BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF040E02

Length=845
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P51819.1|HSP83_IPONI  RecName: Full=Heat shock protein 83            378   9e-123   Ipomoea nil [qian niu]
emb|CAK22426.1|  heat shock protein 83                                  364   1e-121   Beta vulgaris [beet]
ref|XP_004140753.1|  PREDICTED: heat shock protein 83-like              368   9e-119   Cucumis sativus [cucumbers]
ref|XP_008439282.1|  PREDICTED: heat shock protein 83                   366   6e-118   Cucumis melo [Oriental melon]
gb|KDP22224.1|  hypothetical protein JCGZ_26055                         365   8e-118   Jatropha curcas
gb|KCW90631.1|  hypothetical protein EUGRSUZ_A02734                     365   1e-117   Eucalyptus grandis [rose gum]
ref|XP_010060433.1|  PREDICTED: heat shock protein 83-like              365   1e-117   Eucalyptus grandis [rose gum]
ref|XP_010671625.1|  PREDICTED: heat shock protein 83                   365   1e-117   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006372391.1|  hypothetical protein POPTR_0017s01160g             364   4e-117   
ref|XP_009377558.1|  PREDICTED: heat shock protein 83-like              362   2e-116   Pyrus x bretschneideri [bai li]
ref|XP_002305263.1|  hypothetical protein POPTR_0004s07190g             361   4e-116   Populus trichocarpa [western balsam poplar]
gb|AAQ08597.1|  heat shock protein                                      361   5e-116   Hevea brasiliensis [jebe]
ref|XP_009368732.1|  PREDICTED: heat shock protein 83                   361   6e-116   Pyrus x bretschneideri [bai li]
ref|XP_010089052.1|  Heat shock protein 83                              360   1e-115   Morus notabilis
ref|XP_004516872.1|  PREDICTED: heat shock protein 83-like              360   1e-115   Cicer arietinum [garbanzo]
ref|XP_011035347.1|  PREDICTED: heat shock protein 83-like isofor...    357   2e-115   Populus euphratica
ref|XP_010089053.1|  Heat shock protein 83                              359   3e-115   Morus notabilis
ref|XP_007220219.1|  hypothetical protein PRUPE_ppa002187mg             359   3e-115   Prunus persica
ref|XP_011046024.1|  PREDICTED: heat shock protein 83                   359   3e-115   Populus euphratica
emb|CDP05141.1|  unnamed protein product                                358   6e-115   Coffea canephora [robusta coffee]
ref|XP_008376647.1|  PREDICTED: heat shock protein 83 isoform X1        358   6e-115   
emb|CAN70887.1|  hypothetical protein VITISV_005592                     357   9e-115   Vitis vinifera
ref|XP_011035346.1|  PREDICTED: heat shock protein 83-like isofor...    358   9e-115   Populus euphratica
ref|XP_004308051.1|  PREDICTED: heat shock protein 83                   357   1e-114   Fragaria vesca subsp. vesca
ref|XP_008380194.1|  PREDICTED: heat shock protein 83-like              357   2e-114   
ref|XP_003533977.1|  PREDICTED: heat shock protein 83-like              356   4e-114   
ref|XP_004974995.1|  PREDICTED: heat shock protein 82-like              356   4e-114   Setaria italica
gb|KDO56797.1|  hypothetical protein CISIN_1g005370mg                   353   4e-114   Citrus sinensis [apfelsine]
ref|XP_008234835.1|  PREDICTED: heat shock protein 83                   356   5e-114   Prunus mume [ume]
ref|XP_006401798.1|  hypothetical protein EUTSA_v10012817mg             355   7e-114   Eutrema salsugineum [saltwater cress]
dbj|BAJ34368.1|  unnamed protein product                                355   9e-114   Eutrema halophilum
ref|XP_009375529.1|  PREDICTED: heat shock protein 83-like              355   9e-114   Pyrus x bretschneideri [bai li]
ref|XP_007038814.1|  Heat shock protein 90.1 isoform 2                  350   1e-113   
ref|XP_006599549.1|  PREDICTED: heat shock protein 83-like              355   1e-113   Glycine max [soybeans]
gb|KHN09298.1|  Heat shock protein 83                                   355   1e-113   Glycine soja [wild soybean]
gb|KJB52728.1|  hypothetical protein B456_008G274600                    355   1e-113   Gossypium raimondii
gb|AAD30456.1|AF123259_1  heat shock protein 90                         345   2e-113   Solanum lycopersicum
ref|XP_004308050.1|  PREDICTED: heat shock protein 83-like              354   2e-113   Fragaria vesca subsp. vesca
gb|KJB24311.1|  hypothetical protein B456_004G138600                    353   3e-113   Gossypium raimondii
ref|XP_006422036.1|  hypothetical protein CICLE_v10004456mg             353   3e-113   Citrus clementina [clementine]
gb|ADF31754.1|  heat shock protein 90                                   353   4e-113   Triticum aestivum [Canadian hard winter wheat]
gb|KDO56796.1|  hypothetical protein CISIN_1g005370mg                   353   4e-113   Citrus sinensis [apfelsine]
ref|XP_010261331.1|  PREDICTED: heat shock protein 83                   353   5e-113   Nelumbo nucifera [Indian lotus]
gb|KEH26332.1|  heat shock protein 81-2                                 353   7e-113   Medicago truncatula
ref|XP_010941080.1|  PREDICTED: heat shock protein 83                   352   1e-112   Elaeis guineensis
ref|XP_007038813.1|  Heat shock protein 90.1 isoform 1                  352   1e-112   
ref|XP_006476504.1|  PREDICTED: heat shock protein 83-like              352   1e-112   Citrus sinensis [apfelsine]
ref|XP_010035175.1|  PREDICTED: heat shock protein 83                   352   2e-112   Eucalyptus grandis [rose gum]
dbj|BAA00615.1|  81kDa heat-shock protein                               352   2e-112   Arabidopsis thaliana [mouse-ear cress]
gb|AAA32822.1|  heat shock protein 83                                   352   2e-112   Arabidopsis thaliana [mouse-ear cress]
sp|P27323.3|HS901_ARATH  RecName: Full=Heat shock protein 90-1; S...    351   2e-112   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200076.1|  heat shock protein 90.1                               351   3e-112   
prf||1908431A  heat shock protein HSP81-1                               351   3e-112
gb|EMS66149.1|  Heat shock protein 83                                   350   3e-112   Triticum urartu
sp|P36182.1|HSP82_TOBAC  RecName: Full=Heat shock protein 82            345   4e-112   Nicotiana tabacum [American tobacco]
gb|KDO76323.1|  hypothetical protein CISIN_1g005321mg                   351   4e-112   Citrus sinensis [apfelsine]
gb|EYU25148.1|  hypothetical protein MIMGU_mgv1a002213mg                350   7e-112   Erythranthe guttata [common monkey flower]
ref|XP_002278894.1|  PREDICTED: heat shock protein 83                   350   9e-112   Vitis vinifera
gb|ADF31778.1|  heat shock protein 90                                   350   1e-111   Triticum dicoccoides [wild emmer wheat]
ref|XP_009628903.1|  PREDICTED: heat shock protein 83-like              350   1e-111   Nicotiana tomentosiformis
gb|ADF31772.1|  heat shock protein 90                                   350   1e-111   Triticum urartu
gb|EMT27103.1|  Heat shock protein 83                                   348   1e-111   
ref|XP_010934626.1|  PREDICTED: heat shock protein 83-like              349   2e-111   Elaeis guineensis
ref|XP_010276895.1|  PREDICTED: heat shock protein 83-like              349   2e-111   Nelumbo nucifera [Indian lotus]
gb|ADF31775.1|  heat shock protein 90                                   348   4e-111   Aegilops tauschii
ref|XP_008797179.1|  PREDICTED: heat shock protein 83-like              348   4e-111   Phoenix dactylifera
gb|ADF31756.1|  heat shock protein 90                                   348   4e-111   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009791186.1|  PREDICTED: heat shock protein 83-like              347   5e-111   Nicotiana sylvestris
gb|AIZ68157.1|  heat shock protein 83                                   348   5e-111   Ornithogalum longebracteatum [sea-onion]
ref|XP_007040338.1|  Heat shock protein 90.1                            348   6e-111   Theobroma cacao [chocolate]
ref|XP_006439485.1|  hypothetical protein CICLE_v10019095mg             348   7e-111   Citrus clementina [clementine]
prf||1710352A  heat shock protein 83                                    347   8e-111
ref|XP_004240717.1|  PREDICTED: heat shock protein 83-like              347   8e-111   
ref|XP_002864186.1|  heat shock protein 81-1                            347   8e-111   
ref|XP_011076104.1|  PREDICTED: heat shock protein 83                   347   8e-111   Sesamum indicum [beniseed]
ref|XP_009413748.1|  PREDICTED: heat shock protein 83                   347   1e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010934628.1|  PREDICTED: heat shock protein 83-like              347   1e-110   Elaeis guineensis
ref|XP_011084460.1|  PREDICTED: heat shock protein 83-like              347   1e-110   Sesamum indicum [beniseed]
ref|XP_009768512.1|  PREDICTED: heat shock protein 82                   347   2e-110   Nicotiana sylvestris
ref|XP_009607669.1|  PREDICTED: heat shock protein 82                   346   4e-110   Nicotiana tomentosiformis
ref|XP_011080917.1|  PREDICTED: heat shock protein 83-like              345   4e-110   Sesamum indicum [beniseed]
dbj|BAJ85535.1|  predicted protein                                      346   5e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY27839.1|  BnaC09g28660D                                          345   7e-110   Brassica napus [oilseed rape]
ref|XP_008801780.1|  PREDICTED: heat shock protein 83                   345   7e-110   Phoenix dactylifera
ref|XP_002513649.1|  heat shock protein, putative                       343   4e-109   Ricinus communis
gb|ADF31779.1|  heat shock protein 90                                   343   5e-109   Triticum dicoccoides [wild emmer wheat]
ref|XP_004234218.1|  PREDICTED: heat shock protein 83                   342   1e-108   Solanum lycopersicum
ref|XP_006362664.1|  PREDICTED: heat shock protein 83-like              342   1e-108   Solanum tuberosum [potatoes]
emb|CAA68885.1|  heat shock protein 90A                                 342   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002447413.1|  hypothetical protein SORBIDRAFT_06g000660          342   2e-108   Sorghum bicolor [broomcorn]
gb|ADF31755.1|  heat shock protein 90                                   341   3e-108   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010446135.1|  PREDICTED: heat shock protein 90-3-like            333   3e-108   Camelina sativa [gold-of-pleasure]
gb|EYU19581.1|  hypothetical protein MIMGU_mgv1a002166mg                340   6e-108   Erythranthe guttata [common monkey flower]
ref|XP_009802902.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    340   9e-108   Nicotiana sylvestris
gb|KFK26865.1|  hypothetical protein AALP_AA8G303900                    339   1e-107   Arabis alpina [alpine rockcress]
gb|KDP25390.1|  hypothetical protein JCGZ_20546                         338   3e-107   Jatropha curcas
ref|XP_010445119.1|  PREDICTED: heat shock protein 90-1-like            338   3e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010482633.1|  PREDICTED: heat shock protein 90-1                 338   4e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010442803.1|  PREDICTED: heat shock protein 90-1-like            338   4e-107   Camelina sativa [gold-of-pleasure]
emb|CAN73318.1|  hypothetical protein VITISV_007727                     338   5e-107   Vitis vinifera
ref|XP_006280097.1|  hypothetical protein CARUB_v10025984mg             338   5e-107   Capsella rubella
ref|XP_002274022.1|  PREDICTED: heat shock protein 83-like              338   5e-107   Vitis vinifera
ref|XP_006664928.1|  PREDICTED: heat shock protein 82-like              338   6e-107   Oryza brachyantha
ref|XP_010055687.1|  PREDICTED: heat shock protein 90-1-like            337   9e-107   Eucalyptus grandis [rose gum]
ref|XP_010552350.1|  PREDICTED: heat shock protein 90-2                 336   1e-106   Tarenaya hassleriana [spider flower]
ref|XP_010235286.1|  PREDICTED: heat shock protein 81-1-like            336   2e-106   Brachypodium distachyon [annual false brome]
ref|XP_010235281.1|  PREDICTED: heat shock protein 81-1-like            335   4e-106   Brachypodium distachyon [annual false brome]
ref|XP_004135777.1|  PREDICTED: heat shock protein 90-2-like            332   5e-106   
ref|XP_007152171.1|  hypothetical protein PHAVU_004G107700g             335   6e-106   Phaseolus vulgaris [French bean]
ref|XP_010537148.1|  PREDICTED: heat shock protein 83                   335   7e-106   Tarenaya hassleriana [spider flower]
ref|XP_003580663.1|  PREDICTED: heat shock protein 82                   335   9e-106   Brachypodium distachyon [annual false brome]
ref|XP_009391803.1|  PREDICTED: heat shock protein 81-1-like            333   2e-105   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK27172.1|  hypothetical protein AALP_AA8G344900                    333   4e-105   Arabis alpina [alpine rockcress]
ref|XP_010443241.1|  PREDICTED: heat shock protein 90-3-like            332   5e-105   Camelina sativa [gold-of-pleasure]
gb|KHG00618.1|  Heat shock 90-1 -like protein                           333   5e-105   Gossypium arboreum [tree cotton]
gb|KGN66050.1|  hypothetical protein Csa_1G569270                       332   5e-105   Cucumis sativus [cucumbers]
gb|KHG21667.1|  Heat shock cognate 80                                   330   6e-105   Gossypium arboreum [tree cotton]
gb|KJB20596.1|  hypothetical protein B456_003G155600                    332   6e-105   Gossypium raimondii
ref|XP_002869603.1|  early-responsive to dehydration 8                  332   6e-105   Arabidopsis lyrata subsp. lyrata
emb|CDY50297.1|  BnaA10g28410D                                          330   7e-105   Brassica napus [oilseed rape]
ref|XP_006287183.1|  hypothetical protein CARUB_v10000353mg             332   8e-105   Capsella rubella
gb|EYU33725.1|  hypothetical protein MIMGU_mgv1a002215mg                332   8e-105   Erythranthe guttata [common monkey flower]
ref|XP_002969937.1|  hypothetical protein SELMODRAFT_267300             331   1e-104   
ref|XP_009119805.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    332   1e-104   Brassica rapa
ref|XP_006401391.1|  hypothetical protein EUTSA_v10012832mg             331   1e-104   Eutrema salsugineum [saltwater cress]
ref|XP_002973159.1|  hypothetical protein SELMODRAFT_271009             332   1e-104   Selaginella moellendorffii
dbj|BAK08691.1|  heat shock protein 90                                  331   1e-104   Chara braunii
ref|XP_010483069.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    331   2e-104   
dbj|BAK08741.1|  heat shock protein 90                                  331   2e-104   Chara braunii
ref|XP_001777383.1|  predicted protein                                  331   2e-104   
ref|XP_002976693.1|  hypothetical protein SELMODRAFT_151384             331   2e-104   Selaginella moellendorffii
ref|XP_006413166.1|  hypothetical protein EUTSA_v10024564mg             331   2e-104   Eutrema salsugineum [saltwater cress]
ref|XP_010483070.1|  PREDICTED: heat shock protein 90-3-like            331   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010443242.1|  PREDICTED: heat shock protein 90-2                 331   2e-104   Camelina sativa [gold-of-pleasure]
gb|AHM23830.1|  heat shock protein 90                                   322   2e-104   Brassica rapa
ref|XP_001777414.1|  predicted protein                                  331   2e-104   
ref|XP_006280101.1|  hypothetical protein CARUB_v10025990mg             331   2e-104   Capsella rubella
ref|XP_002981406.1|  hypothetical protein SELMODRAFT_271484             331   2e-104   Selaginella moellendorffii
ref|XP_006413591.1|  hypothetical protein EUTSA_v10024561mg             330   3e-104   Eutrema salsugineum [saltwater cress]
gb|ADF31757.1|  heat shock protein 90                                   330   3e-104   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010450563.1|  PREDICTED: heat shock protein 90-3-like            330   5e-104   Camelina sativa [gold-of-pleasure]
ref|NP_001234439.1|  heat shock cognate protein 80                      330   5e-104   Solanum lycopersicum
ref|XP_009126978.1|  PREDICTED: heat shock protein 90-2-like            330   5e-104   Brassica rapa
gb|AAF31705.1|AF221856_1  heat-shock protein 80                         318   5e-104   Euphorbia esula [wolf's milk]
ref|XP_010433476.1|  PREDICTED: heat shock protein 90-2-like            330   5e-104   Camelina sativa [gold-of-pleasure]
gb|KFK38607.1|  hypothetical protein AALP_AA3G136000                    328   6e-104   Arabis alpina [alpine rockcress]
ref|XP_010483071.1|  PREDICTED: heat shock protein 90-3-like            330   6e-104   Camelina sativa [gold-of-pleasure]
gb|ACN27969.1|  unknown                                                 330   7e-104   Zea mays [maize]
dbj|BAK08743.1|  heat shock protein 90                                  329   7e-104   Chara braunii
ref|NP_001135416.2|  heat shock protein 82                              330   8e-104   
dbj|BAK08742.1|  heat shock protein 90                                  329   8e-104   Chara braunii
gb|ACX37414.1|  cytosolic heat shock protein 90.2                       329   1e-103   Dactylis glomerata [cocksfoot]
ref|XP_006280103.1|  hypothetical protein CARUB_v10025991mg             329   1e-103   Capsella rubella
ref|XP_006280102.1|  hypothetical protein CARUB_v10025991mg             328   1e-103   
gb|EAY92778.1|  hypothetical protein OsI_14582                          328   2e-103   Oryza sativa Indica Group [Indian rice]
emb|CAE02770.2|  OSJNBb0085F13.17                                       328   2e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006828794.1|  hypothetical protein AMTR_s00001p00118120          328   2e-103   Amborella trichopoda
ref|XP_010438732.1|  PREDICTED: heat shock protein 90-2-like            328   2e-103   Camelina sativa [gold-of-pleasure]
ref|NP_200411.1|  Heat shock protein 90-4                               328   2e-103   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ86355.1|  predicted protein                                      328   3e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGT98548.1|  heat shock protein 90                                   315   3e-103   Paeonia lactiflora [common garden peony]
ref|XP_002509852.1|  heat shock protein, putative                       327   4e-103   Ricinus communis
gb|KFK29176.1|  hypothetical protein AALP_AA7G099100                    327   5e-103   Arabis alpina [alpine rockcress]
ref|XP_009132299.1|  PREDICTED: heat shock protein 90-2-like            327   8e-103   Brassica rapa
dbj|BAK08690.1|  heat shock protein 90                                  326   2e-102   Chara braunii
dbj|BAH97107.1|  heat shock protein of Hsp90                            326   2e-102   Chara braunii
dbj|BAK08728.1|  heat shock protein 90                                  326   2e-102   Chara braunii
dbj|BAG16518.1|  putative Hsp90-2                                       325   3e-102   Capsicum chinense [bonnet pepper]
gb|ACX37413.1|  cytosolic heat shock protein 90.1                       325   3e-102   Dactylis glomerata [cocksfoot]
gb|KFK40163.1|  hypothetical protein AALP_AA3G338900                    325   3e-102   Arabis alpina [alpine rockcress]
gb|ABV89643.1|  heat shock protein 81-4                                 323   3e-102   Brassica rapa
ref|XP_001779443.1|  predicted protein                                  324   5e-102   
ref|XP_001780981.1|  predicted protein                                  324   6e-102   
ref|XP_001766228.1|  predicted protein                                  324   8e-102   
gb|AFR60309.1|  HSP90                                                   324   1e-101   Pelargonium peltatum
gb|ABB84343.1|  heat shock protein 90                                   322   1e-101   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009383207.1|  PREDICTED: heat shock protein 81-1-like            323   1e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009132345.1|  PREDICTED: heat shock protein 90-2                 323   1e-101   Brassica rapa
dbj|BAO20259.1|  heat shock protein                                     323   2e-101   Brassica rapa subsp. chinensis [bok-choy]
gb|ADF31760.1|  heat shock protein 90                                   323   2e-101   Triticum aestivum [Canadian hard winter wheat]
emb|CAJ19348.1|  heat shock protein 90                                  322   2e-101   Triticum aestivum [Canadian hard winter wheat]
gb|ABG57075.1|  heat shock protein 90                                   323   2e-101   Triticum aestivum [Canadian hard winter wheat]
gb|AAP87284.1|  cytosolic heat shock protein 90                         323   3e-101   Hordeum vulgare [barley]
gb|EMT17245.1|  Heat shock protein 81-3                                 323   4e-101   
ref|XP_008238949.1|  PREDICTED: heat shock protein 90-1-like            322   5e-101   Prunus mume [ume]
ref|XP_008811147.1|  PREDICTED: heat shock protein 81-1-like            322   5e-101   Phoenix dactylifera
gb|KCW70450.1|  hypothetical protein EUGRSUZ_F03673                     317   6e-101   Eucalyptus grandis [rose gum]
gb|KFK25886.1|  hypothetical protein AALP_AA8G175000                    321   1e-100   Arabis alpina [alpine rockcress]
dbj|BAJ99646.1|  predicted protein                                      321   1e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB13948.1|  hypothetical protein B456_002G103000                    318   2e-100   Gossypium raimondii
ref|XP_002866122.1|  heat shock protein 81-4                            320   2e-100   
ref|XP_002864424.1|  heat shock protein 81-3                            320   3e-100   
ref|XP_009417329.1|  PREDICTED: heat shock protein 81-1                 320   3e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390627.1|  PREDICTED: heat shock protein 81-1-like            320   3e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420064.1|  PREDICTED: heat shock protein 81-1-like            320   4e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010103960.1|  Heat shock cognate protein 80                      320   4e-100   
dbj|BAD95027.1|  heat shock protein 90                                  310   5e-100   Arabidopsis thaliana [mouse-ear cress]
gb|AAH08189.1|  Unknown (protein for IMAGE:3584589)                     313   5e-100   Mus musculus [mouse]
gb|KJB13949.1|  hypothetical protein B456_002G103000                    319   6e-100   Gossypium raimondii
ref|XP_003574727.1|  PREDICTED: heat shock protein 81-1                 319   7e-100   Brachypodium distachyon [annual false brome]
ref|XP_009132342.1|  PREDICTED: heat shock protein 90-2-like            318   1e-99    Brassica rapa
gb|AAB33937.1|  heat-shock Protein                                      318   1e-99    Arabidopsis thaliana [mouse-ear cress]
gb|KCW70451.1|  hypothetical protein EUGRSUZ_F03673                     316   1e-99    Eucalyptus grandis [rose gum]
gb|EEC84770.1|  hypothetical protein OsI_31800                          304   1e-99    Oryza sativa Indica Group [Indian rice]
gb|KHG22758.1|  Heat shock cognate 80                                   318   2e-99    Gossypium arboreum [tree cotton]
ref|XP_001419938.1|  Heat Shock Protein 90, cytosolic                   317   3e-99    Ostreococcus lucimarinus CCE9901
gb|KHG19401.1|  Heat shock cognate 80                                   317   5e-99    Gossypium arboreum [tree cotton]
ref|NP_001274833.1|  Hsp90-2-like                                       317   5e-99    Solanum tuberosum [potatoes]
gb|EYU31897.1|  hypothetical protein MIMGU_mgv1a002208mg                316   8e-99    Erythranthe guttata [common monkey flower]
emb|CDP13679.1|  unnamed protein product                                316   8e-99    Coffea canephora [robusta coffee]
gb|KCW79839.1|  hypothetical protein EUGRSUZ_C01179                     316   8e-99    Eucalyptus grandis [rose gum]
gb|AAD11549.1|  heat shock protein 80                                   316   9e-99    Triticum aestivum [Canadian hard winter wheat]
gb|AFQ94045.1|  heat shock protein 90                                   316   9e-99    Lactuca sativa [cultivated lettuce]
gb|ADF31758.1|  heat shock protein 90                                   316   9e-99    Triticum aestivum [Canadian hard winter wheat]
gb|EMS59444.1|  Heat shock protein 81-3                                 316   1e-98    Triticum urartu
ref|XP_010063241.1|  PREDICTED: heat shock cognate protein 80-like      316   1e-98    Eucalyptus grandis [rose gum]
gb|ADF31773.1|  heat shock protein 90                                   316   1e-98    Triticum urartu
ref|XP_010047845.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock c...    316   1e-98    Eucalyptus grandis [rose gum]
ref|XP_006857538.1|  hypothetical protein AMTR_s00061p00036160          316   1e-98    Amborella trichopoda
ref|XP_004974826.1|  PREDICTED: heat shock protein 81-1-like            314   1e-98    
tpg|DAA40367.1|  TPA: putative heat shock protein 90 family protein     305   2e-98    
ref|XP_004973824.1|  PREDICTED: heat shock protein 81-1-like            315   2e-98    
ref|XP_002532177.1|  heat shock protein, putative                       315   3e-98    Ricinus communis
ref|NP_001240230.1|  uncharacterized protein LOC100819568               315   3e-98    Glycine max [soybeans]
ref|XP_010675973.1|  PREDICTED: heat shock cognate protein 80           315   3e-98    Beta vulgaris subsp. vulgaris [field beet]
gb|ADF31759.1|  heat shock protein 90                                   315   3e-98    Triticum aestivum [Canadian hard winter wheat]
gb|AHB36893.1|  heat shock protein 90                                   315   3e-98    Matricaria chamomilla var. recutita [German chamomile]
gb|AGU99972.1|  HSP90                                                   314   4e-98    Populus tomentosa [Chinese white poplar]
gb|ADF31781.1|  heat shock protein 90                                   314   4e-98    Triticum dicoccoides [wild emmer wheat]
ref|NP_001063503.1|  Os09g0482400                                       314   5e-98    
ref|XP_002299048.1|  hypothetical protein POPTR_0001s47020g             314   5e-98    Populus trichocarpa [western balsam poplar]
ref|NP_001063500.1|  Os09g0482100                                       314   5e-98    
ref|NP_001275844.1|  HSP90 protein                                      314   6e-98    Citrus sinensis [apfelsine]
ref|NP_001170475.1|  LOC100384473                                       314   6e-98    Zea mays [maize]
ref|XP_011039800.1|  PREDICTED: heat shock protein 90-2                 314   6e-98    Populus euphratica
dbj|BAD04054.1|  heat shock protein 90                                  314   6e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004135593.1|  PREDICTED: heat shock cognate protein 80-like      314   7e-98    
gb|KDP32613.1|  hypothetical protein JCGZ_13163                         313   9e-98    Jatropha curcas
ref|XP_010928158.1|  PREDICTED: heat shock protein 81-1-like            313   1e-97    Elaeis guineensis
ref|XP_006659553.1|  PREDICTED: heat shock protein 81-1-like            313   1e-97    
ref|XP_006659612.1|  PREDICTED: heat shock protein 81-1-like            313   1e-97    Oryza brachyantha
ref|XP_002444804.1|  hypothetical protein SORBIDRAFT_07g028270          313   1e-97    Sorghum bicolor [broomcorn]
ref|XP_003081563.1|  Molecular chaperone (HSP90 family) (ISS)           305   1e-97    
tpg|DAA61993.1|  TPA: putative heat shock protein 90 family protein     305   2e-97    
dbj|BAD73667.1|  putative heat shock protein 82                         310   2e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010252844.1|  PREDICTED: heat shock cognate protein 80-like      313   2e-97    Nelumbo nucifera [Indian lotus]
ref|XP_007020406.1|  Heat shock protein 81.4                            313   2e-97    Theobroma cacao [chocolate]
ref|XP_008776162.1|  PREDICTED: heat shock protein 81-1                 312   2e-97    Phoenix dactylifera
emb|CAA67191.1|  HSP80-2                                                312   3e-97    Triticum aestivum [Canadian hard winter wheat]
gb|AGB76029.1|  heat shock protein 90                                   312   3e-97    Salicornia europaea [chicken-claws]
ref|XP_004294900.1|  PREDICTED: heat shock protein 90-2                 312   4e-97    Fragaria vesca subsp. vesca
ref|XP_006659551.1|  PREDICTED: heat shock protein 81-1-like isof...    311   4e-97    
ref|XP_002462554.1|  hypothetical protein SORBIDRAFT_02g028020          311   4e-97    Sorghum bicolor [broomcorn]
ref|XP_006659552.1|  PREDICTED: heat shock protein 81-1-like isof...    311   5e-97    
ref|XP_011097724.1|  PREDICTED: heat shock cognate protein 80-like      311   5e-97    Sesamum indicum [beniseed]
ref|NP_200414.1|  heat shock protein 81-2                               311   6e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006373573.1|  HSP80 family protein                               311   7e-97    Populus trichocarpa [western balsam poplar]
ref|XP_011040123.1|  PREDICTED: heat shock protein 81-1                 311   7e-97    Populus euphratica
sp|A2YWQ1.1|HSP81_ORYSI  RecName: Full=Heat shock protein 81-1; S...    311   7e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_004500151.1|  PREDICTED: heat shock cognate protein 80-like      311   8e-97    Cicer arietinum [garbanzo]
gb|AGA62462.1|  heat shock protein 90                                   311   8e-97    Gossypium hirsutum [American cotton]
gb|ADP89125.1|  heat shock protein 90                                   311   1e-96    Cenchrus americanus [bulrush millet]
ref|XP_006452664.1|  hypothetical protein CICLE_v10007633mg             311   1e-96    Citrus clementina [clementine]
ref|XP_003544594.1|  PREDICTED: heat shock cognate protein 80-like      311   1e-96    Glycine max [soybeans]
ref|NP_001190553.1|  heat shock protein 81-2                            311   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536759.1|  PREDICTED: heat shock protein 90-2-like            311   1e-96    Tarenaya hassleriana [spider flower]
ref|XP_003592196.1|  Heat shock protein                                 310   1e-96    
ref|NP_200412.1|  Heat shock protein 90-3                               310   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010539340.1|  PREDICTED: heat shock protein 90-2-like            310   1e-96    Tarenaya hassleriana [spider flower]
gb|AIZ68152.1|  heat shock protein 81-1                                 310   2e-96    Ornithogalum longebracteatum [sea-onion]
ref|NP_001062159.1|  Os08g0500700                                       310   2e-96    
gb|AAN31859.1|  putative heat shock protein 81-2 (HSP81-2)              310   2e-96    Arabidopsis thaliana [mouse-ear cress]
gb|ADC53692.1|  heat shock protein 90-1                                 296   2e-96    Cryptocoryne ciliata
ref|XP_003635036.1|  PREDICTED: heat shock cognate protein 80           310   2e-96    Vitis vinifera
gb|AGC60019.1|  heat shock protein 90                                   310   2e-96    Saccharum hybrid cultivar SP80-3280
ref|XP_008811143.1|  PREDICTED: heat shock protein 81-1-like            310   3e-96    Phoenix dactylifera
ref|XP_009758556.1|  PREDICTED: heat shock cognate protein 80-like      309   3e-96    Nicotiana sylvestris
ref|XP_009594054.1|  PREDICTED: heat shock cognate protein 80-like      309   3e-96    Nicotiana tomentosiformis
gb|ABW96308.1|  heat shock protein 90                                   309   3e-96    Vitis pseudoreticulata
ref|XP_006408893.1|  hypothetical protein EUTSA_v10002229mg             309   3e-96    
gb|KJB22185.1|  hypothetical protein B456_004G034000                    308   3e-96    
ref|XP_010913224.1|  PREDICTED: heat shock protein 81-1-like            309   4e-96    
gb|AAL49788.1|  putative heat shock protein 90                          309   4e-96    
gb|ADU04387.1|  heat shock protein 90-2                                 309   4e-96    
ref|XP_006344905.1|  PREDICTED: heat shock cognate protein 80-like      309   4e-96    
ref|XP_009785111.1|  PREDICTED: heat shock cognate protein 80           309   5e-96    
ref|NP_001236599.1|  heat shock protein 90-2                            309   5e-96    
ref|XP_008384610.1|  PREDICTED: heat shock protein 90-2                 309   5e-96    
ref|XP_007208337.1|  hypothetical protein PRUPE_ppa002220mg             309   6e-96    
ref|NP_001170480.1|  HSP protein                                        309   6e-96    
ref|XP_011089536.1|  PREDICTED: heat shock cognate protein 80           308   6e-96    
gb|EPS61618.1|  hypothetical protein M569_13176                         308   6e-96    
ref|XP_009362097.1|  PREDICTED: heat shock protein 90-2                 308   7e-96    
ref|XP_008218765.1|  PREDICTED: heat shock protein 90-2                 308   7e-96    
ref|XP_009367265.1|  PREDICTED: heat shock protein 90-2                 308   7e-96    
gb|ACN36206.1|  unknown                                                 308   7e-96    
ref|NP_001234436.1|  molecular chaperone Hsp90-1                        308   8e-96    
gb|KHN23824.1|  Heat shock cognate protein 80                           308   1e-95    
ref|XP_006352548.1|  PREDICTED: heat shock cognate protein 80-like      308   1e-95    
ref|XP_002307846.1|  HSP80 family protein                               308   1e-95    
gb|ADU04386.1|  heat shock protein 90-1                                 308   1e-95    
ref|XP_011005759.1|  PREDICTED: heat shock cognate protein 80-like      308   1e-95    
ref|XP_007142447.1|  hypothetical protein PHAVU_008G281400g             308   2e-95    
ref|XP_007142446.1|  hypothetical protein PHAVU_008G281300g             307   2e-95    
ref|XP_002273244.1|  PREDICTED: heat shock cognate protein 80-like      307   2e-95    
ref|XP_009763345.1|  PREDICTED: heat shock cognate protein 80-like      307   2e-95    
gb|AAR12194.1|  molecular chaperone Hsp90-2                             307   2e-95    
gb|ACX31585.1|  molecular chaperone Hsp90-3                             307   2e-95    
gb|KJB22184.1|  hypothetical protein B456_004G033900                    307   2e-95    
emb|CAA72513.1|  heat shock protein                                     307   2e-95    
ref|XP_008652859.1|  PREDICTED: heat shock protein 81-1                 307   2e-95    
emb|CEF99333.1|  Histidine kinase-like ATPase, ATP-binding domain       307   3e-95    
emb|CAN62488.1|  hypothetical protein VITISV_029391                     307   3e-95    
ref|XP_010913223.1|  PREDICTED: heat shock protein 81-1-like            307   3e-95    
gb|KHN31689.1|  Heat shock cognate protein 80                           306   5e-95    
ref|XP_009607645.1|  PREDICTED: heat shock cognate protein 80-like      306   9e-95    
ref|XP_008670278.1|  PREDICTED: heat shock protein 81-1-like            305   1e-94    
ref|XP_008355028.1|  PREDICTED: heat shock protein 90-2                 305   1e-94    
gb|KIY96293.1|  Heat shock protein 82                                   299   2e-94    
gb|KJB81563.1|  hypothetical protein B456_013G150300                    304   3e-94    
ref|XP_010545291.1|  PREDICTED: heat shock protein 90-2-like            304   4e-94    
ref|XP_002947115.1|  hypothetical protein VOLCADRAFT_73112              304   4e-94    
gb|ADC45395.1|  HSP90-1                                                 303   8e-94    
ref|NP_001236612.1|  heat shock protein 90-1                            303   9e-94    
gb|KJB81562.1|  hypothetical protein B456_013G150300                    303   1e-93    
ref|XP_010246543.1|  PREDICTED: heat shock cognate protein 80           303   1e-93    
gb|ABX76302.1|  heat shock protein 90                                   302   2e-93    
gb|KHN16650.1|  Heat shock protein 81-3                                 298   5e-93    
ref|XP_003058104.1|  predicted protein                                  301   7e-93    
ref|XP_003617873.1|  Heat shock protein                                 301   7e-93    
ref|XP_005643103.1|  HSP90-domain-containing protein                    300   1e-92    
ref|XP_001695264.1|  heat shock protein 90A                             300   1e-92    
gb|AAR12193.1|  molecular chaperone Hsp90-1                             298   5e-92    
gb|ADX06844.1|  molecular chaperone Hsp90                               298   6e-92    
ref|XP_009591410.1|  PREDICTED: heat shock cognate protein 80           298   6e-92    
gb|AAS79798.1|  heat shock protein 90                                   298   7e-92    
ref|XP_002300303.1|  HSP80 family protein                               298   1e-91    
ref|XP_011030250.1|  PREDICTED: heat shock protein 81-1-like            297   2e-91    
gb|AEP39605.1|  heat shock protein 90                                   297   2e-91    
ref|XP_004491530.1|  PREDICTED: heat shock cognate protein 80-lik...    296   4e-91    
gb|AFK31312.1|  heat shock protein 90                                   296   4e-91    
ref|XP_002460433.1|  hypothetical protein SORBIDRAFT_02g028050          296   5e-91    
ref|XP_002499727.1|  predicted protein                                  295   9e-91    
gb|AEK20869.1|  heat shock protein 90-2                                 295   1e-90    
ref|XP_005703696.1|  molecular chaperone HtpG                           291   4e-89    
gb|AGV54249.1|  heat-shock protein                                      289   2e-88    
gb|AFK31313.1|  heat shock protein 90                                   288   6e-88    
gb|KFG42944.1|  heat shock protein HSP90                                274   2e-87    
ref|XP_006385775.1|  hypothetical protein POPTR_0003s13180g             281   7e-87    
ref|XP_007510316.1|  predicted protein                                  285   1e-86    
dbj|BAL45643.1|  heat shock protein 90                                  284   1e-86    
gb|ADC53691.1|  heat shock protein 90-2                                 270   2e-86    
ref|XP_008353934.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    281   2e-85    
ref|XP_004367478.1|  heat shock protein 90 alpha, putative              281   2e-85    
gb|AAN61003.1|  putative heat shock protein 90                          276   2e-85    
gb|KDD75584.1|  heat shock protein 90 Hsp90                             280   4e-85    
ref|XP_002682619.1|  predicted protein                                  279   9e-85    
gb|EJY69804.1|  Heat shock protein 90                                   279   1e-84    
ref|XP_002963536.1|  hypothetical protein SELMODRAFT_230177             276   9e-84    
ref|XP_005715129.1|  unnamed protein product                            277   1e-83    
gb|AAY67878.1|  heat shock protein 90                                   276   2e-83    
dbj|BAJ93614.1|  predicted protein                                      268   2e-83    
ref|XP_009824430.1|  hsp83-like protein                                 264   3e-83    
ref|XP_005538149.1|  heat shock protein of Hsp90 family                 275   3e-83    
emb|CDY22598.1|  BnaC05g24360D                                          270   3e-83    
emb|CDW75268.1|  heat shock protein 90                                  275   7e-83    
gb|EJY88528.1|  Heat shock protein 90                                   274   8e-83    
ref|XP_002672583.1|  predicted protein                                  273   2e-82    
ref|XP_002981544.1|  hypothetical protein SELMODRAFT_233774             272   2e-82    
ref|XP_001713499.1|  heat shock protein 82                              273   2e-82    
ref|XP_002368278.1|  heat shock protein 90                              273   2e-82    
gb|EWM29604.1|  heat shock protein 90                                   273   4e-82    
ref|XP_004032449.1|  hypothetical protein IMG5_122190                   263   5e-82    
ref|XP_008889030.1|  heat shock protein HSP90                           272   5e-82    
gb|AAC64932.1|  heat-shock protein 90                                   261   5e-82    
ref|XP_002185608.1|  predicted protein                                  271   2e-81    
ref|XP_001712605.1|  hsp90                                              270   2e-81    
gb|KFH67886.1|  heat shock protein 83                                   270   3e-81    
gb|ETW57274.1|  hypothetical protein PFUGPA_00763                       258   4e-81    
ref|XP_005764796.1|  hypothetical protein EMIHUDRAFT_437342             270   4e-81    
ref|XP_005777261.1|  hypothetical protein EMIHUDRAFT_443778             270   5e-81    
ref|XP_002291118.1|  HSP90 family member                                269   1e-80    
dbj|BAJ06407.1|  90 kDa heat shock protein                              268   1e-80    
ref|XP_005855339.1|  molecular chaperone HtpG                           269   1e-80    
ref|XP_004363302.1|  heat shock protein 90a                             268   1e-80    
ref|XP_003881046.1|  hsp90, related                                     268   2e-80    
ref|XP_009534751.1|  hypothetical protein PHYSODRAFT_355817             268   2e-80    
ref|XP_005841337.1|  hypothetical protein GUITHDRAFT_83993              268   2e-80    
gb|ADJ00017.1|  heat shock protein 90                                   260   2e-80    
gb|KJE92655.1|  heat shock protein 90a                                  268   3e-80    
gb|ACO58580.1|  heat shock protein 90                                   258   3e-80    
ref|XP_006678605.1|  hypothetical protein BATDEDRAFT_36900              265   3e-80    
gb|ABH04243.1|  heat shock protein 90 kDa                               268   3e-80    
gb|EJK51577.1|  hypothetical protein THAOC_29237                        268   3e-80    
ref|XP_002998541.1|  heat shock protein 90                              268   3e-80    
gb|ETK95017.1|  heat shock protein 90-2                                 267   4e-80    
ref|XP_008915791.1|  heat shock protein 90-2                            267   4e-80    
gb|ACY66376.1|  HSP90                                                   261   4e-80    
ref|XP_002142400.1|  Hsp90 protein                                      267   5e-80    
ref|XP_002787611.1|  heat shock protein 90, putative                    268   5e-80    
gb|AFM73650.1|  heat shock protein 90                                   255   6e-80    
emb|CDW72432.1|  heat shock protein 90                                  266   6e-80    
ref|XP_002775585.1|  heat shock protein 90, putative                    267   7e-80    
gb|ADV59561.1|  heat shock protein 90                                   266   8e-80    
gb|AFX84559.1|  90 kDa heat shock protein                               266   1e-79    
gb|ACF06184.1|  heat shock protein 90                                   260   1e-79    
emb|CCA24455.1|  heat shock protein 90 putative                         266   1e-79    
ref|XP_004035743.1|  hypothetical protein IMG5_091060                   266   1e-79    
emb|CCI50227.1|  unnamed protein product                                266   1e-79    
emb|CAC29071.1|  heat shock protein 90                                  253   1e-79    
dbj|BAF01967.1|  HEAT SHOCK PROTEIN 81-2                                251   2e-79    
gb|EYD92886.1|  hsp90 family protein                                    254   2e-79    
gb|AFO84300.1|  heat shock protein 90                                   265   2e-79    
ref|XP_009824429.1|  hsp82-like protein                                 265   2e-79    
gb|ABG77328.1|  Hsp90                                                   263   2e-79    
gb|KDO27827.1|  heat shock protein                                      265   3e-79    
dbj|BAB15121.1|  unnamed protein product                                256   3e-79    
gb|AAY67995.1|  HSP 90                                                  259   3e-79    
ref|XP_008604300.1|  heat shock protein 90-2                            265   4e-79    
gb|AAH49951.1|  Hsp90ab1 protein                                        256   4e-79    
dbj|BAF83423.1|  unnamed protein product                                255   4e-79    
gb|AAG00567.1|AF287229_1  heat shock protein 90                         265   4e-79    
gb|ADQ20111.1|  heat shock protein 90                                   265   4e-79    
gb|AHF81420.1|  heat shock protein 90-2                                 266   5e-79    
gb|ETW37561.1|  hsp90-like protein                                      257   5e-79    
gb|AAZ17404.1|  90 kDa heat shock protein                               257   6e-79    
gb|AAO46139.1|  heat shock protein 90                                   255   6e-79    
gb|KIH68348.1|  Hsp90 protein                                           264   7e-79    
gb|AAK59281.1|AF378703_1  heat shock protein 90 alpha                   255   7e-79    
ref|NP_001164703.1|  heat shock protein 90                              264   8e-79    
ref|XP_676736.1|  hypothetical protein                                  251   8e-79    
ref|XP_008863963.1|  hsp81-like protein                                 264   9e-79    
gb|AAH44888.1|  Hsp90ab1 protein                                        255   9e-79    
gb|EYC13285.1|  hypothetical protein Y032_0044g1081                     264   9e-79    
gb|AGM20719.1|  heat shock protein 90                                   264   1e-78    
dbj|BAE87688.1|  unnamed protein product                                254   2e-78    
ref|XP_003239560.1|  heat shock protein                                 263   2e-78    
gb|EFA80384.1|  heat shock protein Hsp90 family protein                 263   2e-78    
gb|ACU45247.1|  HSP90                                                   254   2e-78    
gb|AAD41357.1|AF151114_1  hsp82 heat shock protein                      263   2e-78    
emb|CAG01828.1|  unnamed protein product                                258   2e-78    
gb|ETN83529.1|  putative heat shock protein 90                          262   2e-78    
ref|XP_001009780.1|  Hsp90 protein                                      263   2e-78    
dbj|BAH83702.1|  heat shock 90 protein                                  249   2e-78    
gb|ADB45333.1|  putative heat shock protein 90                          263   2e-78    
emb|CAA34748.1|  heat shock-like protein                                250   3e-78    
gb|ADK64952.1|  heat shock protein 90                                   263   3e-78    
gb|ADN87332.1|  heat shock protein 90                                   263   3e-78    
gb|AFQ23182.1|  heat shock protein 90                                   263   3e-78    
ref|XP_002165028.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    263   3e-78    
dbj|BAN65595.1|  hsp90 protein                                          254   3e-78    
gb|AAM90674.1|AF402100_1  heat shock protein Hsp90                      262   3e-78    
gb|AAM90675.1|AF402101_1  heat shock protein Hsp90                      262   3e-78    
ref|XP_001649751.1|  AAEL014845-PA                                      259   3e-78    
ref|XP_005841364.1|  heat shock protein Hsp90, cytosolic protein        262   3e-78    
ref|XP_729156.1|  heat shock 90 kDa protein                             251   3e-78    
gb|AEA42008.1|  heat shock protein 90                                   262   4e-78    
ref|XP_009029869.1|  hypothetical protein HELRODRAFT_158018             263   4e-78    
gb|ACA03524.1|  heat shock protein 90                                   262   4e-78    
gb|KDR11182.1|  Heat shock protein 83                                   262   5e-78    
ref|XP_008473647.1|  PREDICTED: heat shock protein 83-like              258   5e-78    
gb|AFN65689.1|  heat shock protein 90                                   262   5e-78    
gb|ACQ90225.1|  heat shock protein 90-1                                 262   5e-78    
ref|XP_009858093.1|  PREDICTED: heat shock protein HSP 90-beta          262   5e-78    
emb|CAC38753.1|  heat shock protein 90                                  262   6e-78    
ref|XP_008470814.1|  PREDICTED: heat shock protein 83                   262   6e-78    
ref|XP_003424204.1|  PREDICTED: heat shock protein 83                   262   6e-78    
emb|CEP16055.1|  hypothetical protein                                   261   6e-78    
dbj|BAE48212.1|  heat shock protein 90 beta                             251   6e-78    
gb|AFP54306.1|  heat shock protein 90                                   262   7e-78    
ref|XP_011250812.1|  PREDICTED: heat shock protein 83                   261   8e-78    
emb|CDJ60939.1|  heat shock protein 90, putative                        249   9e-78    
gb|ADL59936.1|  heat shock protein 90                                   261   1e-77    
ref|XP_007211089.1|  hypothetical protein PRUPE_ppa002509mg             260   1e-77    
ref|XP_002613491.1|  hypothetical protein BRAFLDRAFT_119839             261   1e-77    
ref|XP_005805661.1|  PREDICTED: heat shock protein HSP 90-alpha-like    261   1e-77    
gb|ACU00686.1|  heat shock protein 90                                   251   1e-77    
ref|XP_008483910.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    259   1e-77    
gb|AAM93756.1|  heat shock protein 90                                   259   1e-77    
ref|XP_001649752.1|  AAEL014843-PA                                      261   1e-77    
gb|EHJ74662.1|  heat shock protein 90                                   260   2e-77    
gb|ADE60732.1|  heat shock protein 90                                   260   2e-77    
ref|XP_003971590.1|  PREDICTED: heat shock protein HSP 90-alpha-like    261   2e-77    
gb|AHW57925.1|  heat shock protein 90                                   260   2e-77    
ref|XP_003704636.1|  PREDICTED: heat shock protein 83-like              260   2e-77    
ref|XP_011171324.1|  PREDICTED: heat shock protein 83                   260   2e-77    
gb|ACJ01642.1|  90 kDa heat shock protein                               260   2e-77    
gb|EGW01344.1|  Heat shock protein HSP 90-beta                          252   2e-77    
gb|AIY24626.1|  heat shock protein 90                                   260   2e-77    
ref|XP_008917763.1|  PREDICTED: heat shock protein HSP 90-alpha         255   3e-77    
gb|EXX78198.1|  Hsp90 family chaperone HSC82                            251   3e-77    
ref|XP_006793115.1|  PREDICTED: heat shock protein HSP 90-alpha-like    260   3e-77    
gb|ACE77780.1|  HSP90                                                   260   3e-77    
ref|XP_003440692.1|  PREDICTED: heat shock protein HSP 90-alpha-like    260   3e-77    
ref|XP_003725294.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    260   3e-77    
ref|XP_008216018.1|  PREDICTED: heat shock protein 83-like              258   3e-77    
ref|XP_004542147.1|  PREDICTED: heat shock protein HSP 90-alpha-l...    260   4e-77    
gb|ABB55881.1|  heat shock protein 90                                   251   4e-77    
ref|XP_008396615.1|  PREDICTED: heat shock protein HSP 90-alpha         260   4e-77    
gb|AAP51213.1|  90-kDa heat-shock protein                               259   4e-77    



