BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF040A06

Length=873
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI30851.3|  unnamed protein product                                422   2e-143   Vitis vinifera
emb|CAN70157.1|  hypothetical protein VITISV_030014                     422   7e-143   Vitis vinifera
ref|XP_006365563.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    422   1e-142   Solanum tuberosum [potatoes]
ref|XP_010275024.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    422   1e-142   Nelumbo nucifera [Indian lotus]
ref|XP_002272874.2|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    421   2e-142   Vitis vinifera
ref|XP_009627828.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    420   6e-142   Nicotiana tomentosiformis
ref|XP_009763087.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    420   6e-142   Nicotiana sylvestris
ref|XP_011085258.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    419   1e-141   Sesamum indicum [beniseed]
ref|XP_006467495.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    419   1e-141   Citrus sinensis [apfelsine]
ref|XP_004233105.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    419   2e-141   Solanum lycopersicum
ref|XP_011096538.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    419   2e-141   Sesamum indicum [beniseed]
gb|KDP37953.1|  hypothetical protein JCGZ_04596                         419   3e-141   Jatropha curcas
ref|XP_006449664.1|  hypothetical protein CICLE_v10015139mg             418   3e-141   Citrus clementina [clementine]
gb|ABJ90468.1|  beta-ketoacyl-ACP synthase I                            418   3e-141   Jatropha curcas
ref|XP_002519707.1|  50 kDa ketoavyl-ACP synthase                       418   4e-141   
ref|XP_010052073.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    417   6e-141   Eucalyptus grandis [rose gum]
ref|XP_011011532.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    417   7e-141   Populus euphratica
gb|KHN28969.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    411   7e-141   Glycine soja [wild soybean]
gb|KJB57278.1|  hypothetical protein B456_009G156400                    417   1e-140   Gossypium raimondii
ref|XP_009801210.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    417   2e-140   Nicotiana sylvestris
ref|XP_006366097.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    417   2e-140   Solanum tuberosum [potatoes]
gb|ABM53471.1|  plastid 3-keto-acyl-ACP synthase I                      416   2e-140   Helianthus annuus
gb|KHG12491.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    416   3e-140   Gossypium arboreum [tree cotton]
gb|EYU43272.1|  hypothetical protein MIMGU_mgv1a005817mg                416   3e-140   Erythranthe guttata [common monkey flower]
ref|XP_009596105.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    416   4e-140   Nicotiana tomentosiformis
ref|XP_002316735.1|  3-oxoacyl-[acyl-carrier-protein] synthase I        415   6e-140   Populus trichocarpa [western balsam poplar]
gb|KJB66778.1|  hypothetical protein B456_010G165600                    409   1e-139   Gossypium raimondii
ref|XP_010241300.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    414   2e-139   Nelumbo nucifera [Indian lotus]
ref|XP_007158937.1|  hypothetical protein PHAVU_002G194300g             414   2e-139   Phaseolus vulgaris [French bean]
gb|KJB66775.1|  hypothetical protein B456_010G165600                    409   3e-139   Gossypium raimondii
gb|KCW75931.1|  hypothetical protein EUGRSUZ_D00305                     413   4e-139   Eucalyptus grandis [rose gum]
ref|XP_004244796.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    413   5e-139   Solanum lycopersicum
ref|NP_001237654.1|  beta-ketoacyl-ACP synthetase I-2                   413   6e-139   Glycine max [soybeans]
ref|NP_001238610.1|  beta-ketoacyl-ACP synthetase I                     412   6e-139   Glycine max [soybeans]
gb|AAC04691.1|  beta-ketoacyl-ACP synthase I                            413   6e-139   Perilla frutescens [beefsteak-mint]
ref|XP_004147414.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    412   7e-139   Cucumis sativus [cucumbers]
emb|CDP06309.1|  unnamed protein product                                413   7e-139   Coffea canephora [robusta coffee]
ref|XP_004161144.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[a...    412   8e-139   
gb|ABA07910.1|  plastid 3-ketoacyl-ACP synthase I                       412   1e-138   Cuphea avigera var. pulcherrima
ref|XP_010666593.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    412   1e-138   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG22354.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    412   1e-138   Gossypium arboreum [tree cotton]
ref|XP_008444105.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    411   3e-138   Cucumis melo [Oriental melon]
ref|XP_002305334.1|  3-oxoacyl-[acyl-carrier-protein] synthase I        411   3e-138   Populus trichocarpa [western balsam poplar]
ref|XP_007025113.1|  3-ketoacyl-acyl carrier protein synthase I i...    413   6e-138   
gb|KJB66777.1|  hypothetical protein B456_010G165600                    409   1e-137   Gossypium raimondii
ref|XP_010529153.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    409   2e-137   Tarenaya hassleriana [spider flower]
ref|XP_004293525.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    408   4e-137   Fragaria vesca subsp. vesca
gb|KEH43811.1|  3-oxoacyl-(acyl carrier) synthase II                    407   8e-137   Medicago truncatula
ref|XP_010538529.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    406   2e-136   Tarenaya hassleriana [spider flower]
emb|CDX77646.1|  BnaC07g19000D                                          406   2e-136   
ref|XP_011012842.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    406   2e-136   Populus euphratica
ref|XP_009101526.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    406   2e-136   Brassica rapa
emb|CDY33467.1|  BnaA06g36060D                                          406   3e-136   Brassica napus [oilseed rape]
ref|XP_003608492.1|  Beta-ketoacyl-ACP synthase I                       406   3e-136   Medicago truncatula
gb|KHN25892.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    412   3e-136   Glycine soja [wild soybean]
ref|XP_007211401.1|  hypothetical protein PRUPE_ppa005228mg             405   5e-136   Prunus persica
ref|XP_010932377.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    405   5e-136   Elaeis guineensis
gb|AGH32916.1|  ketoacyl-ACP synthase I                                 404   9e-136   Camellia chekiangoleosa
ref|XP_009128853.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    404   1e-135   Brassica rapa
gb|KFK31480.1|  hypothetical protein AALP_AA6G117600                    404   1e-135   Arabis alpina [alpine rockcress]
gb|AFK43304.1|  unknown                                                 404   2e-135   Medicago truncatula
emb|CDY43962.1|  BnaA02g24400D                                          404   2e-135   Brassica napus [oilseed rape]
ref|XP_006398324.1|  hypothetical protein EUTSA_v10000874mg             404   2e-135   Eutrema salsugineum [saltwater cress]
ref|XP_010917436.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    403   3e-135   Elaeis guineensis
ref|XP_004504688.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    403   3e-135   Cicer arietinum [garbanzo]
ref|NP_001032018.1|  beta-ketoacyl-[acyl carrier protein] synthase I    401   3e-135   Arabidopsis thaliana [mouse-ear cress]
gb|KHG12107.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    403   4e-135   Gossypium arboreum [tree cotton]
ref|XP_006845316.1|  hypothetical protein AMTR_s00141p00029880          402   5e-135   Amborella trichopoda
gb|ACJ07141.1|  beta-ketoacyl-ACP synthase I-2                          402   5e-135   Arachis hypogaea [goober]
gb|ACJ07140.1|  beta-ketoacyl-ACP synthase I-1                          402   6e-135   Arachis hypogaea [goober]
gb|ACZ06069.1|  beta-ketoacyl-ACP synthetase I                          402   6e-135   Arachis hypogaea [goober]
ref|XP_008225453.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    402   9e-135   Prunus mume [ume]
ref|XP_002863412.1|  kas I                                              402   1e-134   Arabidopsis lyrata subsp. lyrata
ref|XP_009401483.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    401   1e-134   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ00014.1|  hypothetical protein OsI_22012                          396   2e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_010441599.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    401   2e-134   Camelina sativa [gold-of-pleasure]
ref|NP_199441.1|  beta-ketoacyl-[acyl carrier protein] synthase I       401   2e-134   Arabidopsis thaliana [mouse-ear cress]
gb|AAC49118.1|  3-ketoacyl-acyl carrier protein synthase I              401   2e-134   Arabidopsis thaliana [mouse-ear cress]
emb|CDY03228.1|  BnaC09g19280D                                          401   3e-134   
emb|CDY35156.1|  BnaA09g17930D                                          401   3e-134   Brassica napus [oilseed rape]
ref|XP_008784346.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    400   3e-134   Phoenix dactylifera
ref|XP_006280411.1|  hypothetical protein CARUB_v10026344mg             399   9e-134   Capsella rubella
ref|NP_001152921.1|  uncharacterized protein LOC100279917               393   3e-133   
gb|EAZ36138.1|  hypothetical protein OsJ_20447                          396   3e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009114364.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    397   6e-133   Brassica rapa
ref|XP_008349175.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    397   9e-133   
ref|XP_008371590.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    397   1e-132   
ref|NP_001057053.1|  Os06g0196600                                       396   1e-132   
