKAV T+GTL LQ+VR IY+R S+FFWF V
Sbjct  271  LSSSLKEQQGHGVTVVRTRIEGGAKAVRTNGTLALQRVRAIYARRSVFFWFEV  323



>ref|NP_567000.2| SKP1/ASK-interacting protein 5 [Arabidopsis thaliana]
 gb|AEE79237.1| SKP1/ASK-interacting protein 5 [Arabidopsis thaliana]
Length=118

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  833  YSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLP  654
            YS   +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D S P
Sbjct  30   YSLTSLNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLSQP  89

Query  653  GIFPNIETAVSSAR  612
            G+F NIE+AVS+AR
Sbjct  90   GVFLNIESAVSAAR  103



>tpg|DAA41661.1| TPA: hypothetical protein ZEAMMB73_083322, partial [Zea mays]
Length=105

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = -2

Query  779  SFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDT  600
            +F+    +RYNT LVCH W FLACHPRLWLRV+R +RD   P ++PN+E  VS+  P   
Sbjct  4    NFIVEPANRYNTVLVCHIWGFLACHPRLWLRVERPIRDVMEPRVYPNLEAVVSAVGPITP  63

Query  599  ILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDS  474
              IA GGSH   NIQI KP+C+IG G +PDDT+LTCSRG D 
Sbjct  64   FFIAAGGSHVACNIQINKPICIIGGGNLPDDTVLTCSRGFDK  105



>ref|XP_008246108.1| PREDICTED: F-box protein SKIP5-like, partial [Prunus mume]
Length=117

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 76/103 (74%), Gaps = 9/103 (9%)
 Frame = -2

Query  782  FSFLSPIP----DRYNTALVCHRWRFLACHPRLWLRVDRSVRDS-SLPGIFPNIETAVSS  618
              FLS I     DRYNTALVCHRW FLACHPRLWLRV+RSV+D    PG+FP+IETAV++
Sbjct  5    LQFLSQIAIEFADRYNTALVCHRWLFLACHPRLWLRVERSVKDRLEEPGVFPDIETAVAA  64

Query  617  ARPGDTILIAGGGSHRVSNIQIKKPLCLIGAG----EIPDDTI  501
            ARPGDTILIA GG H  SNIQIKK LCL+       EIP  T+
Sbjct  65   ARPGDTILIAAGGRHLASNIQIKKRLCLVCLKVLHLEIPIKTV  107



>ref|XP_006494345.1| PREDICTED: F-box protein SKIP5-like isoform X3 [Citrus sinensis]
Length=137

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 10/106 (9%)
 Frame = -2

Query  818  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  639
            INNLDDGCLMH+FSFLSPIPDRYNTALVCHRW +LACHPRLWLRVD+SV+D    G+FP+
Sbjct  30   INNLDDGCLMHVFSFLSPIPDRYNTALVCHRWNYLACHPRLWLRVDQSVKDLFETGVFPD  89

Query  638  IETAVSSAR----------PGDTILIAGGGSHRVSNIQIKKPLCLI  531
            ++TAVS AR          P   + +    +   S+  I++ LC++
Sbjct  90   LKTAVSVARSVEVSFLMKQPSSVLEVRTEDTFNRSDTLIQQTLCMV  135



>gb|EYU42992.1| hypothetical protein MIMGU_mgv1a018998mg, partial [Erythranthe 
guttata]
Length=102

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 69/96 (72%), Gaps = 18/96 (19%)
 Frame = -2

Query  821  DINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFP  642
             IN LDDGCLM IFSFLSPIPDRYNTALVC RWRFLA                   G++P
Sbjct  25   QINRLDDGCLMLIFSFLSPIPDRYNTALVCRRWRFLAS------------------GVYP  66

Query  641  NIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCL  534
             IETAVS+ARPGDTILIA GG HR SNIQIKKPLCL
Sbjct  67   CIETAVSAARPGDTILIAAGGIHRTSNIQIKKPLCL  102



>ref|XP_005651314.1| hypothetical protein COCSUDRAFT_59281 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26770.1| hypothetical protein COCSUDRAFT_59281 [Coccomyxa subellipsoidea 
C-169]
Length=292

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 109/191 (57%), Gaps = 12/191 (6%)
 Frame = -2