>sp|P51819.1|HSP83_IPONI RecName: Full=Heat shock protein 83 [Ipomoea nil]
 gb|AAA33748.1| heat shock protein 83 [Ipomoea nil]
 prf||1909372A heat shock protein 83
Length=703

 Score =   378 bits (971),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 234/234 (100%), Positives = 234/234 (100%), Gaps = 0/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  456  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLEDDDEEEKKKREEKKKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC
Sbjct  516  KLVSATKEGLKLEDDDEEEKKKREEKKKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL
Sbjct  636  VKDLVLLLFETALLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  689



>emb|CAK22426.1| heat shock protein 83 [Beta vulgaris]
Length=350

 Score =   364 bits (934),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 216/234 (92%), Positives = 230/234 (98%), Gaps = 0/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  103  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  162

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKK SFENLCK+IKD+LGDKVEKVVVSDRIVDSPCC
Sbjct  163  KLVSATKEGLKLDDESEEEKKKKEEKKASFENLCKVIKDVLGDKVEKVVVSDRIVDSPCC  222

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSM +YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  223  LVTGEYGWSANMERIMKAQALRDSSMGAYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  282

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLV+LLFETALLTSGFSL+DPNTF ARIHRMLKLGLSI+E++AG+DADMPAL
Sbjct  283  VKDLVMLLFETALLTSGFSLEDPNTFAARIHRMLKLGLSIEEDDAGEDADMPAL  336



>ref|XP_004140753.1| PREDICTED: heat shock protein 83-like [Cucumis sativus]
 ref|XP_004157188.1| PREDICTED: heat shock protein 83-like [Cucumis sativus]
 gb|KGN57413.1| hypothetical protein Csa_3G183950 [Cucumis sativus]
Length=703

 Score =   368 bits (945),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 223/235 (95%), Positives = 229/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFENLCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCKTIKDILGDKVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM +YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDNSMGAYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTF ARIHRMLKLGLSIDEEE  GDDADMPAL
Sbjct  635  VKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEEENEGDDADMPAL  689



>ref|XP_008439282.1| PREDICTED: heat shock protein 83 [Cucumis melo]
Length=703

 Score =   366 bits (939),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 221/235 (94%), Positives = 229/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEY+GK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYEGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFENLCK IKDILGDKVEKVV+SDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCKTIKDILGDKVEKVVISDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM +YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDNSMGAYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTF ARIHRMLKLGLSIDEEE  GDDADMPAL
Sbjct  635  VKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEEENEGDDADMPAL  689



>gb|KDP22224.1| hypothetical protein JCGZ_26055 [Jatropha curcas]
Length=703

 Score =   365 bits (938),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 225/235 (96%), Positives = 229/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKKREEKKKSFENLCK IKDILGDKVEKVV+SDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEKKKREEKKKSFENLCKTIKDILGDKVEKVVISDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLV LLFETALLTSGFSLDDPNTF ARIHRMLKLGLSIDE+E  GDDADMPAL
Sbjct  635  VKDLVWLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEDETVGDDADMPAL  689



>gb|KCW90631.1| hypothetical protein EUGRSUZ_A02734 [Eucalyptus grandis]
Length=691

 Score =   365 bits (937),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 217/234 (93%), Positives = 225/234 (96%), Gaps = 0/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  444  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  503

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKKK+EEK KSFENLCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  504  KLVSATKEGLKLDEETEEEKKKKEEKIKSFENLCKTIKDILGDKVEKVVVSDRIVDSPCC  563

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM SYMSSKKTMEINPDNGIMEELRKRAEA+KNDKS
Sbjct  564  LVTGEYGWTANMERIMKAQALRDNSMGSYMSSKKTMEINPDNGIMEELRKRAEAEKNDKS  623

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDL +LLFETALLTSGFSLDDPNTF ARIHRMLKLGLSIDE  AGDDADMP L
Sbjct  624  VKDLTMLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEGAAGDDADMPPL  677



>ref|XP_010060433.1| PREDICTED: heat shock protein 83-like [Eucalyptus grandis]
 gb|KCW90632.1| hypothetical protein EUGRSUZ_A02734 [Eucalyptus grandis]
Length=704

 Score =   365 bits (938),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 217/234 (93%), Positives = 225/234 (96%), Gaps = 0/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  457  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKKK+EEK KSFENLCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  517  KLVSATKEGLKLDEETEEEKKKKEEKIKSFENLCKTIKDILGDKVEKVVVSDRIVDSPCC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM SYMSSKKTMEINPDNGIMEELRKRAEA+KNDKS
Sbjct  577  LVTGEYGWTANMERIMKAQALRDNSMGSYMSSKKTMEINPDNGIMEELRKRAEAEKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDL +LLFETALLTSGFSLDDPNTF ARIHRMLKLGLSIDE  AGDDADMP L
Sbjct  637  VKDLTMLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEGAAGDDADMPPL  690



>ref|XP_010671625.1| PREDICTED: heat shock protein 83 [Beta vulgaris subsp. vulgaris]
Length=703

 Score =   365 bits (937),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 216/234 (92%), Positives = 230/234 (98%), Gaps = 0/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  456  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKK SFENLCK+IKD+LGDKVEKVVVSDRIVDSPCC
Sbjct  516  KLVSATKEGLKLDDESEEEKKKKEEKKASFENLCKVIKDVLGDKVEKVVVSDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSM +YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  576  LVTGEYGWSANMERIMKAQALRDSSMGAYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLV+LLFETALLTSGFSL+DPNTF ARIHRMLKLGLSI+E++AG+DADMPAL
Sbjct  636  VKDLVMLLFETALLTSGFSLEDPNTFAARIHRMLKLGLSIEEDDAGEDADMPAL  689