ref|XP_008383499.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    397   1e-132   
ref|XP_010495756.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    400   1e-132   
gb|KJB57279.1|  hypothetical protein B456_009G156400                    398   2e-132   Gossypium raimondii
ref|XP_010481467.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    396   2e-132   Camelina sativa [gold-of-pleasure]
ref|XP_009391220.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    396   2e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009360871.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    396   2e-132   Pyrus x bretschneideri [bai li]
gb|EPS68881.1|  hypothetical protein M569_05881                         396   4e-132   Genlisea aurea
ref|XP_002438009.1|  hypothetical protein SORBIDRAFT_10g006430          394   6e-132   Sorghum bicolor [broomcorn]
ref|NP_001146139.1|  uncharacterized protein LOC100279707               393   9e-132   Zea mays [maize]
ref|XP_001762048.1|  predicted protein                                  393   9e-132   
gb|AFW85455.1|  hypothetical protein ZEAMMB73_016804                    394   1e-131   
ref|NP_001149639.1|  3-oxoacyl-synthase I                               393   2e-131   Zea mays [maize]
gb|EAZ30871.1|  hypothetical protein OsJ_14945                          391   2e-131   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052904.1|  Os04g0445700                                       391   6e-131   
emb|CAD40964.2|  OSJNBa0027P08.14                                       391   7e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656734.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    390   1e-130   
ref|XP_010917434.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    392   1e-130   Elaeis guineensis
emb|CAH67240.1|  OSIGBa0140O07.8                                        390   1e-130   Oryza sativa [red rice]
gb|EMT32067.1|  3-oxoacyl-(acyl-carrier-protein) synthase I, chlo...    386   1e-130   
gb|ABR18442.1|  unknown                                                 394   1e-130   Picea sitchensis
dbj|BAH00228.1|  unnamed protein product                                391   1e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564149.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    391   2e-130   Brachypodium distachyon [annual false brome]
gb|EMS61772.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    386   2e-130   Triticum urartu
ref|XP_004964587.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    391   2e-130   Setaria italica
ref|NP_001190479.1|  beta-ketoacyl-[acyl carrier protein] synthase I    392   2e-130   Arabidopsis thaliana [mouse-ear cress]
gb|EAY94286.1|  hypothetical protein OsI_16057                          390   2e-130   Oryza sativa Indica Group [Indian rice]
ref|XP_004975742.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    390   5e-130   Setaria italica
ref|XP_004975743.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    389   5e-130   
ref|XP_001776124.1|  predicted protein                                  390   6e-130   
emb|CDX87726.1|  BnaC02g32230D                                          389   9e-130   
dbj|BAJ86549.1|  predicted protein                                      387   5e-129   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002960175.1|  hypothetical protein SELMODRAFT_229853             385   2e-128   
ref|XP_010915981.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    385   5e-128   Elaeis guineensis
sp|P23902.1|KASC1_HORVU  RecName: Full=3-oxoacyl-[acyl-carrier-pr...    384   6e-128   Hordeum vulgare [barley]
ref|XP_006653452.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    384   9e-128   
gb|AGJ84410.1|  beta-ketoacyl-ACP synthase I                            384   2e-127   Cocos nucifera
ref|XP_003579824.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    383   2e-127   Brachypodium distachyon [annual false brome]
ref|XP_001762687.1|  predicted protein                                  382   3e-127   
ref|XP_002964698.1|  hypothetical protein SELMODRAFT_230451             380   5e-127   
ref|XP_010111005.1|  3-oxoacyl-[acyl-carrier-protein] synthase I        381   8e-127   
gb|ADE76842.1|  unknown                                                 377   7e-125   Picea sitchensis
ref|XP_008783167.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    377   1e-124   Phoenix dactylifera
ref|XP_002969875.1|  hypothetical protein SELMODRAFT_171238             372   2e-123   
gb|AAC78479.1|  3-oxoacyl-[acyl-carrier-protein] synthase               371   2e-122   Capsicum chinense [bonnet pepper]
gb|KHG12490.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    371   4e-122   Gossypium arboreum [tree cotton]
gb|KJB34973.1|  hypothetical protein B456_006G093400                    370   5e-122   Gossypium raimondii
ref|XP_002299456.1|  hypothetical protein POPTR_0001s10890g             369   2e-121   
ref|XP_011026849.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    367   1e-120   Populus euphratica
ref|XP_007025114.1|  3-ketoacyl-acyl carrier protein synthase I i...    368   1e-120   
dbj|BAK03950.1|  predicted protein                                      365   2e-120   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006343829.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    364   1e-119   Solanum tuberosum [potatoes]
gb|KEH21260.1|  3-oxoacyl-(acyl carrier) synthase II                    364   1e-119   Medicago truncatula
gb|AGV54408.1|  beta-ketoacyl-ACP synthetase I                          363   2e-119   Phaseolus vulgaris [French bean]
gb|EMS48560.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    357   7e-119   Triticum urartu
ref|XP_010053160.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    359   1e-118   
ref|XP_002265207.2|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    361   2e-118   Vitis vinifera
ref|XP_007040574.1|  3-ketoacyl-acyl carrier protein synthase I         360   7e-118   
emb|CDP12182.1|  unnamed protein product                                359   1e-117   Coffea canephora [robusta coffee]
gb|KJB24182.1|  hypothetical protein B456_004G131800                    358   2e-117   Gossypium raimondii
ref|XP_004245499.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    358   3e-117   Solanum lycopersicum
ref|XP_009590113.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    357   4e-117   Nicotiana tomentosiformis
ref|XP_006852603.1|  hypothetical protein AMTR_s00021p00221400          351   6e-117   
gb|EYU23310.1|  hypothetical protein MIMGU_mgv1a005480mg                356   9e-117   Erythranthe guttata [common monkey flower]
gb|AFW85456.1|  hypothetical protein ZEAMMB73_016804                    356   9e-117   
ref|XP_011082304.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    357   1e-116   Sesamum indicum [beniseed]
ref|XP_011082303.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    357   2e-116   
ref|XP_011022477.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    355   5e-116   Populus euphratica
gb|KDP25270.1|  hypothetical protein JCGZ_20426                         354   7e-116   Jatropha curcas
ref|XP_002518849.1|  3-oxoacyl-[acyl-carrier-protein] synthase, p...    353   1e-115   Ricinus communis
ref|XP_009803233.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    353   2e-115   Nicotiana sylvestris
gb|AIQ82743.1|  3-oxoacyl-(acyl-carrier-protein) synthase               353   2e-115   Capsicum annuum
ref|XP_007160188.1|  hypothetical protein PHAVU_002G300400g             353   2e-115   Phaseolus vulgaris [French bean]
gb|KHM99882.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    350   3e-115   Glycine soja [wild soybean]
ref|XP_007209938.1|  hypothetical protein PRUPE_ppa004714mg             353   3e-115   
gb|AIQ82742.1|  3-oxoacyl-(acyl-carrier-protein) synthase               352   4e-115   Capsicum annuum
ref|XP_006439308.1|  hypothetical protein CICLE_v10019855mg             353   4e-115   Citrus clementina [clementine]
ref|XP_006476353.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    353   4e-115   Citrus sinensis [apfelsine]
gb|AIQ82747.1|  3-oxoacyl-(acyl-carrier-protein) synthase               352   4e-115   Capsicum annuum
gb|KDO76592.1|  hypothetical protein CISIN_1g010896mg                   353   4e-115   Citrus sinensis [apfelsine]
ref|XP_004987019.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    351   4e-115   
gb|AIQ82734.1|  3-oxoacyl-(acyl-carrier-protein) synthase               352   4e-115   Capsicum annuum
ref|XP_004959862.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    351   5e-115   
gb|AIQ82745.1|  3-oxoacyl-(acyl-carrier-protein) synthase               352   5e-115   Capsicum annuum
ref|XP_008341776.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    352   5e-115   Malus domestica [apple tree]
gb|AIQ82746.1|  3-oxoacyl-(acyl-carrier-protein) synthase               352   5e-115   Capsicum annuum
ref|XP_002303661.2|  hypothetical protein POPTR_0003s14190g             352   6e-115   Populus trichocarpa [western balsam poplar]
ref|XP_009341875.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    352   7e-115   Pyrus x bretschneideri [bai li]
gb|ACC64615.1|  beta ketoacyl-ACP synthase I                            342   8e-115   Chlorella sp. GHA-2008
ref|XP_008352312.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    349   2e-114   
ref|XP_004503596.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    350   3e-114   Cicer arietinum [garbanzo]
gb|EYU26414.1|  hypothetical protein MIMGU_mgv1a024999mg                349   3e-114   Erythranthe guttata [common monkey flower]
ref|XP_006584771.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    350   4e-114   Glycine max [soybeans]
ref|XP_006584772.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    350   4e-114   Glycine max [soybeans]
ref|XP_006584770.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    350   4e-114   Glycine max [soybeans]
