BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF040E20

Length=862
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011099741.1|  PREDICTED: mitogen-activated protein kinase ...  62.4    2e-23   Sesamum indicum [beniseed]
gb|KHG03029.1|  Mitogen-activated protein kinase kinase kinase 2      69.7    2e-19   Gossypium arboreum [tree cotton]
gb|KJB46890.1|  hypothetical protein B456_008G000500                  69.7    1e-18   Gossypium raimondii
gb|KJB46891.1|  hypothetical protein B456_008G000500                  69.7    2e-18   Gossypium raimondii
gb|KDP42587.1|  hypothetical protein JCGZ_24361                       67.4    3e-18   Jatropha curcas
ref|XP_006432224.1|  hypothetical protein CICLE_v10000585mg           59.3    1e-17   Citrus clementina [clementine]
gb|KDO50298.1|  hypothetical protein CISIN_1g040472mg                 59.3    1e-17   Citrus sinensis [apfelsine]
emb|CBI37539.3|  unnamed protein product                              62.4    2e-17   Vitis vinifera
ref|XP_002280682.1|  PREDICTED: mitogen-activated protein kinase ...  62.4    2e-17   Vitis vinifera
emb|CDP04692.1|  unnamed protein product                              60.8    6e-17   Coffea canephora [robusta coffee]
ref|XP_003523226.1|  PREDICTED: mitogen-activated protein kinase ...  59.3    8e-17   Glycine max [soybeans]
gb|KHN31145.1|  Mitogen-activated protein kinase kinase kinase 2      59.3    8e-17   Glycine soja [wild soybean]
ref|XP_006350963.1|  PREDICTED: mitogen-activated protein kinase ...  75.9    9e-17   Solanum tuberosum [potatoes]
ref|XP_003526863.1|  PREDICTED: mitogen-activated protein kinase ...  59.7    2e-16   Glycine max [soybeans]
ref|XP_003602611.1|  Mitogen-activated protein kinase kinase kinase   56.6    2e-16   Medicago truncatula
ref|XP_003630274.1|  Protein kinase, putative                         59.3    9e-16   Medicago truncatula
ref|XP_007137724.1|  hypothetical protein PHAVU_009G150500g           60.5    1e-15   Phaseolus vulgaris [French bean]
ref|XP_004503937.1|  PREDICTED: mitogen-activated protein kinase ...  56.2    1e-15   Cicer arietinum [garbanzo]
ref|XP_004288333.1|  PREDICTED: mitogen-activated protein kinase ...  60.1    1e-15   Fragaria vesca subsp. vesca
ref|NP_001234485.1|  MAP3Ka                                           72.0    2e-15   Solanum lycopersicum
ref|XP_010270404.1|  PREDICTED: mitogen-activated protein kinase ...  60.8    2e-15   Nelumbo nucifera [Indian lotus]
gb|AAS78639.1|  MAP3Ka                                                71.2    8e-15   Nicotiana benthamiana
ref|XP_010270403.1|  PREDICTED: mitogen-activated protein kinase ...  60.8    8e-15   Nelumbo nucifera [Indian lotus]
ref|XP_009625680.1|  PREDICTED: mitogen-activated protein kinase ...  71.2    1e-14   Nicotiana tomentosiformis
ref|XP_009765252.1|  PREDICTED: mitogen-activated protein kinase ...  70.9    1e-14   Nicotiana sylvestris
ref|XP_010260483.1|  PREDICTED: mitogen-activated protein kinase ...  57.4    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010260481.1|  PREDICTED: mitogen-activated protein kinase ...  57.0    3e-14   Nelumbo nucifera [Indian lotus]
gb|EYU23759.1|  hypothetical protein MIMGU_mgv1a003649mg              62.8    4e-14   Erythranthe guttata [common monkey flower]
ref|XP_010260482.1|  PREDICTED: mitogen-activated protein kinase ...  57.0    1e-13   Nelumbo nucifera [Indian lotus]
gb|EYU24311.1|  hypothetical protein MIMGU_mgv1a025509mg              60.1    2e-13   Erythranthe guttata [common monkey flower]
gb|KJB46892.1|  hypothetical protein B456_008G000500                  70.1    3e-13   Gossypium raimondii
gb|EYU18037.1|  hypothetical protein MIMGU_mgv1a002756mg              59.7    5e-13   Erythranthe guttata [common monkey flower]
ref|XP_002529731.1|  mitogen activated protein kinase kinase kina...  68.9    5e-12   Ricinus communis
ref|XP_010680195.1|  PREDICTED: mitogen-activated protein kinase ...  57.0    2e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008441055.1|  PREDICTED: mitogen-activated protein kinase ...  56.2    3e-10   Cucumis melo [Oriental melon]
ref|XP_004148657.1|  PREDICTED: serine/threonine-protein kinase K...  56.2    3e-10   Cucumis sativus [cucumbers]
ref|XP_008441054.1|  PREDICTED: mitogen-activated protein kinase ...  56.2    3e-10   Cucumis melo [Oriental melon]
ref|XP_004171417.1|  PREDICTED: protein kinase wis1-like              56.2    3e-10   
gb|KJB46894.1|  hypothetical protein B456_008G000500                  70.1    3e-10   Gossypium raimondii
gb|KJB46893.1|  hypothetical protein B456_008G000500                  70.1    3e-10   Gossypium raimondii
ref|XP_008358959.1|  PREDICTED: mitogen-activated protein kinase ...  54.3    3e-10   
ref|XP_007048387.1|  Mitogen-activated protein kinase kinase kina...  69.7    5e-10   
gb|KJB75262.1|  hypothetical protein B456_012G034500                  69.3    7e-10   Gossypium raimondii
gb|KHG01918.1|  Mitogen-activated protein kinase kinase kinase 2      69.3    8e-10   Gossypium arboreum [tree cotton]
gb|KJB75259.1|  hypothetical protein B456_012G034500                  68.9    8e-10   Gossypium raimondii
gb|KJB75261.1|  hypothetical protein B456_012G034500                  68.9    8e-10   Gossypium raimondii
gb|ADI52619.1|  mitogen-activated protein kinase kinase kinase        68.9    9e-10   Gossypium hirsutum [American cotton]
ref|XP_002309908.2|  mitogen-activated protein kinase kinase kinase   67.4    3e-09   
ref|XP_002306242.1|  mitogen-activated protein kinase kinase kinase   66.6    5e-09   
ref|XP_010912615.1|  PREDICTED: mitogen-activated protein kinase ...  65.1    5e-09   Elaeis guineensis
ref|XP_011031200.1|  PREDICTED: mitogen-activated protein kinase ...  66.6    6e-09   Populus euphratica
ref|XP_008808477.1|  PREDICTED: mitogen-activated protein kinase ...  66.2    7e-09   Phoenix dactylifera
gb|KFK39943.1|  hypothetical protein AALP_AA3G309800                  50.1    9e-09   Arabis alpina [alpine rockcress]
ref|XP_011022952.1|  PREDICTED: mitogen-activated protein kinase ...  65.9    1e-08   Populus euphratica
ref|XP_010912614.1|  PREDICTED: mitogen-activated protein kinase ...  65.1    2e-08   Elaeis guineensis
gb|ACN30597.1|  unknown                                               63.9    3e-08   Zea mays [maize]
gb|KFK39944.1|  hypothetical protein AALP_AA3G309800                  50.1    5e-08   Arabis alpina [alpine rockcress]
gb|KFK39942.1|  hypothetical protein AALP_AA3G309800                  50.1    5e-08   Arabis alpina [alpine rockcress]
ref|NP_001130692.1|  mitogen activated protein kinase kinase kinase   63.5    6e-08   Zea mays [maize]
ref|XP_010090849.1|  Mitogen-activated protein kinase kinase kina...  63.2    9e-08   Morus notabilis
ref|XP_010479930.1|  PREDICTED: mitogen-activated protein kinase ...  56.6    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010479928.1|  PREDICTED: mitogen-activated protein kinase ...  56.6    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010930645.1|  PREDICTED: mitogen-activated protein kinase ...  62.8    1e-07   Elaeis guineensis
ref|XP_010930646.1|  PREDICTED: mitogen-activated protein kinase ...  62.8    1e-07   
emb|CAN67061.1|  hypothetical protein VITISV_017538                   62.8    1e-07   Vitis vinifera
emb|CAA08995.1|  MAP3K alpha 1 protein kinase                         51.2    1e-07   Brassica napus [oilseed rape]
gb|KHN10572.1|  Mitogen-activated protein kinase kinase kinase 2      58.9    2e-07   Glycine soja [wild soybean]
ref|XP_008795233.1|  PREDICTED: mitogen-activated protein kinase ...  62.0    2e-07   
ref|XP_004979130.1|  PREDICTED: mitogen-activated protein kinase ...  62.0    2e-07   Setaria italica
gb|AGU71374.1|  mitogen-activated protein kinase kinase kinase        58.9    2e-07   Lumnitzera racemosa
ref|XP_006409679.1|  hypothetical protein EUTSA_v10022608mg           53.5    3e-07   Eutrema salsugineum [saltwater cress]
ref|XP_008795232.1|  PREDICTED: mitogen-activated protein kinase ...  61.6    3e-07   Phoenix dactylifera
ref|NP_001185211.1|  mitogen-activated protein kinase kinase kina...  56.6    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009347263.1|  PREDICTED: mitogen-activated protein kinase ...  61.2    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_006858394.1|  hypothetical protein AMTR_s00071p00019220        61.2    3e-07   
ref|XP_008363405.1|  PREDICTED: mitogen-activated protein kinase ...  61.2    4e-07   
ref|XP_008227651.1|  PREDICTED: mitogen-activated protein kinase ...  60.8    4e-07   Prunus mume [ume]
ref|XP_008227652.1|  PREDICTED: mitogen-activated protein kinase ...  60.8    4e-07   
ref|NP_001185212.1|  mitogen-activated protein kinase kinase kina...  56.6    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007213592.1|  hypothetical protein PRUPE_ppa002709mg           60.5    6e-07   Prunus persica
gb|KHN34079.1|  Mitogen-activated protein kinase kinase kinase 2      60.1    8e-07   Glycine soja [wild soybean]
ref|XP_003525123.1|  PREDICTED: mitogen-activated protein kinase ...  60.1    8e-07   Glycine max [soybeans]
ref|XP_003577728.1|  PREDICTED: mitogen-activated protein kinase ...  60.1    9e-07   Brachypodium distachyon [annual false brome]
ref|XP_003531452.1|  PREDICTED: mitogen-activated protein kinase ...  59.7    1e-06   Glycine max [soybeans]
ref|XP_006432223.1|  hypothetical protein CICLE_v10000585mg           59.3    1e-06   
ref|XP_006585362.1|  PREDICTED: mitogen-activated protein kinase ...  59.3    1e-06   Glycine max [soybeans]
gb|KHN29245.1|  Mitogen-activated protein kinase kinase kinase ANP1   59.3    1e-06   Glycine soja [wild soybean]
gb|ACI16513.1|  MAP3Ka                                                56.6    2e-06   Cucumis sativus [cucumbers]
dbj|BAD12492.1|  mitogen-activated kinase kinase kinase alpha         59.3    2e-06   Lotus japonicus
gb|EMS66799.1|  Mitogen-activated protein kinase kinase kinase 2      58.5    2e-06   Triticum urartu
dbj|BAJ94063.1|  predicted protein                                    58.9    2e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007159840.1|  hypothetical protein PHAVU_002G272100g           58.5    3e-06   Phaseolus vulgaris [French bean]
ref|XP_007159841.1|  hypothetical protein PHAVU_002G272100g           58.5    3e-06   Phaseolus vulgaris [French bean]
gb|ABK06423.1|  HA-tagged protein kinase domain of putative mitog...  57.8    3e-06   synthetic construct
ref|XP_009406130.1|  PREDICTED: mitogen-activated protein kinase ...  58.2    4e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW62310.1|  hypothetical protein EUGRSUZ_H04962                   57.4    6e-06   Eucalyptus grandis [rose gum]
gb|AFA36527.1|  mitogen activated protein kinase kinase kinase        54.7    6e-06   Lolium perenne [perennial ryegrass]
ref|XP_009371492.1|  PREDICTED: mitogen-activated protein kinase ...  57.4    6e-06   Pyrus x bretschneideri [bai li]
gb|AFA36471.1|  putative mitogen-activated kinase kinase kinase a...  54.7    7e-06   Lolium perenne [perennial ryegrass]
ref|XP_010025592.1|  PREDICTED: mitogen-activated protein kinase ...  57.0    9e-06   Eucalyptus grandis [rose gum]
ref|XP_010025591.1|  PREDICTED: mitogen-activated protein kinase ...  57.0    9e-06   
gb|EPS67034.1|  mitogen activated protein kinase kinase kinase kkk 3  56.6    9e-06   Genlisea aurea
gb|KEH35595.1|  MAP kinase kinase kinase                              57.0    9e-06   Medicago truncatula
gb|ACY01925.1|  mitogen activated protein kinase kinase kinase kkk 3  57.0    1e-05   Beta vulgaris [beet]
ref|XP_010479927.1|  PREDICTED: mitogen-activated protein kinase ...  56.6    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010479926.1|  PREDICTED: mitogen-activated protein kinase ...  56.6    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_004502938.1|  PREDICTED: mitogen-activated protein kinase ...  50.1    1e-05   
ref|XP_009404852.1|  PREDICTED: mitogen-activated protein kinase ...  56.6    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416942.1|  PREDICTED: mitogen-activated protein kinase ...  56.6    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_849803.1|  mitogen-activated protein kinase kinase kinase 3    56.6    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564635.1|  mitogen-activated protein kinase kinase kinase 3    56.6    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAL31904.1|AF419572_1  At1g53570/F22G10_18                         56.6    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891761.1|  MEK kinase                                       56.6    1e-05   Arabidopsis lyrata subsp. lyrata
emb|CAA08994.1|  MAP3K alpha protein kinase                           56.6    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAD10848.1|  MEK kinase                                            56.6    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004234420.1|  PREDICTED: mitogen-activated protein kinase ...  56.6    1e-05   Solanum lycopersicum
ref|XP_006353887.1|  PREDICTED: mitogen-activated protein kinase ...  56.6    1e-05   Solanum tuberosum [potatoes]
ref|XP_010462253.1|  PREDICTED: mitogen-activated protein kinase ...  55.8    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010462255.1|  PREDICTED: mitogen-activated protein kinase ...  55.8    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010462254.1|  PREDICTED: mitogen-activated protein kinase ...  55.8    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006307044.1|  hypothetical protein CARUB_v10008633mg           55.8    2e-05   
ref|XP_010501012.1|  PREDICTED: mitogen-activated protein kinase ...  55.8    2e-05   Camelina sativa [gold-of-pleasure]
gb|ABG22409.1|  mitogen-activated kinase kinase kinase alpha, put...  55.5    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010501009.1|  PREDICTED: mitogen-activated protein kinase ...  55.8    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010501011.1|  PREDICTED: mitogen-activated protein kinase ...  55.8    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010501010.1|  PREDICTED: mitogen-activated protein kinase ...  55.8    2e-05   Camelina sativa [gold-of-pleasure]
gb|ABG22410.1|  mitogen-activated kinase kinase kinase alpha, put...  55.5    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006307045.1|  hypothetical protein CARUB_v10008633mg           55.5    3e-05   Capsella rubella
ref|NP_001067464.1|  Os11g0207200                                     55.5    3e-05   
gb|EEE51829.1|  hypothetical protein OsJ_33308                        55.5    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67854.1|  hypothetical protein OsI_35471                        55.5    3e-05   Oryza sativa Indica Group [Indian rice]
gb|AAF34436.1|AF172282_25  similar to mitogen-activated protein k...  55.5    3e-05   Oryza sativa [red rice]
ref|XP_002520246.1|  mitogen activated protein kinase kinase kina...  54.7    4e-05   
ref|XP_001753661.1|  predicted protein                                53.9    6e-05   
emb|CDP11994.1|  unnamed protein product                              54.3    6e-05   Coffea canephora [robusta coffee]
ref|XP_009758259.1|  PREDICTED: mitogen-activated protein kinase ...  53.9    8e-05   Nicotiana sylvestris
ref|XP_009758258.1|  PREDICTED: mitogen-activated protein kinase ...  53.9    8e-05   Nicotiana sylvestris
ref|XP_009627909.1|  PREDICTED: mitogen-activated protein kinase ...  53.9    9e-05   Nicotiana tomentosiformis
ref|XP_009627903.1|  PREDICTED: mitogen-activated protein kinase ...  53.9    9e-05   Nicotiana tomentosiformis
ref|XP_010530598.1|  PREDICTED: mitogen-activated protein kinase ...  53.9    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_010530597.1|  PREDICTED: mitogen-activated protein kinase ...  53.9    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_010530599.1|  PREDICTED: mitogen-activated protein kinase ...  53.9    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_006663285.1|  PREDICTED: mitogen-activated protein kinase ...  53.9    1e-04   
ref|XP_010530600.1|  PREDICTED: mitogen-activated protein kinase ...  53.5    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_010530601.1|  PREDICTED: mitogen-activated protein kinase ...  53.5    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_006368759.1|  hypothetical protein POPTR_0001s09520g           53.5    1e-04   
gb|KDP25418.1|  hypothetical protein JCGZ_20574                       53.5    1e-04   Jatropha curcas
ref|XP_011029295.1|  PREDICTED: mitogen-activated protein kinase ...  53.5    1e-04   Populus euphratica
ref|XP_006368758.1|  hypothetical protein POPTR_0001s09520g           53.5    1e-04   
ref|XP_004240726.1|  PREDICTED: mitogen-activated protein kinase ...  53.5    1e-04   Solanum lycopersicum
gb|KJB29083.1|  hypothetical protein B456_005G083400                  53.1    2e-04   Gossypium raimondii
gb|KJB29081.1|  hypothetical protein B456_005G083400                  53.1    2e-04   Gossypium raimondii
ref|XP_006363326.1|  PREDICTED: mitogen-activated protein kinase ...  53.1    2e-04   Solanum tuberosum [potatoes]
ref|XP_006363327.1|  PREDICTED: mitogen-activated protein kinase ...  53.1    2e-04   Solanum tuberosum [potatoes]
gb|KDO39019.1|  hypothetical protein CISIN_1g033880mg                 50.1    2e-04   Citrus sinensis [apfelsine]
ref|XP_001753280.1|  predicted protein                                52.4    2e-04   
ref|XP_006391722.1|  hypothetical protein EUTSA_v10023253mg           53.1    2e-04   
ref|XP_008804443.1|  PREDICTED: mitogen-activated protein kinase ...  53.1    2e-04   
ref|XP_010539223.1|  PREDICTED: mitogen-activated protein kinase ...  52.8    2e-04   Tarenaya hassleriana [spider flower]
ref|XP_008804442.1|  PREDICTED: mitogen-activated protein kinase ...  52.8    2e-04   Phoenix dactylifera
ref|XP_006404200.1|  hypothetical protein EUTSA_v10010957mg           52.0    3e-04   
ref|XP_010935850.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...  46.6    3e-04   
gb|KHN09317.1|  Mitogen-activated protein kinase kinase kinase 2      52.4    3e-04   Glycine soja [wild soybean]
ref|XP_003548172.1|  PREDICTED: mitogen-activated protein kinase ...  52.4    3e-04   Glycine max [soybeans]
ref|XP_007152223.1|  hypothetical protein PHAVU_004G112000g           52.4    3e-04   Phaseolus vulgaris [French bean]
emb|CDP05168.1|  unnamed protein product                              52.4    3e-04   Coffea canephora [robusta coffee]
ref|XP_010918584.1|  PREDICTED: mitogen-activated protein kinase ...  52.4    3e-04   Elaeis guineensis
ref|XP_010918583.1|  PREDICTED: mitogen-activated protein kinase ...  52.4    3e-04   Elaeis guineensis
ref|XP_010918582.1|  PREDICTED: mitogen-activated protein kinase ...  52.4    3e-04   Elaeis guineensis
ref|XP_009398019.1|  PREDICTED: mitogen-activated protein kinase ...  52.0    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398018.1|  PREDICTED: mitogen-activated protein kinase ...  52.0    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011080940.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...  52.0    4e-04   
ref|XP_002964768.1|  hypothetical protein SELMODRAFT_82459            51.2    4e-04   
ref|XP_002961700.1|  hypothetical protein SELMODRAFT_76216            51.2    4e-04   
ref|XP_002509819.1|  ATP binding protein, putative                    52.0    4e-04   Ricinus communis
ref|XP_001784035.1|  predicted protein                                51.2    4e-04   
ref|XP_011022671.1|  PREDICTED: mitogen-activated protein kinase ...  52.0    4e-04   Populus euphratica
ref|XP_008787472.1|  PREDICTED: mitogen-activated protein kinase ...  52.0    5e-04   Phoenix dactylifera
ref|XP_001760762.1|  predicted protein                                50.8    5e-04   
ref|XP_009608127.1|  PREDICTED: mitogen-activated protein kinase ...  51.6    5e-04   Nicotiana tomentosiformis
ref|XP_004972122.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    5e-04   Setaria italica
ref|XP_009765193.1|  PREDICTED: mitogen-activated protein kinase ...  51.6    5e-04   Nicotiana sylvestris
dbj|BAM36967.1|  protein kinase                                       51.6    5e-04   Nicotiana benthamiana
ref|XP_002447871.1|  hypothetical protein SORBIDRAFT_06g017240        51.6    6e-04   Sorghum bicolor [broomcorn]
ref|XP_006360533.1|  PREDICTED: mitogen-activated protein kinase ...  50.8    6e-04   Solanum tuberosum [potatoes]
ref|XP_010907216.1|  PREDICTED: mitogen-activated protein kinase ...  51.6    6e-04   
ref|XP_003556116.1|  PREDICTED: mitogen-activated protein kinase ...  51.6    6e-04   Glycine max [soybeans]
gb|KHN12154.1|  Mitogen-activated protein kinase kinase kinase 2      51.6    6e-04   Glycine soja [wild soybean]
gb|KDO51976.1|  hypothetical protein CISIN_1g007478mg                 51.2    6e-04   Citrus sinensis [apfelsine]
ref|XP_007143448.1|  hypothetical protein PHAVU_007G0728001g          51.2    6e-04   Phaseolus vulgaris [French bean]
ref|XP_007143447.1|  hypothetical protein PHAVU_007G0728001g          51.2    6e-04   Phaseolus vulgaris [French bean]
ref|XP_010907217.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    7e-04   
gb|KDO51977.1|  hypothetical protein CISIN_1g007478mg                 51.2    7e-04   Citrus sinensis [apfelsine]
dbj|BAD94298.1|  MEK kinase MAP3Ka                                    48.9    7e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CDX89612.1|  BnaC03g45260D                                        51.2    7e-04   
ref|XP_002322482.1|  hypothetical protein POPTR_0015s12870g           51.2    7e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006827575.1|  hypothetical protein AMTR_s00009p00228600        51.2    7e-04   Amborella trichopoda
ref|XP_006421975.1|  hypothetical protein CICLE_v10004272mg           51.2    7e-04   Citrus clementina [clementine]
emb|CDX93120.1|  BnaA03g38420D                                        51.2    7e-04   
ref|XP_003533990.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    8e-04   Glycine max [soybeans]
gb|KHN41598.1|  Mitogen-activated protein kinase kinase kinase 2      51.2    8e-04   Glycine soja [wild soybean]
ref|XP_009136221.1|  PREDICTED: mitogen-activated protein kinase ...  50.8    8e-04   Brassica rapa
ref|XP_009757984.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    8e-04   Nicotiana sylvestris
ref|XP_003592222.1|  Serine/threonine protein kinase                  50.8    9e-04   Medicago truncatula
ref|XP_003581251.1|  PREDICTED: mitogen-activated protein kinase ...  50.8    0.001   Brachypodium distachyon [annual false brome]
ref|XP_010239934.1|  PREDICTED: mitogen-activated protein kinase ...  50.8    0.001   Brachypodium distachyon [annual false brome]
ref|XP_008804032.1|  PREDICTED: mitogen-activated protein kinase ...  50.8    0.001   Phoenix dactylifera
ref|XP_010547898.1|  PREDICTED: mitogen-activated protein kinase ...  50.8    0.001   Tarenaya hassleriana [spider flower]
ref|XP_007038746.1|  Kinase superfamily protein isoform 1             50.8    0.001   
ref|XP_010547897.1|  PREDICTED: mitogen-activated protein kinase ...  50.8    0.001   Tarenaya hassleriana [spider flower]
ref|XP_007038747.1|  Kinase superfamily protein isoform 2             50.8    0.001   