Query  647  FPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSAL  468
            + ++  AV  +RPGD I++  G  H V+++ I  PL L+G G   DDT+L CS+  D  L
Sbjct  19   YHSLRDAVEGSRPGDRIVLEPG-EHDVADVHISWPLHLVGGGITADDTVLRCSKSRDGVL  77

Query  467  EFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSP----  300
            +F ++ K+ NLT++++   C+ HR G LT++GC L+C    L+HL   +V+ A+ P    
Sbjct  78   DFRASGKVQNLTIQSKANACITHRQGALTVEGCSLRCTGTGLNHLFAPLVTLATLPALHG  137

Query  299  RDLPTTLKTNADSVSVLRTRIEG--GAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQDG  126
              LP   K  A  ++V+ T+I G  G+ AV T G+  L+ VR+I       FWF V+   
Sbjct  138  NGLPA--KGGAGVLTVIETKIRGQHGSLAVRTEGSGALRGVRIINLFRGTLFWFKVDSAV  195

Query  125  SST---PQAPS  102
            S+T    Q PS
Sbjct  196  SATIPVKQEPS  206



>gb|AAG01324.1|AF276888_1 unknown, partial [Arabidopsis thaliana]
 gb|AAK69441.1|AF276887_2 unknown [Arabidopsis thaliana]
Length=94

 Score =   107 bits (267),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 54/95 (57%), Positives = 67/95 (71%), Gaps = 12/95 (13%)
 Frame = -2

Query  380  IDGCILQCESNPLDHLSYAIVSTASSPRDLPTTL-----------KTNADSVSVLRTRIE  234
            IDGC+LQCE+NPLDHLSY IVSTA    D+   L           K  A+SV+VL+TRIE
Sbjct  1    IDGCVLQCETNPLDHLSYPIVSTAGD-EDIENILSHVEVKETVTGKIKANSVTVLQTRIE  59

Query  233  GGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQD  129
            GGAKAV T G L LQ+VRV+YS+  L+FWF+V+ +
Sbjct  60   GGAKAVSTRGDLVLQRVRVMYSKAYLYFWFDVDYE  94



>gb|KIY98094.1| F-box protein SKIP5 [Monoraphidium neglectum]
Length=410

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 93/176 (53%), Gaps = 9/176 (5%)
 Frame = -2

Query  812  NLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWL-----RVDRSVRDSSLPGI  648
            +LDD  L  +  FL P P   N AL C R R +A     WL      VD +   S   G 
Sbjct  23   DLDDALLSKVLLFLDPFPGVANAALTCRRLRRVATDKGRWLVVAPHAVDAAGTPSGRAGP  82

Query  647  -FPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSA  471
             F ++  AV+++RPGDTI +A    H    ++++ PL + GAG     + L  S   ++A
Sbjct  83   RFTSLAGAVAASRPGDTIWLAPHVRHEAPCVRVRWPLHICGAGA---GSTLLASPSGEAA  139

Query  470  LEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASS  303
            L+  ++ K+  + + + LG C+LHR G L ++ C L+C++  LDH+   I++ A S
Sbjct  140  LDIGASAKIIGVAIESRLGPCILHRRGTLHVESCALRCDNGGLDHILAPIITAAVS  195



>ref|XP_006386008.1| hypothetical protein POPTR_0003s19945g [Populus trichocarpa]
 gb|ERP63805.1| hypothetical protein POPTR_0003s19945g [Populus trichocarpa]
Length=153

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 66/125 (53%), Gaps = 24/125 (19%)
 Frame = -2

Query  464  FLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRDLPT  285
            F ST    +      LGCCL H SGRLTID CILQC +NPL +LS            + T
Sbjct  32   FPSTETAVSAASEERLGCCLHHESGRLTIDSCILQCWANPL-YLSL-----------IST  79

Query  284  TLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQV------------RVIYSRTSLFFWFN  141
                   S SV +TRIEGGAKAVLTSG L    V            RVIY+R S++FW +
Sbjct  80   GGGNGGASASVSQTRIEGGAKAVLTSGDLAFMIVFLIPKLMVIVFPRVIYARNSVYFWLD  139