ref|XP_003530435.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    350   4e-114   Glycine max [soybeans]
ref|XP_009358636.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    350   4e-114   Pyrus x bretschneideri [bai li]
ref|XP_008352311.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    350   4e-114   
ref|XP_006584769.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    350   4e-114   Glycine max [soybeans]
gb|ADZ05697.1|  3-oxoacyl-(acyl-carrier-protein) synthase               350   5e-114   Capsicum annuum
ref|XP_006579443.1|  PREDICTED: uncharacterized protein LOC100808...    347   6e-114   Glycine max [soybeans]
ref|XP_002463312.1|  hypothetical protein SORBIDRAFT_02g041620          348   9e-114   
gb|AAK58535.1|  beta-ketoacyl-ACP synthetase I                          348   1e-113   Coriandrum sativum [cilantro]
ref|XP_006579442.1|  PREDICTED: uncharacterized protein LOC100808...    348   2e-113   Glycine max [soybeans]
ref|XP_008239156.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    348   2e-113   Prunus mume [ume]
ref|NP_001241906.1|  uncharacterized protein LOC100808453               348   2e-113   
ref|XP_004301818.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    344   1e-111   Fragaria vesca subsp. vesca
gb|EMS63377.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    345   1e-111   Triticum urartu
ref|XP_010239948.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    343   2e-111   
gb|KHG26930.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    342   4e-111   Gossypium arboreum [tree cotton]
gb|KIZ02816.1|  hypothetical protein MNEG_5138                          333   2e-110   Monoraphidium neglectum
gb|EYU26415.1|  hypothetical protein MIMGU_mgv1a006855mg                338   3e-110   Erythranthe guttata [common monkey flower]
ref|XP_010109776.1|  hypothetical protein L484_003136                   341   3e-110   
ref|XP_005843858.1|  hypothetical protein CHLNCDRAFT_27559              339   3e-110   Chlorella variabilis
gb|KEH21263.1|  3-oxoacyl-[acyl-carrier] synthase I                     332   3e-108   Medicago truncatula
gb|EMT20383.1|  3-oxoacyl-(acyl-carrier-protein) synthase I, chlo...    333   4e-108   
ref|XP_002961627.1|  hypothetical protein SELMODRAFT_230041             328   7e-107   
gb|AEF13159.1|  beta-ketoacyl acyl carrier protein synthase             328   6e-106   Haematococcus lacustris
ref|XP_002956811.1|  hypothetical protein VOLCADRAFT_83790              327   1e-105   Volvox carteri f. nagariensis
ref|XP_001416469.1|  predicted protein                                  325   2e-105   Ostreococcus lucimarinus CCE9901
ref|XP_005643461.1|  3-oxoacyl-synth                                    326   5e-105   Coccomyxa subellipsoidea C-169
gb|KJB66776.1|  hypothetical protein B456_010G165600                    325   6e-105   Gossypium raimondii
ref|XP_003074998.1|  beta-ketoacyl-ACP synthase (ISS)                   324   2e-104   
emb|CEG00998.1|  Beta-ketoacyl synthase, active site                    324   2e-104   Ostreococcus tauri
ref|XP_007509323.1|  predicted protein                                  323   3e-104   Bathycoccus prasinos
ref|XP_011398280.1|  3-oxoacyl-[acyl-carrier-protein] synthase I,...    316   2e-101   Auxenochlorella protothecoides
ref|WP_032125192.1|  3-oxoacyl-ACP synthase                             312   2e-100   Candidatus Protochlamydia massiliensis
gb|EMS48559.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    314   3e-100   Triticum urartu
emb|CAF23962.1|  probable beta-ketoacyl-ACP synthetase                  311   6e-100   
ref|WP_039359465.1|  3-oxoacyl-ACP synthase                             311   7e-100   Candidatus Protochlamydia amoebophila
ref|WP_042282680.1|  3-oxoacyl-ACP synthase                             311   7e-100   Candidatus Protochlamydia sp. R18
ref|XP_005715183.1|  Beta-ketoacyl synthase                             299   3e-97    Chondrus crispus [carageen]
ref|WP_039384131.1|  3-oxoacyl-ACP synthase                             301   3e-96    Neochlamydia sp. TUME1
gb|KDD75769.1|  beta-ketoacyl synthase                                  302   6e-96    Helicosporidium sp. ATCC 50920
ref|WP_042239744.1|  3-oxoacyl-ACP synthase                             298   5e-95    Neochlamydia sp. S13
ref|WP_042103505.1|  3-oxoacyl-ACP synthase                             298   9e-95    Parachlamydiaceae bacterium HS-T3
gb|KIC73224.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    297   2e-94    Neochlamydia sp. EPS4
ref|WP_006340838.1|  3-oxoacyl-ACP synthase                             295   9e-94    Parachlamydia acanthamoebae
ref|XP_001701199.1|  3-ketoacyl-CoA-synthase                            295   4e-92    Chlamydomonas reinhardtii
ref|XP_002504288.1|  predicted protein                                  292   3e-91    Micromonas commoda
ref|WP_013182436.1|  3-oxoacyl-ACP synthase                             288   4e-91    Waddlia chondrophila
ref|XP_005642959.1|  3-ketoacyl-ACP-synthase                            289   8e-91    Coccomyxa subellipsoidea C-169
tpg|DAA41443.1|  TPA: hypothetical protein ZEAMMB73_227409              281   1e-90    
ref|WP_013712221.1|  3-oxoacyl-ACP synthase                             286   3e-90    Chlamydia pecorum
ref|XP_005707986.1|  3-oxoacyl-[acyl-carrier-protein] synthase II       288   4e-90    Galdieria sulphuraria
ref|WP_011457720.1|  3-oxoacyl-ACP synthase                             285   1e-89    Chlamydia felis
tpg|DAA41444.1|  TPA: hypothetical protein ZEAMMB73_227409              280   2e-89    
ref|WP_006344425.1|  3-oxoacyl-ACP synthase                             284   2e-89    Chlamydia abortus
ref|WP_011097353.1|  3-oxoacyl-ACP synthase                             284   2e-89    Chlamydia abortus
ref|XP_003060067.1|  predicted protein                                  285   3e-89    Micromonas pusilla CCMP1545
ref|WP_011006808.1|  3-oxoacyl-ACP synthase                             284   3e-89    Chlamydia caviae
gb|AAA33872.1|  chloroplast beta-ketoacyl-ACP synthase precursor        287   3e-89    Ricinus communis
emb|CBI27767.3|  unnamed protein product                                286   5e-89    Vitis vinifera
ref|WP_014945306.1|  3-oxoacyl-ACP synthase                             283   5e-89    Chlamydia psittaci
ref|WP_006343509.1|  3-oxoacyl-ACP synthase                             283   5e-89    Chlamydia psittaci
ref|XP_002516228.1|  46 kDa ketoavyl-ACP synthase                       287   6e-89    Ricinus communis
ref|XP_002276214.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    286   8e-89    Vitis vinifera
ref|WP_021828618.1|  MULTISPECIES: beta-ketoacyl-acyl-carrier-pro...    282   9e-89    Chlamydia gallinacea
ref|WP_020370551.1|  MULTISPECIES: beta-ketoacyl-acyl-carrier-pro...    282   1e-88    Chlamydia ibidis
ref|WP_010229532.1|  3-oxoacyl-ACP synthase                             282   1e-88    Chlamydia muridarum [agent of mouse pneumonitis]
ref|WP_011324861.1|  3-oxoacyl-ACP synthase                             282   1e-88    Chlamydia trachomatis
ref|WP_009872915.1|  3-oxoacyl-ACP synthase                             282   1e-88    Chlamydia trachomatis
ref|WP_009872150.1|  3-oxoacyl-ACP synthase                             281   2e-88    Chlamydia trachomatis
ref|WP_020967796.1|  3-oxoacyl-ACP synthase                             281   2e-88    Chlamydia trachomatis
gb|ADE77460.1|  unknown                                                 276   3e-88    Picea sitchensis
ref|WP_009873390.1|  3-oxoacyl-ACP synthase                             281   3e-88    Chlamydia trachomatis
ref|XP_006658817.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    281   4e-88    
ref|WP_020356536.1|  MULTISPECIES: beta-ketoacyl-acyl-carrier-pro...    280   5e-88    Chlamydia
ref|XP_009104733.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    284   6e-88    Brassica rapa
emb|CDX68154.1|  BnaA07g21940D                                          284   7e-88    
ref|WP_024067272.1|  3-oxoacyl-ACP synthase                             280   9e-88    Chlamydia trachomatis
ref|XP_002463181.1|  hypothetical protein SORBIDRAFT_02g039230          281   2e-87    Sorghum bicolor [broomcorn]
ref|XP_008651372.1|  PREDICTED: uncharacterized protein LOC100280...    281   3e-87    
ref|XP_006651481.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    279   3e-87    Oryza brachyantha
ref|XP_001763306.1|  predicted protein                                  280   4e-87    
ref|WP_035407645.1|  3-oxoacyl-ACP synthase                             278   4e-87    Chlamydia suis
ref|NP_001132041.1|  uncharacterized protein LOC100193451 precursor     281   5e-87    Zea mays [maize]
gb|ACG25173.1|  3-oxoacyl-synthase I                                    280   5e-87    Zea mays [maize]
ref|XP_011006167.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    282   5e-87    Populus euphratica
gb|EAZ42784.1|  hypothetical protein OsJ_27364                          278   9e-87    Oryza sativa Japonica Group [Japonica rice]
gb|EMS61602.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    278   1e-86    Triticum urartu
ref|XP_004984084.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    280   1e-86    Setaria italica
ref|XP_007154557.1|  hypothetical protein PHAVU_003G128700g             279   2e-86    Phaseolus vulgaris [French bean]
emb|CAA84022.1|  beta-ketoacyl-ACP synthase                             279   2e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91001.1|  predicted protein                                      279   2e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_014518181.1|  3-oxoacyl-ACP synthase                             276   3e-86    Chlamydia pneumoniae
ref|XP_001773138.1|  predicted protein                                  280   3e-86    
ref|XP_008784350.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    280   4e-86    Phoenix dactylifera