>ref|XP_006372391.1| hypothetical protein POPTR_0017s01160g [Populus trichocarpa]
 gb|ERP50188.1| hypothetical protein POPTR_0017s01160g [Populus trichocarpa]
Length=703

 Score =   364 bits (934),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 224/235 (95%), Positives = 230/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFENLCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCKTIKDILGDKVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSIDE+E AGDD DMPAL
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEDEAAGDDTDMPAL  689



>ref|XP_009377558.1| PREDICTED: heat shock protein 83-like [Pyrus x bretschneideri]
 ref|XP_009377599.1| PREDICTED: heat shock protein 83-like [Pyrus x bretschneideri]
Length=703

 Score =   362 bits (928),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 221/235 (94%), Positives = 229/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKK +EEK+KSFENLCK +KDILGD+VEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEKKAKEEKRKSFENLCKTMKDILGDRVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSI+EEE  G+DADMPAL
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIEEEETGGEDADMPAL  689



>ref|XP_002305263.1| hypothetical protein POPTR_0004s07190g [Populus trichocarpa]
 gb|EEE85774.1| hypothetical protein POPTR_0004s07190g [Populus trichocarpa]
Length=703

 Score =   361 bits (927),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 222/235 (94%), Positives = 230/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFENLCK IKDILGD+VEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCKTIKDILGDRVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSL+DPNTF ARIHRMLKLGLSIDE+E AGDD DMPAL
Sbjct  635  VKDLVLLLFETALLTSGFSLEDPNTFAARIHRMLKLGLSIDEDEAAGDDTDMPAL  689



>gb|AAQ08597.1| heat shock protein [Hevea brasiliensis]
Length=698

 Score =   361 bits (926),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 224/235 (95%), Positives = 230/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  450  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  509

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFENLCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  510  KLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCKTIKDILGDKVEKVVVSDRIVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDN I+EELRKRAEADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNVIVEELRKRAEADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSID++E AGDDADMPAL
Sbjct  630  VKDLVLLLFETALLTSGFSLDDPNTFSARIHRMLKLGLSIDDDETAGDDADMPAL  684



>ref|XP_009368732.1| PREDICTED: heat shock protein 83 [Pyrus x bretschneideri]
Length=703

 Score =   361 bits (926),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 221/235 (94%), Positives = 229/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKK +EEKKKSFENLCK +KDILGD+VEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEKKAKEEKKKSFENLCKTMKDILGDRVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSI+EEE AGDD DMPAL
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIEEEETAGDDDDMPAL  689



>ref|XP_010089052.1| Heat shock protein 83 [Morus notabilis]
 gb|EXB37299.1| Heat shock protein 83 [Morus notabilis]
Length=703

 Score =   360 bits (924),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 221/235 (94%), Positives = 228/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEE+KK+EEKKKSFENLCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEEKKKEEKKKSFENLCKTIKDILGDKVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAE DKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEVDKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAG-DDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF +RIHRMLKLGLSIDE+EAG DD DMP L
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFASRIHRMLKLGLSIDEDEAGADDTDMPPL  689



>ref|XP_004516872.1| PREDICTED: heat shock protein 83-like [Cicer arietinum]
Length=699

 Score =   360 bits (923),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 219/235 (93%), Positives = 228/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  451  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFE+LC++IKDILGD+VEKVVVSDRIVDSPCC
Sbjct  511  KLVSATKEGLKLDDETEEEKKKKEEKKKSFEDLCRVIKDILGDRVEKVVVSDRIVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF +RIHRMLKLGLSIDE+E  GDD DMP L
Sbjct  631  VKDLVLLLFETALLTSGFSLDDPNTFASRIHRMLKLGLSIDEDETGGDDVDMPPL  685



>ref|XP_011035347.1| PREDICTED: heat shock protein 83-like isoform X2 [Populus euphratica]
Length=593

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 220/235 (94%), Positives = 230/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  345  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  404

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKKK+EEKKKSFENLCK IKDILGD+VEKVVVSDRIVDSPCC
Sbjct  405  KLVSATKEGLKLDEETEEEKKKKEEKKKSFENLCKTIKDILGDRVEKVVVSDRIVDSPCC  464

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  465  LVTGEYGWTANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  524

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSIDE+E AG+D DMPAL
Sbjct  525  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEDEAAGEDTDMPAL  579



>ref|XP_010089053.1| Heat shock protein 83 [Morus notabilis]
 gb|EXB37300.1| Heat shock protein 83 [Morus notabilis]
Length=701

 Score =   359 bits (921),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 221/235 (94%), Positives = 230/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSP LERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  454  YVTRMKEGQKDIYYITGESKKAVENSPLLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  513

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEK+K+EEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  514  KLVSATKEGLKLDDESEEEKQKKEEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  573

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  574  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  633

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLL+ETALLTSGFSLDDPNTF +RIHRML+LGLSIDE+E AGDDADMPAL
Sbjct  634  VKDLVLLLYETALLTSGFSLDDPNTFASRIHRMLRLGLSIDEDETAGDDADMPAL  688



>ref|XP_007220219.1| hypothetical protein PRUPE_ppa002187mg [Prunus persica]
 gb|EMJ21418.1| hypothetical protein PRUPE_ppa002187mg [Prunus persica]
Length=703

 Score =   359 bits (921),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 222/235 (94%), Positives = 231/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFE+LCK IKDILGD+VEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEKKKKEEKKKSFESLCKTIKDILGDRVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLS+D+EE AG+DADMPAL
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSLDDEETAGEDADMPAL  689



>ref|XP_011046024.1| PREDICTED: heat shock protein 83 [Populus euphratica]
Length=703

 Score =   359 bits (921),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 222/235 (94%), Positives = 230/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFENLCK IKDILG+KVEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCKTIKDILGEKVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSIDE+E AGDD DMPAL
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEDEAAGDDTDMPAL  689



>emb|CDP05141.1| unnamed protein product [Coffea canephora]
Length=705

 Score =   358 bits (919),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 222/235 (94%), Positives = 230/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVD IDEYAVGQLKEYDGK
Sbjct  457  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDTIDEYAVGQLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+DD EEE KK+EEKKKSFE+LCK+IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  517  KLVSATKEGLKLDDDSEEENKKKEEKKKSFEDLCKVIKDILGDKVEKVVVSDRIVDSPCC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  577  LVTGEYGWTANMERIMKAQALRDTSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDE-EEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSI+E ++AGDDADMPAL
Sbjct  637  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIEESDDAGDDADMPAL  691



>ref|XP_008376647.1| PREDICTED: heat shock protein 83 isoform X1 [Malus domestica]
 ref|XP_008376648.1| PREDICTED: heat shock protein 83 isoform X2 [Malus domestica]
Length=703

 Score =   358 bits (919),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 219/235 (93%), Positives = 227/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEK  +EEKKKSFENLCK +KDILGD+VEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEKAAKEEKKKSFENLCKTMKDILGDRVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNT  ARIHRMLKLGLSI+EEE  GDDADMPAL
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTXAARIHRMLKLGLSIEEEETGGDDADMPAL  689



>emb|CAN70887.1| hypothetical protein VITISV_005592 [Vitis vinifera]
Length=690

 Score =   357 bits (917),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 220/235 (94%), Positives = 226/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  442  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  501

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+  EEKKK+EEKKKSFE+LCK IKDILGDKVEKVVVS+RIVDSPCC
Sbjct  502  KLVSATKEGLKLEDETXEEKKKKEEKKKSFESLCKTIKDILGDKVEKVVVSERIVDSPCC  561

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM SYMSSKKTMEINPDN IMEELRKRAE DKNDKS
Sbjct  562  LVTGEYGWTANMERIMKAQALRDSSMGSYMSSKKTMEINPDNPIMEELRKRAEVDKNDKS  621

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFGARIHRMLKLGLSIDE+EA GDD +MP L
Sbjct  622  VKDLVLLLFETALLTSGFSLDDPNTFGARIHRMLKLGLSIDEDEAGGDDTEMPPL  676



>ref|XP_011035346.1| PREDICTED: heat shock protein 83-like isoform X1 [Populus euphratica]
Length=703

 Score =   358 bits (918),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 220/235 (94%), Positives = 230/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKKK+EEKKKSFENLCK IKDILGD+VEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDEETEEEKKKKEEKKKSFENLCKTIKDILGDRVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSIDE+E AG+D DMPAL
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEDEAAGEDTDMPAL  689



>ref|XP_004308051.1| PREDICTED: heat shock protein 83 [Fragaria vesca subsp. vesca]
Length=703

 Score =   357 bits (917),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 214/234 (91%), Positives = 226/234 (97%), Gaps = 0/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  457  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEK K+EEKKKSFENLCK IKDILGD+VEKVVVSDRIVDSPCC
Sbjct  517  KLVSATKEGLKLDDETEEEKTKKEEKKKSFENLCKTIKDILGDRVEKVVVSDRIVDSPCC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRD+SM +YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  577  LVTGEYGWSANMERIMKAQALRDNSMGAYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTF +RIHRMLKLGLSI+E+E  +DADMP L
Sbjct  637  VKDLVLLLFETALLTSGFSLDEPNTFASRIHRMLKLGLSIEEDETVEDADMPEL  690



>ref|XP_008380194.1| PREDICTED: heat shock protein 83-like [Malus domestica]
Length=703

 Score =   357 bits (916),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 220/235 (94%), Positives = 228/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKK +EEKKKSFENLCK +KDILGD+VEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEKKAKEEKKKSFENLCKTMKDILGDRVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSI+EEE  GDD DMPAL
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIEEEETGGDDTDMPAL  689



>ref|XP_003533977.1| PREDICTED: heat shock protein 83-like [Glycine max]
 gb|KHN42443.1| Heat shock protein 83 [Glycine soja]
Length=699

 Score =   356 bits (913),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 218/235 (93%), Positives = 227/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  451  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSF+ LCK+IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  511  KLVSATKEGLKLDDETEEEKKKKEEKKKSFDELCKVIKDILGDKVEKVVVSDRIVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  571  LVTGEYGWSANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF +RIHRMLKLGLSIDE++  GDD DMP L
Sbjct  631  VKDLVLLLFETALLTSGFSLDDPNTFASRIHRMLKLGLSIDEDDNGGDDVDMPPL  685



>ref|XP_004974995.1| PREDICTED: heat shock protein 82-like [Setaria italica]
Length=709

 Score =   356 bits (914),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 214/235 (91%), Positives = 229/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLK+KGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  461  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKRKGYEVLFMVDAIDEYAVGQLKEYDGK  520

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++DDEE KK+REE+KK FE+LCK+IK+ILGD+VEKVVVSDRIVDSPCC
Sbjct  521  KLVSATKEGLKLDEDDEEAKKRREERKKQFEDLCKVIKEILGDRVEKVVVSDRIVDSPCC  580

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS+YM+SKKTMEINPDNGIMEELRKRAEAD+NDKS
Sbjct  581  LVTGEYGWTANMERIMKAQALRDSSMSAYMASKKTMEINPDNGIMEELRKRAEADRNDKS  640

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAG-DDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTF ARIHRMLKLGL+IDEE A  DDADMPAL
Sbjct  641  VKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLKLGLNIDEEAAPEDDADMPAL  695



>gb|KDO56797.1| hypothetical protein CISIN_1g005370mg [Citrus sinensis]
Length=594

 Score =   353 bits (905),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 217/235 (92%), Positives = 228/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEY+GK
Sbjct  346  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYEGK  405

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFENLCK +KDILGD+VEKVVVSDRIVDSPCC
Sbjct  406  KLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCKTMKDILGDRVEKVVVSDRIVDSPCC  465

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  466  LVTGEYGWSANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  525

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDL +LLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSIDEEE  D D DMPAL
Sbjct  526  VKDLTMLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEEENADEDIDMPAL  580



>ref|XP_008234835.1| PREDICTED: heat shock protein 83 [Prunus mume]
Length=703

 Score =   356 bits (913),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 221/235 (94%), Positives = 230/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFE+LCK IKDILGD+VEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEKKKKEEKKKSFESLCKTIKDILGDRVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLS+D+EE A +DADMPAL
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSLDDEETAEEDADMPAL  689



>ref|XP_006401798.1| hypothetical protein EUTSA_v10012817mg [Eutrema salsugineum]
 gb|ESQ43251.1| hypothetical protein EUTSA_v10012817mg [Eutrema salsugineum]
Length=707

 Score =   355 bits (912),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 217/235 (92%), Positives = 227/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLE+LKK+GYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  459  YVTRMKEGQKDIFYITGESKKAVENSPFLEKLKKRGYEVLYMVDAIDEYAVGQLKEYDGK  518

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFENLCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  519  KLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCKTIKDILGDKVEKVVVSDRIVDSPCC  578

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  579  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  638

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTF ARIHRMLKLGLSIDE+E   +D DMPAL
Sbjct  639  VKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEDENVEEDGDMPAL  693



>dbj|BAJ34368.1| unnamed protein product [Thellungiella halophila]
Length=705

 Score =   355 bits (911),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 217/235 (92%), Positives = 227/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLE+LKK+GYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  457  YVTRMKEGQKDIFYITGESKKAVENSPFLEKLKKRGYEVLYMVDAIDEYAVGQLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFENLCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  517  KLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCKTIKDILGDKVEKVVVSDRIVDSPCC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  577  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTF ARIHRMLKLGLSIDE+E   +D DMPAL
Sbjct  637  VKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEDENVEEDGDMPAL  691



>ref|XP_009375529.1| PREDICTED: heat shock protein 83-like [Pyrus x bretschneideri]
Length=703

 Score =   355 bits (911),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 219/235 (93%), Positives = 228/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKK +EEK+KSFENLCK +KDIL D+VEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEKKAKEEKRKSFENLCKTMKDILEDRVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSI+EEE  G+DADMPAL
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIEEEETGGEDADMPAL  689



>ref|XP_007038814.1| Heat shock protein 90.1 isoform 2 [Theobroma cacao]
 ref|XP_007038815.1| Heat shock protein 90.1 isoform 2 [Theobroma cacao]
 gb|EOY23315.1| Heat shock protein 90.1 isoform 2 [Theobroma cacao]
 gb|EOY23316.1| Heat shock protein 90.1 isoform 2 [Theobroma cacao]
Length=542

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 221/235 (94%), Positives = 231/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDA+DEYAVGQ+KEYDGK
Sbjct  294  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAVDEYAVGQMKEYDGK  353

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEK+K+EEKKKSFE+LCK +KDILGDKVEKVVVSDRIVDSPCC
Sbjct  354  KLVSATKEGLKLEDESEEEKRKKEEKKKSFEDLCKTMKDILGDKVEKVVVSDRIVDSPCC  413

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  414  LVTGEYGWSANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  473

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFGARIHRMLKLGLSIDE+E  GDDADMPAL
Sbjct  474  VKDLVLLLFETALLTSGFSLDDPNTFGARIHRMLKLGLSIDEDETGGDDADMPAL  528



>ref|XP_006599549.1| PREDICTED: heat shock protein 83-like [Glycine max]
Length=699

 Score =   355 bits (910),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 216/235 (92%), Positives = 227/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  451  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+E+KKKSF+ LCK+IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  511  KLVSATKEGLKLDDETEEEKKKKEDKKKSFDELCKVIKEILGDKVEKVVVSDRIVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  571  LVTGEYGWSANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF +RIHRMLKLGLSIDE++  GDD DMP L
Sbjct  631  VKDLVLLLFETALLTSGFSLDDPNTFASRIHRMLKLGLSIDEDDNGGDDVDMPPL  685



>gb|KHN09298.1| Heat shock protein 83 [Glycine soja]
Length=699

 Score =   355 bits (910),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 216/235 (92%), Positives = 227/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  451  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+E+KKKSF+ LCK+IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  511  KLVSATKEGLKLDDETEEEKKKKEDKKKSFDELCKVIKEILGDKVEKVVVSDRIVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  571  LVTGEYGWSANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF +RIHRMLKLGLSIDE++  GDD DMP L
Sbjct  631  VKDLVLLLFETALLTSGFSLDDPNTFASRIHRMLKLGLSIDEDDNGGDDVDMPPL  685



>gb|KJB52728.1| hypothetical protein B456_008G274600 [Gossypium raimondii]
Length=703

 Score =   355 bits (910),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 220/235 (94%), Positives = 227/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGL LED+ EEEKKK+EEKKKSFE+LCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLNLEDETEEEKKKKEEKKKSFEDLCKTIKDILGDKVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF  RIHRMLKLGLSIDE+E  GDDADMP L
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFAGRIHRMLKLGLSIDEDETGGDDADMPTL  689



>gb|AAD30456.1|AF123259_1 heat shock protein 90 [Solanum lycopersicum]
Length=406

 Score =   345 bits (885),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 215/236 (91%), Positives = 226/236 (96%), Gaps = 2/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKE QKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYA+GQLKEYDGK
Sbjct  158  YVTRMKEVQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAIGQLKEYDGK  217

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVS TKEGLKL+D+ EEEKKK+EEKK+SFE+LCK+IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  218  KLVSVTKEGLKLDDESEEEKKKKEEKKQSFESLCKVIKDILGDKVEKVVVSDRIVDSPCC  277

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQAL+D+SMSSYMSS+KTMEINPDNGI+EELRKRAE DKNDKS
Sbjct  278  LVTGEYGWTANMERIMKAQALKDNSMSSYMSSEKTMEINPDNGIVEELRKRAEVDKNDKS  337

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSID-EEEAGDDA-DMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSID EEEAG D  DMP L
Sbjct  338  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEEEEAGVDVDDMPPL  393



>ref|XP_004308050.1| PREDICTED: heat shock protein 83-like [Fragaria vesca subsp. 
vesca]
Length=700

 Score =   354 bits (908),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 215/235 (91%), Positives = 227/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  453  YVTRMKEGQKDIFYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEK+K+EEKKKSFENLCK IKDILGD++EK VVSDRIVDSPCC
Sbjct  513  KLVSATKEGLKLDDETEEEKQKKEEKKKSFENLCKTIKDILGDRIEKAVVSDRIVDSPCC  572

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM SYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  573  LVTGEYGWTANMERIMKAQALRDNSMGSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  632

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAG-DDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF +RI+RMLKLGLSIDE+EA  +DADMP L
Sbjct  633  VKDLVLLLFETALLTSGFSLDDPNTFASRINRMLKLGLSIDEDEAAVEDADMPEL  687



>gb|KJB24311.1| hypothetical protein B456_004G138600 [Gossypium raimondii]
Length=704

 Score =   353 bits (907),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 216/235 (92%), Positives = 226/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  456  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ E+EKKKREEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  516  KLVSATKEGLKLDEESEDEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMS+YMSSKKTMEINPDNGIME LRKRAE DKNDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALRDNSMSAYMSSKKTMEINPDNGIMEALRKRAEVDKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLL+ETALLTSGFSLDDPNTF  RIHRMLKLGLSIDE+E A DD DMP+L
Sbjct  636  VKDLVLLLYETALLTSGFSLDDPNTFAGRIHRMLKLGLSIDEDETAVDDVDMPSL  690



>ref|XP_006422036.1| hypothetical protein CICLE_v10004456mg [Citrus clementina]
 ref|XP_006490631.1| PREDICTED: heat shock protein 83-like [Citrus sinensis]
 gb|ESR35276.1| hypothetical protein CICLE_v10004456mg [Citrus clementina]
Length=699

 Score =   353 bits (907),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 217/235 (92%), Positives = 228/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEY+GK
Sbjct  451  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFENLCK +KDILGD+VEKVVVSDRIVDSPCC
Sbjct  511  KLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCKTMKDILGDRVEKVVVSDRIVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  571  LVTGEYGWSANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDL +LLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSIDEEE  D D DMPAL
Sbjct  631  VKDLTMLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEEENADEDIDMPAL  685



>gb|ADF31754.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31763.1| heat shock protein 90 [Triticum aestivum]
Length=707

 Score =   353 bits (907),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 211/235 (90%), Positives = 228/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  459  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  518

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKK++EEKK +FE LCKIIKDILGDKVEKVVVSDRIVDSPCC
Sbjct  519  KLVSATKEGLKLDEETEEEKKRKEEKKAAFEGLCKIIKDILGDKVEKVVVSDRIVDSPCC  578

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINP+NGIMEELRKRA+ADKNDKS
Sbjct  579  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADKNDKS  638

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTF ARIHRMLKLGL+ID+++A  +DADMPAL
Sbjct  639  VKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLKLGLNIDDQDAEEEDADMPAL  693



>gb|KDO56796.1| hypothetical protein CISIN_1g005370mg [Citrus sinensis]
Length=699

 Score =   353 bits (906),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 217/235 (92%), Positives = 228/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEY+GK
Sbjct  451  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFENLCK +KDILGD+VEKVVVSDRIVDSPCC
Sbjct  511  KLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCKTMKDILGDRVEKVVVSDRIVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  571  LVTGEYGWSANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDL +LLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSIDEEE  D D DMPAL
Sbjct  631  VKDLTMLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEEENADEDIDMPAL  685



>ref|XP_010261331.1| PREDICTED: heat shock protein 83 [Nelumbo nucifera]
Length=703

 Score =   353 bits (906),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 223/235 (95%), Positives = 228/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDESEEEKKKKEEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAG-DDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF +RIHRMLKLGLSIDEEE G DD DMP L
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFASRIHRMLKLGLSIDEEETGADDTDMPPL  689



>gb|KEH26332.1| heat shock protein 81-2 [Medicago truncatula]
Length=699

 Score =   353 bits (905),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 214/235 (91%), Positives = 227/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  451  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFE+LC+++K+ILGDKVEKVVVSDRIVDSPCC
Sbjct  511  KLVSATKEGLKLDDETEEEKKKKEEKKKSFEDLCRVMKEILGDKVEKVVVSDRIVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSM+ YMSSKKTMEINPDNGIMEELRKR+EADKNDKS
Sbjct  571  LVTGEYGWSANMERIMKAQALRDSSMAGYMSSKKTMEINPDNGIMEELRKRSEADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAG-DDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTF  RIHRMLKLGLSIDE+E G DD DMP L
Sbjct  631  VKDLVLLLFETALLTSGFSLDEPNTFAGRIHRMLKLGLSIDEDETGADDVDMPPL  685



>ref|XP_010941080.1| PREDICTED: heat shock protein 83 [Elaeis guineensis]
Length=702

 Score =   352 bits (904),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 212/235 (90%), Positives = 228/235 (97%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KK+ E+K  +FE+LCK++KDILGD+VEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLEESEDEKKKREEKKA-AFESLCKVMKDILGDRVEKVVVSDRIVDSPCC  573

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINP+NGI+EELRKRAEADKNDKS
Sbjct  574  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPENGIIEELRKRAEADKNDKS  633

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+E AG+D DMPAL
Sbjct  634  VKDLVLLLFETALLTSGFSLDDPNTFGGRIHRMLKLGLSIDEDEAAGEDTDMPAL  688



>ref|XP_007038813.1| Heat shock protein 90.1 isoform 1 [Theobroma cacao]
 gb|EOY23314.1| Heat shock protein 90.1 isoform 1 [Theobroma cacao]
Length=703

 Score =   352 bits (903),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 221/235 (94%), Positives = 231/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDA+DEYAVGQ+KEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAVDEYAVGQMKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEK+K+EEKKKSFE+LCK +KDILGDKVEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLEDESEEEKRKKEEKKKSFEDLCKTMKDILGDKVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWSANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFGARIHRMLKLGLSIDE+E  GDDADMPAL
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFGARIHRMLKLGLSIDEDETGGDDADMPAL  689



>ref|XP_006476504.1| PREDICTED: heat shock protein 83-like [Citrus sinensis]
Length=701

 Score =   352 bits (903),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 216/235 (92%), Positives = 228/235 (97%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  454  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  513

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+D+EE+KK+ E+KK SFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  514  KLVSATKEGLKLEEDEEEKKKREEKKK-SFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  572

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAE DKNDKS
Sbjct  573  LVTGEYGWSANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEVDKNDKS  632

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLL+ETALLTSGFSLDDPNTF ARIHRMLKLGLSI+E+E AGDDA+MP L
Sbjct  633  VKDLVLLLYETALLTSGFSLDDPNTFAARIHRMLKLGLSIEEDETAGDDAEMPPL  687



>ref|XP_010035175.1| PREDICTED: heat shock protein 83 [Eucalyptus grandis]
 gb|KCW46468.1| hypothetical protein EUGRSUZ_K00295 [Eucalyptus grandis]
Length=700

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 221/235 (94%), Positives = 230/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  452  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  511

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKKKREEKKKSFENLCK +KDILGDKVEKVVVSDRIVDSPCC
Sbjct  512  KLVSATKEGLKLDEESEEEKKKREEKKKSFENLCKTMKDILGDKVEKVVVSDRIVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  572  LVTGEYGWSANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGF+LDDPNTF ARIHRMLKLGLSIDE+E AGDD DMPAL
Sbjct  632  VKDLVMLLFETALLTSGFNLDDPNTFAARIHRMLKLGLSIDEDETAGDDVDMPAL  686



>dbj|BAA00615.1| 81kDa heat-shock protein [Arabidopsis thaliana]
Length=700

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 216/235 (92%), Positives = 226/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLERLKK+GYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  452  YVTRMKEGQKDIFYITGESKKAVENSPFLERLKKRGYEVLYMVDAIDEYAVGQLKEYDGK  511

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKKREEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  512  KLVSATKEGLKLEDETEEEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LL+ETALLTSGFSLD+PNTF ARIHRMLKLGLSIDE+E   +D DMP L
Sbjct  632  VKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEEDGDMPEL  686



>gb|AAA32822.1| heat shock protein 83 [Arabidopsis thaliana]
Length=705

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 216/235 (92%), Positives = 226/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLERLKK+GYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  457  YVTRMKEGQKDIFYITGESKKAVENSPFLERLKKRGYEVLYMVDAIDEYAVGQLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKKREEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  517  KLVSATKEGLKLEDETEEEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  577  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LL+ETALLTSGFSLD+PNTF ARIHRMLKLGLSIDE+E   +D DMP L
Sbjct  637  VKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEEDGDMPEL  691



>sp|P27323.3|HS901_ARATH RecName: Full=Heat shock protein 90-1; Short=AtHSP90.1; AltName: 
Full=Heat shock protein 81-1; Short=HSP81-1; AltName: Full=Heat 
shock protein 83 [Arabidopsis thaliana]
Length=700

 Score =   351 bits (901),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 216/235 (92%), Positives = 226/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLERLKK+GYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  452  YVTRMKEGQKDIFYITGESKKAVENSPFLERLKKRGYEVLYMVDAIDEYAVGQLKEYDGK  511

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKKREEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  512  KLVSATKEGLKLEDETEEEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LL+ETALLTSGFSLD+PNTF ARIHRMLKLGLSIDE+E   +D DMP L
Sbjct  632  VKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEEDGDMPEL  686



>ref|NP_200076.1| heat shock protein 90.1 [Arabidopsis thaliana]
 dbj|BAA98082.1| heat-shock protein [Arabidopsis thaliana]
 gb|AAM91104.1| AT5g52640/F6N7_13 [Arabidopsis thaliana]
 gb|AAN46890.1| At5g52640/F6N7_13 [Arabidopsis thaliana]
 gb|AED96244.1| heat shock protein 90.1 [Arabidopsis thaliana]
Length=705