Query  140  VEQDG  126
            V+  G
Sbjct  140  VDSQG  144


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  722  RFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  615
            R+LACHPR+WLR +RS +D S PG+FP+ ETAVS+A
Sbjct  7    RYLACHPRMWLRDERSAKDLSEPGVFPSTETAVSAA  42



>ref|XP_011397893.1| F-box protein SKIP5 [Auxenochlorella protothecoides]
 gb|KFM25005.1| F-box protein SKIP5 [Auxenochlorella protothecoides]
Length=248

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 95/188 (51%), Gaps = 14/188 (7%)
 Frame = -2

Query  647  FPNIETAVSSARPGDTILIAGGGSHRVSN--IQIKKPLCLIGAGEIPDDTILTCSRGSDS  474
            F  +  AV +++PG TIL+ GG  HRVS   + I+  L L+G+G   +  +L    G ++
Sbjct  30   FSTLAEAVQASQPGHTILLQGGQPHRVSGQPVVIRHALRLLGSGGRAEAVVLRGDPGLET  89

Query  473  ALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSYAIVSTASSPRD  294
             L F S  +L NL+V +  G CL+H +G L + GCIL+  +  L HL    VS  +   D
Sbjct  90   VLLFHSLAQLLNLSVHSVRGACLMHLAGTLRVGGCILESSAAGLPHL----VSQIALAGD  145

Query  293  LPTTLKTNADSVSVLRTRIEGG-AKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQDGSST  117
                 + + D      TR+ G  A+ V T G   +   R IY R   + WF+V + G   
Sbjct  146  AAERRRLHFDE-----TRLLGDCARPVATGGMGRVLNARAIYLRHQTYAWFDVHELGQEA  200

Query  116  PQA--PSG  99
             +A  P+G
Sbjct  201  SRAHPPAG  208



>ref|XP_010497120.1| PREDICTED: F-box protein SKIP5-like, partial [Camelina sativa]
Length=73

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -2

Query  770  SPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNI  636
            S   DRYNTALVCHRWR+LACHPRLWLRVDR V+D + PG+F NI
Sbjct  29   SECADRYNTALVCHRWRYLACHPRLWLRVDRFVKDLTQPGVFRNI  73



>ref|XP_010248139.1| PREDICTED: F-box protein SKIP5-like, partial [Nelumbo nucifera]
Length=99

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  758  DRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARP  609
            DRYNTALVCHRW FLACHPRLWLRVDRS++D + PG+FP+     S   P
Sbjct  22   DRYNTALVCHRWCFLACHPRLWLRVDRSIKDPTEPGVFPDXFLEESLDHP  71



>ref|XP_005852278.1| hypothetical protein CHLNCDRAFT_133681 [Chlorella variabilis]
 gb|EFN60176.1| hypothetical protein CHLNCDRAFT_133681 [Chlorella variabilis]
Length=514

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 79/147 (54%), Gaps = 26/147 (18%)
 Frame = -2

Query  647  FPNIETAVSSARPGDTILI-AGGGSHRVSN-IQIKKPLCLIGAGEIPDDTILTCSRGSDS  474
            F  ++ AV+++RPGDTIL+ AG   H VS  + +  P+ ++G G    + +L  S G D+
Sbjct  109  FATLDAAVAASRPGDTILLEAGPAPHAVSAPLAVPHPVLILGGGVEAGECVLQGSPGLDA  168

Query  473  ALEF---------------LSTC--------KLANLTVRAELGCCLLHRSGRLTIDGCIL  363
             L+F               L  C        +LANLT+RA  G C+ H  GRLT+ GC L
Sbjct  169  LLDFRQAGPWQRAAAPGANLRACAQAGRASGRLANLTLRATSGACVAHTRGRLTVQGCNL  228

Query  362  QCESNPLDHLSYAIVSTASS-PRDLPT  285
            +C++  L HL   +++ A+S PR  PT
Sbjct  229  ECDARGLPHLVAPLLTRAASWPRIPPT  255



>ref|XP_006386002.1| hypothetical protein POPTR_0003s19900g, partial [Populus trichocarpa]
 gb|ERP63799.1| hypothetical protein POPTR_0003s19900g, partial [Populus trichocarpa]
Length=79