gb|ACJ07142.1|  beta-ketoacyl-ACP synthase II-1                         280   4e-86    Arachis hypogaea [goober]
ref|XP_006381576.1|  FATTY ACID BIOSYNTHESIS 1 family protein           278   5e-86    
ref|WP_010883551.1|  3-oxoacyl-ACP synthase                             275   5e-86    Chlamydia pneumoniae
ref|XP_003557750.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    278   5e-86    Brachypodium distachyon [annual false brome]
gb|KEH37628.1|  3-oxoacyl-(acyl carrier) synthase II                    277   6e-86    
ref|NP_001060274.1|  Os07g0616200                                       278   6e-86    
gb|EAZ04708.1|  hypothetical protein OsI_26869                          278   7e-86    
ref|XP_010533238.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    279   7e-86    
ref|XP_002965643.1|  hypothetical protein SELMODRAFT_230708             275   8e-86    
gb|KEH32421.1|  3-oxoacyl-(acyl carrier) synthase II                    272   9e-86    
ref|NP_001169617.1|  uncharacterized protein LOC100383498 precursor     277   1e-85    
ref|XP_002989269.1|  hypothetical protein SELMODRAFT_129433             275   1e-85    
gb|EMT21411.1|  3-oxoacyl-(acyl-carrier-protein) synthase I, chlo...    277   1e-85    
ref|WP_041017043.1|  3-oxoacyl-ACP synthase                             274   2e-85    
emb|CAA84023.1|  beta-ketoacyl-ACP synthase                             276   2e-85    
ref|XP_010932373.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    278   2e-85    
ref|XP_010932372.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    278   2e-85    
ref|XP_006416523.1|  hypothetical protein EUTSA_v10007353mg             276   3e-85    
ref|XP_011039936.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    277   4e-85    
gb|AAL91174.1|  putative 3-ketoacyl-ACP synthase                        276   5e-85    
ref|XP_002986735.1|  hypothetical protein SELMODRAFT_158169             275   6e-85    
ref|XP_006600238.1|  PREDICTED: beta-ketoacyl-ACP synthetase 2 is...    275   7e-85    
gb|EPJ19371.1|  beta-ketoacyl-acyl-carrier-protein synthase II          265   8e-85    
ref|XP_002509140.1|  predicted protein                                  272   9e-85    
ref|XP_004488123.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    274   9e-85    
ref|XP_006466135.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    267   1e-84    
ref|XP_001700152.1|  3-ketoacyl-ACP-synthase                            273   1e-84    
gb|AAB37270.1|  beta-ketoacyl-ACP synthase II                           275   1e-84    
ref|XP_002973275.1|  hypothetical protein SELMODRAFT_149056             274   1e-84    
emb|CBI35831.3|  unnamed protein product                                275   2e-84    
ref|XP_004508026.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    274   2e-84    
gb|AAF26738.2|AF220453_1  beta-ketoacyl-ACP synthase II                 276   2e-84    
ref|XP_010654405.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    275   3e-84    
gb|KJB82970.1|  hypothetical protein B456_013G222600                    271   3e-84    
ref|WP_013944050.1|  3-oxoacyl-ACP synthase                             270   4e-84    
ref|XP_009390876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    274   4e-84    
ref|XP_003609968.1|  3-oxoacyl-ACP synthase                             272   6e-84    
gb|ACJ85772.1|  unknown                                                 272   6e-84    
gb|KDO45710.1|  hypothetical protein CISIN_1g0448241mg                  268   7e-84    
ref|XP_001768994.1|  predicted protein                                  274   7e-84    
ref|NP_001235052.1|  beta-ketoacyl-ACP synthetase 2 precursor           271   1e-83    
ref|XP_006307215.1|  hypothetical protein CARUB_v10008814mg             272   2e-83    
gb|AAC68860.1|  3-ketoacyl-ACP synthase                                 272   3e-83    
gb|AAB37271.1|  beta-ketoacyl-ACP synthase II                           271   4e-83    
gb|KJB82969.1|  hypothetical protein B456_013G222600                    271   9e-83    
gb|KDO73814.1|  hypothetical protein CISIN_1g008146mg                   267   1e-82    
gb|KHN17744.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    274   1e-82    
ref|XP_010932371.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    271   1e-82    
gb|AAC68861.1|  3-ketoacyl-ACP synthase                                 270   2e-82    
ref|XP_010932370.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    271   2e-82    
ref|XP_002893037.1|  predicted protein                                  268   2e-82    
gb|AIL53811.1|  beta-ketoacyl-[acyl carrier protein] synthase II        270   3e-82    
emb|CDY41034.1|  BnaC05g14920D                                          268   3e-82    
ref|XP_010498338.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    269   3e-82    
emb|CDY26686.1|  BnaA06g13360D                                          268   4e-82    
gb|KHG18322.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    270   4e-82    
emb|CDP03046.1|  unnamed protein product                                269   5e-82    
gb|AAF91318.1|AF242848_1  beta-ketoacyl-acyl carrier protein synt...    268   7e-82    
ref|XP_009149615.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    269   7e-82    
ref|XP_010477131.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    268   1e-81    
emb|CAC59946.1|  beta-ketoacyl-ACP synthase IV                          268   1e-81    
ref|XP_010459587.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    268   1e-81    
emb|CDZ80412.1|  3-oxoacyl-[acyl-carrier-protein] synthase 2            264   1e-81    
ref|XP_009336709.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    265   1e-81    
gb|AAF61739.1|AF244520_1  beta-ketoacyl-ACP synthetase 2                264   3e-81    
ref|XP_006426741.1|  hypothetical protein CICLE_v10027240mg             265   4e-81    
gb|KDO73811.1|  hypothetical protein CISIN_1g008146mg                   267   4e-81    
ref|XP_006452865.1|  hypothetical protein CICLE_v10007846mg             267   4e-81    
ref|XP_006474686.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    267   6e-81    
emb|CDX85866.1|  BnaC06g22680D                                          266   6e-81    
ref|XP_006426746.1|  hypothetical protein CICLE_v10025485mg             264   9e-81    
gb|AGC65509.1|  keto acyl-acyl carrier protein synthase II              265   9e-81    
emb|CDX73128.1|  BnaC06g35760D                                          265   1e-80    
emb|CDY45409.1|  BnaA07g31890D                                          265   1e-80    
ref|XP_003061616.1|  predicted protein                                  263   2e-80    
ref|XP_001768920.1|  predicted protein                                  261   2e-80    
ref|XP_009106152.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    265   2e-80    
ref|XP_006426725.1|  hypothetical protein CICLE_v10027447mg             261   2e-80    
gb|ADK23940.1|  KASII                                                   265   3e-80    
ref|XP_006390366.1|  hypothetical protein EUTSA_v10018368mg             263   5e-80    
ref|XP_006597888.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    258   6e-80    
ref|XP_011460975.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    262   1e-79    
ref|XP_002889002.1|  hypothetical protein ARALYDRAFT_476635             261   3e-79    
ref|XP_002950994.1|  hypothetical protein VOLCADRAFT_104947             259   3e-79    
ref|XP_002324139.2|  hypothetical protein POPTR_0018s07450g             262   3e-79    
ref|XP_006597887.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    257   3e-79    
ref|XP_010089666.1|  3-oxoacyl-[acyl-carrier-protein] synthase II       261   3e-79    
ref|XP_010687531.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    261   4e-79    
ref|NP_565097.1|  3-oxoacyl-[acyl-carrier-protein] synthase II          261   5e-79    
ref|XP_008337819.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    261   5e-79    
ref|XP_009771698.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    260   5e-79    
ref|XP_008242279.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    261   5e-79    
ref|XP_008228351.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    261   5e-79    
ref|XP_009767768.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    259   7e-79    
gb|AGH32917.1|  ketoacyl-ACP synthase II                                261   7e-79    
ref|XP_009625177.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    259   8e-79    
gb|AAD55280.1|AC008263_11  Similar to gb|AF060519 3-ketoacyl-ACP ...    261   8e-79    
ref|NP_001289900.1|  3-oxoacyl-[acyl-carrier-protein] synthase II...    260   9e-79    
ref|XP_010261746.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    261   1e-78    
ref|XP_006300437.1|  hypothetical protein CARUB_v10020101mg             260   1e-78    
gb|AAM09292.1|  beta-ketoacyl-ACP synthase II                           251   1e-78    
ref|XP_010428495.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    260   1e-78    
gb|KDO45708.1|  hypothetical protein CISIN_1g0114931mg                  257   1e-78    
ref|NP_001290396.1|  3-oxoacyl-[acyl-carrier-protein] synthase II...    260   1e-78    
emb|CDY37268.1|  BnaCnng08220D                                          256   2e-78    
ref|XP_011467455.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    259   3e-78    
ref|XP_011467454.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    259   3e-78    
emb|CDO97819.1|  unnamed protein product                                259   3e-78    
ref|XP_003562655.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    258   3e-78    
ref|XP_006466136.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    256   3e-78    
ref|XP_003547514.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    257   4e-78    
ref|XP_004305765.2|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    259   4e-78    