 Score =   351 bits (901),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 216/235 (92%), Positives = 226/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLERLKK+GYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  457  YVTRMKEGQKDIFYITGESKKAVENSPFLERLKKRGYEVLYMVDAIDEYAVGQLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKKREEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  517  KLVSATKEGLKLEDETEEEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  577  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LL+ETALLTSGFSLD+PNTF ARIHRMLKLGLSIDE+E   +D DMP L
Sbjct  637  VKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEEDGDMPEL  691



>prf||1908431A heat shock protein HSP81-1
Length=705

 Score =   351 bits (901),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 216/235 (92%), Positives = 226/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLERLKK+GYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  457  YVTRMKEGQKDIFYITGESKKAVENSPFLERLKKRGYEVLYMVDAIDEYAVGQLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKKREEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  517  KLVSATKEGLKLEDETEEEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  577  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LL+ETALLTSGFSLD+PNTF ARIHRMLKLGLSIDE+E   +D DMP L
Sbjct  637  VKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEEDGDMPEL  691



>gb|EMS66149.1| Heat shock protein 83 [Triticum urartu]
Length=658

 Score =   350 bits (897),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 210/235 (89%), Positives = 227/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  410  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  469

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKK+REEKK +FE LCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  470  KLVSATKEGLKLDEETEEEKKRREEKKAAFEGLCKTIKDILGDKVEKVVVSDRIVDSPCC  529

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINP+NGIMEELRKRA+ADKNDKS
Sbjct  530  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADKNDKS  589

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLV+LLFETALLTSGFSL+DPNTF ARIHRMLKLGL+ID+++A  +DADMPAL
Sbjct  590  VKDLVMLLFETALLTSGFSLEDPNTFAARIHRMLKLGLNIDDQDAEEEDADMPAL  644



>sp|P36182.1|HSP82_TOBAC RecName: Full=Heat shock protein 82, partial [Nicotiana tabacum]
 emb|CAA44877.1| heat shock protein 82 [Nicotiana tabacum]
Length=499

 Score =   345 bits (884),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 226/235 (96%), Positives = 231/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  252  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  311

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+DD EEEKKK+EEKKKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC
Sbjct  312  KLVSATKEGLKLDDDSEEEKKKKEEKKKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  371

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  372  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  431

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI-DEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSI +EEEA +DADMPAL
Sbjct  432  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEEEEAVEDADMPAL  486



>gb|KDO76323.1| hypothetical protein CISIN_1g005321mg [Citrus sinensis]
Length=702

 Score =   351 bits (900),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 216/235 (92%), Positives = 227/235 (97%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+DDEE+KK+ E+KK SFENLCK IK+ILGD VEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLEEDDEEKKKREEKKK-SFENLCKTIKEILGDNVEKVVVSDRIVDSPCC  573

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAE DKNDKS
Sbjct  574  LVTGEYGWSANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEVDKNDKS  633

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLL+ETALLTSGFSLDDPNTF ARIHRMLKLGLSI+E+E AGDDA+MP L
Sbjct  634  VKDLVLLLYETALLTSGFSLDDPNTFAARIHRMLKLGLSIEEDETAGDDAEMPPL  688



>gb|EYU25148.1| hypothetical protein MIMGU_mgv1a002213mg [Erythranthe guttata]
Length=700

 Score =   350 bits (898),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 217/236 (92%), Positives = 229/236 (97%), Gaps = 2/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  451  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKK+EEKKK+FE+LCK+IKDILGD+VEKVVVSDRIVDSPCC
Sbjct  511  KLVSATKEGLKLEDETEEEKKKKEEKKKAFESLCKVIKDILGDRVEKVVVSDRIVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM SYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDSSMGSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSID--EEEAGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTF +RIHRMLKLGLSID  EEE+G+D +MP L
Sbjct  631  VKDLVMLLFETALLTSGFSLDDPNTFASRIHRMLKLGLSIDEVEEESGEDVEMPGL  686



>ref|XP_002278894.1| PREDICTED: heat shock protein 83 [Vitis vinifera]
Length=703

 Score =   350 bits (898),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 221/235 (94%), Positives = 227/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKK+EEKKKSFE+LCK IKDILGDKVEKVVVS+RIVDSPCC
Sbjct  515  KLVSATKEGLKLEDETEEEKKKKEEKKKSFESLCKTIKDILGDKVEKVVVSERIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM SYMSSKKTMEINPDN IMEELRKRAE DKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDSSMGSYMSSKKTMEINPDNPIMEELRKRAEVDKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFGARIHRMLKLGLSIDE+EA GDD +MP L
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFGARIHRMLKLGLSIDEDEAGGDDTEMPPL  689



>gb|ADF31778.1| heat shock protein 90 [Triticum dicoccoides]
Length=712

 Score =   350 bits (897),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 209/235 (89%), Positives = 227/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  464  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  523

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKK++EEKK +FE LCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  524  KLVSATKEGLKLDEETEEEKKRKEEKKAAFEGLCKTIKDILGDKVEKVVVSDRIVDSPCC  583

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINP+NGIMEELRKRA+ADKNDKS
Sbjct  584  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADKNDKS  643

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLV+LLFETALLTSGFSL+DPNTF ARIHRMLKLGL+ID+++A  +DADMPAL
Sbjct  644  VKDLVMLLFETALLTSGFSLEDPNTFAARIHRMLKLGLNIDDQDAEEEDADMPAL  698



>ref|XP_009628903.1| PREDICTED: heat shock protein 83-like [Nicotiana tomentosiformis]
Length=703

 Score =   350 bits (897),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 211/235 (90%), Positives = 226/235 (96%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEG+KDIYYITGESKKAVENSPFLE+LKK+GYEVLFMVDAIDEYA+GQLKEYDGK
Sbjct  456  YVTRMKEGRKDIYYITGESKKAVENSPFLEKLKKRGYEVLFMVDAIDEYAIGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ +EE++KK E+KK SFENLCK+IKDILGD+VEKVVVSDRIVDSPCC
Sbjct  516  KLVSATKEGLKLEETEEEKQKKEEKKK-SFENLCKVIKDILGDRVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS+YMSSKKTMEINPDNGIMEELRKRAE DKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDSSMSAYMSSKKTMEINPDNGIMEELRKRAEVDKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPN F ARIHRMLKLGLSI+E+EA GDD +MP L
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNAFAARIHRMLKLGLSIEEDEASGDDTEMPVL  689



>gb|ADF31772.1| heat shock protein 90 [Triticum urartu]
Length=712

 Score =   350 bits (897),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 210/235 (89%), Positives = 227/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  464  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  523

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKK+REEKK +FE LCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  524  KLVSATKEGLKLDEETEEEKKRREEKKAAFEGLCKTIKDILGDKVEKVVVSDRIVDSPCC  583

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINP+NGIMEELRKRA+ADKNDKS
Sbjct  584  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADKNDKS  643

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLV+LLFETALLTSGFSL+DPNTF ARIHRMLKLGL+ID+++A  +DADMPAL
Sbjct  644  VKDLVMLLFETALLTSGFSLEDPNTFAARIHRMLKLGLNIDDQDAEEEDADMPAL  698



>gb|EMT27103.1| Heat shock protein 83 [Aegilops tauschii]
Length=679

 Score =   348 bits (894),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 209/236 (89%), Positives = 225/236 (95%), Gaps = 2/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  430  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  489

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKK++EEKK +FE LCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  490  KLVSATKEGLKLDEETEEEKKRKEEKKAAFEGLCKTIKDILGDKVEKVVVSDRIVDSPCC  549

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINP+NGIMEELRKRA+ADKNDKS
Sbjct  550  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADKNDKS  609

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAG--DDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTF ARIHRMLKLGL+ID++     +DADMPAL
Sbjct  610  VKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLKLGLNIDDQADAEEEDADMPAL  665



>ref|XP_010934626.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
 ref|XP_010934627.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=702

 Score =   349 bits (896),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 206/235 (88%), Positives = 225/235 (96%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKE QKDIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEDQKDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLK+++ ++E+K+K E+K  +FE+LCK++KDILGDKVEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKIDESEDEKKRKEEKKA-AFESLCKVMKDILGDKVEKVVVSDRIVDSPCC  573

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQAL+D+SM SYMSSKKTMEINP+NGIMEE+RKRAEADKNDKS
Sbjct  574  LVTGEYGWTANMERIMKAQALKDNSMGSYMSSKKTMEINPENGIMEEMRKRAEADKNDKS  633

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETA+LTSGFSLDDPNTF  RIHRMLKLGLSIDE+E AGDD DMPAL
Sbjct  634  VKDLVLLLFETAILTSGFSLDDPNTFAGRIHRMLKLGLSIDEDEAAGDDTDMPAL  688



>ref|XP_010276895.1| PREDICTED: heat shock protein 83-like [Nelumbo nucifera]
Length=701

 Score =   349 bits (895),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 215/235 (91%), Positives = 222/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  454  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  513

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EE+KKK E+ K   E+LCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  514  KLVSATKEGLKLDDESEEKKKKEEKNKSF-ESLCKTIKEILGDKVEKVVVSDRIVDSPCC  572

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  573  LVTGEYGWTANMERIMKAQALRDNSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  632

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSIDEEE A DD DMP L
Sbjct  633  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEEETAADDTDMPPL  687



>gb|ADF31775.1| heat shock protein 90 [Aegilops tauschii]
Length=713

 Score =   348 bits (894),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 209/236 (89%), Positives = 225/236 (95%), Gaps = 2/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  464  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  523

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKK++EEKK +FE LCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  524  KLVSATKEGLKLDEETEEEKKRKEEKKAAFEGLCKTIKDILGDKVEKVVVSDRIVDSPCC  583

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINP+NGIMEELRKRA+ADKNDKS
Sbjct  584  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADKNDKS  643

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAG--DDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTF ARIHRMLKLGL+ID++     +DADMPAL
Sbjct  644  VKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLKLGLNIDDQADAEEEDADMPAL  699



>ref|XP_008797179.1| PREDICTED: heat shock protein 83-like [Phoenix dactylifera]
Length=701

 Score =   348 bits (893),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 208/234 (89%), Positives = 224/234 (96%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQK+IYYITGESKKAVENSPFLE+LK+KGYEVLFMVDAIDEYAV QLKEYDGK
Sbjct  455  YVTRMKEGQKEIYYITGESKKAVENSPFLEKLKRKGYEVLFMVDAIDEYAVTQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED +EE+KKK E+K  +FE LCK++KDILGD+VEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLEDSEEEKKKKEEKKA-AFEPLCKVMKDILGDRVEKVVVSDRIVDSPCC  573

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDS+MS+YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  574  LVTGEYGWTANMERIMKAQALRDSTMSAYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  633

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF  RIHRMLKLGL+IDE+E G+DA+MP L
Sbjct  634  VKDLVLLLFETALLTSGFSLDDPNTFAGRIHRMLKLGLNIDEDETGEDAEMPTL  687



>gb|ADF31756.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31765.1| heat shock protein 90 [Triticum aestivum]
Length=713

 Score =   348 bits (894),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 209/236 (89%), Positives = 225/236 (95%), Gaps = 2/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  464  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  523

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKK++EEKK +FE LCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  524  KLVSATKEGLKLDEETEEEKKRKEEKKAAFEGLCKTIKDILGDKVEKVVVSDRIVDSPCC  583

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINP+NGIMEELRKRA+ADKNDKS
Sbjct  584  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADKNDKS  643

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAG--DDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTF ARIHRMLKLGL+ID++     +DADMPAL
Sbjct  644  VKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLKLGLNIDDQADAEEEDADMPAL  699



>ref|XP_009791186.1| PREDICTED: heat shock protein 83-like, partial [Nicotiana sylvestris]
Length=658

 Score =   347 bits (889),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 207/235 (88%), Positives = 226/235 (96%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVT MKEGQKDIYYITGESKKAVENSPFLE+LKK+GYEVL+MVDAIDEYA+GQLKEYDGK
Sbjct  411  YVTSMKEGQKDIYYITGESKKAVENSPFLEKLKKRGYEVLYMVDAIDEYAIGQLKEYDGK  470

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGL+LE+ +EE++KK+E+KK SFENLCK+IKDILGD+VEKVVVSDRIVDSPCC
Sbjct  471  KLVSATKEGLELEETEEEKQKKKEKKK-SFENLCKVIKDILGDRVEKVVVSDRIVDSPCC  529

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS+YMSSKKTMEINPDNGIMEELRKRAE DKNDKS
Sbjct  530  LVTGEYGWTANMERIMKAQALRDSSMSAYMSSKKTMEINPDNGIMEELRKRAEVDKNDKS  589

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLVLLL+ETALLTSGFSLDDPN F ARIHRMLKLGLS++E+EA GDD +MP L
Sbjct  590  VKDLVLLLYETALLTSGFSLDDPNAFAARIHRMLKLGLSVEEDEASGDDTEMPVL  644



>gb|AIZ68157.1| heat shock protein 83 [Ornithogalum saundersiae]
Length=701

 Score =   348 bits (892),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 211/235 (90%), Positives = 225/235 (96%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  454  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  513

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGL+LED +EE+K+K E+K  +FE LCK +K+ILGDKVEKVVVSDRIVDSPCC
Sbjct  514  KLVSATKEGLQLEDTEEEKKRKEEKKA-AFEGLCKTMKEILGDKVEKVVVSDRIVDSPCC  572

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINP+NGIMEELRKRAEADKNDKS
Sbjct  573  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPENGIMEELRKRAEADKNDKS  632

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGFSL+DPNTF  RIHRMLKLGLSI+E+E AGDD DMPAL
Sbjct  633  VKDLVMLLFETALLTSGFSLEDPNTFAGRIHRMLKLGLSIEEDETAGDDTDMPAL  687



>ref|XP_007040338.1| Heat shock protein 90.1 [Theobroma cacao]
 gb|EOY24839.1| Heat shock protein 90.1 [Theobroma cacao]
Length=705

 Score =   348 bits (892),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 211/234 (90%), Positives = 225/234 (96%), Gaps = 2/234 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKK+GYEVLF+V+AIDEYAVGQLKEYDGK
Sbjct  456  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKRGYEVLFLVEAIDEYAVGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKK++EEKKKSFENLCK IK+ILGD+VEKVVVSDRIVDSPCC
Sbjct  516  KLVSATKEGLKLDEESEEEKKEKEEKKKSFENLCKTIKEILGDRVEKVVVSDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMS+YMSSKKTMEINPDNGIMEELRKR E DKNDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALRDNSMSAYMSSKKTMEINPDNGIMEELRKRVEVDKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE--AGDDADMP  148
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSIDE+E  A DD DMP
Sbjct  636  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEDETAAADDIDMP  689



>ref|XP_006439485.1| hypothetical protein CICLE_v10019095mg [Citrus clementina]
 gb|ESR52725.1| hypothetical protein CICLE_v10019095mg [Citrus clementina]
Length=702

 Score =   348 bits (892),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 215/235 (91%), Positives = 226/235 (96%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+DDEE+KK+ E+KK SFENLCK IK+ILGD VEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLEEDDEEKKKREEKKK-SFENLCKTIKEILGDNVEKVVVSDRIVDSPCC  573

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAE DKNDKS
Sbjct  574  LVTGEYGWSANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEVDKNDKS  633

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLL+ETALLTSGFSLDDPNTF ARIHRMLKLGLSI+E+E A DDA+MP L
Sbjct  634  VKDLVLLLYETALLTSGFSLDDPNTFAARIHRMLKLGLSIEEDETADDDAEMPPL  688



>prf||1710352A heat shock protein 83
Length=705

 Score =   347 bits (891),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 215/235 (91%), Positives = 225/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLERLKK+GYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  457  YVTRMKEGQKDIFYITGESKKAVENSPFLERLKKRGYEVLYMVDAIDEYAVGQLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKKREEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSP C
Sbjct  517  KLVSATKEGLKLEDETEEEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPSC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  577  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LL+ETALLTSGFSLD+PNTF ARIHRMLKLGLSIDE+E   +D DMP L
Sbjct  637  VKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEEDGDMPEL  691



>ref|XP_004240717.1| PREDICTED: heat shock protein 83-like [Solanum lycopersicum]
Length=704

 Score =   347 bits (891),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 218/236 (92%), Positives = 227/236 (96%), Gaps = 2/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYA+GQLKEYDGK
Sbjct  456  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAIGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVS TKEGLKL+D+ EEEKKK+EEKK+SFE+LCK+IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  516  KLVSVTKEGLKLDDESEEEKKKKEEKKQSFESLCKVIKDILGDKVEKVVVSDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQAL+D+SMSSYMSSKKTMEINPDNGIMEELRKRAE DKNDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALKDNSMSSYMSSKKTMEINPDNGIMEELRKRAEVDKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSID-EEEAGDDA-DMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSID EEEAG D  DMP L
Sbjct  636  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEEEEAGVDVDDMPPL  691



>ref|XP_002864186.1| heat shock protein 81-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40445.1| heat shock protein 81-1 [Arabidopsis lyrata subsp. lyrata]
Length=705

 Score =   347 bits (891),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 215/235 (91%), Positives = 225/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLE+LKK+GYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  457  YVTRMKEGQKDIFYITGESKKAVENSPFLEKLKKRGYEVLYMVDAIDEYAVGQLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKKREEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  517  KLVSATKEGLKLEDETEEEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  577  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLD+PNTF ARIHRMLKLGLSIDE+E   +D  MP L
Sbjct  637  VKDLVMLLFETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEEDGAMPEL  691



>ref|XP_011076104.1| PREDICTED: heat shock protein 83 [Sesamum indicum]
Length=698

 Score =   347 bits (891),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 221/234 (94%), Positives = 231/234 (99%), Gaps = 0/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  451  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFE+LCK+IKDILGDKVEKVV+SDRIVDSPCC
Sbjct  511  KLVSATKEGLKLDDETEEEKKKKEEKKKSFESLCKVIKDILGDKVEKVVISDRIVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF +RIHRMLKLGLSIDE+EA +DADMPAL
Sbjct  631  VKDLVLLLFETALLTSGFSLDDPNTFASRIHRMLKLGLSIDEDEAAEDADMPAL  684



>ref|XP_009413748.1| PREDICTED: heat shock protein 83 [Musa acuminata subsp. malaccensis]
Length=702

 Score =   347 bits (891),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 212/235 (90%), Positives = 224/235 (95%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQTDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ +EE+K+K E+K  +FE+LCK +K+ILGDKVEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLEETEEEKKRKEEKKA-AFESLCKTMKEILGDKVEKVVVSDRIVDSPCC  573

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINP+NGIMEELRKRAEADKNDKS
Sbjct  574  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPENGIMEELRKRAEADKNDKS  633

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLVLLLFETALLTSGFSL+DPNTF  RIHRMLKLGL+IDE EA GDD DMPAL
Sbjct  634  VKDLVLLLFETALLTSGFSLEDPNTFAGRIHRMLKLGLNIDEGEAGGDDTDMPAL  688



>ref|XP_010934628.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=701

 Score =   347 bits (890),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 206/234 (88%), Positives = 224/234 (96%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQK+IYYITGESKKAVENSPFLE+LK+KGYEVLFMVDAIDEY V QLKEYDGK
Sbjct  455  YVTRMKEGQKEIYYITGESKKAVENSPFLEKLKRKGYEVLFMVDAIDEYVVTQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED +EE+KKK E+K  +FE LCK++KDILGD+VEKVVVS+RIVDSPCC
Sbjct  515  KLVSATKEGLKLEDSEEEKKKKEEKKA-AFEPLCKVMKDILGDRVEKVVVSERIVDSPCC  573

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS+YMSSKKTMEINPDNGIM+ELRKRAEADKNDKS
Sbjct  574  LVTGEYGWTANMERIMKAQALRDSSMSAYMSSKKTMEINPDNGIMDELRKRAEADKNDKS  633

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLV+LL+ETALLTSGFSLDDPNTF  RIHRMLKLGL+IDEEE G+DA+MPAL
Sbjct  634  VKDLVMLLYETALLTSGFSLDDPNTFAGRIHRMLKLGLNIDEEETGEDAEMPAL  687



>ref|XP_011084460.1| PREDICTED: heat shock protein 83-like [Sesamum indicum]
Length=703

 Score =   347 bits (890),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 222/234 (95%), Positives = 231/234 (99%), Gaps = 0/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  456  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFE+LCK++KDILGDKVEKVV+SDRIVDSPCC
Sbjct  516  KLVSATKEGLKLDDETEEEKKKKEEKKKSFESLCKVMKDILGDKVEKVVISDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF +RIHRMLKLGLSIDE+E GDDADMPAL
Sbjct  636  VKDLVLLLFETALLTSGFSLDDPNTFASRIHRMLKLGLSIDEDEGGDDADMPAL  689



>ref|XP_009768512.1| PREDICTED: heat shock protein 82 [Nicotiana sylvestris]
Length=703

 Score =   347 bits (889),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 226/235 (96%), Positives = 231/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  456  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+DD EEEKKK+EEKKKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC
Sbjct  516  KLVSATKEGLKLDDDSEEEKKKKEEKKKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI-DEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSI +EEEA +DADMPAL
Sbjct  636  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEEEEAVEDADMPAL  690



>ref|XP_009607669.1| PREDICTED: heat shock protein 82 [Nicotiana tomentosiformis]
Length=703

 Score =   346 bits (887),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 225/235 (96%), Positives = 231/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  456  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+DD EEEKKK+EEKKKSFENLCKIIKDILGD+VEKVVVSDRIVDSPCC
Sbjct  516  KLVSATKEGLKLDDDSEEEKKKKEEKKKSFENLCKIIKDILGDRVEKVVVSDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI-DEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSI +EEEA +DADMPAL
Sbjct  636  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEEEEAVEDADMPAL  690



>ref|XP_011080917.1| PREDICTED: heat shock protein 83-like [Sesamum indicum]
Length=704

 Score =   345 bits (886),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 218/235 (93%), Positives = 228/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  456  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEK+K+EEKKKSFENLCK+IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  516  KLVSATKEGLKLDEESEEEKEKKEEKKKSFENLCKVIKDILGDKVEKVVVSDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS+YMSSKKTMEINPDNGIMEELRKRAE DKNDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALRDSSMSAYMSSKKTMEINPDNGIMEELRKRAEVDKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI-DEEEAGDDADMPAL  142
            VKDLVLLL+ETALLTSGFSLDDPNTF ARIHRMLKLGLSI D+E A DD +MPAL
Sbjct  636  VKDLVLLLYETALLTSGFSLDDPNTFAARIHRMLKLGLSIDDDETATDDTEMPAL  690



>dbj|BAJ85535.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score =   346 bits (887),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 206/236 (87%), Positives = 225/236 (95%), Gaps = 2/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  467  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  526

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKK++EEKK +FE LCK IKDILGD+VEKVVVSDRIVDSPCC
Sbjct  527  KLVSATKEGLKLDEETEEEKKRKEEKKAAFEGLCKTIKDILGDRVEKVVVSDRIVDSPCC  586

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINP+NGIMEELRKRA+ADKNDKS
Sbjct  587  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADKNDKS  646

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAG--DDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTF ARIHRML+LGL+ID++     +DADMP+L
Sbjct  647  VKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLRLGLNIDDQADAEEEDADMPSL  702



>emb|CDY27839.1| BnaC09g28660D [Brassica napus]
Length=705

 Score =   345 bits (885),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 216/235 (92%), Positives = 226/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLE+LKK+GYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  457  YVTRMKEGQKDIFYITGESKKAVENSPFLEKLKKRGYEVLYMVDAIDEYAVGQLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKK+EEKKKSFENLCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  517  KLVSATKEGLKLEDETEEEKKKKEEKKKSFENLCKTIKDILGDKVEKVVVSDRIVDSPCC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAE DKNDKS
Sbjct  577  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEVDKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLD+PNTF ARIHRMLKLGLSIDE+E   +D DMPAL
Sbjct  637  VKDLVMLLFETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEEDGDMPAL  691



>ref|XP_008801780.1| PREDICTED: heat shock protein 83 [Phoenix dactylifera]
Length=703

 Score =   345 bits (885),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 210/236 (89%), Positives = 225/236 (95%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E+K  +FE+LCK++KDILGDKVEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLEESEDEKKKKEEKKA-AFESLCKVMKDILGDKVEKVVVSDRIVDSPCC  573

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+ MSSYMSSKKTMEINP+NGIMEELRKRAEADKNDKS
Sbjct  574  LVTGEYGWTANMERIMKAQALRDNGMSSYMSSKKTMEINPENGIMEELRKRAEADKNDKS  633

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSL+DPNTF  RIHRMLKLGLSIDE+E AGD D D+P L
Sbjct  634  VKDLVLLLFETALLTSGFSLEDPNTFAGRIHRMLKLGLSIDEDEAAGDGDTDLPDL  689



>ref|XP_002513649.1| heat shock protein, putative [Ricinus communis]
 gb|EEF49052.1| heat shock protein, putative [Ricinus communis]
Length=703

 Score =   343 bits (880),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 224/235 (95%), Positives = 231/235 (98%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFENLCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCKTIKDILGDKVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDNSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI-DEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSI ++E+AGDDADMPAL
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEDEDAGDDADMPAL  689



>gb|ADF31779.1| heat shock protein 90 [Triticum dicoccoides]
Length=712

 Score =   343 bits (880),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 207/234 (88%), Positives = 222/234 (95%), Gaps = 3/234 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  462  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  521

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKK+REEKK +FE LCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  522  KLVSATKEGLKLDEETEEEKKRREEKKAAFEGLCKTIKDILGDKVEKVVVSDRIVDSPCC  581

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINP+NGIMEELRKRA+AD+NDKS
Sbjct  582  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADRNDKS  641

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAG---DDADM  151
            VKDLV+LLFETALLTSGFSLDDPNTF ARIHRMLKLGL+ID+   G   +DADM
Sbjct  642  VKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLKLGLNIDDSAGGAEEEDADM  695



>ref|XP_004234218.1| PREDICTED: heat shock protein 83 [Solanum lycopersicum]
Length=704

 Score =   342 bits (876),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 213/220 (97%), Positives = 218/220 (99%), Gaps = 0/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  456  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+DD EEEKKK+EEKKKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC
Sbjct  516  KLVSATKEGLKLDDDSEEEKKKKEEKKKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEAD+NDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALRDTSMSSYMSSKKTMEINPDNGIMEELRKRAEADQNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSI
Sbjct  636  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSI  675



>ref|XP_006362664.1| PREDICTED: heat shock protein 83-like [Solanum tuberosum]
Length=704

 Score =   342 bits (876),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 213/220 (97%), Positives = 218/220 (99%), Gaps = 0/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  456  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+DD EEEKKK+EEKKKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC
Sbjct  516  KLVSATKEGLKLDDDSEEEKKKKEEKKKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMSSYMSSKKTMEINPDNGIMEELRKRAEAD+NDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALRDTSMSSYMSSKKTMEINPDNGIMEELRKRAEADQNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSI
Sbjct  636  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSI  675



>emb|CAA68885.1| heat shock protein 90A [Arabidopsis thaliana]
Length=704

 Score =   342 bits (876),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 214/235 (91%), Positives = 225/235 (96%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENS FLERLKK+GYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  457  YVTRMKEGQKDIFYITGESKKAVENS-FLERLKKRGYEVLYMVDAIDEYAVGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKKREEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  516  KLVSATKEGLKLEDETEEEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIME+LRKRAEADKNDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEDLRKRAEADKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LL+ETALLTSGFSLD+PNTF ARIHRMLKLGLSIDE+E   +D DMP L
Sbjct  636  VKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEEDGDMPEL  690