>ref|XP_011099741.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Sesamum indicum]
Length=625

 Score = 62.4 bits (150),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV  747
            ++AKSFIR CLQREPSARPTA+QLL HPF+++Q T++ 
Sbjct  449  ADAKSFIRLCLQREPSARPTAAQLLTHPFVRNQTTARA  486


 Score = 56.6 bits (135),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 74/134 (55%), Gaps = 10/134 (7%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ +T  +  + N+  E  PR+FDGS T P ALE +H S+ + +S D D A    + V R
Sbjct  478  VRNQTTARATNVNITREAFPRAFDGSRT-PTALE-MHSSRMHNSSSDRDEASR--LTVPR  533

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD  413
             +IS RDN +TITS       S    RH   A RS +LSPP+PS    + +   GN++  
Sbjct  534  TLISPRDNTRTITSLPVSPSSSPL--RHDGAAHRSFFLSPPHPS----YTSVGQGNHNYS  587

Query  412  YSSTFAARVNTRNT  371
              S F +R N+R++
Sbjct  588  DHSVFPSRPNSRSS  601


 Score = 38.1 bits (87),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  387  STQGTLDPWLDIPQYRTQTPGRSSTRTM  304
            +++ + DPWL+IPQ+R+QTP R  TRT+
Sbjct  597  NSRSSFDPWLEIPQFRSQTPVRPPTRTI  624



>gb|KHG03029.1| Mitogen-activated protein kinase kinase kinase 2 [Gossypium arboreum]
Length=660

 Score = 69.7 bits (169),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +EAKSFIR CLQREPSARPTA QLLDHPFI DQ T++VA
Sbjct  484  NEAKSFIRLCLQREPSARPTALQLLDHPFIHDQATTRVA  522


 Score = 50.8 bits (120),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 5/92 (5%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTI  557
            ++  +  P +FDGS TPP  LEL   ++ N  S DGDY +  M    R + + RDNA+ I
Sbjct  525  SITKDAFPYTFDGSRTPPI-LEL-QSTRNNVPSFDGDYEMRGMTTTSRALRNPRDNARAI  582

Query  556  TsslpvspcsspLRRHSEEARRSCYLSPPNPS  461
            TS       S    R+   A +SC+LSPP+P+
Sbjct  583  TSLPVSPCSSPL--RYG-AAHKSCFLSPPHPA  611


 Score = 22.7 bits (47),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTP  328
            TLDPWL     + QTP
Sbjct  636  TLDPWLQTSLLKVQTP  651



>gb|KJB46890.1| hypothetical protein B456_008G000500 [Gossypium raimondii]
Length=654

 Score = 69.7 bits (169),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +EAKSFIR CLQREPSARPTA QLLDHPFI DQ T++VA
Sbjct  477  NEAKSFIRLCLQREPSARPTALQLLDHPFIHDQATTRVA  515


 Score = 49.7 bits (117),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 49/91 (54%), Gaps = 5/91 (5%)
 Frame = -1

Query  733  VINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTIT  554
            +  +  P +FDGS TPP  LEL    + N  S DGDY +  M    R + + RDNA+ IT
Sbjct  519  ITKDAFPYTFDGSRTPPI-LEL-QSIRNNVPSFDGDYEMRGMTTASRALRNPRDNARAIT  576

Query  553  sslpvspcsspLRRHSEEARRSCYLSPPNPS  461
            S       S    R+   A +SC+LSPP+P+
Sbjct  577  SLPVSPCSSPL--RYG-AAHKSCFLSPPHPA  604


 Score = 21.6 bits (44),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 8/15 (53%), Positives = 9/15 (60%), Gaps = 0/15 (0%)
 Frame = -2

Query  372  LDPWLDIPQYRTQTP  328
            LDPWL     + QTP
Sbjct  631  LDPWLQTSLLKVQTP  645



>gb|KJB46891.1| hypothetical protein B456_008G000500 [Gossypium raimondii]
Length=660

 Score = 69.7 bits (169),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +EAKSFIR CLQREPSARPTA QLLDHPFI DQ T++VA
Sbjct  483  NEAKSFIRLCLQREPSARPTALQLLDHPFIHDQATTRVA  521


 Score = 49.7 bits (117),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 49/91 (54%), Gaps = 5/91 (5%)
 Frame = -1

Query  733  VINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTIT  554
            +  +  P +FDGS TPP  LEL    + N  S DGDY +  M    R + + RDNA+ IT
Sbjct  525  ITKDAFPYTFDGSRTPPI-LEL-QSIRNNVPSFDGDYEMRGMTTASRALRNPRDNARAIT  582

Query  553  sslpvspcsspLRRHSEEARRSCYLSPPNPS  461
            S       S    R+   A +SC+LSPP+P+
Sbjct  583  SLPVSPCSSPL--RYG-AAHKSCFLSPPHPA  610


 Score = 21.2 bits (43),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 8/15 (53%), Positives = 9/15 (60%), Gaps = 0/15 (0%)
 Frame = -2

Query  372  LDPWLDIPQYRTQTP  328
            LDPWL     + QTP
Sbjct  637  LDPWLQTSLLKVQTP  651



>gb|KDP42587.1| hypothetical protein JCGZ_24361 [Jatropha curcas]
Length=644

 Score = 67.4 bits (163),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AKSFI+ CLQR+PSARPTASQLLDHPFI+DQ T++V 
Sbjct  471  NDAKSFIKLCLQRDPSARPTASQLLDHPFIRDQATTRVV  509


 Score = 52.4 bits (124),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 15/120 (13%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTI  557
            N+  +  P +FDGS TPP  L+L   S R+    DGDYA+  +V   R + ++RD+ + I
Sbjct  512  NITRDAFPYTFDGSRTPPV-LDLH--SNRS----DGDYAMKQIVTNTRALKNTRDDVRMI  564

Query  556  TsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFA-TTQFGNNHPDYSSTFAARVNT  380
            TS       S    RH   A +SC+LSPP+P+    +A   Q G N  DY S ++ R NT
Sbjct  565  TSLPVSPCSSPL--RHYGPAHKSCFLSPPHPT----YALVGQSGYNLSDY-SLYSTRPNT  617



>ref|XP_006432224.1| hypothetical protein CICLE_v10000585mg [Citrus clementina]
 ref|XP_006464984.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Citrus sinensis]
 gb|ESR45464.1| hypothetical protein CICLE_v10000585mg [Citrus clementina]
Length=628

 Score = 59.3 bits (142),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +AKSFI+ CLQR+PSARP AS+LLDHPF++DQ  ++  
Sbjct  450  DAKSFIKQCLQRDPSARPPASKLLDHPFVRDQAVARAG  487


 Score = 54.7 bits (130),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 63/120 (53%), Gaps = 7/120 (6%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTI  557
            N+  +  P S DGS TPP  L+LL P++++    +GDY  N +V   R + + R+NA+TI
Sbjct  490  NLAKDSSPYSLDGSRTPPK-LDLL-PTRKSITLCEGDYLANPLVPTSRALNNPRENARTI  547

Query  556  TsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNTR  377
            TS       S    R    + +SC+LSPP+PS  +       G N  DYS  +  R N R
Sbjct  548  TSLPVSPCSSPL--RQYGPSHKSCFLSPPHPS--YAVMGQSSGYNLGDYSG-YPTRSNPR  602


 Score = 23.5 bits (49),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = -2

Query  369  DPWLDIPQYRTQTPGRS  319
            DPWL+    + QTPG S
Sbjct  606  DPWLETSLLKAQTPGTS  622



>gb|KDO50298.1| hypothetical protein CISIN_1g040472mg [Citrus sinensis]
Length=628

 Score = 59.3 bits (142),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +AKSFI+ CLQR+PSARP AS+LLDHPF++DQ  ++  
Sbjct  450  DAKSFIKQCLQRDPSARPPASKLLDHPFVRDQAVARAG  487


 Score = 54.7 bits (130),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 63/120 (53%), Gaps = 7/120 (6%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTI  557
            N+  +  P S DGS TPP  L+LL P++++    +GDY  N +V   R + + R+NA+TI
Sbjct  490  NLAKDSSPYSLDGSRTPPK-LDLL-PTRKSITLCEGDYLANPLVPTSRALNNPRENARTI  547

Query  556  TsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNTR  377
            TS       S    R    + +SC+LSPP+PS  +       G N  DYS  +  R N R
Sbjct  548  TSLPVSPCSSPL--RQYGPSHKSCFLSPPHPS--YAVMGQSSGYNLGDYSG-YPTRSNPR  602


 Score = 23.5 bits (49),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = -2

Query  369  DPWLDIPQYRTQTPGRS  319
            DPWL+    + QTPG S
Sbjct  606  DPWLETSLLKAQTPGTS  622



>emb|CBI37539.3| unnamed protein product [Vitis vinifera]
Length=600

 Score = 62.4 bits (150),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AKSF+R CLQR+PSARPTA QLLDH F++DQ T+++A
Sbjct  422  NDAKSFVRLCLQRDPSARPTALQLLDHSFVRDQATTRIA  460


 Score = 50.1 bits (118),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 63/121 (52%), Gaps = 8/121 (7%)
 Frame = -1

Query  733  VINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTIT  554
            +  +  P +FDGS TP  ALEL H ++ +    DGDY    +  V R   +SRD+ +TIT
Sbjct  464  ITKDAFPSTFDGSRTP-TALEL-HSNRTSLTLFDGDYVTKPVGTVSRAAKNSRDSVRTIT  521

Query  553  sslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNTRN  374
            S       S    R+   A +SC+LSPP+P SY     + + +N  DY S +  R  T+ 
Sbjct  522  SLPVSPCSSPL--RNYGPAHKSCFLSPPHP-SYPIVGQSSYNSN--DY-SLYPTRAITKY  575

Query  373  T  371
            T
Sbjct  576  T  576


 Score = 24.3 bits (51),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (61%), Gaps = 1/28 (4%)
 Frame = -2

Query  384  TQGTLDPWLDIPQYRTQTPGRSSTRTMP  301
            T+ T DPW D P +R+ TP   S RT P
Sbjct  573  TKYTHDPWSDNPPFRSLTP-NGSPRTRP  599



>ref|XP_002280682.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Vitis vinifera]
Length=623

 Score = 62.4 bits (150),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AKSF+R CLQR+PSARPTA QLLDH F++DQ T+++A
Sbjct  445  NDAKSFVRLCLQRDPSARPTALQLLDHSFVRDQATTRIA  483


 Score = 50.1 bits (118),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 63/121 (52%), Gaps = 8/121 (7%)
 Frame = -1

Query  733  VINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTIT  554
            +  +  P +FDGS TP  ALEL H ++ +    DGDY    +  V R   +SRD+ +TIT
Sbjct  487  ITKDAFPSTFDGSRTP-TALEL-HSNRTSLTLFDGDYVTKPVGTVSRAAKNSRDSVRTIT  544

Query  553  sslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNTRN  374
            S       S    R+   A +SC+LSPP+P SY     + + +N  DY S +  R  T+ 
Sbjct  545  SLPVSPCSSPL--RNYGPAHKSCFLSPPHP-SYPIVGQSSYNSN--DY-SLYPTRAITKY  598