gb|KDP33964.1|  hypothetical protein JCGZ_07535                         259   4e-78    
gb|EYU28306.1|  hypothetical protein MIMGU_mgv1a004039mg                258   4e-78    
ref|XP_009587352.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    257   5e-78    
ref|XP_007204195.1|  hypothetical protein PRUPE_ppa003597mg             259   5e-78    
ref|XP_008338300.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    258   6e-78    
ref|XP_006342938.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    258   8e-78    
gb|ABI18155.1|  plastid 3-keto-acyl-ACP synthase II                     256   1e-77    
ref|XP_009337172.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    258   2e-77    
ref|XP_001421246.1|  predicted protein                                  253   2e-77    
ref|XP_006353782.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    257   2e-77    
gb|KDO45712.1|  hypothetical protein CISIN_1g037985mg                   256   2e-77    
ref|NP_001236069.1|  plastid 3-keto-acyl-ACP synthase II-B precursor    255   2e-77    
ref|XP_011093876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    257   2e-77    
ref|XP_010318480.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    257   2e-77    
gb|EYU25822.1|  hypothetical protein MIMGU_mgv1a004003mg                256   3e-77    
ref|XP_006345248.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    256   3e-77    
ref|XP_002505037.1|  predicted protein                                  253   3e-77    
ref|XP_010313772.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    254   3e-77    
ref|XP_009359705.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    256   5e-77    
ref|XP_006426733.1|  hypothetical protein CICLE_v10025676mg             252   7e-77    
ref|XP_010273891.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    256   7e-77    
ref|WP_013120920.1|  3-oxoacyl-ACP synthase                             251   8e-77    
gb|KCW81914.1|  hypothetical protein EUGRSUZ_C03291                     254   8e-77    
ref|XP_010539937.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    257   8e-77    
ref|XP_004251704.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    254   9e-77    
ref|XP_001421280.1|  predicted protein                                  251   1e-76    
ref|XP_010049368.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    255   1e-76    
ref|XP_005847731.1|  hypothetical protein CHLNCDRAFT_31085              250   1e-76    
ref|XP_010047453.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    255   2e-76    
emb|CDY46021.1|  BnaA02g17050D                                          253   2e-76    
ref|XP_009128067.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    253   2e-76    
ref|XP_010273890.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    256   3e-76    
ref|WP_026596467.1|  3-oxoacyl-ACP synthase                             250   3e-76    
tpg|DAA41442.1|  TPA: hypothetical protein ZEAMMB73_227409              244   3e-76    
ref|XP_004243689.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    253   3e-76    
gb|ABJ90469.2|  beta-ketoacyl-ACP synthase II                           254   4e-76    
ref|WP_012306650.1|  3-oxoacyl-ACP synthase                             249   5e-76    
ref|WP_030007222.1|  3-oxoacyl-ACP synthase                             249   6e-76    
ref|XP_003083296.1|  Animal-type fatty acid synthase and related ...    251   6e-76    
ref|XP_010937284.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    253   1e-75    
ref|XP_010937285.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    253   1e-75    
ref|XP_010937286.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    252   1e-75    
ref|XP_009380020.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    252   1e-75    
ref|XP_007024704.1|  Fatty acid biosynthesis 1                          250   2e-75    
ref|XP_006466138.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    250   2e-75    
ref|XP_005537149.1|  3-oxoacyl-[acyl-carrier-protein] synthase I,...    250   2e-75    
ref|XP_011078136.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    251   3e-75    
gb|KHN12535.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    246   4e-75    
ref|XP_006843870.1|  hypothetical protein AMTR_s00007p00265100          252   5e-75    
ref|WP_007303076.1|  3-oxoacyl-ACP synthase                             247   6e-75    
gb|AAC04692.1|  beta-ketoacyl-ACP synthase II                           250   6e-75    
gb|EHJ11303.1|  3-oxoacyl-[acyl-carrier-protein] synthase, KASII        246   6e-75    
ref|XP_007012570.1|  Fatty acid biosynthesis 1 isoform 5                248   9e-75    
ref|WP_024565065.1|  3-oxoacyl-ACP synthase                             246   1e-74    
ref|WP_013321190.1|  3-oxoacyl-ACP synthase                             245   3e-74    
ref|WP_015891895.1|  3-oxoacyl-ACP synthase                             244   3e-74    
ref|WP_016743279.1|  3-oxoacyl-ACP synthase                             244   3e-74    
ref|WP_011610306.1|  3-oxoacyl-ACP synthase                             244   4e-74    
ref|WP_021346543.1|  3-oxoacyl-ACP synthase                             244   4e-74    
ref|WP_009543802.1|  MULTISPECIES: 3-oxoacyl-ACP synthase               244   4e-74    
ref|WP_034847767.1|  3-oxoacyl-ACP synthase                             244   4e-74    
ref|WP_011878393.1|  3-oxoacyl-ACP synthase                             244   6e-74    
ref|WP_024566988.1|  3-oxoacyl-ACP synthase                             244   6e-74    
ref|XP_008450963.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    248   7e-74    
gb|KHG27960.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    247   8e-74    
gb|KJB27216.1|  hypothetical protein B456_004G285300                    247   9e-74    
gb|AIL53812.1|  beta-ketoacyl-[acyl carrier protein] synthase II        246   1e-73    
ref|XP_007012566.1|  Fatty acid biosynthesis 1 isoform 1                248   1e-73    
ref|WP_009085241.1|  3-oxoacyl-ACP synthase                             243   1e-73    
ref|WP_017249371.1|  3-oxoacyl-ACP synthase                             243   2e-73    
ref|WP_034869203.1|  3-oxoacyl-ACP synthase                             243   2e-73    
ref|WP_009631537.1|  beta-ketoacyl-acyl-carrier-protein synthase II     243   2e-73    
ref|XP_008782961.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    247   2e-73    
ref|XP_008782971.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    246   2e-73    
ref|WP_038250031.1|  3-oxoacyl-ACP synthase                             243   2e-73    
ref|WP_024546055.1|  3-oxoacyl-ACP synthase                             243   2e-73    
ref|WP_015136255.1|  3-oxoacyl-(acyl-carrier-protein) synthase II       243   2e-73    
gb|KEH37629.1|  3-oxoacyl-(acyl carrier) synthase II                    243   3e-73    
gb|KHG11340.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    243   3e-73    
gb|AFW88075.1|  hypothetical protein ZEAMMB73_812704                    244   3e-73    
gb|KHN07879.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    244   4e-73    
ref|XP_010939869.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    246   4e-73    
ref|XP_010939870.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    246   4e-73    
ref|XP_011072620.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    246   5e-73    
ref|XP_011072618.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    246   5e-73    
ref|WP_029420548.1|  3-oxoacyl-ACP synthase                             241   6e-73    
ref|WP_008314539.1|  beta-ketoacyl-acyl-carrier-protein synthase II     241   6e-73    
ref|WP_016198189.1|  3-oxoacyl-ACP synthase                             241   6e-73    
ref|XP_004984083.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    244   6e-73    
ref|WP_017719391.1|  3-oxoacyl-ACP synthase                             241   6e-73    
ref|WP_035999301.1|  3-oxoacyl-ACP synthase                             241   7e-73    
ref|XP_007024707.1|  Fatty acid biosynthesis 1                          243   8e-73    
gb|AFW88073.1|  hypothetical protein ZEAMMB73_812704                    243   8e-73    
ref|WP_015180447.1|  beta-ketoacyl-acyl-carrier-protein synthase II     241   1e-72    
ref|XP_007514613.1|  predicted protein                                  244   1e-72    
ref|WP_016878950.1|  3-oxoacyl-ACP synthase                             241   1e-72    
ref|WP_019504850.1|  3-oxoacyl-ACP synthase                             241   1e-72    
ref|WP_013907007.1|  3-oxoacyl-ACP synthase                             241   1e-72    
gb|KJB65355.1|  hypothetical protein B456_010G091400                    240   1e-72    
gb|ADI21488.1|  3-oxoacyl-(acyl-carrier-protein) synthase               240   1e-72    
ref|WP_019120484.1|  3-oxoacyl-ACP synthase                             241   1e-72    
ref|WP_007719724.1|  3-oxoacyl-ACP synthase                             240   1e-72    
ref|WP_035589223.1|  3-oxoacyl-ACP synthase                             240   2e-72    
ref|XP_004169836.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    244   2e-72    
ref|WP_018398399.1|  3-oxoacyl-ACP synthase                             240   2e-72    
ref|XP_004144052.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    244   2e-72    
ref|WP_006101680.1|  3-oxoacyl-ACP synthase                             240   2e-72    
ref|WP_006633717.1|  3-oxoacyl-ACP synthase                             240   2e-72    
gb|EPS66235.1|  hypothetical protein M569_08544                         233   2e-72    
ref|WP_005834333.1|  MULTISPECIES: 3-oxoacyl-ACP synthase               240   3e-72    
ref|WP_018992330.1|  3-oxoacyl-ACP synthase                             239   3e-72    
ref|WP_026734654.1|  3-oxoacyl-ACP synthase                             239   4e-72    
dbj|GAK50321.1|  3-oxoacyl-[acyl-carrier-protein] synthase 2            240   4e-72    