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 8/56 (14%)
 Frame = -2

Query  293  LPTTLKTNADSVSVLRTRIEGGAKAVLTSGTLTLQQVRVIYSRTSLFFWFNVEQDG  126
            L +++KTN DSVSV +TRIEGGAKA         Q+VRVIY+R S++FW +V+  G
Sbjct  23   LSSSVKTNGDSVSVSQTRIEGGAKA--------FQRVRVIYARNSVYFWLDVDSQG  70



>ref|XP_008904960.1| hypothetical protein PPTG_11400 [Phytophthora parasitica INRA-310]
 gb|ETN09814.1| hypothetical protein PPTG_11400 [Phytophthora parasitica INRA-310]
Length=2533

 Score = 54.7 bits (130),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 31/98 (32%), Positives = 48/98 (49%), Gaps = 6/98 (6%)
 Frame = -2

Query  794   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  615
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S LP    ++   ++  
Sbjct  1633  LHRVMSLLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGLP---VSLAKVLAKV  1689

Query  614   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  501
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1690  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1724



>ref|WP_038557082.1| hypothetical protein [Draconibacterium orientale]
 gb|AHW61731.1| hypothetical protein FH5T_07235 [Draconibacterium orientale]
Length=351

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 1/90 (1%)
 Frame = -2

Query  719  FLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPL  540
            FL      W +    V++ +   ++ NI TA+++A  GDT+ I GGG   ++N  I K L
Sbjct  9    FLFLATLSWGQAQFVVQNGTKTEVYNNINTAITNAVAGDTLYIPGGG-FTITNTTIDKTL  67

Query  539  CLIGAGEIPDDTILTCSRGSDSALEFLSTC  450
              +G G  P +T  T     +SAL F   C
Sbjct  68   HWVGHGHYPSETGATMQTRINSALNFTGNC  97



>tpg|DAA63986.1| TPA: hypothetical protein ZEAMMB73_319872, partial [Zea mays]
Length=153

 Score = 48.5 bits (114),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -2

Query  854  EAAPYYCYSRHDINNLDDGCLMHIFSFLSPIPD  756
            E AP        +N+LDDGCLMHIFSFLSPIPD
Sbjct  64   ELAPVVEELISPMNSLDDGCLMHIFSFLSPIPD  96


 Score = 23.5 bits (49),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 8/13 (62%), Positives = 9/13 (69%), Gaps = 0/13 (0%)
 Frame = -3

Query  727  DGVSWHVTRGFGC  689
            DG S H T G+GC
Sbjct  96   DGASLHATLGYGC  108



>gb|ETP17406.1| hypothetical protein F441_08176 [Phytophthora parasitica CJ01A1]
Length=2533

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = -2

Query  794   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  615
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1633  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1689

Query  614   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  501
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1690  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1724



>gb|ETI47607.1| hypothetical protein F443_08200 [Phytophthora parasitica P1569]
Length=2533

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = -2

Query  794   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  615
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1633  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1689

Query  614   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  501
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1690  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1724



>gb|ETL94122.1| hypothetical protein L917_07851, partial [Phytophthora parasitica]
Length=2550

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = -2

Query  794   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  615
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1650  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1706

Query  614   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  501
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1707  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1741



>gb|ETP45417.1| hypothetical protein F442_08141, partial [Phytophthora parasitica 
P10297]
Length=2550

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = -2

Query  794   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  615
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1650  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1706

Query  614   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  501
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1707  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1741



>gb|ETO76325.1| hypothetical protein F444_08256, partial [Phytophthora parasitica 
P1976]
Length=2550

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = -2

Query  794   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  615
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1650  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1706

Query  614   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  501
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1707  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1741



>gb|ETM47366.1| hypothetical protein L914_07913, partial [Phytophthora parasitica]
Length=2550

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = -2

Query  794   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  615
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1650  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1706

Query  614   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  501
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1707  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1741



>gb|ETL40964.1| hypothetical protein L916_07950, partial [Phytophthora parasitica]
Length=2550

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = -2

Query  794   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  615
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1650  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1706

Query  614   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  501
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1707  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1741



>gb|ETK87535.1| hypothetical protein L915_08027, partial [Phytophthora parasitica]
Length=2550

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = -2

Query  794   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  615
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1650  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1706

Query  614   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  501
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1707  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1741



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2130794066790