Query  373  T  371
            T
Sbjct  599  T  599


 Score = 24.3 bits (51),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (61%), Gaps = 1/28 (4%)
 Frame = -2

Query  384  TQGTLDPWLDIPQYRTQTPGRSSTRTMP  301
            T+ T DPW D P +R+ TP   S RT P
Sbjct  596  TKYTHDPWSDNPPFRSLTP-NGSPRTRP  622



>emb|CDP04692.1| unnamed protein product [Coffea canephora]
Length=623

 Score = 60.8 bits (146),  Expect(3) = 6e-17, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AKSFIR CLQREPS RPTA QLL+HPF++DQ   +V+
Sbjct  447  NDAKSFIRSCLQREPSQRPTAVQLLEHPFVRDQAIPRVS  485


 Score = 42.4 bits (98),  Expect(3) = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 69/121 (57%), Gaps = 11/121 (9%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTI  557
            N+  +  P++FDGS TP  ALEL   S+ N    D  Y    ++ V R  IS R+NA+TI
Sbjct  488  NITKQAFPQAFDGSRTP-TALEL-RGSRSNIGPED--YTSRQVLTVSRGNISPRENARTI  543

Query  556  TsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNTR  377
            T SLPVSPCSSPLR+H    R   +LSP +PS      +T   N++    S F  R N+R
Sbjct  544  T-SLPVSPCSSPLRQHGGSYR--GFLSPTHPSYAFAGQSTYTSNDY----SMFPMRPNSR  596

Query  376  N  374
            N
Sbjct  597  N  597


 Score = 32.0 bits (71),  Expect(3) = 6e-17, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = -2

Query  387  STQGTLDPWLDIPQYRTQTPGRSSTRTMP  301
            +++  L+PW + PQ+R QTPGR + RT P
Sbjct  594  NSRNILEPWNEAPQFRAQTPGR-TIRTRP  621



>ref|XP_003523226.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform 1 [Glycine max]
Length=601

 Score = 59.3 bits (142),  Expect(3) = 8e-17, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK  750
            SEAK FI+ CLQR+PSARPTA  LL+HPFI+DQ+ +K
Sbjct  429  SEAKKFIQLCLQRDPSARPTAQMLLEHPFIRDQSLTK  465


 Score = 52.4 bits (124),  Expect(3) = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 57/121 (47%), Gaps = 9/121 (7%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ ++  K  +  +  +  P  FDGS TPP  L+  H ++ +  SLDGDYA   +    R
Sbjct  458  IRDQSLTKATNVRITRDAFPCMFDGSRTPPPVLD--HSNRTSLTSLDGDYATKPVPVTSR  515

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD  413
               S RDN + ITS       S    R  E A +SC+LSPP     HP  T    N  P 
Sbjct  516  AERSPRDNTRMITSLPVSPCSSPL--RQYEPAHKSCFLSPP-----HPTYTLMGQNTLPS  568

Query  412  Y  410
            Y
Sbjct  569  Y  569


 Score = 23.1 bits (48),  Expect(3) = 8e-17, Method: Compositional matrix adjust.
 Identities = 10/24 (42%), Positives = 14/24 (58%), Gaps = 0/24 (0%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTPGRSSTRTM  304
            TLDP+ +   Y+  TPG S  R +
Sbjct  578  TLDPFQETSFYKAHTPGGSPRRLI  601



>gb|KHN31145.1| Mitogen-activated protein kinase kinase kinase 2 [Glycine soja]
Length=593

 Score = 59.3 bits (142),  Expect(3) = 8e-17, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK  750
            SEAK FI+ CLQR+PSARPTA  LL+HPFI+DQ+ +K
Sbjct  421  SEAKKFIQLCLQRDPSARPTAQMLLEHPFIRDQSLTK  457


 Score = 52.4 bits (124),  Expect(3) = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 57/121 (47%), Gaps = 9/121 (7%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ ++  K  +  +  +  P  FDGS TPP  L+  H ++ +  SLDGDYA   +    R
Sbjct  450  IRDQSLTKATNVRITRDAFPCMFDGSRTPPPVLD--HSNRTSLTSLDGDYATKPVPVTSR  507

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD  413
               S RDN + ITS       S    R  E A +SC+LSPP     HP  T    N  P 
Sbjct  508  AERSPRDNTRMITSLPVSPCSSPL--RQYEPAHKSCFLSPP-----HPTYTLMGQNTLPS  560

Query  412  Y  410
            Y
Sbjct  561  Y  561


 Score = 23.1 bits (48),  Expect(3) = 8e-17, Method: Compositional matrix adjust.
 Identities = 10/24 (42%), Positives = 14/24 (58%), Gaps = 0/24 (0%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTPGRSSTRTM  304
            TLDP+ +   Y+  TPG S  R +
Sbjct  570  TLDPFQETSFYKAHTPGGSPRRLI  593



>ref|XP_006350963.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Solanum tuberosum]
Length=614

 Score = 75.9 bits (185),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPS------QRNFASLDGDYAVNH  611
            +K ++  K+ H  V  E  PRSFDGS TPP  LE LHP        RN +  +G+YA + 
Sbjct  458  VKNQSTAKVAHVGVTKESYPRSFDGSRTPP-VLE-LHPGGRNISPGRNISPAEGNYASHP  515

Query  610  MVNVFRPMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQF  431
            ++ V RP+I +R++ K I S       S    R  E AR+SCYLSPP+PS        Q 
Sbjct  516  VITVSRPLICTRESVKAIASLPVSPTSSPL--RQYEPARKSCYLSPPHPSY---GIGGQS  570

Query  430  GNNHPDYSSTFAARVNTRNT  371
            G    DY S F AR +TR T
Sbjct  571  GYEANDY-SMFQARPSTRTT  589


 Score = 38.9 bits (89),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  387  STQGTLDPWLDIPQYRTQTPGRS  319
            ST+ TL+PWL+IPQ+R QTP RS
Sbjct  585  STRTTLEPWLEIPQFRAQTPSRS  607


 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AKSFIR CLQREPS RPTAS+LL+HPF+K+Q+T+KVA
Sbjct  429  NDAKSFIRSCLQREPSTRPTASKLLEHPFVKNQSTAKVA  467



>ref|XP_003526863.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Glycine max]
Length=616

 Score = 59.7 bits (143),  Expect(3) = 2e-16, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV  747
            SEAK+FI+ CLQR+PSARPTA +L++HPFI+DQ+ +K 
Sbjct  444  SEAKNFIQLCLQRDPSARPTAQKLIEHPFIRDQSATKA  481


 Score = 50.4 bits (119),  Expect(3) = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 56/121 (46%), Gaps = 9/121 (7%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ ++  K  +  +  +  P  FDGS TPP  L+  H ++ +  S DGDYA   +    R
Sbjct  473  IRDQSATKATNVRITRDAFPYMFDGSRTPPPVLD--HSNRTSLTSFDGDYATKPIPVTSR  530

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD  413
             + S RDN + ITS       S    R    A +SC+LSPP     HP  T    N  P 
Sbjct  531  TVRSPRDNTRMITSLPVSPCSSPL--RQYGPAHKSCFLSPP-----HPTYTLMGQNTLPS  583

Query  412  Y  410
            Y
Sbjct  584  Y  584


 Score = 23.1 bits (48),  Expect(3) = 2e-16, Method: Compositional matrix adjust.
 Identities = 10/24 (42%), Positives = 14/24 (58%), Gaps = 0/24 (0%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTPGRSSTRTM  304
            TLDP+ +   Y+  TPG S  R +
Sbjct  593  TLDPFHETAFYKAHTPGGSPRRLI  616



>ref|XP_003602611.1| Mitogen-activated protein kinase kinase kinase [Medicago truncatula]
 gb|AES72862.1| MAP kinase kinase kinase [Medicago truncatula]
Length=647

 Score = 56.6 bits (135),  Expect(3) = 2e-16, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FI+ CL R+PS RPTA  LL+HPFI+DQ+ +K A
Sbjct  471  NDAKNFIKLCLHRDPSTRPTAQMLLNHPFIRDQSATKAA  509


 Score = 48.5 bits (114),  Expect(3) = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 57/121 (47%), Gaps = 10/121 (8%)
 Frame = -1

Query  733  VINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTIT  554
            +  +  P   DGS TPPA+   LH ++   AS D DYA   ++   R + S RDN + IT
Sbjct  513  ITRDAFPYMCDGSRTPPASD--LHSNRTCIASQDADYATKSVLAASRAVRSPRDNTRMIT  570

Query  553  sslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNTRN  374
            S       S    R S  A +SC+LSPP+P+          G N      ++  R NT+ 
Sbjct  571  SLPVSPCSSPL--RQSGPAHKSCFLSPPHPT------YAMMGQNTLTSYESYPMRSNTKF  622

Query  373  T  371
            T
Sbjct  623  T  623


 Score = 27.7 bits (60),  Expect(3) = 2e-16, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  387  STQGTLDPWLDIPQYRTQTPGRS  319
            +T+ TLDPW +   Y+ +TPG S
Sbjct  619  NTKFTLDPWHETHMYKVRTPGAS  641



>ref|XP_003630274.1| Protein kinase, putative [Medicago truncatula]
 gb|AET04750.1| MAP kinase kinase kinase [Medicago truncatula]
Length=701

 Score = 59.3 bits (142),  Expect(3) = 9e-16, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FI  CLQR+PSARPTA +LL+HPFI+DQ+ +K A
Sbjct  526  NDAKNFIMLCLQRDPSARPTAQKLLEHPFIRDQSATKAA  564


 Score = 47.8 bits (112),  Expect(3) = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 58/90 (64%), Gaps = 8/90 (9%)
 Frame = -1

Query  724  EVQPRSFDGSCTPPAALELLHPS--QRNFASLDGDYAVNHMVNVFRPMISSRDNAKTITs  551
            +V    FDGS TPP    +L P+  +R+  S DGDYA    +   R   S RD+++TIT 
Sbjct  567  DVSSYMFDGSRTPP----VLEPNSNRRSITSFDGDYATKSAIAAPRTTRSPRDHSRTIT-  621

Query  550  slpvspcsspLRRHSEEARRSCYLSPPNPS  461
            SLPVSP SSPLR++ +E  RSC+ SPP+PS
Sbjct  622  SLPVSPSSSPLRQYGQE-HRSCFYSPPHPS  650


 Score = 23.9 bits (50),  Expect(3) = 9e-16, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 13/22 (59%), Gaps = 0/22 (0%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTPGRSSTR  310
            TLDPW +  +Y+  TP   S R
Sbjct  676  TLDPWHETSRYKAHTPPGGSPR  697



>ref|XP_007137724.1| hypothetical protein PHAVU_009G150500g [Phaseolus vulgaris]
 gb|ESW09718.1| hypothetical protein PHAVU_009G150500g [Phaseolus vulgaris]
Length=612

 Score = 60.5 bits (145),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV  747
            SEAK+FI+ CLQR+PSARPTA +LL+HPFI+DQ+ +K 
Sbjct  440  SEAKNFIQLCLQRDPSARPTAQRLLEHPFIRDQSATKA  477


 Score = 49.3 bits (116),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 53/104 (51%), Gaps = 4/104 (4%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ ++  K  +  +  +  P  FDGS TPP  L+  H ++ +  S DGDYA   +    R
Sbjct  469  IRDQSATKATNVRITRDAFPCMFDGSRTPPPVLD--HSNRTSINSFDGDYATKPVPVTSR  526

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPS  461
             + S RDN + ITS       S    R    A +SC+LSPP+PS
Sbjct  527  AVRSPRDNTRMITSLPVSPCSSPL--RQYGPAHKSCFLSPPHPS  568


 Score = 21.2 bits (43),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 9/24 (38%), Positives = 13/24 (54%), Gaps = 0/24 (0%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTPGRSSTRTM  304
             LDP+ +   Y+  TPG S  R +
Sbjct  589  ALDPFQEKSFYKAHTPGGSPRRLI  612



>ref|XP_004503937.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cicer arietinum]
Length=625

 Score = 56.2 bits (134),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FI  CLQR+P ARPTA +LL+HPFI+DQ+ +K A
Sbjct  452  NDAKNFIMLCLQRDPLARPTAHKLLEHPFIRDQSPTKAA  490


 Score = 50.4 bits (119),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 59/121 (49%), Gaps = 10/121 (8%)
 Frame = -1

Query  745  PHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNA  566
            P +    +V P  FDGS TPP  LE  H ++R   SLDGDYA    +   R + S RD+ 
Sbjct  486  PTKAATRDVFPYMFDGSRTPPV-LES-HSNRRTKTSLDGDYATKSAIAAPRAIRSPRDHT  543

Query  565  KTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARV  386
            + IT        SS   R+  E  RSC+ SPP     HP  T    N++  Y + + AR 
Sbjct  544  RMIT--SLPVSPSSSPLRYGPE-HRSCFYSPP-----HPTYTLMGQNSNTLYDTPYPARS  595

Query  385  N  383
            N
Sbjct  596  N  596


 Score = 23.9 bits (50),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 13/22 (59%), Gaps = 0/22 (0%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTPGRSSTR  310
            TLDPW +  +Y+  TP   S R
Sbjct  600  TLDPWHETSRYKAHTPPGGSPR  621



>ref|XP_004288333.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Fragaria vesca subsp. vesca]
Length=618

 Score = 60.1 bits (144),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK  750
            +AK+F+R CLQR PS RPTASQLLDHPFI++Q T++
Sbjct  441  DAKNFVRLCLQRNPSERPTASQLLDHPFIREQMTTR  476


 Score = 44.7 bits (104),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 58/115 (50%), Gaps = 8/115 (7%)
 Frame = -1

Query  715  PRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTITsslpvs  536
            P +FDGS TPP  LEL H ++ +    D D+ +   V   R + S RDNA+ ITS     
Sbjct  488  PYAFDGSRTPPI-LEL-HSNRTSITLGDADHIMKPSVTTSRAIRSPRDNARMITSLPVSP  545

Query  535  pcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNTRNT  371
              S    R    A +SC+LSPP+P+    +A     N + +  S++  R NT  T
Sbjct  546  CSSPL--RQYGPAHKSCFLSPPHPT----YAMMGQNNYNLNEYSSYTTRPNTSYT  594


 Score = 25.4 bits (54),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 18/29 (62%), Gaps = 1/29 (3%)
 Frame = -2

Query  387  STQGTLDPWLDIPQYRTQTPGRSSTRTMP  301
            +T  TL+PW + P  R QTPG  S RT P
Sbjct  590  NTSYTLEPWRESPLLRPQTPG-GSPRTRP  617



>ref|NP_001234485.1| MAP3Ka [Solanum lycopersicum]
 gb|AAS78640.1| MAP3Ka [Solanum lycopersicum]
Length=614

 Score = 72.0 bits (175),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQR------NFASLDGDYAVNH  611
            +K ++  K+ H  V  E   RSFDGS TPP  LEL HP  R      N +  +G+YA + 
Sbjct  458  VKNQSTAKVAHVGVTKESYLRSFDGSRTPPV-LEL-HPGGRTISPGRNISPAEGNYASHP  515

Query  610  MVNVFRPMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQF  431
            ++ V RP+I +R+N K ITS       S    R  E AR+SCYLSPP+ SSY     + +
Sbjct  516  VITVSRPLICARENVKAITSLPVSPTSSPL--RQYEPARKSCYLSPPH-SSYGIGGQSGY  572

Query  430  GNNHPDYSSTFAARVNTRNT  371
              N  DY S F  R +TR T
Sbjct  573  EAN--DY-SMFQTRPSTRIT  589


 Score = 38.1 bits (87),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  387  STQGTLDPWLDIPQYRTQTPGRS  319
            ST+ TL+PWL+IP +RTQTP RS
Sbjct  585  STRITLEPWLEIPHFRTQTPSRS  607


 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AKSFIR CLQREPS RPTAS+LL+HPF+K+Q+T+KVA
Sbjct  429  NDAKSFIRSCLQREPSLRPTASKLLEHPFVKNQSTAKVA  467



>ref|XP_010270404.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X2 [Nelumbo nucifera]
Length=640

 Score = 60.8 bits (146),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV  747
            ++AK+F++ CLQR+PSARPTA+QLL+HPF++DQ  S+V
Sbjct  462  NDAKNFLKLCLQRDPSARPTAAQLLEHPFVRDQAASRV  499


 Score = 43.1 bits (100),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 80/138 (58%), Gaps = 10/138 (7%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ +   ++ H N  N+V P S++G+ + P +    H    N  SL GDYA+  +V   R
Sbjct  491  VRDQAASRVIHINTTNDVYPSSYEGNHSLPTSE--FHFKGINTTSLHGDYAMKPVVTSSR  548

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPF-ATTQFGNNHP  416
             +  SRD+A+ +  SLPVSPCSSPLR+H   A RS +LSPP+ S  +PF A + +G    
Sbjct  549  ALKISRDSAR-VNMSLPVSPCSSPLRQHC-TANRSYFLSPPHLS--YPFIAQSSYGMT--  602

Query  415  DYSSTFAARVNTRNTGSM  362
            DYS+  + R NT  T  +
Sbjct  603  DYSA-LSTRPNTNYTADV  619


 Score = 25.8 bits (55),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = -2

Query  387  STQGTLDPWLDIPQYRTQTPGRS  319
            +T  T D W D PQ RT TPG S
Sbjct  612  NTNYTADVWWDSPQIRTPTPGGS  634



>gb|AAS78639.1| MAP3Ka [Nicotiana benthamiana]
Length=611

 Score = 71.2 bits (173),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 71/134 (53%), Gaps = 10/134 (7%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            +K ++  K+ H  V  E  PRSFDG+ TPP    +L    RN +   G+YA + ++ + R
Sbjct  463  VKNQSTTKVTHVGVTKEAYPRSFDGNRTPP----VLDSGGRNISPTKGNYASHPVITISR  518