>emb|CBI30851.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   422 bits (1085),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 199/211 (94%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEY+GGA
Sbjct  196  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYMGGA  255

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI S+LEDAGVSPEEVNYINAHATST+VGDLAEVNA+KKV
Sbjct  256  VNCDAYHMTDPRSDGLGVSSCIESSLEDAGVSPEEVNYINAHATSTIVGDLAEVNAIKKV  315

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTV N
Sbjct  316  FKSTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVAN  375

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVV FSAFKP
Sbjct  376  KKQQHEVNVAISNSFGFGGHNSVVVFSAFKP  406



>emb|CAN70157.1| hypothetical protein VITISV_030014 [Vitis vinifera]
Length=441

 Score =   422 bits (1084),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 199/211 (94%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEY+GGA
Sbjct  231  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYMGGA  290

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI S+LEDAGVSPEEVNYINAHATST+VGDLAEVNA+KKV
Sbjct  291  VNCDAYHMTDPRSDGLGVSSCIESSLEDAGVSPEEVNYINAHATSTIVGDLAEVNAIKKV  350

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTV N
Sbjct  351  FKSTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVAN  410

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVV FSAFKP
Sbjct  411  KKQQHEVNVAISNSFGFGGHNSVVVFSAFKP  441



>ref|XP_006365563.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Solanum tuberosum]
Length=469

 Score =   422 bits (1085),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/211 (94%), Positives = 207/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAG+LVMESLEHAMKRGAPIIAEYLGGA
Sbjct  259  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGILVMESLEHAMKRGAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATST+VGDLAE+NAVKKV
Sbjct  319  VNCDAYHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATSTIVGDLAEINAVKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IKMNATKSMIGHCLGAAGGLEAIAT+KAITTGW+HP+INQFNPEPSVEFDTVPN
Sbjct  379  FKTTSGIKMNATKSMIGHCLGAAGGLEAIATIKAITTGWVHPSINQFNPEPSVEFDTVPN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  439  KKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_010275024.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nelumbo nucifera]
Length=471

 Score =   422 bits (1085),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 199/211 (94%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  261  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  320

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATST+ GDLAEVNA+KKV
Sbjct  321  VNCDAYHMTDPRADGLGVSSCIESSLEDAGVSPEEVNYINAHATSTIAGDLAEVNAIKKV  380

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+T EIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTV N
Sbjct  381  FKNTKEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVAN  440

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVV FSAFKP
Sbjct  441  KKQQHEVNVAISNSFGFGGHNSVVVFSAFKP  471



>ref|XP_002272874.2| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Vitis vinifera]
Length=463

 Score =   421 bits (1082),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 199/211 (94%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEY+GGA
Sbjct  253  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYMGGA  312

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI S+LEDAGVSPEEVNYINAHATST+VGDLAEVNA+KKV
Sbjct  313  VNCDAYHMTDPRSDGLGVSSCIESSLEDAGVSPEEVNYINAHATSTIVGDLAEVNAIKKV  372

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTV N
Sbjct  373  FKSTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVAN  432

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVV FSAFKP
Sbjct  433  KKQQHEVNVAISNSFGFGGHNSVVVFSAFKP  463



>ref|XP_009627828.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=467

 Score =   420 bits (1080),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 200/211 (95%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  257  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  316

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATST+VGDLAEVNAVKKV
Sbjct  317  VNCDAYHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATSTIVGDLAEVNAVKKV  376

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ SEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  377  FKNPSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  436

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVV FSAFKP
Sbjct  437  KKQQHEVNVAISNSFGFGGHNSVVVFSAFKP  467



>ref|XP_009763087.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nicotiana sylvestris]
Length=467

 Score =   420 bits (1080),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 200/211 (95%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  257  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  316

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATST+VGDLAEVNAVKKV
Sbjct  317  VNCDAYHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATSTIVGDLAEVNAVKKV  376

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ SEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  377  FKNPSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  436

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVV FSAFKP
Sbjct  437  KKQQHEVNVAISNSFGFGGHNSVVVFSAFKP  467



>ref|XP_011085258.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Sesamum indicum]
Length=471

 Score =   419 bits (1078),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 199/211 (94%), Positives = 207/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLV+ESLEHAMKRGAPIIAEYLGGA
Sbjct  261  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVLESLEHAMKRGAPIIAEYLGGA  320

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI SALEDAGVSPEEVNYINAHATST+VGDLAEVNA+KKV
Sbjct  321  VNCDAYHMTDPRSDGLGVSSCIQSALEDAGVSPEEVNYINAHATSTIVGDLAEVNAIKKV  380

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQF+ EPSVEFDTV N
Sbjct  381  FKNTSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFSAEPSVEFDTVAN  440

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQEHE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  441  KKQEHEVNVAISNSFGFGGHNSVVAFSAFKP  471



>ref|XP_006467495.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Citrus sinensis]
 gb|KDO78133.1| hypothetical protein CISIN_1g012221mg [Citrus sinensis]
Length=468

 Score =   419 bits (1078),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 197/211 (93%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  258  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  317

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  318  VNCDAYHMTDPRADGLGVSSCIESSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  377

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+T+ IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  378  FKNTTGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  437

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  438  KKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  468



>ref|XP_004233105.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Solanum lycopersicum]
Length=469

 Score =   419 bits (1078),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/211 (93%), Positives = 207/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK+RDGFVMGEGAG+LVMESLEHAMKRGAPIIAEYLGGA
Sbjct  259  FVACRALSQRNDDPQTASRPWDKERDGFVMGEGAGILVMESLEHAMKRGAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATST+VGDLAE+NAVKKV
Sbjct  319  VNCDAYHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATSTIVGDLAEINAVKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK T+ IKMNATKSMIGHCLGAAGGLEAIAT+KAITTGW+HP+INQFNPEPSVEFDTVPN
Sbjct  379  FKTTTGIKMNATKSMIGHCLGAAGGLEAIATIKAITTGWVHPSINQFNPEPSVEFDTVPN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  439  KKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_011096538.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Sesamum indicum]
Length=472

 Score =   419 bits (1077),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 199/211 (94%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  262  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  321

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI SALEDAGVSPEEVNYINAHATST+VGDLAEVNA+KKV
Sbjct  322  VNCDAYHMTDPRADGLGVSSCIQSALEDAGVSPEEVNYINAHATSTVVGDLAEVNAIKKV  381

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTV N
Sbjct  382  FKNTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVAN  441

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  442  KKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  472



>gb|KDP37953.1| hypothetical protein JCGZ_04596 [Jatropha curcas]
Length=468

 Score =   419 bits (1076),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 197/211 (93%), Positives = 204/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWD+DRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  258  FVACRALSQRNDDPQTASRPWDRDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  317

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  318  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  377

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIK+NATKSMIGHCLGAAGGLEAIA  KAITTGWLHPTINQFNPEPSVEFDTV N
Sbjct  378  FKDTSEIKINATKSMIGHCLGAAGGLEAIACAKAITTGWLHPTINQFNPEPSVEFDTVAN  437

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  438  KKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  468



>ref|XP_006449664.1| hypothetical protein CICLE_v10015139mg [Citrus clementina]
 gb|ESR62904.1| hypothetical protein CICLE_v10015139mg [Citrus clementina]
Length=468

 Score =   418 bits (1075),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 197/211 (93%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  258  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  317

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  318  VNCDAYHMTDPRADGLGVSSCIESSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  377

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK T+ IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  378  FKSTAGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  437

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  438  KKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  468



>gb|ABJ90468.1| beta-ketoacyl-ACP synthase I [Jatropha curcas]
Length=468

 Score =   418 bits (1075),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 197/211 (93%), Positives = 204/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWD+DRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  258  FVACRALSQRNDDPQTASRPWDRDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  317

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  318  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  377

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIK+NATKSMIGHCLGAAGGLEAIA  KAITTGWLHPTINQFNPEPSVEFDTV N
Sbjct  378  FKDTSEIKINATKSMIGHCLGAAGGLEAIACAKAITTGWLHPTINQFNPEPSVEFDTVAN  437

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  438  KKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  468