>ref|XP_002447413.1| hypothetical protein SORBIDRAFT_06g000660 [Sorghum bicolor]
 gb|EES11741.1| hypothetical protein SORBIDRAFT_06g000660 [Sorghum bicolor]
Length=716

 Score =   342 bits (877),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 216/235 (92%), Positives = 228/235 (97%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  468  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  527

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+DDDEE KK+REE+KK FE+LCK+IKDILGD+VEKVVVSDRIVDSPCC
Sbjct  528  KLVSATKEGLKLDDDDEEAKKRREERKKQFEDLCKVIKDILGDRVEKVVVSDRIVDSPCC  587

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS+YMSSKKTMEINPDNGIMEELRKRAEAD+NDKS
Sbjct  588  LVTGEYGWTANMERIMKAQALRDSSMSAYMSSKKTMEINPDNGIMEELRKRAEADRNDKS  647

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI-DEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGL+I ++  A +DADMPAL
Sbjct  648  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLNIDEDAAADEDADMPAL  702



>gb|ADF31755.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31764.1| heat shock protein 90 [Triticum aestivum]
Length=712

 Score =   341 bits (875),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 206/234 (88%), Positives = 222/234 (95%), Gaps = 3/234 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLK++GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  462  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKRRGYEVLFMVDAIDEYAVGQLKEYDGK  521

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKK+REEKK +FE LCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  522  KLVSATKEGLKLDEETEEEKKRREEKKAAFEGLCKTIKDILGDKVEKVVVSDRIVDSPCC  581

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINP+NGIMEELRKRA+AD+NDKS
Sbjct  582  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADRNDKS  641

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAG---DDADM  151
            VKDLV+LLFETALLTSGFSLDDPNTF ARIHRMLKLGL+ID+   G   +DADM
Sbjct  642  VKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLKLGLNIDDSADGAEEEDADM  695



>ref|XP_010446135.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=437

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  189  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  248

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  249  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  307

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  308  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRAEADKNDKS  367

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSIDE++  + DA+MP L
Sbjct  368  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDEDDTVEADAEMPPL  422



>gb|EYU19581.1| hypothetical protein MIMGU_mgv1a002166mg [Erythranthe guttata]
Length=706

 Score =   340 bits (872),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 207/220 (94%), Positives = 217/220 (99%), Gaps = 0/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKKKGYEV++MVDAIDEYAVGQLKEYDGK
Sbjct  456  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKKGYEVVYMVDAIDEYAVGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKKREEKKKSFE+LCK+IKDILGDK+EKVVVSDRIVDSPCC
Sbjct  516  KLVSATKEGLKLEDETEEEKKKREEKKKSFESLCKVIKDILGDKIEKVVVSDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM SYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALRDSSMGSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLV+LLFETA+LTSGFSLD+PNTF ARIHRMLKLGLSI
Sbjct  636  VKDLVMLLFETAMLTSGFSLDEPNTFAARIHRMLKLGLSI  675



>ref|XP_009802902.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 83-like [Nicotiana 
sylvestris]
Length=703

 Score =   340 bits (871),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 220/235 (94%), Positives = 232/235 (99%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  456  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFE+LCK+IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  516  KLVSATKEGLKLDDETEEEKKKKEEKKKSFESLCKVIKDILGDKVEKVVVSDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMSSYMSSKKTME+NPDNGIMEELRKRAEAD+NDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALRDNSMSSYMSSKKTMEVNPDNGIMEELRKRAEADRNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI-DEEEAGDDADMPAL  142
            VKD+VLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSI +EEEAG+DADMPAL
Sbjct  636  VKDIVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSIDEEEEAGEDADMPAL  690



>gb|KFK26865.1| hypothetical protein AALP_AA8G303900 [Arabis alpina]
Length=705

 Score =   339 bits (870),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 212/235 (90%), Positives = 224/235 (95%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLE+LKK+GYEVL+MVDAIDEYAVGQ KEYDGK
Sbjct  457  YVTRMKEGQKDIFYITGESKKAVENSPFLEKLKKRGYEVLYMVDAIDEYAVGQWKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKK+EEKKKSFENLCK IKDILGDK+EKVVVSDRIVDSPCC
Sbjct  517  KLVSATKEGLKLEDETEEEKKKKEEKKKSFENLCKTIKDILGDKIEKVVVSDRIVDSPCC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  577  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGFSL++PNTF ARIHRMLKLGLSIDE+E   +D DMP L
Sbjct  637  VKDLVMLLFETALLTSGFSLEEPNTFAARIHRMLKLGLSIDEDENVEEDGDMPEL  691



>gb|KDP25390.1| hypothetical protein JCGZ_20546 [Jatropha curcas]
Length=706

 Score =   338 bits (868),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 206/236 (87%), Positives = 223/236 (94%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ+ IYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAV QLKEYDGK
Sbjct  458  YVTRMKEGQQHIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVTQLKEYDGK  517

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGL+LE+ +EE+KKK E+KK SFENLCK IK++LGD+VEKVVVSDRIVDSPCC
Sbjct  518  KLVSATKEGLQLEEPEEEKKKKEEKKK-SFENLCKTIKEVLGDRVEKVVVSDRIVDSPCC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMS+YMSSKK MEINPDN IM+ELRKRAEADKNDKS
Sbjct  577  LVTGEYGWTANMERIMKAQALRDNSMSAYMSSKKIMEINPDNPIMDELRKRAEADKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAG--DDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGL IDE+E+G  +D DMPAL
Sbjct  637  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLGIDEDESGEQEDIDMPAL  692



>ref|XP_010445119.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=706

 Score =   338 bits (867),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 212/235 (90%), Positives = 225/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLE+LKK+GYEVL+MVDAIDEYA+GQLKEYDGK
Sbjct  458  YVTRMKEGQKDIFYITGESKKAVENSPFLEKLKKRGYEVLYMVDAIDEYAIGQLKEYDGK  517

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKK+EEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  518  KLVSATKEGLKLEDETEEEKKKKEEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  577

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  578  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  637

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGFSL++PNTF ARIHRMLKLGLSIDE+E   +D  MP L
Sbjct  638  VKDLVMLLFETALLTSGFSLEEPNTFAARIHRMLKLGLSIDEDENVEEDGGMPEL  692



>ref|XP_010482633.1| PREDICTED: heat shock protein 90-1 [Camelina sativa]
Length=705

 Score =   338 bits (867),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 212/235 (90%), Positives = 225/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLE+LKK+GYEVL+MVDAIDEYA+GQLKEYDGK
Sbjct  457  YVTRMKEGQKDIFYITGESKKAVENSPFLEKLKKRGYEVLYMVDAIDEYAIGQLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKK+EEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  517  KLVSATKEGLKLEDETEEEKKKKEEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  577  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGFSL++PNTF ARIHRMLKLGLSIDE+E   +D  MP L
Sbjct  637  VKDLVMLLFETALLTSGFSLEEPNTFAARIHRMLKLGLSIDEDENVEEDGGMPEL  691



>ref|XP_010442803.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=705

 Score =   338 bits (867),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 212/235 (90%), Positives = 225/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLE+LKK+GYEVL+MVDAIDEYA+GQLKEYDGK
Sbjct  457  YVTRMKEGQKDIFYITGESKKAVENSPFLEKLKKRGYEVLYMVDAIDEYAIGQLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKK+EEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  517  KLVSATKEGLKLEDETEEEKKKKEEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  577  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGFSL++PNTF ARIHRMLKLGLSIDE+E   +D  MP L
Sbjct  637  VKDLVMLLFETALLTSGFSLEEPNTFAARIHRMLKLGLSIDEDENVEEDGGMPEL  691



>emb|CAN73318.1| hypothetical protein VITISV_007727 [Vitis vinifera]
Length=704

 Score =   338 bits (866),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 216/236 (92%), Positives = 223/236 (94%), Gaps = 2/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKKKREEKKKSFENLCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDEESEEEKKKREEKKKSFENLCKTIKDILGDKVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINPDNGIMEELRKRAE DKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPDNGIMEELRKRAEVDKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI--DEEEAGDDADMPAL  142
            VKDLV+LL+ETALLTSGFSLDDPNTF  RIHRMLKLGLSI   EE   +DADMP L
Sbjct  635  VKDLVMLLYETALLTSGFSLDDPNTFAGRIHRMLKLGLSIDEGEEVGEEDADMPPL  690



>ref|XP_006280097.1| hypothetical protein CARUB_v10025984mg [Capsella rubella]
 gb|EOA12995.1| hypothetical protein CARUB_v10025984mg [Capsella rubella]
Length=705

 Score =   338 bits (866),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 212/235 (90%), Positives = 225/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLE+LKK+GYEVL+MVDAIDEYA+GQLKEYDGK
Sbjct  457  YVTRMKEGQKDIFYITGESKKAVENSPFLEKLKKRGYEVLYMVDAIDEYAIGQLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKK+EEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  517  KLVSATKEGLKLEDETEEEKKKKEEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  576

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  577  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  636

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGFSL++PNTF ARIHRMLKLGLSIDE+E   +D  MP L
Sbjct  637  VKDLVMLLFETALLTSGFSLEEPNTFAARIHRMLKLGLSIDEDENVEEDGGMPEL  691



>ref|XP_002274022.1| PREDICTED: heat shock protein 83-like [Vitis vinifera]
Length=704

 Score =   338 bits (866),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 216/236 (92%), Positives = 223/236 (94%), Gaps = 2/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ EEEKKKREEKKKSFENLCK IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLDEESEEEKKKREEKKKSFENLCKTIKDILGDKVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINPDNGIMEELRKRAE DKNDKS
Sbjct  575  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPDNGIMEELRKRAEVDKNDKS  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI--DEEEAGDDADMPAL  142
            VKDLV+LL+ETALLTSGFSLDDPNTF  RIHRMLKLGLSI   EE   +DADMP L
Sbjct  635  VKDLVMLLYETALLTSGFSLDDPNTFAGRIHRMLKLGLSIDEGEEVGEEDADMPPL  690



>ref|XP_006664928.1| PREDICTED: heat shock protein 82-like [Oryza brachyantha]
Length=717

 Score =   338 bits (866),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 202/220 (92%), Positives = 216/220 (98%), Gaps = 0/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  467  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  526

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++D EEEKK+REEK++SFE+LCK++KDILGD+VEKVVVSDRIVDSPCC
Sbjct  527  KLVSATKEGLKLDEDTEEEKKRREEKRRSFESLCKVMKDILGDRVEKVVVSDRIVDSPCC  586

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINP+NGIMEELR+RAEAD NDKS
Sbjct  587  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRRRAEADPNDKS  646

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            V+DLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGLSI
Sbjct  647  VRDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLSI  686



>ref|XP_010055687.1| PREDICTED: heat shock protein 90-1-like [Eucalyptus grandis]
 gb|KCW72202.1| hypothetical protein EUGRSUZ_E00653 [Eucalyptus grandis]
Length=703

 Score =   337 bits (864),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 205/222 (92%), Positives = 217/222 (98%), Gaps = 0/222 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKK+GYEVLFMVDAIDEY V QLKEYDGK
Sbjct  451  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKRGYEVLFMVDAIDEYVVSQLKEYDGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE++ EEEKK+REEKKKSFENLCK IK+ILGD+VEKVVVSDRIVDSPCC
Sbjct  511  KLVSATKEGLKLEEESEEEKKRREEKKKSFENLCKTIKEILGDRVEKVVVSDRIVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMS+YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDNSMSAYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDE  178
            VKDLVLLL+ETALLTSGFSLDDPNTF +RIHRMLKLGLSI++
Sbjct  631  VKDLVLLLYETALLTSGFSLDDPNTFASRIHRMLKLGLSIED  672



>ref|XP_010552350.1| PREDICTED: heat shock protein 90-2 [Tarenaya hassleriana]
Length=699

 Score =   336 bits (862),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E++KK   K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDETEDEKQKKEALKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+ AG+ D+DMP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDVAGEADSDMPPL  684



>ref|XP_010235286.1| PREDICTED: heat shock protein 81-1-like [Brachypodium distachyon]
Length=699

 Score =   336 bits (862),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 201/236 (85%), Positives = 220/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLERLKKKGYEV++MVDAIDEYA+GQLKE++GK
Sbjct  452  YVTRMKEGQNDIYYITGESKKAVENSPFLERLKKKGYEVIYMVDAIDEYAIGQLKEFEGK  511

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED ++E+KKK E K+K  E LCK+IKD+LGD+VEKV+VSDR+VDSPCC
Sbjct  512  KLVSATKEGLKLEDSEDEKKKKEELKEKF-EGLCKVIKDVLGDRVEKVIVSDRVVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENAIMEELRKRADADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA--GDDADMPAL  142
            VKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKLGLSIDE+E    DD DMPAL
Sbjct  631  VKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKLGLSIDEDETAEADDTDMPAL  686



>ref|XP_010235281.1| PREDICTED: heat shock protein 81-1-like [Brachypodium distachyon]
Length=700

 Score =   335 bits (859),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 200/236 (85%), Positives = 221/236 (94%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLERLKKKGYEV++MVDAIDEYA+GQLKE++GK
Sbjct  453  YVTRMKEGQNDIYYITGESKKAVENSPFLERLKKKGYEVIYMVDAIDEYAIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED ++E+KKK E K+K  E LCK+IK++LGD+VEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLEDTEDEKKKKEELKEKF-EGLCKVIKEVLGDRVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMEELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA--GDDADMPAL  142
            VKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKLGLSIDE+E    DD DMPAL
Sbjct  632  VKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKLGLSIDEDETAEADDTDMPAL  687



>ref|XP_004135777.1| PREDICTED: heat shock protein 90-2-like [Cucumis sativus]
Length=611

 Score =   332 bits (852),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 193/234 (82%), Positives = 217/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  363  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  422

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK    +  F+ LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  423  KLVSATKEGLKLDESEDEKKKKEALVE-KFDGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  481

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQAL+D+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  482  LVTGEYGWTANMERIMKAQALKDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  541

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFET+LLTSGFSLD+PNTFG RIHRMLKLGLSIDEE    D++MP L
Sbjct  542  VKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRMLKLGLSIDEEAGEGDSEMPPL  595



>ref|XP_007152171.1| hypothetical protein PHAVU_004G107700g [Phaseolus vulgaris]
 gb|ESW24165.1| hypothetical protein PHAVU_004G107700g [Phaseolus vulgaris]
Length=700

 Score =   335 bits (858),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 216/236 (92%), Positives = 223/236 (94%), Gaps = 2/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  451  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ EEEKKK+EEKKKSFE LCK+IKDILGDKVEKVVVSDRIVDSPCC
Sbjct  511  KLVSATKEGLKLDDETEEEKKKKEEKKKSFEELCKVIKDILGDKVEKVVVSDRIVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM  YMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDNSMGGYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI--DEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF +RIHRMLKLGLSI  DE    DD DMP L
Sbjct  631  VKDLVLLLFETALLTSGFSLDDPNTFASRIHRMLKLGLSIDEDENGGDDDVDMPPL  686



>ref|XP_010537148.1| PREDICTED: heat shock protein 83 [Tarenaya hassleriana]
Length=702

 Score =   335 bits (858),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 217/235 (92%), Positives = 225/235 (96%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  454  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  513

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKK+EEKKKSFENLCK +KDILGDKVEKVVVSDRIVDSPCC
Sbjct  514  KLVSATKEGLKLEDESEEEKKKKEEKKKSFENLCKTMKDILGDKVEKVVVSDRIVDSPCC  573

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS
Sbjct  574  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKS  633

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI-DEEEAGDDADMPAL  142
            VKDLV+LLFETALLTSGFSL+DPN F  RIHRMLKLGLSI +E+E   + DMPAL
Sbjct  634  VKDLVMLLFETALLTSGFSLEDPNMFAGRIHRMLKLGLSIEEEDENVGEEDMPAL  688



>ref|XP_003580663.1| PREDICTED: heat shock protein 82 [Brachypodium distachyon]
Length=710

 Score =   335 bits (858),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 212/235 (90%), Positives = 224/235 (95%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  462  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  521

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE++ EEEKK+REEKK +FE LCK IKDILGD+VEKVVVS+RIVDSPCC
Sbjct  522  KLVSATKEGLKLEEETEEEKKRREEKKAAFEGLCKTIKDILGDRVEKVVVSERIVDSPCC  581

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINP+NGIMEELRKRAEADKNDKS
Sbjct  582  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRAEADKNDKS  641

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI-DEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPN F ARIHRML+LGL+I +E  A DDADMPAL
Sbjct  642  VKDLVLLLFETALLTSGFSLDDPNMFAARIHRMLRLGLNIDEEAAAEDDADMPAL  696



>ref|XP_009391803.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=699

 Score =   333 bits (854),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 196/234 (84%), Positives = 219/234 (94%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEY+VGQLKE++GK
Sbjct  453  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYSVGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLK+++ ++E+KKK   K+K  E LCK+IK++LGDKVEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKIDESEDEKKKKETLKEKF-EGLCKVIKEVLGDKVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKT+EINP+N IMEELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTLEINPENPIMEELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDL LLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+E  +D DMP+L
Sbjct  632  VKDLTLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDEKVEDTDMPSL  685



>gb|KFK27172.1| hypothetical protein AALP_AA8G344900 [Arabis alpina]
Length=699

 Score =   333 bits (853),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRAEADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSIDE++  + DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDEDDTVEADAEMPPL  684



>ref|XP_010443241.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   332 bits (852),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 222/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSIDE++A + DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDEDDAVEADAEMPPL  684



>gb|KHG00618.1| Heat shock 90-1 -like protein [Gossypium arboreum]
Length=707

 Score =   333 bits (853),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 204/220 (93%), Positives = 215/220 (98%), Gaps = 0/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  458  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  517

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ E+EKKK+EEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  518  KLVSATKEGLKLDEESEDEKKKKEEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  577

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMS+YMSSKKTMEINPDNGIMEELRKRAE DKNDKS
Sbjct  578  LVTGEYGWTANMERIMKAQALRDNSMSAYMSSKKTMEINPDNGIMEELRKRAEVDKNDKS  637

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLL+ETALLTSGFSLDDPNTF  RIHRMLKLGLSI
Sbjct  638  VKDLVLLLYETALLTSGFSLDDPNTFAGRIHRMLKLGLSI  677



>gb|KGN66050.1| hypothetical protein Csa_1G569270 [Cucumis sativus]
Length=699

 Score =   332 bits (852),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 193/234 (82%), Positives = 217/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK    +  F+ LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKKKKEALVE-KFDGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQAL+D+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALKDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFET+LLTSGFSLD+PNTFG RIHRMLKLGLSIDEE    D++MP L
Sbjct  630  VKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRMLKLGLSIDEEAGEGDSEMPPL  683



>gb|KHG21667.1| Heat shock cognate 80 [Gossypium arboreum]
Length=615

 Score =   330 bits (845),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 201/236 (85%), Positives = 220/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  367  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  426

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK   K+K  E LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  427  KLVSATKEGLKLDESEDEKKKKEALKEKF-EGLCKVIKDVLGDKVEKVLVSDRVVDSPCC  485

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  486  LVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  545

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEE--EAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+  EA  DADMP L
Sbjct  546  VKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDAGEAEADADMPPL  601



>gb|KJB20596.1| hypothetical protein B456_003G155600 [Gossypium raimondii]
Length=707

 Score =   332 bits (852),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 204/220 (93%), Positives = 215/220 (98%), Gaps = 0/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LKK+GYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  458  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKKRGYEVLFMVDAIDEYAVGQLKEYDGK  517

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+++ E+EKKK+EEKKKSFENLCK IK+ILGDKVEKVVVSDRIVDSPCC
Sbjct  518  KLVSATKEGLKLDEESEDEKKKKEEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCC  577

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SMS+YMSSKKTMEINPDNGIMEELRKRAE DKNDKS
Sbjct  578  LVTGEYGWTANMERIMKAQALRDNSMSAYMSSKKTMEINPDNGIMEELRKRAEVDKNDKS  637

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLL+ETALLTSGFSLDDPNTF  RIHRMLKLGLSI
Sbjct  638  VKDLVLLLYETALLTSGFSLDDPNTFAGRIHRMLKLGLSI  677



>ref|XP_002869603.1| early-responsive to dehydration 8 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45862.1| early-responsive to dehydration 8 [Arabidopsis lyrata subsp. 
lyrata]
Length=700

 Score =   332 bits (851),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 221/236 (94%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEE--EAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSID++  E   DADMP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDDDAGETEADADMPPL  685



>emb|CDY50297.1| BnaA10g28410D [Brassica napus]
Length=636

 Score =   330 bits (846),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 210/235 (89%), Positives = 222/235 (94%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLE+LKK+GYEVL+MVDAIDEYAVGQLK+ DGK
Sbjct  388  YVTRMKEGQKDIFYITGESKKAVENSPFLEKLKKRGYEVLYMVDAIDEYAVGQLKKCDGK  447

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKK+EEKKKSFENLCK IKDILGDKVEKVVVSDRIV SPCC
Sbjct  448  KLVSATKEGLKLEDETEEEKKKKEEKKKSFENLCKTIKDILGDKVEKVVVSDRIVYSPCC  507

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANME IMKA+ALRDSSMS YMSSKKTMEINPDNGIMEELRKRAE DKND S
Sbjct  508  LVTGEYGWTANMENIMKAEALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEVDKNDNS  567

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLD+PNTF ARIHRMLKLGLSIDE+E   +D DMPAL
Sbjct  568  VKDLVMLLFETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEEDGDMPAL  622



>ref|XP_006287183.1| hypothetical protein CARUB_v10000353mg [Capsella rubella]
 gb|EOA20081.1| hypothetical protein CARUB_v10000353mg [Capsella rubella]
Length=699

 Score =   332 bits (851),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 223/235 (95%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSIDE++A + DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDEDDAVEADAEMPPL  684



>gb|EYU33725.1| hypothetical protein MIMGU_mgv1a002215mg [Erythranthe guttata]
Length=700

 Score =   332 bits (850),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 223/235 (95%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGESKKAVENSPFLERLKKKGYEV++MVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQNEIYYITGESKKAVENSPFLERLKKKGYEVIYMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK E K+K  E LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKKKKEELKEKF-EGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLV+LLFET+LLTSGFSLD+PNTFG RIHRMLKLGLSID++E+G+ D DMPAL
Sbjct  630  VKDLVMLLFETSLLTSGFSLDEPNTFGNRIHRMLKLGLSIDDDESGEADVDMPAL  684



>ref|XP_002969937.1| hypothetical protein SELMODRAFT_267300 [Selaginella moellendorffii]
 gb|EFJ29061.1| hypothetical protein SELMODRAFT_267300 [Selaginella moellendorffii]
Length=691

 Score =   331 bits (849),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 209/237 (88%), Positives = 222/237 (94%), Gaps = 4/237 (2%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLERLK+KGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  441  YVTRMKEGQKDIFYITGESKKAVENSPFLERLKRKGYEVLYMVDAIDEYAVGQLKEYDGK  500

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED D+E+KK  E+K    E LCK+IKDILG+KVEKVVVSDRIVDSPCC
Sbjct  501  KLVSATKEGLKLEDTDDEKKKFEEKKAAF-EGLCKVIKDILGEKVEKVVVSDRIVDSPCC  559

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDN IMEELRKRA+ADKNDK+
Sbjct  560  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNSIMEELRKRADADKNDKA  619

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEE-EAGDDA--DMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSID++  AG DA  DMP L
Sbjct  620  VKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDDDVGAGADADVDMPPL  676



>ref|XP_009119805.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 90-1 [Brassica 
rapa]
Length=710

 Score =   332 bits (851),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 210/235 (89%), Positives = 223/235 (95%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLE+LKK+GYEVL+MVDAIDEYAVG+LK+YDGK
Sbjct  462  YVTRMKEGQKDIFYITGESKKAVENSPFLEKLKKRGYEVLYMVDAIDEYAVGKLKKYDGK  521

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED+ EEEKKK+EEKKKSFENLCK IKDILGDKVEKVVVSDRIV SPCC
Sbjct  522  KLVSATKEGLKLEDETEEEKKKKEEKKKSFENLCKTIKDILGDKVEKVVVSDRIVYSPCC  581

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANME IMKA+ALRDSSMS YMSSKKTMEINPDNGIMEELRKRAE DKND S
Sbjct  582  LVTGEYGWTANMENIMKAKALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEVDKNDNS  641

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLD+PNTF ARIHRMLKLGLSIDE+E   +D DMPAL
Sbjct  642  VKDLVMLLFETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEEDGDMPAL  696



>ref|XP_006401391.1| hypothetical protein EUTSA_v10012832mg [Eutrema salsugineum]
 dbj|BAJ33984.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42844.1| hypothetical protein EUTSA_v10012832mg [Eutrema salsugineum]
Length=699

 Score =   331 bits (849),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEESEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRAEADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSIDE++  + DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDEDDTVEADAEMPPL  684



>ref|XP_002973159.1| hypothetical protein SELMODRAFT_271009 [Selaginella moellendorffii]
 gb|EFJ25533.1| hypothetical protein SELMODRAFT_271009 [Selaginella moellendorffii]
Length=705

 Score =   332 bits (850),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 206/236 (87%), Positives = 221/236 (94%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKE QKDI+YITGESKKAVENSPFLERLK+KGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  456  YVTRMKENQKDIFYITGESKKAVENSPFLERLKRKGYEVLYMVDAIDEYAVGQLKEYDGK  515

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED D+E+KK  E+K    E LCK++KDILG+KVEKVVVSDRIVDSPCC
Sbjct  516  KLVSATKEGLKLEDTDDEKKKFEEKKAAF-EGLCKVVKDILGEKVEKVVVSDRIVDSPCC  574

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDN IMEELRKRA+ADKNDK+
Sbjct  575  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNSIMEELRKRADADKNDKA  634

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDAD--MPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSID++ +GD AD  MP L
Sbjct  635  VKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDDDVSGDAADVEMPPL  690



>dbj|BAK08691.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08734.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08735.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   331 bits (849),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 196/234 (84%), Positives = 222/234 (95%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMK+GQKDIYYITGESKKAVENSPFLE+LK++GYEVLFMVD IDEYAVGQLKEYDGK
Sbjct  453  YVTRMKDGQKDIYYITGESKKAVENSPFLEKLKRRGYEVLFMVDPIDEYAVGQLKEYDGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D DE++KKK E KK  FE+LCK++K+ILGDKVEKVVVSDRIVDSPCC
Sbjct  513  KLVSATKEGLKLDDTDEDKKKKEEIKK-EFESLCKLMKEILGDKVEKVVVSDRIVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIM+AQALRDSSMSSYM+SKKTME+NP+N IM+EL+KRA+AD++DK+
Sbjct  572  LVTGEYGWTANMERIMRAQALRDSSMSSYMTSKKTMEVNPENAIMKELKKRADADRSDKT  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPN F +RIHRM+KLGLSIDE+ AG+D DMP L
Sbjct  632  VKDLVMLLFETALLTSGFSLDDPNMFASRIHRMIKLGLSIDEDAAGEDEDMPPL  685



>ref|XP_010483069.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 90-3-like 
[Camelina sativa]
Length=699

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSIDE++  + DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDEDDTVEADAEMPPL  684



>dbj|BAK08741.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 196/234 (84%), Positives = 222/234 (95%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMK+GQKDIYYITGESKKAVENSPFLE+LK++GYEVLFMVD IDEYAVGQLKEYDGK
Sbjct  453  YVTRMKDGQKDIYYITGESKKAVENSPFLEKLKRRGYEVLFMVDPIDEYAVGQLKEYDGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D +EE+KKK E KK  FE+LCK++K+ILGDKVEKVVVSDRIVDSPCC
Sbjct  513  KLVSATKEGLKLDDTEEEKKKKEEIKK-EFESLCKLMKEILGDKVEKVVVSDRIVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIM+AQALRDSSMSSYM+SKKTME+NP+N IM+EL+KRA+AD++DK+
Sbjct  572  LVTGEYGWTANMERIMRAQALRDSSMSSYMTSKKTMEVNPENAIMKELKKRADADRSDKT  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPN F +RIHRM+KLGLSIDE+ AG+D DMP L
Sbjct  632  VKDLVMLLFETALLTSGFSLDDPNMFASRIHRMIKLGLSIDEDAAGEDEDMPPL  685



>ref|XP_001777383.1| predicted protein [Physcomitrella patens]
 gb|EDQ57787.1| predicted protein [Physcomitrella patens]
Length=707

 Score =   331 bits (849),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 216/234 (92%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LK++GYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  460  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKRRGYEVLYMVDAIDEYAVGQLKEYDGK  519

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGL LE+ +EE+KKK E K   FE LCK +KDILGDKVEKVVVSDRIVDSPC 
Sbjct  520  KLVSATKEGLVLEETEEEKKKKEETKA-RFEPLCKAVKDILGDKVEKVVVSDRIVDSPCV  578

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSMSSYMSSKKTMEINPDN IMEELRKRAE DKNDKS
Sbjct  579  LVTGEYGWSANMERIMKAQALRDSSMSSYMSSKKTMEINPDNQIMEELRKRAEVDKNDKS  638

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETA+LTSGFSL++PNTFG RIHRMLKLGLSID++    DADMP L
Sbjct  639  VKDLVLLLFETAMLTSGFSLEEPNTFGNRIHRMLKLGLSIDDDVTEADADMPPL  692



>ref|XP_002976693.1| hypothetical protein SELMODRAFT_151384 [Selaginella moellendorffii]
 gb|EFJ22362.1| hypothetical protein SELMODRAFT_151384 [Selaginella moellendorffii]
Length=704

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 206/236 (87%), Positives = 221/236 (94%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKE QKDI+YITGESKKAVENSPFLERLK+KGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  455  YVTRMKENQKDIFYITGESKKAVENSPFLERLKRKGYEVLYMVDAIDEYAVGQLKEYDGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED D+E+KK  E+K    E LCK++KDILG+KVEKVVVSDRIVDSPCC
Sbjct  515  KLVSATKEGLKLEDTDDEKKKFEEKKAAF-EGLCKVVKDILGEKVEKVVVSDRIVDSPCC  573

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDN IMEELRKRA+ADKNDK+
Sbjct  574  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNTIMEELRKRADADKNDKA  633

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDAD--MPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSID++ +GD AD  MP L
Sbjct  634  VKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDDDVSGDAADVEMPPL  689



>ref|XP_006413166.1| hypothetical protein EUTSA_v10024564mg [Eutrema salsugineum]
 gb|ESQ54619.1| hypothetical protein EUTSA_v10024564mg [Eutrema salsugineum]
Length=700

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 220/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEE--EAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSID++  E   DADMP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDDDAGEGEADADMPPL  685



>ref|XP_010483070.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQDDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSIDE++A + DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDDAVEADAEMPPL  684



>ref|XP_010443242.1| PREDICTED: heat shock protein 90-2 [Camelina sativa]
Length=699

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQDDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSIDE++A + DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDDAVEADAEMPPL  684



>gb|AHM23830.1| heat shock protein 90, partial [Brassica rapa]
Length=421

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 211/220 (96%), Gaps = 1/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ+DI+YITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  173  YVTRMKEGQEDIFYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  232

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  233  KLVSATKEGLKLEESEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  291

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  292  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENAIMDELRKRAEADKNDKS  351

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSI
Sbjct  352  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSI  391



>ref|XP_001777414.1| predicted protein [Physcomitrella patens]
 gb|EDQ57818.1| predicted protein [Physcomitrella patens]
Length=704

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 216/234 (92%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LK++GYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  457  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKRRGYEVLYMVDAIDEYAVGQLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGL LE+ +EE+KKK E K   FE LCK +KDILGDKVEKVVVSDRIVDSPC 
Sbjct  517  KLVSATKEGLVLEETEEEKKKKEETKA-RFEPLCKAVKDILGDKVEKVVVSDRIVDSPCV  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSMSSYMSSKKTMEINPDN IMEELRKRAE DKNDKS
Sbjct  576  LVTGEYGWSANMERIMKAQALRDSSMSSYMSSKKTMEINPDNQIMEELRKRAEVDKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETA+LTSGFSL++PNTFG RIHRMLKLGLSID++    DADMP L
Sbjct  636  VKDLVLLLFETAMLTSGFSLEEPNTFGNRIHRMLKLGLSIDDDVTEADADMPPL  689



>ref|XP_006280101.1| hypothetical protein CARUB_v10025990mg [Capsella rubella]
 gb|EOA12999.1| hypothetical protein CARUB_v10025990mg [Capsella rubella]
Length=699

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 220/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEY++GQLKE++GK
Sbjct  451  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSS  SYMSSKKTMEINP+N IM ELRKRAEADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSTGSYMSSKKTMEINPENSIMNELRKRAEADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSIDE++A + DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDDAVEADAEMPPL  684



>ref|XP_002981406.1| hypothetical protein SELMODRAFT_271484 [Selaginella moellendorffii]
 gb|EFJ17594.1| hypothetical protein SELMODRAFT_271484 [Selaginella moellendorffii]
Length=704

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 209/237 (88%), Positives = 222/237 (94%), Gaps = 4/237 (2%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDI+YITGESKKAVENSPFLERLK+KGYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  454  YVTRMKEGQKDIFYITGESKKAVENSPFLERLKRKGYEVLYMVDAIDEYAVGQLKEYDGK  513

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED D+E+KK  E+K    E LCK+IKDILG+KVEKVVVSDRIVDSPCC
Sbjct  514  KLVSATKEGLKLEDTDDEKKKFEEKKAAF-EGLCKVIKDILGEKVEKVVVSDRIVDSPCC  572

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDN IMEELRKRA+ADKNDK+
Sbjct  573  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNSIMEELRKRADADKNDKA  632

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEE-EAGDDA--DMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSID++  AG DA  DMP L
Sbjct  633  VKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDDDVGAGADADVDMPPL  689



>ref|XP_006413591.1| hypothetical protein EUTSA_v10024561mg [Eutrema salsugineum]
 gb|ESQ55044.1| hypothetical protein EUTSA_v10024561mg [Eutrema salsugineum]
Length=700

 Score =   330 bits (847),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 220/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEV++MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVIYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEE--EAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSID++  E   DADMP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDDDAGETEADADMPPL  685



>gb|ADF31757.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31766.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31780.1| heat shock protein 90 [Triticum dicoccoides]
Length=700

 Score =   330 bits (847),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 220/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEY++GQLKE++GK
Sbjct  453  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D +EE+K+K E K+K  E LCK+IK++LGD+VEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDDSEEEKKRKEELKEKF-EGLCKVIKEVLGDRVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM  YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTMEINPENAIMEELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE--AGDDADMPAL  142
            VKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKLGLSIDE+E  AG D DMP L
Sbjct  632  VKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKLGLSIDEDEEAAGADTDMPPL  687



>ref|XP_010450563.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   330 bits (845),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRAEADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSIDE++A + D ++P L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDEDDAVEADVELPPL  684



>ref|NP_001234439.1| heat shock cognate protein 80 [Solanum lycopersicum]
 sp|P36181.1|HSP80_SOLLC RecName: Full=Heat shock cognate protein 80 [Solanum lycopersicum]
 gb|AAB01376.1| heat shock cognate protein 80 [Solanum lycopersicum]
 gb|AAR12196.1| molecular chaperone Hsp90-2 [Solanum lycopersicum]
 prf||1909348A heat shock protein hsp80
Length=699

 Score =   330 bits (845),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 196/234 (84%), Positives = 220/234 (94%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEY++GQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK+ E K+K  E LCK++KD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKKKQEELKEKF-EGLCKVMKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSL++PNTFG RIHRMLKLGLSIDEE    DADMPAL
Sbjct  630  VKDLVLLLFETALLTSGFSLEEPNTFGNRIHRMLKLGLSIDEESGDADADMPAL  683



>ref|XP_009126978.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=696

 Score =   330 bits (845),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  448  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  507

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+ KK E K+K  E LCK+IKDILGDKVEKV+VSDR+VDSPCC
Sbjct  508  KLVSATKEGLKLDESEDEKNKKEELKEKF-EGLCKVIKDILGDKVEKVIVSDRVVDSPCC  566

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRAEADKNDKS
Sbjct  567  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMEELRKRAEADKNDKS  626

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSIDE++A + DA+MP L
Sbjct  627  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDDAVEGDAEMPPL  681



>gb|AAF31705.1|AF221856_1 heat-shock protein 80 [Euphorbia esula]
Length=320

 Score =   318 bits (814),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 201/234 (86%), Positives = 220/234 (94%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  72   YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  131

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLK+++ ++E+KKK E K+  FE LCK+IKD+LGD+VEKVVVSDR+VDSPCC
Sbjct  132  KLVSATKEGLKIDESEDEKKKKDELKE-QFEGLCKVIKDVLGDRVEKVVVSDRVVDSPCC  190

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  191  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMDELRKRADADKNDKS  250

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+    DADMPAL
Sbjct  251  VKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDAGEGDADMPAL  304



>ref|XP_010433476.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448245.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448246.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448248.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010491086.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
Length=701

 Score =   330 bits (845),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 221/236 (94%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEV++MVDAIDEYA+GQLKE++GK
Sbjct  452  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVIYMVDAIDEYAIGQLKEFEGK  511

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK++KD+LGDKVEKV+VSDR+VDSPCC
Sbjct  512  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVMKDVLGDKVEKVIVSDRVVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEE--EAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSID++  E   DADMP L
Sbjct  631  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDDDAGETEADADMPPL  686



>gb|KFK38607.1| hypothetical protein AALP_AA3G136000 [Arabis alpina]
Length=655

 Score =   328 bits (842),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 195/235 (83%), Positives = 218/235 (93%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  407  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  466

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSD +VDSPCC
Sbjct  467  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDHVVDSPCC  525

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDS M  YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  526  LVTGEYGWTANMERIMKAQALRDSGMGGYMSSKKTMEINPENSIMDELRKRAEADKNDKS  585

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLV+LLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSIDE++  + D +MP L
Sbjct  586  VKDLVVLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDEDDTVEADTEMPPL  640



>ref|XP_010483071.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   330 bits (845),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSIDE++  + DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDEDDTVEADAEMPLL  684



>gb|ACN27969.1| unknown [Zea mays]
 gb|ACN28652.1| unknown [Zea mays]
 gb|AFW57714.1| putative heat shock protein 90 family protein [Zea mays]
Length=714

 Score =   330 bits (845),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 210/236 (89%), Positives = 223/236 (94%), Gaps = 2/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  465  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  524

Query  663  KLVSATke-glkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPC  487
            KLVSATKE     ++DDEE KK+REE+KK FE LCK+IKDILGD+VEKVVVSDRIVDSPC
Sbjct  525  KLVSATKEGLKLDDEDDEEAKKRREERKKRFEELCKVIKDILGDRVEKVVVSDRIVDSPC  584

Query  486  CLVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDK  307
            CLVTGEYGWTANMERIMKAQALRDSSMS+YMSSKKTMEINPDNGIMEELRKRAEAD+NDK
Sbjct  585  CLVTGEYGWTANMERIMKAQALRDSSMSAYMSSKKTMEINPDNGIMEELRKRAEADRNDK  644

Query  306  SVKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI-DEEEAGDDADMPAL  142
            SVKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGL+I ++  A +DADMPAL
Sbjct  645  SVKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLNIDEDAAADEDADMPAL  700



>dbj|BAK08743.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   329 bits (844),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 195/234 (83%), Positives = 221/234 (94%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMK+GQKDIYYITGESKKAVENSPFLE+LK++GYEVLFMVD IDEYAVGQLKEYDGK
Sbjct  453  YVTRMKDGQKDIYYITGESKKAVENSPFLEKLKRRGYEVLFMVDPIDEYAVGQLKEYDGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D +EE+KKK E KK  FE+LCK++K+ILGDKVEKVVVSDRIVDSPCC
Sbjct  513  KLVSATKEGLKLDDTEEEKKKKEEIKK-EFESLCKLMKEILGDKVEKVVVSDRIVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIM+AQ LRDSSMSSYM+SKKTME+NP+N IM+EL+KRA+AD++DK+
Sbjct  572  LVTGEYGWTANMERIMRAQTLRDSSMSSYMTSKKTMEVNPENAIMKELKKRADADRSDKT  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPN F +RIHRM+KLGLSIDE+ AG+D DMP L
Sbjct  632  VKDLVMLLFETALLTSGFSLDDPNMFASRIHRMIKLGLSIDEDAAGEDEDMPPL  685



>ref|NP_001135416.2| heat shock protein 82 [Zea mays]
 sp|Q08277.1|HSP82_MAIZE RecName: Full=Heat shock protein 82 [Zea mays]
 gb|AAB26482.2| heat shock protein HSP82 [Zea mays]
Length=715

 Score =   330 bits (845),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 210/236 (89%), Positives = 223/236 (94%), Gaps = 2/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGES+KAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  466  YVTRMKEGQKDIYYITGESRKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  525

Query  663  KLVSATke-glkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPC  487
            KLVSATKE     ++DDEE KK+REE+KK FE LCK+IKDILGD+VEKVVVSDRIVDSPC
Sbjct  526  KLVSATKEGLKLDDEDDEEAKKRREERKKRFEELCKVIKDILGDRVEKVVVSDRIVDSPC  585

Query  486  CLVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDK  307
            CLVTGEYGWTANMERIMKAQALRDSSMS+YMSSKKTMEINPDNGIMEELRKRAEAD+NDK
Sbjct  586  CLVTGEYGWTANMERIMKAQALRDSSMSAYMSSKKTMEINPDNGIMEELRKRAEADRNDK  645

Query  306  SVKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI-DEEEAGDDADMPAL  142
            SVKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGL+I ++  A +DADMPAL
Sbjct  646  SVKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLNIDEDAAADEDADMPAL  701



>dbj|BAK08742.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   329 bits (844),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 195/234 (83%), Positives = 222/234 (95%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMK+GQKDIYYITGESKKAVENSPFLE+LK++GYEVLFMVD IDEYAVGQLKEYDGK
Sbjct  453  YVTRMKDGQKDIYYITGESKKAVENSPFLEKLKRRGYEVLFMVDPIDEYAVGQLKEYDGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D +EE+KKK E KK  FE+LCK++K+ILG+KVEKVVVSDRIVDSPCC
Sbjct  513  KLVSATKEGLKLDDTEEEKKKKEEIKK-EFESLCKLMKEILGEKVEKVVVSDRIVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIM+AQALRDSSMSSYM+SKKTME+NP+N IM+EL+KRA+AD++DK+
Sbjct  572  LVTGEYGWTANMERIMRAQALRDSSMSSYMTSKKTMEVNPENAIMKELKKRADADRSDKT  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPN F +RIHRM+KLGLSIDE+ AG+D DMP L
Sbjct  632  VKDLVMLLFETALLTSGFSLDDPNMFASRIHRMIKLGLSIDEDAAGEDEDMPPL  685



>gb|ACX37414.1| cytosolic heat shock protein 90.2 [Dactylis glomerata]
Length=699

 Score =   329 bits (843),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 218/236 (92%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLERLKKKG EVLFMVDAIDEYA+GQLKE++GK
Sbjct  452  YVTRMKEGQSDIYYITGESKKAVENSPFLERLKKKGLEVLFMVDAIDEYAIGQLKEFEGK  511

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLK++D ++E+K+K E K+K  E LCK+IK++LGD+VEKV+VSDR+VDSPCC
Sbjct  512  KLVSATKEGLKIDDSEDEKKRKEELKEKF-EGLCKVIKEVLGDRVEKVIVSDRVVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENAIMEELRKRADADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA--GDDADMPAL  142
            VKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKLGLSIDE+E    DD DMP L
Sbjct  631  VKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDEPAEADDTDMPPL  686



>ref|XP_006280103.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
 gb|EOA13001.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
Length=699

 Score =   329 bits (843),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEY++GQLKE++GK
Sbjct  451  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSIDE++A + DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDDAVEADAEMPPL  684



>ref|XP_006280102.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
 gb|EOA13000.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
Length=658

 Score =   328 bits (840),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEY++GQLKE++GK
Sbjct  410  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGK  469

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  470  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  528

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  529  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRADADKNDKS  588

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSIDE++A + DA+MP L
Sbjct  589  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDDAVEADAEMPPL  643



>gb|EAY92778.1| hypothetical protein OsI_14582 [Oryza sativa Indica Group]
Length=703

 Score =   328 bits (842),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 194/220 (88%), Positives = 210/220 (95%), Gaps = 5/220 (2%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQK++YYITGES+KAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  458  YVTRMKEGQKEVYYITGESRKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  517

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+DDD+ +++KR     SFE LCK+IKDILGD+VEKVVVSDRIVDSPCC
Sbjct  518  KLVSATKEGLKLDDDDDAKERKR-----SFEPLCKVIKDILGDRVEKVVVSDRIVDSPCC  572

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINP+NGIMEELRKRA+AD NDKS
Sbjct  573  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADANDKS  632

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            V+DLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGL+I
Sbjct  633  VRDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLNI  672



>emb|CAE02770.2| OSJNBb0085F13.17 [Oryza sativa Japonica Group]
 emb|CAD39419.2| OSJNBa0027H06.1 [Oryza sativa Japonica Group]
Length=703

 Score =   328 bits (842),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 194/220 (88%), Positives = 210/220 (95%), Gaps = 5/220 (2%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQK++YYITGES+KAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKEYDGK
Sbjct  458  YVTRMKEGQKEVYYITGESRKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  517

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+DDD+ +++KR     SFE LCK+IKDILGD+VEKVVVSDRIVDSPCC
Sbjct  518  KLVSATKEGLKLDDDDDAKERKR-----SFEPLCKVIKDILGDRVEKVVVSDRIVDSPCC  572

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM +YMSSKKTMEINP+NGIMEELRKRA+AD NDKS
Sbjct  573  LVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADANDKS  632

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            V+DLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGL+I
Sbjct  633  VRDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLNI  672



>ref|XP_006828794.1| hypothetical protein AMTR_s00001p00118120 [Amborella trichopoda]
 gb|ERM96210.1| hypothetical protein AMTR_s00001p00118120 [Amborella trichopoda]
Length=705

 Score =   328 bits (841),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 208/234 (89%), Positives = 221/234 (94%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLERLK+KGYEVLFMVD IDEYAVGQLKEYDGK
Sbjct  459  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKRKGYEVLFMVDVIDEYAVGQLKEYDGK  518

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ +EE+K+K E+K  +FE LCK +K+ILGD+VEKVVVSDRIVDSPCC
Sbjct  519  KLVSATKEGLKLEETEEEKKRKEEKKA-AFEGLCKTMKEILGDRVEKVVVSDRIVDSPCC  577

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINP+N IMEELRKRAEADKNDKS
Sbjct  578  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPENPIMEELRKRAEADKNDKS  637

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF  RIHRMLKLGLSIDEEE  +DA+MP L
Sbjct  638  VKDLVLLLFETALLTSGFSLDDPNTFSGRIHRMLKLGLSIDEEEVAEDAEMPPL  691



>ref|XP_010438732.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
Length=706

 Score =   328 bits (841),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 221/236 (94%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEV++MVDAIDEYA+GQLKE++GK
Sbjct  457  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVIYMVDAIDEYAIGQLKEFEGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK++K++LGDKVEKV+VSDR+VDSPCC
Sbjct  517  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVMKEVLGDKVEKVIVSDRVVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEE--EAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSID++  E   DADMP L
Sbjct  636  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDDDAGETEADADMPPL  691



>ref|NP_200411.1| Heat shock protein 90-4 [Arabidopsis thaliana]
 sp|O03986.1|HS904_ARATH RecName: Full=Heat shock protein 90-4; Short=AtHSP90.4; AltName: 
Full=Heat shock protein 81-4; Short=HSP81-4 [Arabidopsis 
thaliana]
 emb|CAA72514.1| heat shock protein [Arabidopsis thaliana]
 dbj|BAB09282.1| heat shock protein [Arabidopsis thaliana]
 dbj|BAE99287.1| heat shock protein [Arabidopsis thaliana]
 gb|AED96708.1| Heat shock protein 90-4 [Arabidopsis thaliana]
Length=699

 Score =   328 bits (841),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 195/235 (83%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +I+YITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNEIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ D+E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETDDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQAL+DS+   YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALKDSNTGGYMSSKKTMEINPENSIMDELRKRAEADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSI+E++A + DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIEEDDAVEADAEMPPL  684



>dbj|BAJ86355.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=700

 Score =   328 bits (840),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 218/236 (92%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEY++GQLKE++GK
Sbjct  453  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D +EE+K+K E K+K  E LCK+IKD+LGD+VEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDDSEEEKKRKEELKEKF-EGLCKVIKDVLGDRVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM  YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTMEINPENAIMEELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDE--EEAGDDADMPAL  142
            VKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKLGLSIDE  E A  D DMP L
Sbjct  632  VKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKLGLSIDEDDEPAEADTDMPPL  687



>gb|AGT98548.1| heat shock protein 90, partial [Paeonia lactiflora]
Length=302

 Score =   315 bits (807),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 217/235 (92%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKG EVL+MVDAIDE+AVGQLKE++GK
Sbjct  53   YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGIEVLYMVDAIDEHAVGQLKEFEGK  112

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLK ++ ++E+KK    K+  FE LCK+IKD+LGDKVEKVVVSDR+VDSPCC
Sbjct  113  KLVSATKEGLKFDESEDEKKKSEALKE-KFEGLCKVIKDVLGDKVEKVVVSDRVVDSPCC  171

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IMEELR+RAEADKNDKS
Sbjct  172  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMEELRERAEADKNDKS  231

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEA-GDDADMPAL  142
            VKDLV+LLFET+LLTSGFSLD+PNTFG RIHRMLKLGLSIDE+   GDDADMPAL
Sbjct  232  VKDLVVLLFETSLLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDAGEGDDADMPAL  286



>ref|XP_002509852.1| heat shock protein, putative [Ricinus communis]
 gb|EEF51239.1| heat shock protein, putative [Ricinus communis]
Length=703

 Score =   327 bits (839),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 200/235 (85%), Positives = 217/235 (92%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ+ IYYITGESKKAVENSPFLE+LKKKGYEVL MVDAIDEYAV  LKEYDGK
Sbjct  457  YVTRMKEGQQHIYYITGESKKAVENSPFLEKLKKKGYEVLLMVDAIDEYAVTHLKEYDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGL+LE+ +EE++KK E+ K SF+N CK IK+ILGD+VEKV+VSDRIVDSPCC
Sbjct  517  KLVSATKEGLQLEESEEEKQKKEEKMK-SFDNFCKKIKEILGDRVEKVMVSDRIVDSPCC  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS+YMSSKK MEINPDN IMEELRKRAEADKNDKS
Sbjct  576  LVTGEYGWTANMERIMKAQALRDSSMSAYMSSKKIMEINPDNSIMEELRKRAEADKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDD-ADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTF ARIHRMLKLGL I+E+EAG +  +MP L
Sbjct  636  VKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLGIEEDEAGAEYIEMPVL  690



>gb|KFK29176.1| hypothetical protein AALP_AA7G099100 [Arabis alpina]
Length=700

 Score =   327 bits (839),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 220/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQSDIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+K K E K+K  E LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKNKEELKEKF-EGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRAEADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEE--EAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSID++  E   DADMP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDDDAGETEADADMPPL  685



>ref|XP_009132299.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=699

 Score =   327 bits (837),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 223/235 (95%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ+DI+YITGESKKAVENSPFLE+LKKKG+EVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQEDIFYITGESKKAVENSPFLEKLKKKGFEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL + ++E+KKK E K+K  E LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLGESEDEKKKKEELKEKF-EGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRAEADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSIDE++A + DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDEDDAVEADAEMPPL  684



>dbj|BAK08690.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08693.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   326 bits (835),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 194/234 (83%), Positives = 222/234 (95%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMK+GQKDIYYITGESKKAVENSPFLE+LK++GYEVLFMVD IDEYAVGQLKEYDGK
Sbjct  453  YVTRMKDGQKDIYYITGESKKAVENSPFLEKLKRRGYEVLFMVDPIDEYAVGQLKEYDGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D +E++KKK E KK+  E+LCK++K+ILGDKVEKVVVSDRIVDSPCC
Sbjct  513  KLVSATKEGLKLDDTEEDKKKKEEIKKEF-ESLCKLMKEILGDKVEKVVVSDRIVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIM+AQALRDSSMSSYM+SKKTME+NP+N IM+EL+KRA+AD++DK+
Sbjct  572  LVTGEYGWTANMERIMRAQALRDSSMSSYMTSKKTMEVNPENAIMKELKKRADADRSDKT  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPN F +RIHRM+KLGLSIDE+ AG+D DMP L
Sbjct  632  VKDLVMLLFETALLTSGFSLDDPNMFASRIHRMIKLGLSIDEDAAGEDEDMPPL  685



>dbj|BAH97107.1| heat shock protein of Hsp90 [Chara braunii]
 dbj|BAK08668.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08669.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08670.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08671.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08672.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08673.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08674.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08675.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08676.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08677.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08678.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08679.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08680.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08681.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08682.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08683.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08684.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08685.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08686.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08687.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08688.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08689.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08692.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08694.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08695.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08696.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08697.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08698.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08699.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08700.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08701.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08702.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08703.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08704.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08705.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08706.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08707.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08708.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08709.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08710.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08711.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08712.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08713.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08714.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08715.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08716.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08717.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08718.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08719.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08720.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08721.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08722.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08723.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08724.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08725.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08726.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08727.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08729.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08730.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08731.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08732.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08733.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08736.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08737.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08738.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08739.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08740.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08832.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08833.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08834.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08835.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08836.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08837.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08838.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08839.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08840.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   326 bits (835),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 194/234 (83%), Positives = 222/234 (95%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMK+GQKDIYYITGESKKAVENSPFLE+LK++GYEVLFMVD IDEYAVGQLKEYDGK
Sbjct  453  YVTRMKDGQKDIYYITGESKKAVENSPFLEKLKRRGYEVLFMVDPIDEYAVGQLKEYDGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D +E++KKK E KK+  E+LCK++K+ILGDKVEKVVVSDRIVDSPCC
Sbjct  513  KLVSATKEGLKLDDTEEDKKKKEEIKKEF-ESLCKLMKEILGDKVEKVVVSDRIVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIM+AQALRDSSMSSYM+SKKTME+NP+N IM+EL+KRA+AD++DK+
Sbjct  572  LVTGEYGWTANMERIMRAQALRDSSMSSYMTSKKTMEVNPENAIMKELKKRADADRSDKT  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPN F +RIHRM+KLGLSIDE+ AG+D DMP L
Sbjct  632  VKDLVMLLFETALLTSGFSLDDPNMFASRIHRMIKLGLSIDEDAAGEDEDMPPL  685