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD  413
            P+   R+  KTITS       S    R  E ARRSCYLSPP+P +Y     + +  N  D
Sbjct  519  PLSCPREIVKTITSLPVSPTSSPL--RQYEPARRSCYLSPPHP-AYGIGGHSGYDEN--D  573

Query  412  YSSTFAARVNTRNT  371
            Y   F AR  TRNT
Sbjct  574  Y-LMFQARPTTRNT  586


 Score = 37.0 bits (84),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  387  STQGTLDPWLDIPQYRTQTPGRS  319
            +T+ TL+PWL+IPQ++ QTP RS
Sbjct  582  TTRNTLEPWLEIPQFKVQTPSRS  604


 Score = 65.9 bits (159),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FI+ CLQREPSARPTASQLL+HPF+K+Q+T+KV 
Sbjct  434  NDAKNFIKLCLQREPSARPTASQLLEHPFVKNQSTTKVT  472



>ref|XP_010270403.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X1 [Nelumbo nucifera]
Length=641

 Score = 60.8 bits (146),  Expect(3) = 8e-15, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV  747
            ++AK+F++ CLQR+PSARPTA+QLL+HPF++DQ  S+V
Sbjct  462  NDAKNFLKLCLQRDPSARPTAAQLLEHPFVRDQAASRV  499


 Score = 41.6 bits (96),  Expect(3) = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 79/138 (57%), Gaps = 9/138 (7%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ +   ++ H N  N+V P S++G+ +     E  H    N  SL GDYA+  +V   R
Sbjct  491  VRDQAASRVIHINTTNDVYPSSYEGNHSLQPTSEF-HFKGINTTSLHGDYAMKPVVTSSR  549

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPF-ATTQFGNNHP  416
             +  SRD+A+ +  SLPVSPCSSPLR+H   A RS +LSPP+ S  +PF A + +G    
Sbjct  550  ALKISRDSAR-VNMSLPVSPCSSPLRQHC-TANRSYFLSPPHLS--YPFIAQSSYGMT--  603

Query  415  DYSSTFAARVNTRNTGSM  362
            DYS+  + R NT  T  +
Sbjct  604  DYSA-LSTRPNTNYTADV  620


 Score = 25.8 bits (55),  Expect(3) = 8e-15, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = -2

Query  387  STQGTLDPWLDIPQYRTQTPGRS  319
            +T  T D W D PQ RT TPG S
Sbjct  613  NTNYTADVWWDSPQIRTPTPGGS  635



>ref|XP_009625680.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Nicotiana tomentosiformis]
Length=608

 Score = 71.2 bits (173),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 69/134 (51%), Gaps = 8/134 (6%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            +K ++  K+ H  V  E  PRSFDGS TPP     L    RN +   G+YA + ++ + R
Sbjct  458  VKNQSTAKVAHVGVTKEAYPRSFDGSRTPPVL--DLQSGGRNISPSKGNYASHPVITISR  515

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD  413
            P+   R+  KTITS       S    R  E ARRSCYLSPP+P+        Q G +  D
Sbjct  516  PLSCPREIVKTITSLPVSPTSSPL--RQYEPARRSCYLSPPHPAY---GIGGQSGYDAND  570

Query  412  YSSTFAARVNTRNT  371
            Y S F  R  TR+T
Sbjct  571  Y-SMFQTRPTTRST  583


 Score = 37.0 bits (84),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  387  STQGTLDPWLDIPQYRTQTPGRS  319
            +T+ TL+PWL+IPQ++ QTP RS
Sbjct  579  TTRSTLEPWLEIPQFKAQTPSRS  601


 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK FI+ CLQREPSARPTASQLL+HPF+K+Q+T+KVA
Sbjct  429  NDAKKFIKLCLQREPSARPTASQLLEHPFVKNQSTAKVA  467



>ref|XP_009765252.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Nicotiana sylvestris]
Length=613

 Score = 70.9 bits (172),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 71/134 (53%), Gaps = 8/134 (6%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            +K ++  K+ H  V  E  PRSFDGS TPP  L+ L    RN +   G+YA + ++ + R
Sbjct  463  VKNQSTAKVAHVGVTKEAYPRSFDGSRTPP-VLD-LQSGGRNISPSKGNYASHPVITISR  520

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD  413
            P+   R+  KTITS       S    R  E ARRSCYLSPP+P+        Q G +  D
Sbjct  521  PLSCPREIVKTITSLPVSPTSSPL--RQYEPARRSCYLSPPHPAY---GIGGQSGYDAND  575

Query  412  YSSTFAARVNTRNT  371
            Y S F  R  TR+T
Sbjct  576  Y-SMFQTRPTTRST  588


 Score = 37.0 bits (84),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  387  STQGTLDPWLDIPQYRTQTPGRS  319
            +T+ TL+PWL+IPQ++ QTP RS
Sbjct  584  TTRSTLEPWLEIPQFKAQTPSRS  606


 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK FI+ CLQREPSARPTASQLL HPF+K+Q+T+KVA
Sbjct  434  NDAKKFIKLCLQREPSARPTASQLLKHPFVKNQSTAKVA  472



>ref|XP_010260483.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X3 [Nelumbo nucifera]
Length=479

 Score = 57.4 bits (137),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            S+AKSF+  CLQR+P+ARPTA+QLLDHPF++D
Sbjct  283  SDAKSFLNLCLQRDPAARPTAAQLLDHPFVRD  314


 Score = 45.1 bits (105),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 68/120 (57%), Gaps = 9/120 (8%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQR-NFASLDGDYAVNHMVNVFRPMISSRDNAKT  560
            N  ++  P SF+GS T     EL  P  R N  SL GDY +  +V   R   SSRD+ + 
Sbjct  325  NTTHDALPSSFEGSHTRQTVSEL--PFNRTNVTSLHGDYGMKQVVTSSRAFKSSRDSVR-  381

Query  559  ITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNT  380
            +  SLPVSPCSSPLR H   A RS +LSPP+PS  +PF   Q G    DYS+  + R NT
Sbjct  382  LNVSLPVSPCSSPLRNHG-TANRSYFLSPPHPS--YPFG-AQSGYGPTDYSA-LSTRPNT  436


 Score = 23.9 bits (50),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 0/20 (0%)
 Frame = -2

Query  369  DPWLDIPQYRTQTPGRSSTR  310
            D W D PQ RT TPG S  R
Sbjct  441  DAWWDNPQPRTTTPGGSPRR  460



>ref|XP_010260481.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Nelumbo nucifera]
Length=665

 Score = 57.0 bits (136),  Expect(3) = 3e-14, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            S+AKSF+  CLQR+P+ARPTA+QLLDHPF++D
Sbjct  469  SDAKSFLNLCLQRDPAARPTAAQLLDHPFVRD  500


 Score = 45.1 bits (105),  Expect(3) = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 68/120 (57%), Gaps = 9/120 (8%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQR-NFASLDGDYAVNHMVNVFRPMISSRDNAKT  560
            N  ++  P SF+GS T     EL  P  R N  SL GDY +  +V   R   SSRD+ + 
Sbjct  511  NTTHDALPSSFEGSHTRQTVSEL--PFNRTNVTSLHGDYGMKQVVTSSRAFKSSRDSVR-  567

Query  559  ITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNT  380
            +  SLPVSPCSSPLR H   A RS +LSPP+PS  +PF   Q G    DYS+  + R NT
Sbjct  568  LNVSLPVSPCSSPLRNHG-TANRSYFLSPPHPS--YPFG-AQSGYGPTDYSA-LSTRPNT  622


 Score = 23.9 bits (50),  Expect(3) = 3e-14, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 0/20 (0%)
 Frame = -2

Query  369  DPWLDIPQYRTQTPGRSSTR  310
            D W D PQ RT TPG S  R
Sbjct  627  DAWWDNPQPRTTTPGGSPRR  646



>gb|EYU23759.1| hypothetical protein MIMGU_mgv1a003649mg [Erythranthe guttata]
Length=572

 Score = 62.8 bits (151),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV  747
            ++AKSFIR CLQREPSARPTASQLL HPF+++Q T + 
Sbjct  416  ADAKSFIRLCLQREPSARPTASQLLGHPFVRNQTTPRT  453


 Score = 43.1 bits (100),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 56/106 (53%), Gaps = 6/106 (6%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ +T  +  + N+  E  PR+FDG+ T   ALE+   S+ N    D D A   ++ + R
Sbjct  445  VRNQTTPRTTNVNITREAFPRAFDGNRTS-TALEMHSSSRTNNTPSDRDDAARLILPI-R  502

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSY  455
             +IS RDN + ITS       S       ++  +S +LSPPNP+SY
Sbjct  503  TLISRRDNTRAITSLPVSPSSSPLR----QDRYKSFFLSPPNPNSY  544



>ref|XP_010260482.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Nelumbo nucifera]
Length=664

 Score = 57.0 bits (136),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            S+AKSF+  CLQR+P+ARPTA+QLLDHPF++D
Sbjct  469  SDAKSFLNLCLQRDPAARPTAAQLLDHPFVRD  500


 Score = 42.4 bits (98),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 68/119 (57%), Gaps = 8/119 (7%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTI  557
            N  ++  P SF+GS T    +  L  ++ N  SL GDY +  +V   R   SSRD+ + +
Sbjct  511  NTTHDALPSSFEGSHT--RTVSELPFNRTNVTSLHGDYGMKQVVTSSRAFKSSRDSVR-L  567

Query  556  TsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNT  380
              SLPVSPCSSPLR H   A RS +LSPP+PS  +PF   Q G    DYS+  + R NT
Sbjct  568  NVSLPVSPCSSPLRNHG-TANRSYFLSPPHPS--YPFG-AQSGYGPTDYSA-LSTRPNT  621


 Score = 23.9 bits (50),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 0/20 (0%)
 Frame = -2

Query  369  DPWLDIPQYRTQTPGRSSTR  310
            D W D PQ RT TPG S  R
Sbjct  626  DAWWDNPQPRTTTPGGSPRR  645



>gb|EYU24311.1| hypothetical protein MIMGU_mgv1a025509mg [Erythranthe guttata]
Length=641

 Score = 60.1 bits (144),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV  747
            ++AKSFIR CLQREPSARPTA+QLL HPF+++Q T + 
Sbjct  461  ADAKSFIRLCLQREPSARPTAAQLLSHPFVRNQITVRA  498


 Score = 35.8 bits (81),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 47/92 (51%), Gaps = 8/92 (9%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTI  557
            N+  E  PR+FDGS T P ALEL     R+  + +  +  +      R ++S RDNA+TI
Sbjct  502  NLTREAFPRAFDGSRT-PTALEL-----RSNRTSNSSFEDSSRSAASRTLLSPRDNARTI  555

Query  556  TsslpvspcsspLRRHSEEARRSCYLSPPNPS  461
             S       S      +  A R+ +LSPP+PS
Sbjct  556  ASLPVSPSSSPLRSDGA--AYRNFFLSPPHPS  585


 Score = 26.9 bits (58),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTPGRSSTRT  307
             +DPW +IP +  QT  RS  RT
Sbjct  614  AVDPWPEIPHFGVQTHARSPIRT  636



>gb|KJB46892.1| hypothetical protein B456_008G000500 [Gossypium raimondii]
Length=576

 Score = 70.1 bits (170),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +EAKSFIR CLQREPSARPTA QLLDHPFI DQ T++VA
Sbjct  483  NEAKSFIRLCLQREPSARPTALQLLDHPFIHDQATTRVA  521


 Score = 32.7 bits (73),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = -1

Query  733  VINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPM  587
            +  +  P +FDGS TPP  LE L   + N  S DGDY +  M    R +
Sbjct  525  ITKDAFPYTFDGSRTPP-ILE-LQSIRNNVPSFDGDYEMRGMTTASRAL  571



>gb|EYU18037.1| hypothetical protein MIMGU_mgv1a002756mg [Erythranthe guttata]
Length=641

 Score = 59.7 bits (143),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV  747
            ++AKSFIR CLQREPSARPTA+QLL HPF+++Q T + 
Sbjct  461  ADAKSFIRLCLQREPSARPTAAQLLTHPFVRNQITVRA  498


 Score = 35.8 bits (81),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 46/92 (50%), Gaps = 8/92 (9%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTI  557
            N+  E  PR+FDGS T P ALEL     R+  + +  +         R ++S RDNA+TI
Sbjct  502  NLTREAFPRAFDGSRT-PTALEL-----RSNRTSNSSFEDTSRSAASRTLLSPRDNARTI  555

Query  556  TsslpvspcsspLRRHSEEARRSCYLSPPNPS  461
             S       S      +  A R+ +LSPP+PS
Sbjct  556  ASLPVSPSSSPLRSDGA--AYRNFFLSPPHPS  585


 Score = 26.2 bits (56),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (62%), Gaps = 0/21 (0%)
 Frame = -2

Query  369  DPWLDIPQYRTQTPGRSSTRT  307
            DPW +IP +  QT  RS  RT
Sbjct  616  DPWPEIPHFGAQTHARSPIRT  636



>ref|XP_002529731.1| mitogen activated protein kinase kinase kinase 3, mapkkk3, mekk3, 
putative [Ricinus communis]
 gb|EEF32660.1| mitogen activated protein kinase kinase kinase 3, mapkkk3, mekk3, 
putative [Ricinus communis]
Length=573

 Score = 68.9 bits (167),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +EAKSFI+ CLQR+PSARPTASQLLDHPFI+DQ T++ A
Sbjct  481  NEAKSFIKLCLQRDPSARPTASQLLDHPFIRDQATTRAA  519


 Score = 30.0 bits (66),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 2/54 (4%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSR  575
            N+  +  P +FDGS TPP AL+ LH  + +    +G+YA+  ++   R + ++R
Sbjct  522  NITRDAFPFTFDGSRTPP-ALD-LHSKRSSIPLSEGEYAMKPVITNVRGLKNTR  573



>ref|XP_010680195.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Beta vulgaris subsp. vulgaris]
Length=647

 Score = 57.0 bits (136),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV  747
            S+AKSF+  CLQR+P+ RP ASQLLDHPF++DQ+  + 
Sbjct  471  SDAKSFLYLCLQRDPADRPLASQLLDHPFVRDQSVGRA  508


 Score = 38.9 bits (89),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 53/109 (49%), Gaps = 14/109 (13%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMIS---SRDNA  566
            N  NE    SFDG    P  LE+ HP +++ +S D D       N+ RP ++   +RDN 
Sbjct  512  NATNEASAFSFDGR-RKPQPLEI-HPRRKSISSYDTD-------NIKRPGVAIFEARDNP  562

Query  565  KTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNH  419
            ++I S       S   R     A +SC LSPP+PS   P  ++   N+H
Sbjct  563  RSIMSLPVSPSSSPLHRL--VPASKSCLLSPPHPSYAWPGQSSYNINDH  609


 Score = 20.4 bits (41),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 8/15 (53%), Positives = 12/15 (80%), Gaps = 1/15 (7%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQT  331
            TLDPW++   ++TQT
Sbjct  623  TLDPWIE-STFKTQT  636



>ref|XP_008441055.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X2 [Cucumis melo]
Length=619

 Score = 56.2 bits (134),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            S+A+SF++ CLQR+PSARP+A++LLDHPF++D  T + +
Sbjct  445  SDARSFVQLCLQRDPSARPSAAELLDHPFVQDAVTPRAS  483


 Score = 36.6 bits (83),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 56/119 (47%), Gaps = 11/119 (9%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTI  557
            N+  +  P SFDG  T P  L   HP++++ +  DGDY  N   +   P  S R N + I
Sbjct  486  NLSVDAFPFSFDGIQTSP--LLDRHPNRKSISICDGDYVTNPTFSSRAP--SPRGNGRLI  541

Query  556  TsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNT  380
            TS       S    R      +SCYLSPP+ +SY      Q G N  +Y+  +  R NT
Sbjct  542  TSLPVSPCSSPL--RSYGPTHQSCYLSPPH-TSY--MGVGQSGYNLNEYA--YNTRPNT  593



>ref|XP_004148657.1| PREDICTED: serine/threonine-protein kinase KIC1-like [Cucumis 
sativus]
 gb|KGN48350.1| hypothetical protein Csa_6G483320 [Cucumis sativus]
Length=623

 Score = 56.2 bits (134),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            S+A+SF++ CLQR+PSARP+A++LLDHPF++D  T + +
Sbjct  449  SDARSFVQLCLQRDPSARPSAAELLDHPFVQDAVTPRAS  487


 Score = 36.6 bits (83),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 52/110 (47%), Gaps = 9/110 (8%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTI  557
            N+  +  P SFDG  T P  L   HP++++ +  DGDY  N   +   P  S R N + I
Sbjct  490  NLSVDAFPFSFDGIQTSP--LLDRHPNRKSISICDGDYVTNPTFSSRAP--SPRGNGRLI  545

Query  556  TsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYS  407
            TS       S    R      +SCYLSPP+ +SY      Q G N  +Y+
Sbjct  546  TSLPVSPCSSPL--RSYGPTHQSCYLSPPH-TSY--MGVGQSGYNLNEYA  590



>ref|XP_008441054.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X1 [Cucumis melo]
Length=625

 Score = 56.2 bits (134),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            S+A+SF++ CLQR+PSARP+A++LLDHPF++D  T + +
Sbjct  451  SDARSFVQLCLQRDPSARPSAAELLDHPFVQDAVTPRAS  489


 Score = 36.6 bits (83),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 56/119 (47%), Gaps = 11/119 (9%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTI  557
            N+  +  P SFDG  T P  L   HP++++ +  DGDY  N   +   P  S R N + I
Sbjct  492  NLSVDAFPFSFDGIQTSP--LLDRHPNRKSISICDGDYVTNPTFSSRAP--SPRGNGRLI  547

Query  556  TsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNT  380
            TS       S    R      +SCYLSPP+ +SY      Q G N  +Y+  +  R NT
Sbjct  548  TSLPVSPCSSPL--RSYGPTHQSCYLSPPH-TSY--MGVGQSGYNLNEYA--YNTRPNT  599