>ref|XP_002519707.1| 50 kDa ketoavyl-ACP synthase [Ricinus communis]
 gb|AAA33873.1| chloroplast beta-ketoacyl-ACP synthase precursor [Ricinus communis]
 gb|ABR12416.1| plastid 3-keto-acyl-ACP synthase I [Ricinus communis]
 gb|EEF42680.1| 50 kDa ketoavyl-ACP synthase [Ricinus communis]
 dbj|BAM75183.1| ketoacyl-acyl carrier protein synthase [Ricinus communis]
Length=469

 Score =   418 bits (1075),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 197/211 (93%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  259  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  319  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS+IK+NATKSMIGHCLGAAGGLEAIA VKAITTGWLHPTINQFNPEPSVEFDTV N
Sbjct  379  FKNTSDIKINATKSMIGHCLGAAGGLEAIACVKAITTGWLHPTINQFNPEPSVEFDTVAN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  439  KKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_010052073.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Eucalyptus grandis]
 gb|KCW75930.1| hypothetical protein EUGRSUZ_D00305 [Eucalyptus grandis]
Length=465

 Score =   417 bits (1073),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 196/211 (93%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLV+ESLEHAMKRGAPIIAEYLGGA
Sbjct  255  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVLESLEHAMKRGAPIIAEYLGGA  314

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  315  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  374

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEPSV+FDTV N
Sbjct  375  FKNTSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVDFDTVAN  434

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  435  KKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  465



>ref|XP_011011532.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Populus euphratica]
Length=466

 Score =   417 bits (1073),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 195/211 (92%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAM+RGAPIIAEYLGGA
Sbjct  256  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAMRRGAPIIAEYLGGA  315

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  316  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  375

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIK+NATKSMIGHCLGA+GGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  376  FKNTSEIKINATKSMIGHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  435

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  436  KKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  466



>gb|KHN28969.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Glycine 
soja]
Length=305

 Score =   411 bits (1057),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  95   FVACRALSQRNDDPKTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  154

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVS+CI S+LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  155  VNCDAYHMTDPRSDGLGVSTCIQSSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  214

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTS IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEP+V+FDTV N
Sbjct  215  FKDTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPAVDFDTVAN  274

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HEINVAISNSFGFGGHNSVVAFSAFKP
Sbjct  275  VKQQHEINVAISNSFGFGGHNSVVAFSAFKP  305



>gb|KJB57278.1| hypothetical protein B456_009G156400 [Gossypium raimondii]
Length=473

 Score =   417 bits (1073),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 196/211 (93%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  263  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  322

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  323  VNCDAYHMTDPRSDGLGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  382

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  383  FKNTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  442

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  443  KKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  473



>ref|XP_009801210.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Nicotiana sylvestris]
Length=469

 Score =   417 bits (1071),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/211 (92%), Positives = 207/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK+RDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  259  FVACRALSQRNDDPQTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATST+VGD+AEVNA+KKV
Sbjct  319  VNCDAHHMTDPRADGLGVSSCIQSSLEDAGVSPEEVNYINAHATSTIVGDIAEVNAIKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS IKMNATKSMIGHCLGAAGG+EAIATVKAITTGW+HP+INQFNPEPSVEFDTVPN
Sbjct  379  FKNTSGIKMNATKSMIGHCLGAAGGMEAIATVKAITTGWVHPSINQFNPEPSVEFDTVPN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NV ISNSFGFGGHNSVVAFSAFKP
Sbjct  439  KKQQHEVNVGISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_006366097.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Solanum tuberosum]
Length=468

 Score =   417 bits (1071),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/211 (94%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  258  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  317

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATST+VGDLAEVNA+KKV
Sbjct  318  VNCDAHHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATSTIVGDLAEVNAIKKV  377

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIKMNATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFN EPSVEFDTVPN
Sbjct  378  FKNTSEIKMNATKSMIGHCLGAAGGLEAIATVKAIKTGWLHPSINQFNTEPSVEFDTVPN  437

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HEINVAISNSFGFGGHNSVV FS FKP
Sbjct  438  KKQQHEINVAISNSFGFGGHNSVVVFSDFKP  468



>gb|ABM53471.1| plastid 3-keto-acyl-ACP synthase I [Helianthus annuus]
Length=462

 Score =   416 bits (1070),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 197/211 (93%), Positives = 204/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  252  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  311

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI S+LEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV
Sbjct  312  VNCDAYHMTDPRSDGLGVSSCIQSSLEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  371

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK T  IKMN+TKSMIGHCLGAAGGLEAIATVKAI TGWLHPTINQFNPEP+VEFDTV N
Sbjct  372  FKSTDGIKMNSTKSMIGHCLGAAGGLEAIATVKAIQTGWLHPTINQFNPEPAVEFDTVAN  431

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +KQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  432  QKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  462



>gb|KHG12491.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Gossypium 
arboreum]
Length=473

 Score =   416 bits (1070),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 195/211 (92%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  263  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  322

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  323  VNCDAYHMTDPRSDGLGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  382

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS IK+NATKSMIGHCLGAAGGLEAIA+VKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  383  FKNTSGIKINATKSMIGHCLGAAGGLEAIASVKAITTGWLHPSINQFNPEPSVEFDTVAN  442

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  443  KKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  473



>gb|EYU43272.1| hypothetical protein MIMGU_mgv1a005817mg [Erythranthe guttata]
Length=469

 Score =   416 bits (1070),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 196/211 (93%), Positives = 204/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK+RDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  259  FVACRALSQRNDDPQTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            + CDAYHMTDPRADGLGVSSCIH+ALEDAGVSPEEVNYINAHATST+VGDLAE+NA+KKV
Sbjct  319  INCDAYHMTDPRADGLGVSSCIHAALEDAGVSPEEVNYINAHATSTIVGDLAELNAIKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK   EIK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTV N
Sbjct  379  FKSPKEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVAN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HEINV ISNSFGFGGHNSVVAFSAFKP
Sbjct  439  TKQQHEINVGISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_009596105.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Nicotiana tomentosiformis]
Length=469

 Score =   416 bits (1068),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 207/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK+RDGFVMGEG+GVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  259  FVACRALSQRNDDPQTASRPWDKERDGFVMGEGSGVLVMESLEHAMKRGAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATST+VGD+AEVNA+KKV
Sbjct  319  VNCDAHHMTDPRADGLGVSSCIQSSLEDAGVSPEEVNYINAHATSTIVGDIAEVNAIKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS IKMNATKSMIGHCLGAAGG+EAIATVKAITTGW+HP+INQFNPEPSVEFDTVPN
Sbjct  379  FKNTSGIKMNATKSMIGHCLGAAGGMEAIATVKAITTGWVHPSINQFNPEPSVEFDTVPN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NV ISNSFGFGGHNSVVAFSAFKP
Sbjct  439  KKQQHEVNVGISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_002316735.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
 gb|EEE97347.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
Length=466

 Score =   415 bits (1067),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWD+DRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  256  FVACRALSQRNDDPKTASRPWDRDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  315

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  316  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  375

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIK+NATKSMIGHCLGA+GGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  376  FKNTSEIKINATKSMIGHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  435

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+H +NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  436  KKQQHAVNVAISNSFGFGGHNSVVAFSAFKP  466



>gb|KJB66778.1| hypothetical protein B456_010G165600 [Gossypium raimondii]
Length=337

 Score =   409 bits (1052),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  127  FVACRALSQRNDDPRTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  186

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADG GVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  187  VNCDAHHMTDPRADGFGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  246

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS+IK+NATKSMIGHCLGA+GGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  247  FKNTSDIKINATKSMIGHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  306

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  307  QKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  337



>ref|XP_010241300.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Nelumbo nucifera]
Length=471

 Score =   414 bits (1064),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 195/211 (92%), Positives = 204/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK+RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  261  FVACRALSQRNDDPQTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  320

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATST+ GDLAEVNA+KKV
Sbjct  321  VNCDAYHMTDPRADGLGVSSCIESSLEDAGVSPEEVNYINAHATSTIAGDLAEVNAIKKV  380

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK T EIK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  381  FKSTKEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  440

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KK++HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  441  KKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  471



>ref|XP_007158937.1| hypothetical protein PHAVU_002G194300g [Phaseolus vulgaris]
 gb|ESW30931.1| hypothetical protein PHAVU_002G194300g [Phaseolus vulgaris]
Length=467

 Score =   414 bits (1063),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  257  FVACRALSQRNDDPKTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  316

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI S+LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  317  VNCDAYHMTDPRSDGLGVSSCIQSSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  376

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTS IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEP+V+FDTV N
Sbjct  377  FKDTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPAVDFDTVAN  436

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  437  VKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  467



>gb|KJB66775.1| hypothetical protein B456_010G165600 [Gossypium raimondii]
Length=347

 Score =   409 bits (1051),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  137  FVACRALSQRNDDPRTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  196

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADG GVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  197  VNCDAHHMTDPRADGFGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  256

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS+IK+NATKSMIGHCLGA+GGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  257  FKNTSDIKINATKSMIGHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  316

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  317  QKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  347