>dbj|BAK08728.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   326 bits (835),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 194/234 (83%), Positives = 222/234 (95%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMK+GQKDIYYITGESKKAVENSPFLE+LK++GYEVLFMVD IDEYAVGQLKEYDGK
Sbjct  453  YVTRMKDGQKDIYYITGESKKAVENSPFLEKLKRRGYEVLFMVDPIDEYAVGQLKEYDGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D +E++KKK E KK+  E+LCK++K+ILGDKVEKVVVSDRIVDSPCC
Sbjct  513  KLVSATKEGLKLDDTEEDKKKKEEIKKEF-ESLCKLMKEILGDKVEKVVVSDRIVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIM+AQALRDSSMSSYM+SKKTME+NP+N IM+EL+KRA+AD++DK+
Sbjct  572  LVTGEYGWTANMERIMRAQALRDSSMSSYMTSKKTMEVNPENAIMKELKKRADADRSDKT  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPN F +RIHRM+KLGLSIDE+ AG+D DMP L
Sbjct  632  VKDLVMLLFETALLTSGFSLDDPNMFASRIHRMIKLGLSIDEDAAGEDEDMPPL  685



>dbj|BAG16518.1| putative Hsp90-2 [Capsicum chinense]
Length=699

 Score =   325 bits (834),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 196/234 (84%), Positives = 218/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEY++GQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK E K+K  E LCK++KD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKKKKEELKEKF-EGLCKVMKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSL++PNTFG RIHRMLKLGLSIDEE    D DMP L
Sbjct  630  VKDLVLLLFETALLTSGFSLEEPNTFGNRIHRMLKLGLSIDEEGGDADVDMPPL  683



>gb|ACX37413.1| cytosolic heat shock protein 90.1 [Dactylis glomerata]
Length=699

 Score =   325 bits (833),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 192/235 (82%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGESKKAVENSPFLE+L+KKGYEV++MVDAIDEYA+GQLKE++GK
Sbjct  453  YVTRMKEGQNEIYYITGESKKAVENSPFLEKLRKKGYEVIYMVDAIDEYAIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK+ E K+K  E LCK+IK++LGDKVEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDESEDEKKKQEELKEKF-EGLCKVIKEVLGDKVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAG-DDADMPAL  142
            VKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKLGLSIDE+EA  +D DMP L
Sbjct  632  VKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDEAPENDTDMPPL  686



>gb|KFK40163.1| hypothetical protein AALP_AA3G338900 [Arabis alpina]
Length=701

 Score =   325 bits (833),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 219/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  452  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  511

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KK  E K+K  E LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  512  KLVSATKEGLKLEETEDEKKKAEELKEKF-EGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRADADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEE--EAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSID++  E   DADMP L
Sbjct  631  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDDDAGETEADADMPPL  686



>gb|ABV89643.1| heat shock protein 81-4 [Brassica rapa]
Length=613

 Score =   323 bits (827),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 211/220 (96%), Gaps = 1/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ+DI+YITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  365  YVTRMKEGQEDIFYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  424

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  425  KLVSATKEGLKLEESEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  483

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  484  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENAIMDELRKRAEADKNDKS  543

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSI
Sbjct  544  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSI  583



>ref|XP_001779443.1| predicted protein [Physcomitrella patens]
 gb|EDQ55721.1| predicted protein [Physcomitrella patens]
Length=697

 Score =   324 bits (831),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 215/234 (92%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LK+KG EVL+MVDAIDEYAVGQLKEYDGK
Sbjct  450  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKRKGLEVLYMVDAIDEYAVGQLKEYDGK  509

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGL LED +EE+KKK E+K   FE LCK IKDILGDKVEKVVVSDRIVDSPC 
Sbjct  510  KLVSATKEGLMLEDTEEEKKKKEEKKT-RFEPLCKTIKDILGDKVEKVVVSDRIVDSPCV  568

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDN IMEELRKRAE DKNDKS
Sbjct  569  LVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNQIMEELRKRAEVDKNDKS  628

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSL++P+TFG RIHRMLKLGLSID++    + D+P L
Sbjct  629  VKDLVLLLFETALLTSGFSLEEPSTFGNRIHRMLKLGLSIDDDATDAEGDVPPL  682



>ref|XP_001780981.1| predicted protein [Physcomitrella patens]
 gb|EDQ54241.1| predicted protein [Physcomitrella patens]
Length=704

 Score =   324 bits (831),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 206/234 (88%), Positives = 218/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPFLE+LK++GYEVLFMVDAIDEYAVGQLKE+DGK
Sbjct  457  YVTRMKEGQKDIYYITGESKKAVENSPFLEKLKRRGYEVLFMVDAIDEYAVGQLKEFDGK  516

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGL LED +EE+KKK E+K   FE LCK IKDILGDKVEKVVVSDRIVDSPC 
Sbjct  517  KLVSATKEGLVLEDTEEEKKKKEEKKA-RFEPLCKTIKDILGDKVEKVVVSDRIVDSPCV  575

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSMSSYMSSKKTMEINPDN IMEELRKRAE DKNDKS
Sbjct  576  LVTGEYGWSANMERIMKAQALRDSSMSSYMSSKKTMEINPDNQIMEELRKRAEVDKNDKS  635

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSL++PNTFG RIHRMLKLGLSID++    DADMPAL
Sbjct  636  VKDLVLLLFETALLTSGFSLEEPNTFGNRIHRMLKLGLSIDDDATDADADMPAL  689



>ref|XP_001766228.1| predicted protein [Physcomitrella patens]
 gb|EDQ68860.1| predicted protein [Physcomitrella patens]
Length=701

 Score =   324 bits (830),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 204/234 (87%), Positives = 218/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LK++GYEVL+MVDAIDEYAVGQLKEYDGK
Sbjct  454  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKRRGYEVLYMVDAIDEYAVGQLKEYDGK  513

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGL LE+ +EE+KKK E+K   FE LCK +KDILGDKVEKVVVSDRIVDSPC 
Sbjct  514  KLVSATKEGLVLEETEEEKKKKEEKKA-QFETLCKTMKDILGDKVEKVVVSDRIVDSPCV  572

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSMSSYMSSKKTMEINPDN IMEELRKRAEADKNDKS
Sbjct  573  LVTGEYGWSANMERIMKAQALRDSSMSSYMSSKKTMEINPDNQIMEELRKRAEADKNDKS  632

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSL++PNTFG RIHRMLKLGLSID++    DADMPAL
Sbjct  633  VKDLVLLLFETALLTSGFSLEEPNTFGNRIHRMLKLGLSIDDDATDADADMPAL  686



>gb|AFR60309.1| HSP90 [Pelargonium peltatum]
Length=699

 Score =   324 bits (830),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 200/235 (85%), Positives = 219/235 (93%), Gaps = 1/235 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+L+KKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLRKKGYEVLYMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK     K+ FE LCK+IKD+LGDKVEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDETEDEKKKPNSPLKEKFEGLCKVIKDVLGDKVEKVVVSDRVVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM +YMSSKKTMEINPDNGIMEELRKRAE DKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDTSMGAYMSSKKTMEINPDNGIMEELRKRAEVDKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE-AGDDADMPAL  142
            VKDLVLLLFETALL SGFSLDDPNTF ARIHRMLKLGLSIDE++ AGDD +MP L
Sbjct  631  VKDLVLLLFETALLISGFSLDDPNTFAARIHRMLKLGLSIDEDDTAGDDTEMPPL  685



>gb|ABB84343.1| heat shock protein 90 [Triticum aestivum]
Length=659

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 219/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGESKKAVENSPFLE+LKKKGYEV++MVDAIDEYA+GQLKE++GK
Sbjct  417  YVTRMKEGQNEIYYITGESKKAVENSPFLEKLKKKGYEVIYMVDAIDEYAIGQLKEFEGK  476

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK+ E K+K  E LCK+IK++LGDKVEKV+VSDR+VDSPCC
Sbjct  477  KLVSATKEGLKLDESEDEKKKQEELKEKF-EGLCKVIKEVLGDKVEKVIVSDRVVDSPCC  535

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  536  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRADADKNDKS  595

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDE--EEAGDDADMPAL  142
            VKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKLGLSIDE  E   +D DMP L
Sbjct  596  VKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDDEAPENDTDMPPL  651



>ref|XP_009383207.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=700

 Score =   323 bits (829),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 199/234 (85%), Positives = 221/234 (94%), Gaps = 0/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  453  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D+ E+EKK++E  K+ FE LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDDESEDEKKRKEALKEKFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  572

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ +MSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  573  LVTGEYGWTANMERIMKAQALRDSSMAGHMSSKKTMEINPENQIMEELRKRADADKNDKS  632

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDL LLLFET+LLTSGFSLDDPNTFG RIHRMLKLGLSIDE+E  +D +MP+L
Sbjct  633  VKDLTLLLFETSLLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDEKVEDTEMPSL  686



>ref|XP_009132345.1| PREDICTED: heat shock protein 90-2 [Brassica rapa]
Length=699

 Score =   323 bits (829),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 211/220 (96%), Gaps = 1/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ+DI+YITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQEDIFYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEESEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENAIMDELRKRAEADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSI
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSI  669



>dbj|BAO20259.1| heat shock protein [Brassica rapa subsp. chinensis]
Length=699

 Score =   323 bits (828),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 211/220 (96%), Gaps = 1/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ+DI+YITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQEDIFYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEESEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENAIMDELRKRAEADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSI
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSI  669



>gb|ADF31760.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31769.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31774.1| heat shock protein 90 [Triticum urartu]
 gb|ADF31782.1| heat shock protein 90 [Triticum dicoccoides]
 gb|EMS53579.1| Heat shock protein 81-3 [Triticum urartu]
Length=700

 Score =   323 bits (828),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 219/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGESKKAVENSPFLE+LKKKGYEV++MVDAIDEYA+GQLKE++GK
Sbjct  453  YVTRMKEGQNEIYYITGESKKAVENSPFLEKLKKKGYEVIYMVDAIDEYAIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK+ E K+K  E LCK+IK++LGDKVEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDESEDEKKKQEELKEKF-EGLCKVIKEVLGDKVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDE--EEAGDDADMPAL  142
            VKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKLGLSIDE  E   +D DMP L
Sbjct  632  VKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDDEAPENDTDMPPL  687



>emb|CAJ19348.1| heat shock protein 90 [Triticum aestivum]
Length=658

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 219/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGESKKAVENSPFLE+LKKKGYEV++MVDAIDEYA+GQLKE++GK
Sbjct  411  YVTRMKEGQNEIYYITGESKKAVENSPFLEKLKKKGYEVIYMVDAIDEYAIGQLKEFEGK  470

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK+ E K+K  E LCK+IK++LGDKVEKV+VSDR+VDSPCC
Sbjct  471  KLVSATKEGLKLDESEDEKKKQEELKEKF-EGLCKVIKEVLGDKVEKVIVSDRVVDSPCC  529

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  530  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRADADKNDKS  589

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDE--EEAGDDADMPAL  142
            VKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKLGLSIDE  E   +D DMP L
Sbjct  590  VKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDDEAPENDTDMPPL  645



>gb|ABG57075.1| heat shock protein 90 [Triticum aestivum]
 gb|ABG57076.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31761.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31762.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31770.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31771.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31777.1| heat shock protein 90 [Aegilops tauschii]
 gb|ADF31783.1| heat shock protein 90 [Triticum dicoccoides]
 gb|AEK01109.1| heat shock protein 90 [Triticum aestivum]
 gb|AFH40333.1| heat shock protein 90 [Secale cereale]
Length=700

 Score =   323 bits (828),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 219/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGESKKAVENSPFLE+LKKKGYEV++MVDAIDEYA+GQLKE++GK
Sbjct  453  YVTRMKEGQNEIYYITGESKKAVENSPFLEKLKKKGYEVIYMVDAIDEYAIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK+ E K+K  E LCK+IK++LGDKVEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDESEDEKKKQEELKEKF-EGLCKVIKEVLGDKVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDE--EEAGDDADMPAL  142
            VKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKLGLSIDE  E   +D DMP L
Sbjct  632  VKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDDEAPENDTDMPPL  687



>gb|AAP87284.1| cytosolic heat shock protein 90 [Hordeum vulgare]
Length=700

 Score =   323 bits (827),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 219/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGESKKAVENSPFLE+LKKKGYEV++MVDAIDEYA+GQLKE++GK
Sbjct  453  YVTRMKEGQNEIYYITGESKKAVENSPFLEKLKKKGYEVIYMVDAIDEYAIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK+ E K+K  E LCK+IK++LGDKVEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDESEDEKKKQEELKEKF-EGLCKVIKEVLGDKVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDE--EEAGDDADMPAL  142
            VKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKLGLSIDE  E   +D DMP L
Sbjct  632  VKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDDEAPENDTDMPPL  687



>gb|EMT17245.1| Heat shock protein 81-3 [Aegilops tauschii]
Length=720

 Score =   323 bits (827),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 219/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGESKKAVENSPFLE+LKKKGYEV++MVDAIDEYA+GQLKE++GK
Sbjct  473  YVTRMKEGQNEIYYITGESKKAVENSPFLEKLKKKGYEVIYMVDAIDEYAIGQLKEFEGK  532

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK+ E K+K  E LCK+IK++LGDKVEKV+VSDR+VDSPCC
Sbjct  533  KLVSATKEGLKLDESEDEKKKQEELKEKF-EGLCKVIKEVLGDKVEKVIVSDRVVDSPCC  591

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  592  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRADADKNDKS  651

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDE--EEAGDDADMPAL  142
            VKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKLGLSIDE  E   +D DMP L
Sbjct  652  VKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDDEAPENDTDMPPL  707



>ref|XP_008238949.1| PREDICTED: heat shock protein 90-1-like [Prunus mume]
Length=710

 Score =   322 bits (826),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 215/236 (91%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGES KA+ENSPFLERLKKKGYEV+FMV+AIDEY VGQLKEYDGK
Sbjct  462  YVTRMKEGQNEIYYITGESNKAIENSPFLERLKKKGYEVIFMVNAIDEYVVGQLKEYDGK  521

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKE LKLED+ EEEK+K+EE+K+SFENLCK +KDIL D VEKVVVSDRIVDSPCC
Sbjct  522  KLVSATKERLKLEDESEEEKRKKEEQKQSFENLCKTMKDILRDIVEKVVVSDRIVDSPCC  581

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD ++ SYM+SKK MEINPDNGI+EELRKRA+ +KNDKS
Sbjct  582  LVTGEYGWTANMERIMKAQALRD-NIISYMASKKIMEINPDNGIVEELRKRADVNKNDKS  640

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDD--ADMPAL  142
            VKD+V+LLFET LLTSGFSLDDPNTF  RIHRMLKLGLSID+++ G D   D+P L
Sbjct  641  VKDIVMLLFETVLLTSGFSLDDPNTFAGRIHRMLKLGLSIDDDDPGLDGNVDVPPL  696



>ref|XP_008811147.1| PREDICTED: heat shock protein 81-1-like [Phoenix dactylifera]
Length=701

 Score =   322 bits (825),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 189/222 (85%), Positives = 209/222 (94%), Gaps = 1/222 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEY+VGQLKE++GK
Sbjct  453  YVTRMKEGQNEIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYSVGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+ KK   K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDESEDEKNKKEALKE-KFEGLCKVIKDVLGDKVEKVMVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKR+E DKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRSEVDKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDE  178
            VKDLVLLLFETALLTSGFSL++PNTFG RIHRMLKLGLSIDE
Sbjct  632  VKDLVLLLFETALLTSGFSLEEPNTFGNRIHRMLKLGLSIDE  673



>gb|KCW70450.1| hypothetical protein EUGRSUZ_F03673 [Eucalyptus grandis]
Length=518

 Score =   317 bits (811),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 198/234 (85%), Positives = 218/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ+DIYYITGESKKAVENSPFLE+L+KKGYEVL+MVDAIDEYAVGQLKEY+GK
Sbjct  270  YVTRMKEGQQDIYYITGESKKAVENSPFLEKLRKKGYEVLYMVDAIDEYAVGQLKEYEGK  329

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK  E K   FE LCK++KD+LGDKVEKVVVSDR+VDSPCC
Sbjct  330  KLVSATKEGLKLDESEDEKKKSEELKA-KFEGLCKVVKDVLGDKVEKVVVSDRVVDSPCC  388

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  389  LVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  448

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSIDE+    DADMP L
Sbjct  449  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDAPDGDADMPPL  502



>gb|KFK25886.1| hypothetical protein AALP_AA8G175000 [Arabis alpina]
Length=700

 Score =   321 bits (822),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 218/236 (92%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+K  E LCK++KD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKDELKEKF-EGLCKVMKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDS+   YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSNTGGYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEE--EAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSID++  E   DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDDDAGETEADAEMPPL  685



>dbj|BAJ99646.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=700

 Score =   321 bits (822),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 219/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEG+ +IYYITGESKKAVENSPFLE+LKKKGYEV++MVDAIDEYA+GQLKE++GK
Sbjct  453  YVTRMKEGRNEIYYITGESKKAVENSPFLEKLKKKGYEVIYMVDAIDEYAIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK+ E K+K  E LCK+IK++LGDKVEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDESEDEKKKQEELKEKF-EGLCKVIKEVLGDKVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDE--EEAGDDADMPAL  142
            VKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKLGLSIDE  E   +D DMP L
Sbjct  632  VKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDDEAPENDTDMPPL  687



>gb|KJB13948.1| hypothetical protein B456_002G103000 [Gossypium raimondii]
Length=594

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 209/220 (95%), Gaps = 1/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  346  YVTRMKEGQDDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  405

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK   K+K  E LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  406  KLVSATKEGLKLDESEDEKKKKEALKEKF-EGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  464

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  465  LVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  524

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSI
Sbjct  525  VKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSI  564



>ref|XP_002866122.1| heat shock protein 81-4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42381.1| heat shock protein 81-4 [Arabidopsis lyrata subsp. lyrata]
Length=699

 Score =   320 bits (820),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 189/220 (86%), Positives = 210/220 (95%), Gaps = 1/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDS+  SYMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSNTGSYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSI
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSI  669



>ref|XP_002864424.1| heat shock protein 81-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40683.1| heat shock protein 81-3 [Arabidopsis lyrata subsp. lyrata]
Length=685

 Score =   320 bits (819),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 191/220 (87%), Positives = 209/220 (95%), Gaps = 1/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLERLKKKG EVL+MVDAIDEYA+GQLKE++GK
Sbjct  437  YVTRMKEGQNDIFYITGESKKAVENSPFLERLKKKGIEVLYMVDAIDEYAIGQLKEFEGK  496

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E+KKK E K+  FE LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  497  KLVSATKEGLKLEETEDEKKKKEELKE-KFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  555

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  556  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRAEADKNDKS  615

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSI
Sbjct  616  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSI  655



>ref|XP_009417329.1| PREDICTED: heat shock protein 81-1 [Musa acuminata subsp. malaccensis]
Length=699

 Score =   320 bits (820),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 199/234 (85%), Positives = 218/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  453  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+K+K   K+  FE LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDESEDEKKRKETLKE-KFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDL LLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+E  +D DMP L
Sbjct  632  VKDLTLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDEKVEDTDMPTL  685



>ref|XP_009390627.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=700

 Score =   320 bits (819),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 199/234 (85%), Positives = 217/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  453  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ D+E+ +K   K+  FE LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDESDDEKTRKEALKE-KFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDL LLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+E  +D DMP L
Sbjct  632  VKDLTLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDEKVEDTDMPTL  685



>ref|XP_009420064.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=698

 Score =   320 bits (819),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 197/234 (84%), Positives = 217/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  452  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  511

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KL+SATKEGLKL++ ++E+K+    K+  FE LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  512  KLLSATKEGLKLDESEDEKKRTEVLKE-KFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDL LLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+E  +D DMP L
Sbjct  631  VKDLTLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDEKAEDTDMPPL  684



>ref|XP_010103960.1| Heat shock cognate protein 80 [Morus notabilis]
 gb|EXB97663.1| Heat shock cognate protein 80 [Morus notabilis]
Length=732

 Score =   320 bits (821),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 201/234 (86%), Positives = 218/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQTDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E++ K  +K+  FE LCK+IKD+LGDKVEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEESEDEKQTKEAQKE-KFEGLCKVIKDVLGDKVEKVVVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+    DADMP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDAVEGDADMPPL  683



>dbj|BAD95027.1| heat shock protein 90 [Arabidopsis thaliana]
Length=373

 Score =   310 bits (793),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 188/220 (85%), Positives = 209/220 (95%), Gaps = 1/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKG EVL+MVDAIDEYA+GQLKE++GK
Sbjct  125  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGIEVLYMVDAIDEYAIGQLKEFEGK  184

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK E K+K  E LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  185  KLVSATKEGLKLDETEDEKKKKEELKEKF-EGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  243

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  244  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRADADKNDKS  303

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSI
Sbjct  304  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSI  343



>gb|AAH08189.1| Unknown (protein for IMAGE:3584589), partial [Mus musculus]
Length=491

 Score =   313 bits (802),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 220/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGE+KKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  244  YVTRMKEGQNDIFYITGETKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  303

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK  E K+  FE LCK++KD+LGDKVEKVVVSDR+VDSPCC
Sbjct  304  KLVSATKEGLKLDESEDEKKKSEESKE-KFEGLCKVMKDVLGDKVEKVVVSDRVVDSPCC  362

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  363  LVTGEYGWSANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  422

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLL ETALLTSGFSLDDPNTFG RIHRMLKLGLSID++ AG+ D DMPAL
Sbjct  423  VKDLVLLLHETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDDDAAGEVDVDMPAL  477



>gb|KJB13949.1| hypothetical protein B456_002G103000 [Gossypium raimondii]
Length=699

 Score =   319 bits (817),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 209/220 (95%), Gaps = 1/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQDDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK   K+K  E LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKKKKEALKEKF-EGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSI
Sbjct  630  VKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSI  669



>ref|XP_003574727.1| PREDICTED: heat shock protein 81-1 [Brachypodium distachyon]
Length=699

 Score =   319 bits (817),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 191/220 (87%), Positives = 208/220 (95%), Gaps = 1/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYA+GQLKE++GK
Sbjct  452  YVTRMKEGQNDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAIGQLKEFEGK  511

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLED ++E+K+K E K+K  E LCK+IKD+LGD+VEKV+VSDR+VDSPCC
Sbjct  512  KLVSATKEGLKLEDSEDEKKRKEELKEKF-EGLCKVIKDVLGDRVEKVIVSDRVVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IMEELRKRA+ DKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENAIMEELRKRADDDKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKLGLSI
Sbjct  631  VKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKLGLSI  670



>ref|XP_009132342.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=698

 Score =   318 bits (816),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 191/220 (87%), Positives = 211/220 (96%), Gaps = 1/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ+DI+YITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  450  YVTRMKEGQEDIFYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  509

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL + ++E+KKK E K+K  E LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  510  KLVSATKEGLKLGESEDEKKKKEELKEKF-EGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  568

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  569  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRAEADKNDKS  628

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSI
Sbjct  629  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSI  668



>gb|AAB33937.1| heat-shock Protein [Arabidopsis thaliana]
Length=699

 Score =   318 bits (816),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 193/235 (82%), Positives = 220/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKG EVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGIEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK E  +K  E LCK+IKD+LGDKVEKV+VSDR++DSPCC
Sbjct  511  KLVSATKEGLKLDETEDEKKKKEELNEKF-EGLCKVIKDVLGDKVEKVIVSDRVLDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM  YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENLIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSI+E++A + DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIEEDDAVEADAEMPPL  684



>gb|KCW70451.1| hypothetical protein EUGRSUZ_F03673 [Eucalyptus grandis]
Length=619

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 198/234 (85%), Positives = 218/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ+DIYYITGESKKAVENSPFLE+L+KKGYEVL+MVDAIDEYAVGQLKEY+GK
Sbjct  371  YVTRMKEGQQDIYYITGESKKAVENSPFLEKLRKKGYEVLYMVDAIDEYAVGQLKEYEGK  430

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK  E K   FE LCK++KD+LGDKVEKVVVSDR+VDSPCC
Sbjct  431  KLVSATKEGLKLDESEDEKKKSEELKA-KFEGLCKVVKDVLGDKVEKVVVSDRVVDSPCC  489

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  490  LVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  549

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSIDE+    DADMP L
Sbjct  550  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDAPDGDADMPPL  603



>gb|EEC84770.1| hypothetical protein OsI_31800 [Oryza sativa Indica Group]
Length=243

 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 192/231 (83%), Positives = 218/231 (94%), Gaps = 2/231 (1%)
 Frame = -3

Query  831  MKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGKKLVS  652
            MKEGQ +IYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GKKLVS
Sbjct  1    MKEGQSEIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVS  60

Query  651  ATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCCLVTG  472
            ATKEGLKL++ ++E+K++ E K+  FE LCK+IK++LGDKVEKVVVSDR+VDSPCCLVTG
Sbjct  61   ATKEGLKLDESEDEKKRQEELKE-KFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTG  119

Query  471  EYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKSVKDl  292
            EYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKSVKDL
Sbjct  120  EYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRADADKNDKSVKDL  179

Query  291  vlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            V+LLFETALLTSGFSL+DPNTFG RIHRMLKLGLSIDE+E+ + DADMP L
Sbjct  180  VMLLFETALLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDESAEADADMPPL  230



>gb|KHG22758.1| Heat shock cognate 80 [Gossypium arboreum]
Length=699

 Score =   318 bits (815),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 191/220 (87%), Positives = 208/220 (95%), Gaps = 1/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK   K+K  E LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKKKKEALKEKF-EGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ DKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADTDKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSI
Sbjct  630  VKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSI  669



>ref|XP_001419938.1| Heat Shock Protein 90, cytosolic [Ostreococcus lucimarinus CCE9901]
 gb|ABO98231.1| Heat Shock Protein 90, cytosolic [Ostreococcus lucimarinus CCE9901]
Length=699

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 187/234 (80%), Positives = 213/234 (91%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQKDIYYITGESKKAVENSPF+E+LKK+GYEVLFM D IDEYAV QLKEYDGK
Sbjct  453  YVTRMKEGQKDIYYITGESKKAVENSPFIEKLKKRGYEVLFMTDPIDEYAVQQLKEYDGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVS TKEGL+L++ +EE+K+K E K   +ENLC++IKDILGDK+EK VVSDR+VDSPC 
Sbjct  513  KLVSVTKEGLELDETEEEKKQKEEVKA-QYENLCRLIKDILGDKIEKCVVSDRVVDSPCV  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRD+SM SYMSSKKTMEINPDN IM+ELRKRA+ADK DK+
Sbjct  572  LVTGEYGWSANMERIMKAQALRDNSMGSYMSSKKTMEINPDNSIMKELRKRADADKGDKT  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLL+FETA+LTSGFSLD+P TFG RIHRM+KLGLSIDE++A    D+PAL
Sbjct  632  VKDLVLLVFETAMLTSGFSLDEPTTFGGRIHRMIKLGLSIDEDDAPAVDDLPAL  685



>gb|KHG19401.1| Heat shock cognate 80 [Gossypium arboreum]
Length=699

 Score =   317 bits (812),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 190/220 (86%), Positives = 209/220 (95%), Gaps = 1/220 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK   K+K  E LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKKKKEALKEKF-EGLCKVIKDVLGDKVEKVMVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI  184
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSI
Sbjct  630  VKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSI  669



>ref|NP_001274833.1| Hsp90-2-like [Solanum tuberosum]
 gb|ABB55365.1| Hsp90-2-like [Solanum tuberosum]
Length=700