>ref|XP_004171417.1| PREDICTED: protein kinase wis1-like [Cucumis sativus]
Length=623

 Score = 56.2 bits (134),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            S+A+SF++ CLQR+PSARP+A++LLDHPF++D  T + +
Sbjct  449  SDARSFVQLCLQRDPSARPSAAELLDHPFVQDAVTPRAS  487


 Score = 36.6 bits (83),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 52/110 (47%), Gaps = 9/110 (8%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTI  557
            N+  +  P SFDG  T P  L   HP++++ +  DGDY  N   +   P  S R N + I
Sbjct  490  NLSVDAFPFSFDGIQTSP--LLDRHPNRKSISICDGDYVTNPTFSSRAP--SPRGNGRLI  545

Query  556  TsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYS  407
            TS       S    R      +SCYLSPP+ +SY      Q G N  +Y+
Sbjct  546  TSLPVSPCSSPL--RSYGPTHQSCYLSPPH-TSY--MGVGQSGYNLNEYA  590



>gb|KJB46894.1| hypothetical protein B456_008G000500 [Gossypium raimondii]
Length=545

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +EAKSFIR CLQREPSARPTA QLLDHPFI DQ T++VA
Sbjct  477  NEAKSFIRLCLQREPSARPTALQLLDHPFIHDQATTRVA  515



>gb|KJB46893.1| hypothetical protein B456_008G000500 [Gossypium raimondii]
Length=551

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +EAKSFIR CLQREPSARPTA QLLDHPFI DQ T++VA
Sbjct  483  NEAKSFIRLCLQREPSARPTALQLLDHPFIHDQATTRVA  521



>ref|XP_008358959.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Malus domestica]
 ref|XP_008358960.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Malus domestica]
Length=642

 Score = 54.3 bits (129),  Expect(3) = 3e-10, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK  750
            ++AKSF+R CLQR PS RPTA  LL HPFI++Q T++
Sbjct  461  NDAKSFVRLCLQRXPSERPTAFDLLXHPFIREQTTTR  497


 Score = 36.2 bits (82),  Expect(3) = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 58/123 (47%), Gaps = 7/123 (6%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ +T  +  +  V  +  P +F GS TPP  LEL H ++ +F   D D+ V   +   R
Sbjct  490  IREQTTTRSSNMKVTKDAFPYAFHGSRTPPV-LEL-HSNRTSFTLSDADHTVKPTIATSR  547

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD  413
             + S R+N + ITS       S    R      +  +LSPP+P +Y     + +  N  D
Sbjct  548  DVRSPRENIRMITSLPVSPCSSPL--RQYGATHKXSFLSPPHP-TYAMMGQSSY--NLSD  602

Query  412  YSS  404
            YSS
Sbjct  603  YSS  605


 Score = 21.2 bits (43),  Expect(3) = 3e-10, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 1/25 (4%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTPGRSSTRTMP  301
            TLDPW +      QT G SS RT P
Sbjct  616  TLDPWQETTLLNAQTLG-SSPRTRP  639



>ref|XP_007048387.1| Mitogen-activated protein kinase kinase kinase 3 [Theobroma cacao]
 gb|EOX92544.1| Mitogen-activated protein kinase kinase kinase 3 [Theobroma cacao]
Length=668

 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +EAK+FIR CLQREPSARPTA QLLDHPFI+DQ T++VA
Sbjct  491  NEAKNFIRLCLQREPSARPTALQLLDHPFIRDQATTRVA  529


 Score = 52.4 bits (124),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 71/134 (53%), Gaps = 9/134 (7%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ +   ++ + ++  +  P +FDGS TPP  LEL   ++ N  S DGDY    +    R
Sbjct  520  IRDQATTRVANISITKDAFPYTFDGSRTPPI-LEL-QSNRNNILSFDGDYGTRGVSATSR  577

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD  413
             + S RDNA+TIT        SS   R++  A +SC+ SPP+P+  + F   Q G N  D
Sbjct  578  ALRSPRDNARTIT--SLPVSPSSSPLRYA-PAHKSCFYSPPHPA--YQF-VGQSGYNFGD  631

Query  412  YSSTFAARVNTRNT  371
            +S + A R + R T
Sbjct  632  FSGS-ALRTSPRYT  644


 Score = 26.9 bits (58),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTPGRSSTRTMP  301
            T DPWL+  Q + QTPG +S RT P
Sbjct  644  THDPWLESSQLKVQTPG-TSPRTRP  667



>gb|KJB75262.1| hypothetical protein B456_012G034500 [Gossypium raimondii]
Length=577

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +EAKSFIR CLQR+PSARPTA QLLDHPFI+DQ T++VA
Sbjct  484  NEAKSFIRLCLQRDPSARPTAFQLLDHPFIRDQATTRVA  522



>gb|KHG01918.1| Mitogen-activated protein kinase kinase kinase 2 [Gossypium arboreum]
Length=661

 Score = 69.3 bits (168),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +EAKSFIR CLQR+PSARPTA QLLDHPFI+DQ T++VA
Sbjct  484  NEAKSFIRLCLQRDPSARPTAFQLLDHPFIRDQATTRVA  522


 Score = 55.1 bits (131),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 71/134 (53%), Gaps = 9/134 (7%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ +   ++ + ++  +  P +FDGS TPP  LE+   ++ N  S DGDY    M    R
Sbjct  513  IRDQATTRVANISITKDAFPYTFDGSRTPPI-LEM-QSNRNNILSFDGDYGTKGMATTSR  570

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD  413
             + + RDNA+TITS       S    R+   A RSC+LSPP+P+  + F   Q G+N  D
Sbjct  571  ALRTPRDNARTITSLPVSPCSSPL--RYG-PAHRSCFLSPPHPA--YQFV-GQSGHNLGD  624

Query  412  YSSTFAARVNTRNT  371
            +S    +R N R T
Sbjct  625  FSGN-TSRPNPRYT  637


 Score = 30.0 bits (66),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTPGRSSTRTMP  301
            T DPWL+ PQ + QTPG +S RT P
Sbjct  637  THDPWLETPQLKVQTPG-TSPRTRP  660



>gb|KJB75259.1| hypothetical protein B456_012G034500 [Gossypium raimondii]
Length=661

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +EAKSFIR CLQR+PSARPTA QLLDHPFI+DQ T++VA
Sbjct  484  NEAKSFIRLCLQRDPSARPTAFQLLDHPFIRDQATTRVA  522


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 69/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ +   ++ + ++  +  P +FDGS TPP  LE+   ++ N  S DGDY    M    R
Sbjct  513  IRDQATTRVANISITKDAFPYTFDGSRTPPI-LEM-QSNRNNILSFDGDYGTQGMATTSR  570

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD  413
             + + RDNA+TITS       S    R+      SC+LSPP+P+  + F   Q G+N  D
Sbjct  571  ALRTPRDNARTITSLPVSPCSSPL--RYG-PVHMSCFLSPPHPA--YQFV-GQSGHNLGD  624

Query  412  YSSTFAARVNTRNT  371
            +S    +R N R T
Sbjct  625  FSGN-TSRPNPRYT  637



>gb|KJB75261.1| hypothetical protein B456_012G034500 [Gossypium raimondii]
Length=662

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +EAKSFIR CLQR+PSARPTA QLLDHPFI+DQ T++VA
Sbjct  484  NEAKSFIRLCLQRDPSARPTAFQLLDHPFIRDQATTRVA  522


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 8/134 (6%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ +   ++ + ++  +  P +FDGS TP   LE+   ++ N  S DGDY    M    R
Sbjct  513  IRDQATTRVANISITKDAFPYTFDGSRTPQPILEM-QSNRNNILSFDGDYGTQGMATTSR  571

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD  413
             + + RDNA+TITS       S    R+      SC+LSPP+P+  + F   Q G+N  D
Sbjct  572  ALRTPRDNARTITSLPVSPCSSPL--RYG-PVHMSCFLSPPHPA--YQFV-GQSGHNLGD  625

Query  412  YSSTFAARVNTRNT  371
            +S    +R N R T
Sbjct  626  FSGN-TSRPNPRYT  638



>gb|ADI52619.1| mitogen-activated protein kinase kinase kinase [Gossypium hirsutum]
Length=661

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +EAKSFIR CLQR+PSARPTA QLLDHPFI+DQ T++VA
Sbjct  484  NEAKSFIRLCLQRDPSARPTAFQLLDHPFIRDQATTRVA  522


 Score = 57.4 bits (137),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 71/134 (53%), Gaps = 9/134 (7%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ +   ++ + ++  +  P +FDGS TPP  LE+   ++ N  S DGDY    M    R
Sbjct  513  IRDQATTRVANISITKDAFPYTFDGSRTPPI-LEM-QSNRNNILSFDGDYGTKGMATTSR  570

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD  413
             + + RDNA+TITS       S    R+   A RSC+LSPP+P +YH     Q G+N  D
Sbjct  571  ALRTPRDNARTITSLPVSPCSSPL--RYG-PAHRSCFLSPPHP-AYH--FVGQSGHNLGD  624

Query  412  YSSTFAARVNTRNT  371
            +S    +R N R T
Sbjct  625  FSGN-TSRPNPRYT  637


 Score = 30.0 bits (66),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTPGRSSTRTMP  301
            T DPWL+ PQ + QTPG +S RT P
Sbjct  637  THDPWLETPQLKVQTPG-TSPRTRP  660



>ref|XP_002309908.2| mitogen-activated protein kinase kinase kinase [Populus trichocarpa]
 gb|EEE90358.2| mitogen-activated protein kinase kinase kinase [Populus trichocarpa]
Length=610

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AKSFI+ CLQR+P ARPTASQLLDHPFI+DQ+T++VA
Sbjct  433  NDAKSFIKLCLQRDPLARPTASQLLDHPFIRDQSTTRVA  471


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 72/104 (69%), Gaps = 4/104 (4%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ ++  ++ + N+  +  PR+FDGS TPPA LEL H ++ N  S DGD+A+  +VN  R
Sbjct  462  IRDQSTTRVANINITRDAFPRTFDGSRTPPA-LEL-HSNRTNANSCDGDFAMKPVVNNIR  519

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPS  461
             + + RD+ + IT S+PVSPCSSPLR+H   A RS YLSPP+P+
Sbjct  520  ALKNPRDDGRMIT-SMPVSPCSSPLRQHG-PAHRSSYLSPPHPA  561



>ref|XP_002306242.1| mitogen-activated protein kinase kinase kinase [Populus trichocarpa]
 gb|EEE93238.1| mitogen-activated protein kinase kinase kinase [Populus trichocarpa]
Length=594

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AKSFI+ CLQR+PSARPTA QLLDHPFI+DQ T++VA
Sbjct  418  NDAKSFIKLCLQRDPSARPTAFQLLDHPFIRDQATTRVA  456



>ref|XP_010912615.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Elaeis guineensis]
Length=678

 Score = 65.1 bits (157),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            SEAKSF++ CLQR+PSARPTA+QL+DHPF++DQ T K A
Sbjct  502  SEAKSFLKLCLQRDPSARPTAAQLMDHPFVRDQPTIKAA  540


 Score = 23.5 bits (49),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/93 (26%), Positives = 39/93 (42%), Gaps = 4/93 (4%)
 Frame = -1

Query  736  NVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDG-DYAVNHMVNVFRPMISSRDNAKT  560
            N+I+++ P S DGS T    +     S+R+ + L   D+ + H         S   N   
Sbjct  543  NMISDLLPSSSDGSHT---KITTGFSSKRSISPLHVRDHGIRHATECPSAFSSGYGNPSI  599

Query  559  ITsslpvspcsspLRRHSEEARRSCYLSPPNPS  461
              +        S   R  ++  RSC  SPP+P+
Sbjct  600  RMNMSLPVSPCSSPLRQFKQCNRSCLPSPPHPA  632



>ref|XP_011031200.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Populus euphratica]
Length=670

 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AKSFI+ CLQR+PSARPTA QLLDHPFI+DQ T++VA
Sbjct  494  NDAKSFIKLCLQRDPSARPTAFQLLDHPFIRDQATTRVA  532



>ref|XP_008808477.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Phoenix dactylifera]
Length=683

 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            S+AKSF+R CLQR+PSARPTA QL+DHPF++DQ T KVA
Sbjct  507  SDAKSFLRRCLQRDPSARPTAVQLMDHPFVRDQPTMKVA  545



>gb|KFK39943.1| hypothetical protein AALP_AA3G309800 [Arabis alpina]
Length=607

 Score = 50.1 bits (118),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT  756
            ++AK+FIR CLQR P+ RPTA QLL+HPFI+   T
Sbjct  440  NDAKNFIRLCLQRSPALRPTAFQLLEHPFIRVHAT  474


 Score = 37.7 bits (86),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 44/92 (48%), Gaps = 8/92 (9%)
 Frame = -1

Query  724  EVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTITssl  545
            +  PRSFDGSCT P     L    R  +S + +Y    +    R + + R+N + ITS  
Sbjct  481  DASPRSFDGSCTQP-----LREPYRGRSSHE-NYLTQPLAVSSRVIKNPRENMRAITSLP  534

Query  544  pvspcsspLRRHSEEARRSCYLSPPNPSSYHP  449
                 S    R    A +SCYLSPP+PS   P
Sbjct  535  VSPCSSPL--RQLGPAYKSCYLSPPHPSYSFP  564



>ref|XP_011022952.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Populus euphratica]
Length=635

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AKSFI+ CLQR+P ARPTASQLLDHPFI+DQ+T++V 
Sbjct  458  NDAKSFIKLCLQRDPLARPTASQLLDHPFIRDQSTTRVV  496


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 72/104 (69%), Gaps = 4/104 (4%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ ++  ++ + N+  +  PR+FDGS TPPA LEL H ++ N  S DGD+A+  +VN  R
Sbjct  487  IRDQSTTRVVNINITRDAFPRTFDGSRTPPA-LEL-HSNRTNANSCDGDFAMKPVVNNIR  544

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPS  461
             + + RD+ + IT S+PVSPCSSPLR+H   A RS YLSPP+P+
Sbjct  545  ALKNPRDDGRMIT-SMPVSPCSSPLRQHG-PAHRSSYLSPPHPA  586



>ref|XP_010912614.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Elaeis guineensis]
Length=707

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            SEAKSF++ CLQR+PSARPTA+QL+DHPF++DQ T K A
Sbjct  502  SEAKSFLKLCLQRDPSARPTAAQLMDHPFVRDQPTIKAA  540



>gb|ACN30597.1| unknown [Zea mays]
 gb|ADM88868.1| mitogen activated protein kinase kinase kinase [Zea mays]
Length=352

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK  750
            SEAKSF++ CLQR+P+ARPTA+QL+DHPF+KDQ T +
Sbjct  170  SEAKSFLKLCLQRDPAARPTAAQLMDHPFVKDQATVR  206



>gb|KFK39944.1| hypothetical protein AALP_AA3G309800 [Arabis alpina]
Length=608

 Score = 50.1 bits (118),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT  756
            ++AK+FIR CLQR P+ RPTA QLL+HPFI+   T
Sbjct  440  NDAKNFIRLCLQRSPALRPTAFQLLEHPFIRVHAT  474


 Score = 35.0 bits (79),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 46/97 (47%), Gaps = 17/97 (18%)
 Frame = -1

Query  724  EVQPRSFDGSCTPPAALELLHP-----SQRNFASLDGDYAVNHMVNVFRPMISSRDNAKT  560
            +  PRSFDGSCT P    L  P     S  N+  L    AV+  V +  P   SR+N + 
Sbjct  481  DASPRSFDGSCTQP----LREPYRGRSSHENY--LTQPLAVSSRV-IKNP---SRENMRA  530

Query  559  ITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHP  449
            ITS       S    R    A +SCYLSPP+PS   P
Sbjct  531  ITSLPVSPCSSPL--RQLGPAYKSCYLSPPHPSYSFP  565



>gb|KFK39942.1| hypothetical protein AALP_AA3G309800 [Arabis alpina]
Length=609

 Score = 50.1 bits (118),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT  756
            ++AK+FIR CLQR P+ RPTA QLL+HPFI+   T
Sbjct  441  NDAKNFIRLCLQRSPALRPTAFQLLEHPFIRVHAT  475


 Score = 35.0 bits (79),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 46/97 (47%), Gaps = 17/97 (18%)
 Frame = -1

Query  724  EVQPRSFDGSCTPPAALELLHP-----SQRNFASLDGDYAVNHMVNVFRPMISSRDNAKT  560
            +  PRSFDGSCT P    L  P     S  N+  L    AV+  V +  P   SR+N + 
Sbjct  482  DASPRSFDGSCTQP----LREPYRGRSSHENY--LTQPLAVSSRV-IKNP---SRENMRA  531

Query  559  ITsslpvspcsspLRRHSEEARRSCYLSPPNPSSYHP  449
            ITS       S    R    A +SCYLSPP+PS   P
Sbjct  532  ITSLPVSPCSSPL--RQLGPAYKSCYLSPPHPSYSFP  566



>ref|NP_001130692.1| mitogen activated protein kinase kinase kinase [Zea mays]
 gb|ACF79010.1| unknown [Zea mays]
Length=604

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK  750
            SEAKSF++ CLQR+P+ARPTA+QL+DHPF+KDQ T +
Sbjct  422  SEAKSFLKLCLQRDPAARPTAAQLMDHPFVKDQATVR  458



>ref|XP_010090849.1| Mitogen-activated protein kinase kinase kinase ANP1 [Morus notabilis]
 gb|EXB40974.1| Mitogen-activated protein kinase kinase kinase ANP1 [Morus notabilis]
Length=616

 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AKSF+R CLQR+PSARPTASQLL+HPFI++Q  ++ A
Sbjct  456  NDAKSFVRQCLQRDPSARPTASQLLEHPFIREQTITRTA  494



>ref|XP_010479930.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X4 [Camelina sativa]
Length=606

 Score = 56.6 bits (135),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR PS RPTASQLLDHPF++  +T++VA
Sbjct  439  NDAKNFIRLCLQRNPSVRPTASQLLDHPFLR-VHTTRVA  476


 Score = 27.3 bits (59),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 15/110 (14%)
 Frame = -1

Query  727  NEVQPRSFDGSCTPPAALELLHPSQRNF-ASLDGDYAVNHMVNVFRPMISSRDNAKTITs  551
             +  PRSFDGS +         P++ ++   L  D      ++  R + S R+N + ITS
Sbjct  482  KDAAPRSFDGSFS--------LPTRESYPGRLSHDNYQRQPLS--RAIKSPRENVRAITS  531

Query  550  slpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSST  401
                   S    R    A +SC+LSPP+PS  + F     G N  +++S+
Sbjct  532  LPVSPCSSPL--RQLGPAYKSCFLSPPHPS--YAFPGLDSGYNLAEFASS  577



>ref|XP_010479928.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X3 [Camelina sativa]
Length=607

 Score = 56.6 bits (135),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR PS RPTASQLLDHPF++  +T++VA
Sbjct  440  NDAKNFIRLCLQRNPSVRPTASQLLDHPFLR-VHTTRVA  477


 Score = 27.3 bits (59),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 15/110 (14%)
 Frame = -1

Query  727  NEVQPRSFDGSCTPPAALELLHPSQRNF-ASLDGDYAVNHMVNVFRPMISSRDNAKTITs  551
             +  PRSFDGS +         P++ ++   L  D      ++  R + S R+N + ITS
Sbjct  483  KDAAPRSFDGSFS--------LPTRESYPGRLSHDNYQRQPLS--RAIKSPRENVRAITS  532

Query  550  slpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSST  401
                   S    R    A +SC+LSPP+PS  + F     G N  +++S+
Sbjct  533  LPVSPCSSPL--RQLGPAYKSCFLSPPHPS--YAFPGLDSGYNLAEFASS  578



>ref|XP_010930645.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Elaeis guineensis]
Length=680

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            S+AKSF+R CLQR+PSARPTA+QL+DHPF++DQ   K A
Sbjct  500  SDAKSFLRRCLQRDPSARPTAAQLMDHPFVRDQPLIKAA  538



>ref|XP_010930646.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Elaeis guineensis]
Length=659

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            S+AKSF+R CLQR+PSARPTA+QL+DHPF++DQ   K A
Sbjct  479  SDAKSFLRRCLQRDPSARPTAAQLMDHPFVRDQPLIKAA  517



>emb|CAN67061.1| hypothetical protein VITISV_017538 [Vitis vinifera]
Length=1066

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AKSF+R CLQR+PSARPTA QLLDH F++DQ T+++A
Sbjct  467  NDAKSFVRLCLQRDPSARPTALQLLDHSFVRDQATTRIA  505



>emb|CAA08995.1| MAP3K alpha 1 protein kinase [Brassica napus]
Length=591

 Score = 51.2 bits (121),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            ++AK+FIR CLQR P+ RPTA+QLL+HPF++
Sbjct  428  NDAKNFIRLCLQRNPTVRPTAAQLLEHPFLR  458


 Score = 32.3 bits (72),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 52/112 (46%), Gaps = 24/112 (21%)
 Frame = -1

Query  724  EVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMIS-SRDNAKTITss  548
            +V PR +DGS + P              + +  Y+  H   VF P+ S SR+N + ITS 
Sbjct  472  DVPPRPYDGSSSMP--------------TREPPYSGRH--PVFHPIKSPSRENVRAITSL  515

Query  547  lpvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAA  392
                  S    R    A +SC+LSPP+PS  + F   + G NH    + FAA
Sbjct  516  PVSPCSSPL--RQLGPAYKSCFLSPPHPS--YAFPVQESGYNH---QAEFAA  560



>gb|KHN10572.1| Mitogen-activated protein kinase kinase kinase 2 [Glycine soja]
Length=131

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK  750
            SEAK+FI+ CLQR+PSARPTA +L++HPFI+DQ+  K
Sbjct  72   SEAKNFIQLCLQRDPSARPTAQKLIEHPFIRDQSARK  108



>ref|XP_008795233.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Phoenix dactylifera]
Length=608

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            S+AK F++ CLQR+PSARPTA+QL+DHPF++DQ T K A
Sbjct  429  SDAKCFLKLCLQRDPSARPTAAQLMDHPFVRDQPTIKAA  467



>ref|XP_004979130.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Setaria italica]
Length=671

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT  756
            SEAKSF++ CLQR+P+ARPTA+QL+DHPF+KD  T
Sbjct  491  SEAKSFLKLCLQRDPAARPTAAQLMDHPFVKDHAT  525



>gb|AGU71374.1| mitogen-activated protein kinase kinase kinase, partial [Lumnitzera 
racemosa]
Length=148

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            SEAKSFI  CLQREPSARP A  LL+HPFI+DQ  ++ +
Sbjct  58   SEAKSFITLCLQREPSARPKAVDLLNHPFIRDQTITRAS  96



>ref|XP_006409679.1| hypothetical protein EUTSA_v10022608mg [Eutrema salsugineum]
 gb|ESQ51132.1| hypothetical protein EUTSA_v10022608mg [Eutrema salsugineum]
Length=603

 Score = 53.5 bits (127),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT  756
            ++AK+FIR CLQR P+ RPTASQLL+HPF++  +T
Sbjct  442  NDAKNFIRLCLQRNPTVRPTASQLLEHPFLRGPST  476


 Score = 29.3 bits (64),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 48/108 (44%), Gaps = 19/108 (18%)
 Frame = -1

Query  724  EVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTITssl  545
            +  PR +DGSC        + P++       G + V H +        SR+N + ITS  
Sbjct  486  DASPRFYDGSC--------IQPTRE--PPYSGRHPVFHTIKS-----PSRENVRAITSLP  530

Query  544  pvspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSST  401
                 S    R    A +SC+LSPP+PS  + F     G N  +++++
Sbjct  531  VSPCSSPL--RQLGPAYKSCFLSPPHPS--YAFPVQDSGYNLAEFAAS  574



>ref|XP_008795232.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Phoenix dactylifera]
Length=684

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            S+AK F++ CLQR+PSARPTA+QL+DHPF++DQ T K A
Sbjct  505  SDAKCFLKLCLQRDPSARPTAAQLMDHPFVRDQPTIKAA  543



>ref|NP_001185211.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
 gb|AEE32963.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
Length=608

 Score = 56.6 bits (135),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 2/39 (5%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLL+HPF++  NT++VA
Sbjct  441  NDAKNFIRLCLQRNPTVRPTASQLLEHPFLR--NTTRVA  477


 Score = 26.2 bits (56),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 14/106 (13%)
 Frame = -1

Query  715  PRSFDGSCTPPAALELLHPSQRNF-ASLDGDYAVNHMVNVFRPMISSRDNAKTITsslpv  539
            PRS+DG+ +       L P++  +   L  D      ++  R + S R+N + ITS    
Sbjct  487  PRSYDGNFS-------LQPTREPYPGRLSHDNYAKQPLS--RTIKSPRENVRAITSLPVS  537

Query  538  spcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSST  401
               S    R    A +SC+LSPP+PS  + F     G N  +++++
Sbjct  538  PCSSPL--RQLGPAYKSCFLSPPHPS--YAFPGQDSGYNLAEFAAS  579



>ref|XP_009347263.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
 ref|XP_009347264.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
 ref|XP_009347265.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
Length=640

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK  750
            +EAKSF+R CLQR PS RPTAS LLDHPFI++Q T++
Sbjct  461  NEAKSFVRLCLQRNPSERPTASGLLDHPFIREQTTTR  497



>ref|XP_006858394.1| hypothetical protein AMTR_s00071p00019220 [Amborella trichopoda]
 gb|ERN19861.1| hypothetical protein AMTR_s00071p00019220 [Amborella trichopoda]
Length=626

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            + K F+R CLQR+PSARPTA++LLDHPF++DQ ++K A
Sbjct  531  DGKHFLRLCLQRDPSARPTATRLLDHPFVRDQTSAKAA  568



>ref|XP_008363405.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Malus domestica]
 ref|XP_008363406.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Malus domestica]
Length=640

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK  750
            +EAKSF+R CLQR PS RPTAS LLDHPFI++Q T++
Sbjct  461  NEAKSFVRLCLQRNPSERPTASGLLDHPFIREQTTTR  497



>ref|XP_008227651.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X1 [Prunus mume]
Length=643

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +AKSF+R CLQR PS RPTAS+LLDHPFI++Q +++++
Sbjct  465  DAKSFVRLCLQRNPSERPTASKLLDHPFIREQTSTRIS  502



>ref|XP_008227652.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X2 [Prunus mume]
Length=588

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +AKSF+R CLQR PS RPTAS+LLDHPFI++Q +++++
Sbjct  465  DAKSFVRLCLQRNPSERPTASKLLDHPFIREQTSTRIS  502



>ref|NP_001185212.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
 gb|AEE32964.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
Length=583

 Score = 56.6 bits (135),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 2/39 (5%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLL+HPF++  NT++VA
Sbjct  415  NDAKNFIRLCLQRNPTVRPTASQLLEHPFLR--NTTRVA  451


 Score = 25.4 bits (54),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 50/107 (47%), Gaps = 15/107 (14%)
 Frame = -1

Query  715  PRSFDGSCTPPAALELLHPSQRNF-ASLDGD-YAVNHMVNVFRPMISSRDNAKTITsslp  542
            PRS+DG+ +       L P++  +   L  D YA   +    +    SR+N + ITS   
Sbjct  461  PRSYDGNFS-------LQPTREPYPGRLSHDNYAKQPLSRTIKS--PSRENVRAITSLPV  511

Query  541  vspcsspLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSST  401
                S    R    A +SC+LSPP+PS  + F     G N  +++++
Sbjct  512  SPCSSPL--RQLGPAYKSCFLSPPHPS--YAFPGQDSGYNLAEFAAS  554



>ref|XP_007213592.1| hypothetical protein PRUPE_ppa002709mg [Prunus persica]
 gb|EMJ14791.1| hypothetical protein PRUPE_ppa002709mg [Prunus persica]
Length=642

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +AKSF+R CLQR PS RP ASQLLDHPFI++Q +++++
Sbjct  465  DAKSFVRLCLQRNPSERPAASQLLDHPFIREQTSTRIS  502



>gb|KHN34079.1| Mitogen-activated protein kinase kinase kinase 2 [Glycine soja]
Length=600

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FI+ CLQR+P ARPTA +LLDHPFI+DQ+ +K A
Sbjct  421  NDAKNFIKLCLQRDPLARPTAHKLLDHPFIRDQSATKAA  459



>ref|XP_003525123.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Glycine max]
Length=600

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FI+ CLQR+P ARPTA +LLDHPFI+DQ+ +K A
Sbjct  421  NDAKNFIKLCLQRDPLARPTAHKLLDHPFIRDQSATKAA  459



>ref|XP_003577728.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Brachypodium distachyon]
Length=663

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQ  762
            SEAKSF++ CLQR+P+ARPTA+QL+DHP++KDQ
Sbjct  479  SEAKSFLKLCLQRDPAARPTAAQLIDHPWVKDQ  511



>ref|XP_003531452.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Glycine max]
Length=566

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK FI+ CLQR+P ARPTA +LLDHPFI+DQ+ +K A
Sbjct  417  NDAKKFIKLCLQRDPLARPTAQKLLDHPFIRDQSATKAA  455



>ref|XP_006432223.1| hypothetical protein CICLE_v10000585mg [Citrus clementina]
 gb|ESR45463.1| hypothetical protein CICLE_v10000585mg [Citrus clementina]
Length=526

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +AKSFI+ CLQR+PSARP AS+LLDHPF++DQ  ++  
Sbjct  450  DAKSFIKQCLQRDPSARPPASKLLDHPFVRDQAVARAG  487



>ref|XP_006585362.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Glycine max]
Length=596

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK FI+ CLQR+P ARPTA +LLDHPFI+DQ+ +K A
Sbjct  417  NDAKKFIKLCLQRDPLARPTAQKLLDHPFIRDQSATKAA  455


 Score = 49.7 bits (117),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 55/104 (53%), Gaps = 4/104 (4%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ ++  K  + ++  +  P  FDGS TPP  LE  H ++ +  SLDGDYA    +   R
Sbjct  446  IRDQSATKAANVSITRDAFPCMFDGSRTPPV-LES-HSNRTSITSLDGDYASKPALAAPR  503

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPS  461
             + SSRDN + IT        SS   R  E   +SC+ SPP+P+
Sbjct  504  ALRSSRDNTRIIT--SLPVSPSSSPLRRYEPMHQSCFFSPPHPA  545


 Score = 23.5 bits (49),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTP  328
             LDPW +  +YR  TP
Sbjct  571  ALDPWHETSRYRANTP  586



>gb|KHN29245.1| Mitogen-activated protein kinase kinase kinase ANP1 [Glycine 
soja]
Length=596

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK FI+ CLQR+P ARPTA +LLDHPFI+DQ+ +K A
Sbjct  417  NDAKKFIKLCLQRDPLARPTAQKLLDHPFIRDQSATKAA  455


 Score = 49.7 bits (117),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 55/104 (53%), Gaps = 4/104 (4%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ ++  K  + ++  +  P  FDGS TPP  LE  H ++ +  SLDGDYA    +   R
Sbjct  446  IRDQSATKAANVSITRDAFPCMFDGSRTPPV-LES-HSNRTSITSLDGDYASKPALAAPR  503

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPS  461
             + SSRDN + IT        SS   R  E   +SC+ SPP+P+
Sbjct  504  ALRSSRDNTRIIT--SLPVSPSSSPLRRYEPMHQSCFFSPPHPA  545


 Score = 23.5 bits (49),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTP  328
             LDPW +  +YR  TP
Sbjct  571  ALDPWHETSRYRANTP  586



>gb|ACI16513.1| MAP3Ka [Cucumis sativus]
Length=160

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT  756
            S+A+SF++ CLQR+PSARP+A++LLDHPF++D  T
Sbjct  113  SDARSFVQLCLQRDPSARPSAAELLDHPFVQDAVT  147



>dbj|BAD12492.1| mitogen-activated kinase kinase kinase alpha [Lotus japonicus]
Length=627

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +AK+FI+ CLQR+P ARPTA  LL+HPFI+DQ+ +KVA
Sbjct  449  DAKNFIKQCLQRDPLARPTAQSLLNHPFIRDQSATKVA  486



>gb|EMS66799.1| Mitogen-activated protein kinase kinase kinase 2 [Triticum urartu]
Length=360

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQ  762
            SEAKSF++ CLQR+P+ARPTA+QL++HP++KDQ
Sbjct  255  SEAKSFLKLCLQRDPAARPTAAQLIEHPWVKDQ  287



>dbj|BAJ94063.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=576

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQ  762
            SEAKSF++ CLQR+P+ARPTA+QL++HP++KDQ
Sbjct  473  SEAKSFLKLCLQRDPAARPTAAQLIEHPWVKDQ  505



>ref|XP_007159840.1| hypothetical protein PHAVU_002G272100g [Phaseolus vulgaris]
 gb|ESW31834.1| hypothetical protein PHAVU_002G272100g [Phaseolus vulgaris]
Length=592

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 1/40 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLD-HPFIKDQNTSKVA  744
            S+AK+FI+ CLQR+PSARPTA +LLD HPFI+DQ+ +K A
Sbjct  428  SDAKNFIKLCLQRDPSARPTAQKLLDHHPFIQDQSATKAA  467



>ref|XP_007159841.1| hypothetical protein PHAVU_002G272100g [Phaseolus vulgaris]
 gb|ESW31835.1| hypothetical protein PHAVU_002G272100g [Phaseolus vulgaris]
Length=608

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 1/40 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLD-HPFIKDQNTSKVA  744
            S+AK+FI+ CLQR+PSARPTA +LLD HPFI+DQ+ +K A
Sbjct  428  SDAKNFIKLCLQRDPSARPTAQKLLDHHPFIQDQSATKAA  467



>gb|ABK06423.1| HA-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=298

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 2/39 (5%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLL+HPF++  NT++VA
Sbjct  240  NDAKNFIRLCLQRNPTVRPTASQLLEHPFLR--NTTRVA  276



>ref|XP_009406130.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Musa acuminata subsp. malaccensis]
Length=678

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            SE K F++ CLQR+PSARP+++QL+DHPF++DQ   K A
Sbjct  487  SEGKEFLKLCLQRDPSARPSSAQLMDHPFVRDQAIIKAA  525



>gb|KCW62310.1| hypothetical protein EUGRSUZ_H04962 [Eucalyptus grandis]
Length=516

 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTS  753
            S+AKSFIR CLQR+PS+RPTA+QLL+H F++DQ  S
Sbjct  443  SDAKSFIRLCLQRDPSSRPTAAQLLEHSFLRDQAAS  478



>gb|AFA36527.1| mitogen activated protein kinase kinase kinase, partial [Lolium 
perenne]
Length=146

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQ  762
            SEAK+F++ CLQR+P+ RPTA+QL++HP++KDQ
Sbjct  24   SEAKNFLKLCLQRDPADRPTAAQLIEHPWVKDQ  56



>ref|XP_009371492.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
 ref|XP_009371493.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
Length=642

 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK  750
            ++AKSF+R CLQR PS RPTA  LLDHPFI++Q T++
Sbjct  461  NDAKSFVRLCLQRNPSERPTAFDLLDHPFIREQTTTR  497



>gb|AFA36471.1| putative mitogen-activated kinase kinase kinase alpha, partial 
[Lolium perenne]
Length=148

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQ  762
            SEAK+F++ CLQR+P+ RPTA+QL++HP++KDQ
Sbjct  25   SEAKNFLKLCLQRDPADRPTAAQLIEHPWVKDQ  57