 Score =   317 bits (811),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 189/235 (80%), Positives = 211/235 (90%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEY++GQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEG  L    +E+KK+ E K+K  E LCK++KD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGSSLMRVKDEKKKQEELKEKF-EGLCKVMKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDP-NTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETA LTSGFSL++P +    RIHRMLKLGLSIDEE    DADMPAL
Sbjct  630  VKDLVLLLFETAFLTSGFSLEEPKHLLANRIHRMLKLGLSIDEESGDVDADMPAL  684



>gb|EYU31897.1| hypothetical protein MIMGU_mgv1a002208mg [Erythranthe guttata]
Length=701

 Score =   316 bits (810),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 192/235 (82%), Positives = 216/235 (92%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKE Q +IYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  452  YVTRMKESQNEIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  511

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK E K+K  E LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  512  KLVSATKEGLKLDESEDEKKKKEELKQKF-EGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQAL+ SS   YM+SKKTMEINP+N IM+ELRKRA++DKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALKGSSAGGYMASKKTMEINPENSIMDELRKRADSDKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSL++PNTFG RI RMLKLGLSID++E GD D DMP L
Sbjct  631  VKDLVLLLFETALLTSGFSLEEPNTFGNRIFRMLKLGLSIDDDEGGDADLDMPEL  685



>emb|CDP13679.1| unnamed protein product [Coffea canephora]
Length=681

 Score =   316 bits (809),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 207/219 (95%), Gaps = 1/219 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVEN PFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENCPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK   K+K  E LCK+IKD+LGDKVEKV+VSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKKKKETLKEKF-EGLCKVIKDVLGDKVEKVIVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLS  187
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLS
Sbjct  630  VKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLS  668



>gb|KCW79839.1| hypothetical protein EUGRSUZ_C01179 [Eucalyptus grandis]
Length=691

 Score =   316 bits (809),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 198/234 (85%), Positives = 219/234 (94%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  441  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  500

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK  E K   FE+LCK+IKD+LGD+VEKVVVSDR+VDSPCC
Sbjct  501  KLVSATKEGLKLDESEDEKKKAEELKA-KFEDLCKVIKDVLGDRVEKVVVSDRVVDSPCC  559

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  560  LVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMDELRKRADADKNDKS  619

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSIDE+    DADMP L
Sbjct  620  VKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEDAGEGDADMPPL  673



>gb|AAD11549.1| heat shock protein 80 [Triticum aestivum]
Length=700

 Score =   316 bits (810),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 217/236 (92%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEY++GQLKE++GK
Sbjct  453  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D +EE+K+K E K+K  E LCK+IK++LGD+VEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDDSEEEKKRKEELKEKF-EGLCKVIKEVLGDRVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM  YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTMEINPENAIMEELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI--DEEEAGDDADMPAL  142
            VKDLV+LLFE +LLTSGFSLDDPNTFG RIHRMLKLGLSI  DEE A  D DMP L
Sbjct  632  VKDLVMLLFENSLLTSGFSLDDPNTFGTRIHRMLKLGLSIDEDEEAAEADTDMPPL  687



>gb|AFQ94045.1| heat shock protein 90 [Lactuca sativa]
Length=698

 Score =   316 bits (810),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 197/234 (84%), Positives = 218/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKG EVL+MVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGIEVLYMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E++K+   K+  FE LCK+IKD+LGDKVEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKQKQDALKE-KFEGLCKVIKDVLGDKVEKVVVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRAEADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMEELRKRAEADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFET+LLTSGFSLD+PNTFG RIHRMLKLGLSIDE+    DAD+PAL
Sbjct  630  VKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDTVDGDADIPAL  683



>gb|ADF31758.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31767.1| heat shock protein 90 [Triticum aestivum]
Length=700

 Score =   316 bits (810),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 218/236 (92%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEY++GQLKE++GK
Sbjct  453  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D +EE+K+K E K+K  E LCK+IK++LGD+VEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDDSEEEKKRKEELKEKF-EGLCKVIKEVLGDRVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM  YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTMEINPENAIMEELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI--DEEEAGDDADMPAL  142
            VKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKLGLSI  DEE A  D DMP L
Sbjct  632  VKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKLGLSIDEDEEAAEADTDMPPL  687



>gb|EMS59444.1| Heat shock protein 81-3 [Triticum urartu]
Length=700

 Score =   316 bits (810),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 218/236 (92%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEY++GQLKE++GK
Sbjct  453  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D +EE+K+K E K+K  E LCK+IK++LGD+VEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDDSEEEKKRKEELKEKF-EGLCKVIKEVLGDRVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM  YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTMEINPENAIMEELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI--DEEEAGDDADMPAL  142
            VKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKLGLSI  DEE A  D DMP L
Sbjct  632  VKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKLGLSIDEDEEAAEADTDMPPL  687



>ref|XP_010063241.1| PREDICTED: heat shock cognate protein 80-like [Eucalyptus grandis]
 gb|KCW70449.1| hypothetical protein EUGRSUZ_F03673 [Eucalyptus grandis]
Length=703

 Score =   316 bits (810),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 198/234 (85%), Positives = 218/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ+DIYYITGESKKAVENSPFLE+L+KKGYEVL+MVDAIDEYAVGQLKEY+GK
Sbjct  455  YVTRMKEGQQDIYYITGESKKAVENSPFLEKLRKKGYEVLYMVDAIDEYAVGQLKEYEGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK  E K   FE LCK++KD+LGDKVEKVVVSDR+VDSPCC
Sbjct  515  KLVSATKEGLKLDESEDEKKKSEELKA-KFEGLCKVVKDVLGDKVEKVVVSDRVVDSPCC  573

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  574  LVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  633

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSIDE+    DADMP L
Sbjct  634  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDAPDGDADMPPL  687



>gb|ADF31773.1| heat shock protein 90 [Triticum urartu]
Length=700

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 218/236 (92%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEY++GQLKE++GK
Sbjct  453  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D +EE+K+K E K+K  E LCK+IK++LGD+VEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDDSEEEKKRKEELKEKF-EGLCKVIKEVLGDRVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM  YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTMEINPENAIMEELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI--DEEEAGDDADMPAL  142
            VKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKLGLSI  DEE A  D DMP L
Sbjct  632  VKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKLGLSIDEDEEAAEADTDMPPL  687



>ref|XP_010047845.1| PREDICTED: LOW QUALITY PROTEIN: heat shock cognate protein 80-like 
[Eucalyptus grandis]
Length=702

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 198/234 (85%), Positives = 219/234 (94%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  452  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  511

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK  E K   FE+LCK+IKD+LGD+VEKVVVSDR+VDSPCC
Sbjct  512  KLVSATKEGLKLDESEDEKKKAEELKA-KFEDLCKVIKDVLGDRVEKVVVSDRVVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMDELRKRADADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSIDE+    DADMP L
Sbjct  631  VKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEDAGEGDADMPPL  684



>ref|XP_006857538.1| hypothetical protein AMTR_s00061p00036160 [Amborella trichopoda]
 gb|ERN19005.1| hypothetical protein AMTR_s00061p00036160 [Amborella trichopoda]
Length=699

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 201/236 (85%), Positives = 217/236 (92%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKEY+GK
Sbjct  451  YVTRMKEGQSEIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK       FE LCK+IKDILGDKVEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKKKKESLMA-KFEGLCKVIKDILGDKVEKVVVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDS+MS YMSSKKTMEINP+N IMEELRKRA+ DKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSNMSGYMSSKKTMEINPENAIMEELRKRADVDKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEE--AGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE++  A  D+DMP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDDTAAEQDSDMPPL  685



>ref|XP_004974826.1| PREDICTED: heat shock protein 81-1-like [Setaria italica]
Length=643

 Score =   314 bits (805),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  397  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  456

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+K++ E K+  FE LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  457  KLVSATKEGLKLDETEDEKKRQEELKE-KFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  515

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINP+N IMEELRKRAEADKNDKS
Sbjct  516  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPENAIMEELRKRAEADKNDKS  575

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLV+LLFETALLTSGFSLD+PNTFG+RIHRMLKLGLSIDE+E  + + DMP L
Sbjct  576  VKDLVMLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDEDETTEAETDMPPL  630



>tpg|DAA40367.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=365

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKK+GYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  119  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKRGYEVLYMVDAIDEYAVGQLKEFEGK  178

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+K+K E K+K  E LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  179  KLVSATKEGLKLDETEDEKKRKEELKEKF-EGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  237

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  238  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMDELRKRAEADKNDKS  297

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+E  + +A+MP L
Sbjct  298  VKDLVMLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDEPVEAEAEMPQL  352



>ref|XP_004973824.1| PREDICTED: heat shock protein 81-1-like [Setaria italica]
Length=698

 Score =   315 bits (807),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 220/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRM EGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  452  YVTRMMEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  511

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+K++ E K+  FE LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  512  KLVSATKEGLKLDETEDEKKRQEELKE-KFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINP+N IMEELRKRAEADKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPENAIMEELRKRAEADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSIDE+E  + D DMP L
Sbjct  631  VKDLVMLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEDETPEADTDMPPL  685



>ref|XP_002532177.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30214.1| heat shock protein, putative [Ricinus communis]
Length=698

 Score =   315 bits (806),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 196/234 (84%), Positives = 218/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  450  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  509

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLK+++ ++E++KK + K+  FE LCK+IKD+LGD+VEKVVVSDR+VDSPCC
Sbjct  510  KLVSATKEGLKIDESEDEKQKKEQLKE-KFEGLCKVIKDVLGDRVEKVVVSDRVVDSPCC  568

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIM+AQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  569  LVTGEYGWTANMERIMRAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  628

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+    D DMP L
Sbjct  629  VKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDAGEGDGDMPPL  682



>ref|NP_001240230.1| uncharacterized protein LOC100819568 [Glycine max]
 gb|ADC45396.1| HSP90-2 [Glycine max]
 gb|KHN01774.1| Heat shock cognate protein 80 [Glycine soja]
Length=699

 Score =   315 bits (806),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 198/234 (85%), Positives = 220/234 (94%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK+ E K+  F+NLCK+IKD+LGDKVEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKKKQEELKE-KFDNLCKVIKDVLGDKVEKVVVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSIDE+    DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDAGEADAEMPPL  683



>ref|XP_010675973.1| PREDICTED: heat shock cognate protein 80 [Beta vulgaris subsp. 
vulgaris]
Length=698

 Score =   315 bits (806),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 220/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGE+KKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQNDIFYITGETKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK  E K+  FE LCK++KD+LGDKVEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKKKSEESKE-KFEGLCKVMKDVLGDKVEKVVVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWSANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLL ETALLTSGFSLDDPNTFG RIHRMLKLGLSID++ AG+ D DMPAL
Sbjct  630  VKDLVLLLHETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDDDAAGEVDVDMPAL  684



>gb|ADF31759.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31768.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31776.1| heat shock protein 90 [Aegilops tauschii]
 gb|EMT03701.1| Heat shock protein 81-3 [Aegilops tauschii]
Length=700

 Score =   315 bits (806),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 217/236 (92%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEY++GQLKE++GK
Sbjct  453  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D +EE+K+K E K+K  E LCK+IK++LGD+VEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDDSEEEKKRKEELKEKF-EGLCKVIKEVLGDRVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM  YMSSKKTMEINP+N IMEELRKRA+ DKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTMEINPENAIMEELRKRADVDKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI--DEEEAGDDADMPAL  142
            VKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKLGLSI  DEE A  D DMP L
Sbjct  632  VKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKLGLSIDEDEEAAEADTDMPPL  687



>gb|AHB36893.1| heat shock protein 90 [Matricaria chamomilla var. recutita]
Length=698

 Score =   315 bits (806),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 198/234 (85%), Positives = 219/234 (94%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKE Q+DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKESQQDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ D+E+ K+   K+  FE LCK++KD+LGDKVEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETDDEKAKQEALKE-KFEGLCKVMKDVLGDKVEKVVVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSI E+ A +DAD+PAL
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIYEDAADEDADVPAL  683



>gb|AGU99972.1| HSP90 [Populus tomentosa]
Length=699

 Score =   314 bits (805),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 198/234 (85%), Positives = 219/234 (94%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E++K+ E K+  FE LCK+IKD+LGDKVEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKQKQEELKQ-KFEGLCKVIKDVLGDKVEKVVVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIM+AQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMRAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSIDE+    DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDAVEADAEMPPL  683



>gb|ADF31781.1| heat shock protein 90 [Triticum dicoccoides]
Length=700

 Score =   314 bits (805),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 217/236 (92%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEY++GQLKE++GK
Sbjct  453  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL+D +EE+K+K E K+K  E LCK+IK++LGD+VEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDDSEEEKKRKEELKEKF-EGLCKVIKEVLGDRVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM  YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTMEINPENAIMEELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSI--DEEEAGDDADMPAL  142
            VKDLV+LLFET+LLTSGF LDDPNTFG RIHRMLKLGLSI  DEE A  D DMP L
Sbjct  632  VKDLVMLLFETSLLTSGFCLDDPNTFGTRIHRMLKLGLSIDEDEEAAEADTDMPPL  687



>ref|NP_001063503.1| Os09g0482400 [Oryza sativa Japonica Group]
 ref|NP_001175894.1| Os09g0482610 [Oryza sativa Japonica Group]
 sp|Q07078.2|HSP83_ORYSJ RecName: Full=Heat shock protein 81-3; Short=HSP81-3; AltName: 
Full=Gravity-specific protein GSC 381 [Oryza sativa Japonica 
Group]
 dbj|BAD33409.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAF25417.1| Os09g0482400 [Oryza sativa Japonica Group]
 gb|ACJ54894.1| heat shock protein [Oryza sativa Japonica Group]
 dbj|BAG88166.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01431.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH94622.1| Os09g0482610 [Oryza sativa Japonica Group]
Length=699

 Score =   314 bits (805),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 222/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  453  YVTRMKEGQSEIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+K++ E K+  FE LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDESEDEKKRQEELKE-KFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLV+LLFETALLTSGFSL+DPNTFG RIHRMLKLGLSIDE+E+ + DADMP L
Sbjct  632  VKDLVMLLFETALLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDESAEADADMPPL  686



>ref|XP_002299048.1| hypothetical protein POPTR_0001s47020g [Populus trichocarpa]
 gb|EEE83853.1| hypothetical protein POPTR_0001s47020g [Populus trichocarpa]
Length=699

 Score =   314 bits (805),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 197/234 (84%), Positives = 219/234 (94%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKLE+ ++E++K+ E K+  FE LCK+IKD+LGDKVEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLEETEDEKQKQEELKQ-KFEGLCKVIKDVLGDKVEKVVVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIM+AQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMRAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSIDE+    DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDAVEADAEMPPL  683



>ref|NP_001063500.1| Os09g0482100 [Oryza sativa Japonica Group]
 sp|Q69QQ6.1|HSP82_ORYSJ RecName: Full=Heat shock protein 81-2; Short=HSP81-2; AltName: 
Full=Heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD33406.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAF25414.1| Os09g0482100 [Oryza sativa Japonica Group]
Length=699

 Score =   314 bits (804),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 222/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  453  YVTRMKEGQSEIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+K++ E K+  FE LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDESEDEKKRQEELKE-KFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLV+LLFETALLTSGFSL+DPNTFG RIHRMLKLGLSIDE+E+ + DADMP L
Sbjct  632  VKDLVMLLFETALLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDESAEADADMPPL  686



>ref|NP_001275844.1| HSP90 protein [Citrus sinensis]
 gb|AFF58924.1| Hsp90 [Citrus sinensis]
Length=700

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 201/235 (86%), Positives = 219/235 (93%), Gaps = 3/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  452  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  511

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+K K   K+  FE LCK+IKD+LGDKVEKVVVSDR+VDSPCC
Sbjct  512  KLVSATKEGLKLDESEDEKKMKETLKE-KFEGLCKVIKDVLGDKVEKVVVSDRVVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VK LVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSI EE+AGD DADMP L
Sbjct  631  VKGLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSI-EEDAGDADADMPPL  684



>ref|NP_001170475.1| LOC100384473 [Zea mays]
 gb|ACO35045.1| heat shock protein 90 [Zea mays]
Length=697

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 202/235 (86%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+K+K E K+K  E LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKKRKEELKEKF-EGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINPDN IMEELRKRAEADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNAIMEELRKRAEADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+EA + D DMP L
Sbjct  630  VKDLVMLLFETALLTSGFSLDDPNTFGGRIHRMLKLGLSIDEDEAPEADTDMPPL  684



>ref|XP_011039800.1| PREDICTED: heat shock protein 90-2 [Populus euphratica]
Length=699

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 196/234 (84%), Positives = 219/234 (94%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E++K+ E K+  FE LCK+IKD+LGDKVEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDETEDEKQKQEELKQ-KFEGLCKVIKDVLGDKVEKVVVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIM+AQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMRAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLD+PNTFG RIHRMLKLGLSIDE+    DA+MP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDAVEADAEMPPL  683



>dbj|BAD04054.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|EAZ09522.1| hypothetical protein OsI_31797 [Oryza sativa Indica Group]
Length=699

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 222/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  453  YVTRMKEGQSEIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+K++ E K+  FE LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDESEDEKKRQEELKE-KFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+ELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLV+LLFETALLTSGFSL+DPNTFG RIHRMLKLGLSIDE+E+ + DADMP L
Sbjct  632  VKDLVMLLFETALLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDESAEADADMPPL  686



>ref|XP_004135593.1| PREDICTED: heat shock cognate protein 80-like [Cucumis sativus]
Length=699

 Score =   314 bits (804),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 195/234 (83%), Positives = 217/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DI+YITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK    +  FE LCK+IKD+LGDKVEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKKKKEALVE-KFEGLCKVIKDVLGDKVEKVVVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQAL+D+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALKDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFET+LLTSGFSLD+PNTFG RIHRMLKLGLSIDEE    D++MP L
Sbjct  630  VKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRMLKLGLSIDEESGEGDSEMPPL  683



>gb|KDP32613.1| hypothetical protein JCGZ_13163 [Jatropha curcas]
Length=699

 Score =   313 bits (803),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 199/234 (85%), Positives = 221/234 (94%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLK+++ ++E+K+K E+K+K  E LCK+IKD+LGD+VEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKIDESEDEKKRKEEQKEKF-EGLCKVIKDVLGDRVEKVVVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIM+AQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMRAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+    DADMPAL
Sbjct  630  VKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDAGEGDADMPAL  683



>ref|XP_010928158.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=702

 Score =   313 bits (803),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 203/235 (86%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLERLKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  455  YVTRMKEGQNDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  514

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KL+SATKEGLKL++ ++E+KKK   K+K  E LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  515  KLLSATKEGLKLDESEDEKKKKEALKEKF-EGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  573

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRAEADKNDKS
Sbjct  574  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRAEADKNDKS  633

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+E  D DADMP+L
Sbjct  634  VKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDEIVDADADMPSL  688



>ref|XP_006659553.1| PREDICTED: heat shock protein 81-1-like [Oryza brachyantha]
Length=699

 Score =   313 bits (803),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 200/235 (85%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  453  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+K+K E K+K  E LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDESEDEKKRKEELKEKF-EGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMEELRKRADADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSIDEEE  + D DMP L
Sbjct  632  VKDLVMLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEEETAEADTDMPPL  686



>ref|XP_006659612.1| PREDICTED: heat shock protein 81-1-like [Oryza brachyantha]
Length=686

 Score =   313 bits (801),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  440  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  499

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+K+K E K+K  E LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  500  KLVSATKEGLKLDESEDEKKRKEELKEKF-EGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  558

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+  MSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  559  LVTGEYGWTANMERIMKAQALRDSSMAGDMSSKKTMEINPENAIMEELRKRADADKNDKS  618

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSIDE+EA + D DMP L
Sbjct  619  VKDLVMLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEDEAAEVDTDMPPL  673



>ref|XP_002444804.1| hypothetical protein SORBIDRAFT_07g028270 [Sorghum bicolor]
 gb|EES14299.1| hypothetical protein SORBIDRAFT_07g028270 [Sorghum bicolor]
Length=698

 Score =   313 bits (802),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 202/235 (86%), Positives = 222/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYA+GQLKE++GK
Sbjct  452  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGK  511

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK E K+K  E LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  512  KLVSATKEGLKLDESEDEKKKKEELKEKF-EGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  570

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINP+N IMEELRKRAEADKNDKS
Sbjct  571  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPENAIMEELRKRAEADKNDKS  630

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSIDE+EA + D DMP L
Sbjct  631  VKDLVMLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEDEAPEADTDMPPL  685



>ref|XP_003081563.1| Molecular chaperone (HSP90 family) (ISS) [Ostreococcus tauri]
Length=429

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 183/234 (78%), Positives = 212/234 (91%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQK IYYITGESKK+VENSPF+E+LKK+GYEVL+M D IDEYAV QLKEYDGK
Sbjct  183  YVTRMKEGQKSIYYITGESKKSVENSPFIEKLKKRGYEVLYMTDPIDEYAVQQLKEYDGK  242

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVS TKEGL+L++ +EE+K+K E     +ENLC++IKDILGDK+EK +VSDR+VDSPC 
Sbjct  243  KLVSCTKEGLELDETEEEKKQKEEVAA-QYENLCRLIKDILGDKIEKCIVSDRVVDSPCV  301

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRD+SMSSYMSSKKTMEINPDN IM+ELRKRA+ADK DK+
Sbjct  302  LVTGEYGWSANMERIMKAQALRDNSMSSYMSSKKTMEINPDNSIMKELRKRADADKGDKT  361

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLL+FETA+LTSGFSLD+P TFG RIHRM+KLGLSIDE++A    D+PAL
Sbjct  362  VKDLVLLVFETAMLTSGFSLDEPTTFGGRIHRMIKLGLSIDEDDAPVADDLPAL  415



>tpg|DAA61993.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=429

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 222/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKK+GYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  183  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKRGYEVLYMVDAIDEYAVGQLKEFEGK  242

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+K+K E K+K  E LCKIIK++LGDKVEKVVVSDR+VDSPCC
Sbjct  243  KLVSATKEGLKLDETEDEKKRKEELKEKF-EGLCKIIKEVLGDKVEKVVVSDRVVDSPCC  301

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSMS YMSSKKTMEINP+N IM+ELRKRAEADKNDKS
Sbjct  302  LVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPENPIMDELRKRAEADKNDKS  361

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLV+LLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+++ + +A+MP L
Sbjct  362  VKDLVMLLFETALLTSGFSLDDPNTFGTRIHRMLKLGLSIDEDKSAEAEAEMPPL  416



>dbj|BAD73667.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAD73668.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
Length=614

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 200/235 (85%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  368  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  427

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+K+K E K+K  E LCK+IK++LGDKVEKVVVSDR+VDSPCC
Sbjct  428  KLVSATKEGLKLDESEDEKKRKEELKEKF-EGLCKVIKEVLGDKVEKVVVSDRVVDSPCC  486

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  487  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMEELRKRADADKNDKS  546

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSIDE+E  + D DMP L
Sbjct  547  VKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEDETAEADTDMPPL  601



>ref|XP_010252844.1| PREDICTED: heat shock cognate protein 80-like [Nelumbo nucifera]
Length=699

 Score =   313 bits (801),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 203/236 (86%), Positives = 220/236 (93%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KKK   K+K  E LCK+IKD+LGD+VEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESEDEKKKKEALKEKF-EGLCKVIKDVLGDRVEKVVVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEE--EAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKLGLSIDEE  EA  D DMP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEEGGEADADTDMPPL  685



>ref|XP_007020406.1| Heat shock protein 81.4 [Theobroma cacao]
 gb|EOY11931.1| Heat shock protein 81.4 [Theobroma cacao]
Length=699

 Score =   313 bits (801),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 218/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLFMVDAIDEYAVGQLKE++GK
Sbjct  451  YVTRMKEGQSDIYYITGESKKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEFEGK  510

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ D+E+KKK   K+K  E LCK+IKD+LGDKVEKVVVSDR+VDSPCC
Sbjct  511  KLVSATKEGLKLDESDDEKKKKEALKEKF-EGLCKVIKDVLGDKVEKVVVSDRVVDSPCC  569

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  570  LVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  629

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKLGLSIDE+    DADMP L
Sbjct  630  VKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDAGEADADMPPL  683



>ref|XP_008776162.1| PREDICTED: heat shock protein 81-1 [Phoenix dactylifera]
Length=700

 Score =   312 bits (800),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 218/235 (93%), Gaps = 2/235 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLERLKKKGYE+LFMVDAIDEYAVGQLKE++GK
Sbjct  453  YVTRMKEGQNDIYYITGESKKAVENSPFLERLKKKGYEILFMVDAIDEYAVGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ + E+KKK   K+K  E LCK+IK++LGDKVEKVVVSD +VDSPCC
Sbjct  513  KLVSATKEGLKLDESEHEKKKKEALKEKF-EGLCKVIKEVLGDKVEKVVVSDHVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRAEADKNDKS
Sbjct  572  LVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRAEADKNDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGD-DADMPAL  142
            VKDLVLLLF+T+LLTSGFSL+DPNTFG RIHRMLKLGLSIDE+E  D D DMP+L
Sbjct  632  VKDLVLLLFDTSLLTSGFSLEDPNTFGNRIHRMLKLGLSIDEDETVDADTDMPSL  686



>emb|CAA67191.1| HSP80-2 [Triticum aestivum]
Length=700

 Score =   312 bits (799),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 216/236 (92%), Gaps = 3/236 (1%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ +IYYITGESKKAVENSPFLE+LKKKGYEV++MVDAIDEYA+GQLKE++GK
Sbjct  453  YVTRMKEGQNEIYYITGESKKAVENSPFLEKLKKKGYEVIYMVDAIDEYAIGQLKEFEGK  512

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK+ E K+K  E LCK+IK++LGDKVEKV+VSDR+VDSPCC
Sbjct  513  KLVSATKEGLKLDESEDEKKKQEELKEKF-EGLCKVIKEVLGDKVEKVIVSDRVVDSPCC  571

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGE GWT NMERIMKAQALRDSSM+ YMSSKKTMEINP+N IM+EL KRA+ADK+DKS
Sbjct  572  LVTGENGWTPNMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELPKRADADKSDKS  631

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDE--EEAGDDADMPAL  142
            VKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKLGLSIDE  E   +D DMP L
Sbjct  632  VKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDDEAPENDTDMPPL  687



>gb|AGB76029.1| heat shock protein 90 [Salicornia europaea]
Length=696

 Score =   312 bits (799),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 196/234 (84%), Positives = 217/234 (93%), Gaps = 1/234 (0%)
 Frame = -3

Query  843  YVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGK  664
            YVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GK
Sbjct  450  YVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGK  509

Query  663  KLVSATkeglkledddeeekkkreekkKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCC  484
            KLVSATKEGLKL++ ++E+KK  E K   FE LCK++KD+LGDKVEKVVVSDR+VDSPCC
Sbjct  510  KLVSATKEGLKLDESEDEKKKSEESKA-KFEGLCKVVKDVLGDKVEKVVVSDRVVDSPCC  568

Query  483  LVTGEYGWTANMERIMKAQALRDssmssymsSKKTMEINPDNGIMEELRKRAEADKNDKS  304
            LVTGEYGW+ANMERIMKAQALRDSSM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKS
Sbjct  569  LVTGEYGWSANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKS  628

Query  303  VKDlvlllfetalLTSGFSLDDPNTFGARIHRMLKLGLSIDEEEAGDDADMPAL  142
            VKDLVLLL+ETALLTSGFSLD+PNTFG RIHRMLKLGLSID++    D DMPAL
Sbjct  629  VKDLVLLLYETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDDDAGEVDVDMPAL  682



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1779474092270