>ref|XP_010025592.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X2 [Eucalyptus grandis]
 gb|KCW62309.1| hypothetical protein EUGRSUZ_H04962 [Eucalyptus grandis]
Length=649

 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTS  753
            S+AKSFIR CLQR+PS+RPTA+QLL+H F++DQ  S
Sbjct  443  SDAKSFIRLCLQRDPSSRPTAAQLLEHSFLRDQAAS  478



>ref|XP_010025591.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X1 [Eucalyptus grandis]
Length=650

 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTS  753
            S+AKSFIR CLQR+PS+RPTA+QLL+H F++DQ  S
Sbjct  443  SDAKSFIRLCLQRDPSSRPTAAQLLEHSFLRDQAAS  478



>gb|EPS67034.1| mitogen activated protein kinase kinase kinase kkk 3, partial 
[Genlisea aurea]
Length=396

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK  750
            S AK FIR CLQR+PS+RPTASQLL HPF+ +Q T +
Sbjct  310  SHAKDFIRQCLQRDPSSRPTASQLLAHPFVTNQITPR  346



>gb|KEH35595.1| MAP kinase kinase kinase [Medicago truncatula]
Length=529

 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FI+ CL R+PS RPTA  LL+HPFI+DQ+ +K A
Sbjct  471  NDAKNFIKLCLHRDPSTRPTAQMLLNHPFIRDQSATKAA  509



>gb|ACY01925.1| mitogen activated protein kinase kinase kinase kkk 3 [Beta vulgaris]
Length=680

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV  747
            S+AKSF+  CLQR+P+ RP ASQLLDHPF++DQ+  + 
Sbjct  475  SDAKSFLYLCLQRDPADRPLASQLLDHPFVRDQSVGRA  512



>ref|XP_010479927.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Camelina sativa]
Length=607

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR PS RPTASQLLDHPF++  +T++VA
Sbjct  439  NDAKNFIRLCLQRNPSVRPTASQLLDHPFLR-VHTTRVA  476



>ref|XP_010479926.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Camelina sativa]
Length=608

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR PS RPTASQLLDHPF++  +T++VA
Sbjct  440  NDAKNFIRLCLQRNPSVRPTASQLLDHPFLR-VHTTRVA  477



>ref|XP_004502938.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cicer arietinum]
Length=631

 Score = 50.1 bits (118),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 53/104 (51%), Gaps = 4/104 (4%)
 Frame = -1

Query  772  LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR  593
            ++ ++  K  +  +  +  P  FDGS TPP +   LH ++   AS DGDYA   +V   R
Sbjct  483  IRDQSATKAANVRITRDAFPYMFDGSRTPPVSD--LHSNRTCIASQDGDYATKPVVTASR  540

Query  592  PMISSRDNAKTITsslpvspcsspLRRHSEEARRSCYLSPPNPS  461
             + S RDN + ITS       S    R      +SC+LSPP+P+
Sbjct  541  AVRSPRDNTRMITSLPVSPCSSPL--RQYVPTHKSCFLSPPHPT  582


 Score = 27.3 bits (59),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -2

Query  375  TLDPWLDIPQYRTQTPGRS  319
            +LDPW + P Y+  TPG S
Sbjct  607  SLDPWQETPMYKGHTPGGS  625


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FI+ CL R+PS RPTA  LL+HPFI+DQ+ +K A
Sbjct  454  NDAKNFIKLCLHRDPSTRPTAQMLLNHPFIRDQSATKAA  492



>ref|XP_009404852.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Musa acuminata subsp. malaccensis]
Length=694

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            SE K F++ CLQR+P ARP+A+QL++HPF++DQ T+  A
Sbjct  511  SEGKDFLKLCLQRDPMARPSAAQLMEHPFVRDQITTNAA  549



>ref|XP_009416942.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Musa acuminata subsp. malaccensis]
Length=669

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  854  AKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
             K F++ CLQR+PSARP+A+QL+DHPF++DQ   K A
Sbjct  487  GKDFLKLCLQRDPSARPSAAQLMDHPFVRDQTIIKAA  523



>ref|NP_849803.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
 ref|NP_001031181.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
 gb|AAF78433.1|AC018748_12 Identical to MEK kinase from Arabidopsis thaliana gb|U58918 and 
contains protein kinase PF|00069 domain. ESTs gb|Z33980, 
gb|T20498, gb|AA650775 come from this gene [Arabidopsis thaliana]
 gb|AAG51965.1|AC024260_3 MEK kinase MAP3Ka, putative; 84794-81452 [Arabidopsis thaliana]
 gb|AAM98147.1| MAP3K alpha protein kinase, putative [Arabidopsis thaliana]
 gb|AAO00958.1| MAP3K alpha protein kinase, putative [Arabidopsis thaliana]
 gb|AEE32961.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
 gb|AEE32962.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
Length=608

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 2/39 (5%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLL+HPF++  NT++VA
Sbjct  441  NDAKNFIRLCLQRNPTVRPTASQLLEHPFLR--NTTRVA  477



>ref|NP_564635.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
 gb|AEE32960.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
Length=609

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 2/39 (5%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLL+HPF++  NT++VA
Sbjct  441  NDAKNFIRLCLQRNPTVRPTASQLLEHPFLR--NTTRVA  477



>gb|AAL31904.1|AF419572_1 At1g53570/F22G10_18 [Arabidopsis thaliana]
Length=609

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 2/39 (5%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLL+HPF++  NT++VA
Sbjct  441  NDAKNFIRLCLQRNPTVRPTASQLLEHPFLR--NTTRVA  477



>ref|XP_002891761.1| MEK kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68020.1| MEK kinase [Arabidopsis lyrata subsp. lyrata]
Length=603

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 2/39 (5%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLL+HPF++  NT++VA
Sbjct  436  NDAKNFIRLCLQRNPTVRPTASQLLEHPFLR--NTTRVA  472



>emb|CAA08994.1| MAP3K alpha protein kinase [Arabidopsis thaliana]
Length=582

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 2/39 (5%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLL+HPF++  NT++VA
Sbjct  414  NDAKNFIRLCLQRNPTVRPTASQLLEHPFLR--NTTRVA  450



>gb|AAD10848.1| MEK kinase [Arabidopsis thaliana]
Length=608

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 2/39 (5%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLL+HPF++  NT++VA
Sbjct  440  NDAKNFIRLCLQRNPTVRPTASQLLEHPFLR--NTTRVA  476



>ref|XP_004234420.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Solanum lycopersicum]
Length=890

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT  756
            EAK F+R CLQREP  RPTA+QLLDHPF+K+  T
Sbjct  638  EAKDFVRKCLQREPRLRPTAAQLLDHPFVKNVAT  671



>ref|XP_006353887.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Solanum tuberosum]
Length=890

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT  756
            EAK F+R CLQREP  RPTA+QLLDHPF+K+  T
Sbjct  638  EAKDFVRKCLQREPRLRPTAAQLLDHPFVKNVAT  671



>ref|XP_010462253.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Camelina sativa]
Length=597

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLLDHPF++  +T++VA
Sbjct  429  NDAKNFIRLCLQRNPTVRPTASQLLDHPFLR-VHTTRVA  466



>ref|XP_010462255.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X3 [Camelina sativa]
Length=596

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLLDHPF++  +T++VA
Sbjct  429  NDAKNFIRLCLQRNPTVRPTASQLLDHPFLR-VHTTRVA  466



>ref|XP_010462254.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Camelina sativa]
Length=596

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLLDHPF++  +T++VA
Sbjct  428  NDAKNFIRLCLQRNPTVRPTASQLLDHPFLR-VHTTRVA  465



>ref|XP_006307044.1| hypothetical protein CARUB_v10008633mg [Capsella rubella]
 gb|EOA39942.1| hypothetical protein CARUB_v10008633mg [Capsella rubella]
Length=516

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 35/39 (90%), Gaps = 1/39 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ARPTASQLL+HPF++  +T++VA
Sbjct  432  NDAKNFIRLCLQRNPTARPTASQLLEHPFLR-VHTTRVA  469



>ref|XP_010501012.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X4 [Camelina sativa]
Length=612

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLLDHPF++  +T++VA
Sbjct  445  NDAKNFIRLCLQRNPTVRPTASQLLDHPFLR-VHTTRVA  482



>gb|ABG22409.1| mitogen-activated kinase kinase kinase alpha, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG99952.1| unnamed protein product [Oryza sativa Japonica Group]
Length=382

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            EAK+F++ CLQR+P+ARPTA+QL++HPF+KD
Sbjct  204  EAKNFLKLCLQRDPAARPTAAQLMEHPFVKD  234



>ref|XP_010501009.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Camelina sativa]
Length=614

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLLDHPF++  +T++VA
Sbjct  446  NDAKNFIRLCLQRNPTVRPTASQLLDHPFLR-VHTTRVA  483



>ref|XP_010501011.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X3 [Camelina sativa]
Length=613

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLLDHPF++  +T++VA
Sbjct  446  NDAKNFIRLCLQRNPTVRPTASQLLDHPFLR-VHTTRVA  483



>ref|XP_010501010.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Camelina sativa]
Length=613

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ RPTASQLLDHPF++  +T++VA
Sbjct  445  NDAKNFIRLCLQRNPTVRPTASQLLDHPFLR-VHTTRVA  482



>gb|ABG22410.1| mitogen-activated kinase kinase kinase alpha, putative, expressed 
[Oryza sativa Japonica Group]
Length=552

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            EAK+F++ CLQR+P+ARPTA+QL++HPF+KD
Sbjct  475  EAKNFLKLCLQRDPAARPTAAQLMEHPFVKD  505



>ref|XP_006307045.1| hypothetical protein CARUB_v10008633mg [Capsella rubella]
 gb|EOA39943.1| hypothetical protein CARUB_v10008633mg [Capsella rubella]
Length=600

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 35/39 (90%), Gaps = 1/39 (3%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            ++AK+FIR CLQR P+ARPTASQLL+HPF++  +T++VA
Sbjct  432  NDAKNFIRLCLQRNPTARPTASQLLEHPFLR-VHTTRVA  469



>ref|NP_001067464.1| Os11g0207200 [Oryza sativa Japonica Group]
 dbj|BAF27827.1| Os11g0207200, partial [Oryza sativa Japonica Group]
Length=554

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            EAK+F++ CLQR+P+ARPTA+QL++HPF+KD
Sbjct  376  EAKNFLKLCLQRDPAARPTAAQLMEHPFVKD  406



>gb|EEE51829.1| hypothetical protein OsJ_33308 [Oryza sativa Japonica Group]
Length=667

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            EAK+F++ CLQR+P+ARPTA+QL++HPF+KD
Sbjct  489  EAKNFLKLCLQRDPAARPTAAQLMEHPFVKD  519



>gb|EEC67854.1| hypothetical protein OsI_35471 [Oryza sativa Indica Group]
Length=653

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            EAK+F++ CLQR+P+ARPTA+QL++HPF+KD
Sbjct  475  EAKNFLKLCLQRDPAARPTAAQLMEHPFVKD  505



>gb|AAF34436.1|AF172282_25 similar to mitogen-activated protein kinases [Oryza sativa]
 gb|ABA92000.1| mitogen-activated kinase kinase kinase alpha, putative, expressed 
[Oryza sativa Japonica Group]
Length=653

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            EAK+F++ CLQR+P+ARPTA+QL++HPF+KD
Sbjct  475  EAKNFLKLCLQRDPAARPTAAQLMEHPFVKD  505



>ref|XP_002520246.1| mitogen activated protein kinase kinase kinase 3, mapkkk3, mekk3, 
putative [Ricinus communis]
 gb|EEF42032.1| mitogen activated protein kinase kinase kinase 3, mapkkk3, mekk3, 
putative [Ricinus communis]
Length=378

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            +A+SF++ CLQR+P  RPT +QLL+HPFI++Q+  +VA
Sbjct  288  DAESFVKLCLQRDPCTRPTTAQLLNHPFIQNQDMREVA  325



>ref|XP_001753661.1| predicted protein [Physcomitrella patens]
 gb|EDQ81413.1| predicted protein [Physcomitrella patens]
Length=313

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K+F+R CLQR+P+ RPTA+QLL+HPF++D
Sbjct  251  EGKAFVRLCLQRDPAQRPTAAQLLEHPFVQD  281



>emb|CDP11994.1| unnamed protein product [Coffea canephora]
Length=444

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS*C  732
            EAKSF++ CLQR PS RPTA+QLL HPFI+    ++++   C
Sbjct  402  EAKSFVKVCLQRNPSVRPTAAQLLHHPFIQGIQENRISKDIC  443



>ref|XP_009758259.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Nicotiana sylvestris]
Length=889

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K F+R CLQREP +RPTA++LL+HPF+KD
Sbjct  640  EGKDFVRKCLQREPRSRPTAAELLEHPFVKD  670



>ref|XP_009758258.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Nicotiana sylvestris]
Length=893

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K F+R CLQREP +RPTA++LL+HPF+KD
Sbjct  640  EGKDFVRKCLQREPRSRPTAAELLEHPFVKD  670



>ref|XP_009627909.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Nicotiana tomentosiformis]
Length=889

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K F+R CLQREP +RPTA++LL+HPF+KD
Sbjct  640  EGKDFVRKCLQREPRSRPTAAELLEHPFVKD  670



>ref|XP_009627903.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Nicotiana tomentosiformis]
Length=893

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K F+R CLQREP +RPTA++LL+HPF+KD
Sbjct  640  EGKDFVRKCLQREPRSRPTAAELLEHPFVKD  670



>ref|XP_010530598.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Tarenaya hassleriana]
Length=600

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT  756
            +AK+FIR CLQR+PS RPTASQLLDH F+++  T
Sbjct  431  DAKNFIRLCLQRDPSKRPTASQLLDHSFLQEHTT  464



>ref|XP_010530597.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Tarenaya hassleriana]
Length=601

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT  756
            +AK+FIR CLQR+PS RPTASQLLDH F+++  T
Sbjct  431  DAKNFIRLCLQRDPSKRPTASQLLDHSFLQEHTT  464



>ref|XP_010530599.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X3 [Tarenaya hassleriana]
Length=599

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT  756
            +AK+FIR CLQR+PS RPTASQLLDH F+++  T
Sbjct  429  DAKNFIRLCLQRDPSKRPTASQLLDHSFLQEHTT  462



>ref|XP_006663285.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Oryza brachyantha]
Length=623

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            EAK+F++ CLQR+P+ARPTA++L++HPF+KD
Sbjct  445  EAKNFLKLCLQRDPAARPTAAKLMEHPFVKD  475



>ref|XP_010530600.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X4 [Tarenaya hassleriana]
Length=598

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT  756
            +AK+FIR CLQR+PS RPTASQLLDH F+++  T
Sbjct  428  DAKNFIRLCLQRDPSKRPTASQLLDHSFLQEHTT  461



>ref|XP_010530601.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X5 [Tarenaya hassleriana]
Length=597

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT  756
            +AK+FIR CLQR+PS RPTASQLLDH F+++  T
Sbjct  428  DAKNFIRLCLQRDPSKRPTASQLLDHSFLQEHTT  461



>ref|XP_006368759.1| hypothetical protein POPTR_0001s09520g [Populus trichocarpa]
 ref|XP_002298029.2| hypothetical protein POPTR_0001s09520g [Populus trichocarpa]
 gb|ERP65328.1| hypothetical protein POPTR_0001s09520g [Populus trichocarpa]
 gb|EEE82834.2| hypothetical protein POPTR_0001s09520g [Populus trichocarpa]
Length=906

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            + K F+R CLQR PS RPTA+QLLDHPF+K+
Sbjct  648  DGKDFVRQCLQRNPSHRPTAAQLLDHPFVKN  678



>gb|KDP25418.1| hypothetical protein JCGZ_20574 [Jatropha curcas]
Length=893

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K F+R CLQR+PS RPTA+QLL+HPF+K+
Sbjct  630  EGKDFVRQCLQRDPSHRPTAAQLLEHPFVKN  660



>ref|XP_011029295.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Populus euphratica]
 ref|XP_011029296.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Populus euphratica]
 ref|XP_011029298.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Populus euphratica]
 ref|XP_011029299.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Populus euphratica]
 ref|XP_011029300.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Populus euphratica]
 ref|XP_011029301.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Populus euphratica]
Length=902

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            + K F+R CLQR PS RPTA+QLLDHPF+K+
Sbjct  644  DGKDFVRQCLQRNPSHRPTAAQLLDHPFVKN  674



>ref|XP_006368758.1| hypothetical protein POPTR_0001s09520g [Populus trichocarpa]
 gb|ERP65327.1| hypothetical protein POPTR_0001s09520g [Populus trichocarpa]
Length=711

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            + K F+R CLQR PS RPTA+QLLDHPF+K+
Sbjct  453  DGKDFVRQCLQRNPSHRPTAAQLLDHPFVKN  483



>ref|XP_004240726.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Solanum lycopersicum]
 ref|XP_010321990.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Solanum lycopersicum]
Length=888

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K F+R CLQREP  RPTA++LL+HPF+KD
Sbjct  637  EGKDFVRKCLQREPRNRPTAAELLEHPFVKD  667



>gb|KJB29083.1| hypothetical protein B456_005G083400 [Gossypium raimondii]
Length=508

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 2/40 (5%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS  738
            +A++FI+ CLQREP+ARPTA +LL HPF++DQ  S V P+
Sbjct  418  DAQNFIKLCLQREPTARPTALKLLQHPFVQDQ--SMVEPT  455



>gb|KJB29081.1| hypothetical protein B456_005G083400 [Gossypium raimondii]
Length=487

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 2/40 (5%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS  738
            +A++FI+ CLQREP+ARPTA +LL HPF++DQ  S V P+
Sbjct  397  DAQNFIKLCLQREPTARPTALKLLQHPFVQDQ--SMVEPT  434



>ref|XP_006363326.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Solanum tuberosum]
Length=889

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K F+R CLQREP  RPTA++LL+HPF+KD
Sbjct  638  EGKDFVRKCLQREPRNRPTAAELLEHPFVKD  668



>ref|XP_006363327.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Solanum tuberosum]
Length=888

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K F+R CLQREP  RPTA++LL+HPF+KD
Sbjct  637  EGKDFVRKCLQREPRNRPTAAELLEHPFVKD  667



>gb|KDO39019.1| hypothetical protein CISIN_1g033880mg [Citrus sinensis]
Length=109

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            E K FIR CLQR P  RPTA +LLDHPF+K
Sbjct  63   EGKDFIRLCLQRNPLNRPTAVKLLDHPFVK  92



>ref|XP_001753280.1| predicted protein [Physcomitrella patens]
 gb|EDQ81909.1| predicted protein, partial [Physcomitrella patens]
Length=263

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E + F+R CLQR+P+ RPTA+QLL+HPF++D
Sbjct  232  EGRDFVRLCLQRDPAHRPTAAQLLEHPFVQD  262



>ref|XP_006391722.1| hypothetical protein EUTSA_v10023253mg [Eutrema salsugineum]
 ref|XP_006391723.1| hypothetical protein EUTSA_v10023253mg [Eutrema salsugineum]
 gb|ESQ29008.1| hypothetical protein EUTSA_v10023253mg [Eutrema salsugineum]
 gb|ESQ29009.1| hypothetical protein EUTSA_v10023253mg [Eutrema salsugineum]
Length=887

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K F+R CLQR P+ RPTA+QLLDHPF+++
Sbjct  633  EGKDFVRTCLQRNPANRPTAAQLLDHPFVRN  663



>ref|XP_008804443.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Phoenix dactylifera]
Length=732

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            E K FIR CLQREPS RPTA++LL HPF+K
Sbjct  638  EGKDFIRQCLQREPSNRPTAAELLQHPFVK  667



>ref|XP_010539223.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Tarenaya hassleriana]
Length=835

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K F+R CLQR PSARP+A+QLL+HPFI++
Sbjct  624  EGKDFVRLCLQRNPSARPSAAQLLEHPFIRN  654



>ref|XP_008804442.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Phoenix dactylifera]
Length=892

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            E K FIR CLQREPS RPTA++LL HPF+K
Sbjct  638  EGKDFIRQCLQREPSNRPTAAELLQHPFVK  667



>ref|XP_006404200.1| hypothetical protein EUTSA_v10010957mg, partial [Eutrema salsugineum]
 gb|ESQ45653.1| hypothetical protein EUTSA_v10010957mg, partial [Eutrema salsugineum]
Length=322

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K F+R CLQR P+ RPTA+Q+LDHPF+++
Sbjct  235  EGKDFVRTCLQRNPANRPTAAQILDHPFVRN  265



>ref|XP_010935850.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
kinase kinase YODA-like [Elaeis guineensis]
Length=870

 Score = 46.6 bits (109),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            ++ K F+  CLQREP  RPTA++LL HPF+K+
Sbjct  634  ADGKDFVMQCLQREPLNRPTAAELLQHPFVKN  665


 Score = 25.4 bits (54),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 15/27 (56%), Gaps = 0/27 (0%)
 Frame = -1

Query  652  RNFASLDGDYAVNHMVNVFRPMISSRD  572
            RNF+SLD +  + H +    P   SRD
Sbjct  698  RNFSSLDMEGTIIHQLRCVTPTAVSRD  724



>gb|KHN09317.1| Mitogen-activated protein kinase kinase kinase 2 [Glycine soja]
Length=862

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            SE K F+R CLQR P  RP+AS+LLDHPF+K
Sbjct  610  SEGKDFVRKCLQRNPHNRPSASELLDHPFVK  640



>ref|XP_003548172.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Glycine max]
Length=898

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            SE K F+R CLQR P  RP+AS+LLDHPF+K
Sbjct  637  SEGKDFVRKCLQRNPHNRPSASELLDHPFVK  667



>ref|XP_007152223.1| hypothetical protein PHAVU_004G112000g [Phaseolus vulgaris]
 gb|ESW24217.1| hypothetical protein PHAVU_004G112000g [Phaseolus vulgaris]
Length=896

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            SE K F+R CLQR P  RP+AS+LLDHPF+K
Sbjct  637  SEGKDFVRKCLQRNPHNRPSASELLDHPFVK  667



>emb|CDP05168.1| unnamed protein product [Coffea canephora]
Length=893

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K F+R CLQR P  RPTA+QLLDHPF+K+
Sbjct  640  EGKDFVRQCLQRNPLHRPTAAQLLDHPFVKN  670



>ref|XP_010918584.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X4 [Elaeis guineensis]
Length=838

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K FIR CLQR+PS RPTA++LL HPF+K+
Sbjct  637  EGKDFIRLCLQRQPSNRPTAAELLQHPFVKN  667



>ref|XP_010918583.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X3 [Elaeis guineensis]
Length=859

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K FIR CLQR+PS RPTA++LL HPF+K+
Sbjct  637  EGKDFIRLCLQRQPSNRPTAAELLQHPFVKN  667



>ref|XP_010918582.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Elaeis guineensis]
Length=863

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K FIR CLQR+PS RPTA++LL HPF+K+
Sbjct  616  EGKDFIRLCLQRQPSNRPTAAELLQHPFVKN  646



>ref|XP_009398019.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=851

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            + K FIR CLQREPS RPTA++LL HPF+K+
Sbjct  627  DGKDFIRRCLQREPSKRPTAAELLQHPFVKN  657



>ref|XP_009398018.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=868

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            + K FIR CLQREPS RPTA++LL HPF+K+
Sbjct  627  DGKDFIRRCLQREPSKRPTAAELLQHPFVKN  657



>ref|XP_011080940.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
kinase kinase YODA [Sesamum indicum]
Length=893

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            + K FIR CLQR PS RPTA+QLL+HPF+K+
Sbjct  631  DGKDFIRQCLQRNPSYRPTAAQLLEHPFVKN  661



>ref|XP_002964768.1| hypothetical protein SELMODRAFT_82459 [Selaginella moellendorffii]
 gb|EFJ33606.1| hypothetical protein SELMODRAFT_82459 [Selaginella moellendorffii]
Length=312

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  854  AKSFIRXCLQREPSARPTASQLLDHPFIK  768
            AK FIR CLQR P  RPTASQLL+HPF+K
Sbjct  241  AKEFIRLCLQRNPDDRPTASQLLEHPFVK  269



>ref|XP_002961700.1| hypothetical protein SELMODRAFT_76216 [Selaginella moellendorffii]
 gb|EFJ36960.1| hypothetical protein SELMODRAFT_76216 [Selaginella moellendorffii]
Length=312

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  854  AKSFIRXCLQREPSARPTASQLLDHPFIK  768
            AK FIR CLQR P  RPTASQLL+HPF+K
Sbjct  241  AKEFIRLCLQRNPDDRPTASQLLEHPFVK  269



>ref|XP_002509819.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51206.1| ATP binding protein, putative [Ricinus communis]
Length=885

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            + K F+R CLQR+PS RPTA+QLL+HPF+K+
Sbjct  627  KGKDFVRQCLQRDPSHRPTAAQLLEHPFVKN  657



>ref|XP_001784035.1| predicted protein [Physcomitrella patens]
 gb|EDQ51141.1| predicted protein, partial [Physcomitrella patens]
Length=268

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            +E + F+R CLQR+P+ RPTAS LL HPF++D
Sbjct  237  TEGQDFVRLCLQRDPAHRPTASYLLQHPFVQD  268



>ref|XP_011022671.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Populus euphratica]
 ref|XP_011022672.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Populus euphratica]
Length=900

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            + K F+R CLQR PS RPTA+QLL+HPF+K+
Sbjct  643  DGKDFVRQCLQRNPSHRPTAAQLLEHPFVKN  673



>ref|XP_008787472.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Phoenix dactylifera]
Length=814

 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            ++ K F+R CLQREPS RPTA++LL HPF+K+
Sbjct  634  ADGKDFVRQCLQREPSNRPTAAELLQHPFVKN  665



>ref|XP_001760762.1| predicted protein [Physcomitrella patens]
 gb|EDQ74501.1| predicted protein, partial [Physcomitrella patens]
Length=267

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -3

Query  854  AKSFIRXCLQREPSARPTASQLLDHPFIKD  765
             + F+R CLQR+P+ RPTA+QLL+HPF++D
Sbjct  238  GREFVRLCLQRDPAQRPTAAQLLEHPFVQD  267



>ref|XP_009608127.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like 
[Nicotiana tomentosiformis]
Length=583

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            +A++FI  CLQ +PSARPTASQLL+HPF+K
Sbjct  535  DARNFINQCLQVDPSARPTASQLLEHPFVK  564



>ref|XP_004972122.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Setaria italica]
Length=454

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK  750
            EAK F+R CL+R P  RPTA+QLLDHPFI     +K
Sbjct  230  EAKDFLRMCLERNPRHRPTATQLLDHPFIVSAEPAK  265



>ref|XP_009765193.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like 
[Nicotiana sylvestris]
Length=564

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            +A++FI  CLQ +PSARPTASQLL+HPF+K
Sbjct  516  DARNFINQCLQVDPSARPTASQLLEHPFVK  545



>dbj|BAM36967.1| protein kinase [Nicotiana benthamiana]
Length=564

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            +A++FI  CLQ +PSARPTASQLL+HPF+K
Sbjct  516  DARNFINQCLQVDPSARPTASQLLEHPFVK  545



>ref|XP_002447871.1| hypothetical protein SORBIDRAFT_06g017240 [Sorghum bicolor]
 gb|EES12199.1| hypothetical protein SORBIDRAFT_06g017240 [Sorghum bicolor]
Length=739

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS  738
            E KSF++ CL+R P++RP+A+QL+DHPF++D    + A S
Sbjct  563  EGKSFLQLCLKRNPASRPSAAQLMDHPFVQDHPAVRAAKS  602



>ref|XP_006360533.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like 
[Solanum tuberosum]
Length=291

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            +A++FI  CLQ +PSARPTA+QLL+HPF+K
Sbjct  243  DARNFINHCLQVDPSARPTATQLLEHPFVK  272



>ref|XP_010907216.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Elaeis guineensis]
Length=845

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            E K FIR CLQREPS RPTA++LL HPF++
Sbjct  638  EGKDFIRQCLQREPSNRPTAAELLQHPFVQ  667



>ref|XP_003556116.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Glycine max]
 ref|XP_006606139.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Glycine max]
Length=888

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            +E K F+R CLQR P  RP+AS+LLDHPF+K+
Sbjct  627  NEGKDFVRKCLQRNPHDRPSASELLDHPFVKN  658



>gb|KHN12154.1| Mitogen-activated protein kinase kinase kinase 2 [Glycine soja]
Length=888

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            +E K F+R CLQR P  RP+AS+LLDHPF+K+
Sbjct  627  NEGKDFVRKCLQRNPHDRPSASELLDHPFVKN  658



>gb|KDO51976.1| hypothetical protein CISIN_1g007478mg [Citrus sinensis]
Length=602

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            E K FIR CLQR P  RPTA++LLDHPF+K
Sbjct  342  EGKDFIRLCLQRNPLNRPTAAELLDHPFVK  371



>ref|XP_007143448.1| hypothetical protein PHAVU_007G0728001g, partial [Phaseolus vulgaris]
 gb|ESW15442.1| hypothetical protein PHAVU_007G0728001g, partial [Phaseolus vulgaris]
Length=460

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            +E K F+R CLQR P  RP+AS+LLDHPF+K
Sbjct  199  NEGKDFVRKCLQRNPYDRPSASELLDHPFVK  229



>ref|XP_007143447.1| hypothetical protein PHAVU_007G0728001g [Phaseolus vulgaris]
 gb|ESW15441.1| hypothetical protein PHAVU_007G0728001g [Phaseolus vulgaris]
Length=464

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            +E K F+R CLQR P  RP+AS+LLDHPF+K
Sbjct  203  NEGKDFVRKCLQRNPYDRPSASELLDHPFVK  233



>ref|XP_010907217.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Elaeis guineensis]
Length=769

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            E K FIR CLQREPS RPTA++LL HPF++
Sbjct  638  EGKDFIRQCLQREPSNRPTAAELLQHPFVQ  667



>gb|KDO51977.1| hypothetical protein CISIN_1g007478mg [Citrus sinensis]
Length=594

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            E K FIR CLQR P  RPTA++LLDHPF+K
Sbjct  342  EGKDFIRLCLQRNPLNRPTAAELLDHPFVK  371



>dbj|BAD94298.1| MEK kinase MAP3Ka [Arabidopsis thaliana]
Length=162

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 2/33 (6%)
 Frame = -3

Query  842  IRXCLQREPSARPTASQLLDHPFIKDQNTSKVA  744
            IR CLQR P+ RPTASQLL+HPF++  NT++VA
Sbjct  1    IRLCLQRNPTVRPTASQLLEHPFLR--NTTRVA  31



>emb|CDX89612.1| BnaC03g45260D [Brassica napus]
Length=579

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            ++AK+FIR CLQR P+ RPTA+QLL+HPF++
Sbjct  416  NDAKNFIRLCLQRNPTVRPTAAQLLEHPFLR  446



>ref|XP_002322482.1| hypothetical protein POPTR_0015s12870g [Populus trichocarpa]
 gb|EEF06609.1| hypothetical protein POPTR_0015s12870g [Populus trichocarpa]
Length=902

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            E K F+R CLQR P  RPTASQLL+HPF+K
Sbjct  643  EGKDFVRQCLQRNPVHRPTASQLLEHPFVK  672



>ref|XP_006827575.1| hypothetical protein AMTR_s00009p00228600 [Amborella trichopoda]
 gb|ERM94991.1| hypothetical protein AMTR_s00009p00228600 [Amborella trichopoda]
Length=898

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K F+R CLQR P+ RPTA+QLL+HPF+K+
Sbjct  652  EGKDFVRCCLQRNPADRPTAAQLLEHPFVKN  682



>ref|XP_006421975.1| hypothetical protein CICLE_v10004272mg [Citrus clementina]
 gb|ESR35215.1| hypothetical protein CICLE_v10004272mg [Citrus clementina]
Length=898

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            E K FIR CLQR P  RPTA++LLDHPF+K
Sbjct  638  EGKDFIRLCLQRNPLNRPTAAELLDHPFVK  667



>emb|CDX93120.1| BnaA03g38420D [Brassica napus]
Length=593

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            ++AK+FIR CLQR P+ RPTA+QLL+HPF++
Sbjct  430  NDAKNFIRLCLQRNPTVRPTAAQLLEHPFLR  460



>ref|XP_003533990.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Glycine max]
Length=897

 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            E K F+R CLQR P  RP+AS+LLDHPF+K
Sbjct  638  EGKDFVRKCLQRNPHNRPSASELLDHPFVK  667



>gb|KHN41598.1| Mitogen-activated protein kinase kinase kinase 2 [Glycine soja]
Length=897

 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            E K F+R CLQR P  RP+AS+LLDHPF+K
Sbjct  638  EGKDFVRKCLQRNPHNRPSASELLDHPFVK  667



>ref|XP_009136221.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Brassica rapa]
Length=592

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            ++AK+FIR CLQR P+ RPTA+QLL+HPF++
Sbjct  429  NDAKNFIRLCLQRNPTVRPTAAQLLEHPFLR  459



>ref|XP_009757984.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Nicotiana sylvestris]
 ref|XP_009757985.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Nicotiana sylvestris]
 ref|XP_009757986.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Nicotiana sylvestris]
Length=892

 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT  756
            E K F+R CLQREP  RPTA+ LL+HPF+K+  T
Sbjct  639  EGKDFVRKCLQREPRHRPTAALLLEHPFVKNAAT  672



>ref|XP_003592222.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES62473.1| ATP-binding protein [Medicago truncatula]
Length=899

 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  860  SEAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            +E K F+R CLQR P  RP+AS+LLDHPF+K
Sbjct  638  NEGKDFVRKCLQRNPRDRPSASELLDHPFVK  668



>ref|XP_003581251.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Brachypodium distachyon]
Length=695

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQ  762
            E KSF++ CL+R+P+AR +ASQL+DHPF++D 
Sbjct  519  EGKSFLQMCLKRDPAARASASQLMDHPFVQDH  550



>ref|XP_010239934.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Brachypodium distachyon]
Length=696

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQ  762
            E KSF++ CL+R+P+AR +ASQL+DHPF++D 
Sbjct  519  EGKSFLQMCLKRDPAARASASQLMDHPFVQDH  550



>ref|XP_008804032.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Phoenix dactylifera]
 ref|XP_008804033.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Phoenix dactylifera]
Length=884

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKD  765
            E K FIR CLQREP  RPTA+ LL HPF+K+
Sbjct  637  EGKDFIRQCLQREPPNRPTAADLLQHPFVKN  667



>ref|XP_010547898.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Tarenaya hassleriana]
Length=599

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQ  762
            +AK+FIR CLQR+PS RPTASQLL+H F+++ 
Sbjct  424  DAKNFIRLCLQRDPSKRPTASQLLEHSFLREH  455



>ref|XP_007038746.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY23247.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=978

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            E K F+R CLQR P  RPTA QLLDHPF+K
Sbjct  641  EGKDFVRQCLQRNPLHRPTAVQLLDHPFVK  670



>ref|XP_010547897.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Tarenaya hassleriana]
Length=600

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIKDQ  762
            +AK+FIR CLQR+PS RPTASQLL+H F+++ 
Sbjct  424  DAKNFIRLCLQRDPSKRPTASQLLEHSFLREH  455



>ref|XP_007038747.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY23248.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=897

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -3

Query  857  EAKSFIRXCLQREPSARPTASQLLDHPFIK  768
            E K F+R CLQR P  RPTA QLLDHPF+K
Sbjct  641  EGKDFVRQCLQRNPLHRPTAVQLLDHPFVK  670



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1837073150400