>gb|KCW75931.1| hypothetical protein EUGRSUZ_D00305 [Eucalyptus grandis]
Length=466

 Score =   413 bits (1061),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 206/212 (97%), Gaps = 1/212 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLV+ESLEHAMKRGAPIIAEYLGGA
Sbjct  255  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVLESLEHAMKRGAPIIAEYLGGA  314

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEV-NYINAHATSTLVGDLAEVNAVKK  517
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEV NYINAHATSTL GDLAE+NA+KK
Sbjct  315  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVVNYINAHATSTLAGDLAEINAIKK  374

Query  516  VFKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVP  337
            VFK+TSEIK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEPSV+FDTV 
Sbjct  375  VFKNTSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVDFDTVA  434

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            NKKQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  435  NKKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  466



>ref|XP_004244796.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Solanum lycopersicum]
Length=468

 Score =   413 bits (1061),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 197/211 (93%), Positives = 204/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  258  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  317

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATST+VGDLAEVNA+KKV
Sbjct  318  VNCDAHHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATSTIVGDLAEVNAIKKV  377

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIKMNATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFN EPSVEFDTV N
Sbjct  378  FKNTSEIKMNATKSMIGHCLGAAGGLEAIATVKAIKTGWLHPSINQFNTEPSVEFDTVAN  437

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HEINVAISNSFGFGGHNSVV FS FKP
Sbjct  438  KKQQHEINVAISNSFGFGGHNSVVVFSDFKP  468



>ref|NP_001237654.1| beta-ketoacyl-ACP synthetase I-2 [Glycine max]
 gb|AAF61731.1|AF243183_1 beta-ketoacyl-ACP synthetase I-2 [Glycine max]
Length=469

 Score =   413 bits (1061),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  259  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVS+CI S+LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  319  VNCDAYHMTDPRSDGLGVSTCIQSSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTS IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEP+V+FDTV N
Sbjct  379  FKDTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPAVDFDTVAN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HEINVAISNSFGFGGHNSVVAFSAF+P
Sbjct  439  VKQQHEINVAISNSFGFGGHNSVVAFSAFRP  469



>ref|NP_001238610.1| beta-ketoacyl-ACP synthetase I [Glycine max]
 gb|AAF61730.1|AF243182_1 beta-ketoacyl-ACP synthetase I [Glycine max]
Length=469

 Score =   412 bits (1060),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  259  FVACRALSQRNDDPKTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVS+CI S+LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  319  VNCDAYHMTDPRSDGLGVSTCIQSSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTS IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEP+V+FDTV N
Sbjct  379  FKDTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPAVDFDTVAN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HEINVAISNSFGFGGHNSVVAFSAFKP
Sbjct  439  VKQQHEINVAISNSFGFGGHNSVVAFSAFKP  469



>gb|AAC04691.1| beta-ketoacyl-ACP synthase I [Perilla frutescens]
Length=474

 Score =   413 bits (1061),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEG+GVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  264  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGSGVLVMESLEHAMKRGAPIIAEYLGGA  323

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI SALED+GVSPEEVNYINAHATST+VGDLA+VNA+KKV
Sbjct  324  VNCDAYHMTDPRADGLGVSSCIQSALEDSGVSPEEVNYINAHATSTIVGDLADVNAIKKV  383

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS IK+NATKSMIGHCLGAAGGLEAIA+VKAITTGWLHPTINQFNPEPS+ FDTV N
Sbjct  384  FKNTSGIKINATKSMIGHCLGAAGGLEAIASVKAITTGWLHPTINQFNPEPSIGFDTVAN  443

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +KQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  444  EKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  474



>ref|XP_004147414.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65557.1| hypothetical protein Csa_1G447400 [Cucumis sativus]
Length=471

 Score =   412 bits (1060),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAG+LVMESLEHAMKRGAPIIAEYLGGA
Sbjct  261  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGILVMESLEHAMKRGAPIIAEYLGGA  320

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  321  VNCDAYHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  380

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPEPSV+FDTV N
Sbjct  381  FKNTSEIKINATKSMIGHCLGAAGGLEAIATVKAIETGWLHPSINQFNPEPSVDFDTVAN  440

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  441  VKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  471



>emb|CDP06309.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   413 bits (1061),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 195/211 (92%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  264  FVACRALSQRNDDPKTASRPWDKARDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  323

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI S+LEDAGVSPEEVNYINAHATST+VGDLAEVNA+KKV
Sbjct  324  VNCDAYHMTDPRSDGLGVSSCIQSSLEDAGVSPEEVNYINAHATSTVVGDLAEVNAIKKV  383

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS IKMNATKSMIGHCLGAAGGLEAIATVKAITTGW+HPTINQFNPEP+VEFDTVPN
Sbjct  384  FKNTSGIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWVHPTINQFNPEPAVEFDTVPN  443

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  444  TKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  474



>ref|XP_004161144.1| PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[acyl-carrier-protein] 
synthase I, chloroplastic-like [Cucumis sativus]
Length=471

 Score =   412 bits (1060),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAG+LVMESLEHAMKRGAPIIAEYLGGA
Sbjct  261  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGILVMESLEHAMKRGAPIIAEYLGGA  320

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  321  VNCDAYHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  380

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPEPSV+FDTV N
Sbjct  381  FKNTSEIKINATKSMIGHCLGAAGGLEAIATVKAIETGWLHPSINQFNPEPSVDFDTVAN  440

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  441  VKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  471



>gb|ABA07910.1| plastid 3-ketoacyl-ACP synthase I [Cuphea avigera var. pulcherrima]
Length=465

 Score =   412 bits (1058),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 204/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLV+ESLEHAMKRGAPIIAEYLGGA
Sbjct  255  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVLESLEHAMKRGAPIIAEYLGGA  314

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            + CDAYHMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  315  INCDAYHMTDPRADGLGVSSCIESSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  374

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+T +IK+NATKSMIGHCLGA+GGLEAIAT+K I TGWLHP+INQFNPEPSVEFDTV N
Sbjct  375  FKNTKDIKINATKSMIGHCLGASGGLEAIATIKGINTGWLHPSINQFNPEPSVEFDTVAN  434

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  435  KKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  465



>ref|XP_010666593.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010666594.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=472

 Score =   412 bits (1059),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 193/211 (91%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEG+GVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  262  FVACRALSQRNDDPQTASRPWDKARDGFVMGEGSGVLVMESLEHAMKRGAPIIAEYLGGA  321

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEVNYINAHATST+VGDLAEVNA+KKV
Sbjct  322  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHATSTIVGDLAEVNAIKKV  381

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIK+NATKSMIGHCLGAAGG+EAIA+VKA TTGWLHPTINQF+PEPSVEF+TVPN
Sbjct  382  FKNTSEIKINATKSMIGHCLGAAGGMEAIASVKACTTGWLHPTINQFDPEPSVEFNTVPN  441

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVV FSAFKP
Sbjct  442  KKQQHEVNVAISNSFGFGGHNSVVVFSAFKP  472



>gb|KHG22354.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic -like 
protein [Gossypium arboreum]
Length=473

 Score =   412 bits (1059),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRN+DPQTASRPWDK+RDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  263  FVACRALSQRNEDPQTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  322

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  323  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  382

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIK+NATKSMIGHCLGAAGGLEAIATVKAITTGW+HPTINQFNPEPSVEFD V N
Sbjct  383  FKNTSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWVHPTINQFNPEPSVEFDPVAN  442

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +KQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  443  EKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  473



>ref|XP_008444105.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Cucumis melo]
Length=471

 Score =   411 bits (1056),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 193/211 (91%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAG+LVMESLEHAMKRGAPIIAEYLGGA
Sbjct  261  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGILVMESLEHAMKRGAPIIAEYLGGA  320

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATSTL GD+AE+NA+KKV
Sbjct  321  VNCDAYHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATSTLAGDIAEINAIKKV  380

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPEPSV+FDTV N
Sbjct  381  FKNTSEIKINATKSMIGHCLGAAGGLEAIATVKAIETGWLHPSINQFNPEPSVDFDTVAN  440

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  441  VKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  471



>ref|XP_002305334.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
 gb|EEE85845.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
Length=471

 Score =   411 bits (1056),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 204/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAM+RGAPIIAEYLGGA
Sbjct  261  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAMRRGAPIIAEYLGGA  320

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEVNYINAHATST+ GDLAE+NA+KKV
Sbjct  321  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHATSTIAGDLAEINAIKKV  380

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS IK+NATKSMIGHCLGAAGGLEAIA+VKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  381  FKNTSGIKINATKSMIGHCLGAAGGLEAIASVKAITTGWLHPSINQFNPEPSVEFDTVAN  440

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVV FSAFKP
Sbjct  441  KKQQHEVNVAISNSFGFGGHNSVVVFSAFKP  471



>ref|XP_007025113.1| 3-ketoacyl-acyl carrier protein synthase I isoform 1 [Theobroma 
cacao]
 gb|EOY27735.1| 3-ketoacyl-acyl carrier protein synthase I isoform 1 [Theobroma 
cacao]
Length=548

 Score =   413 bits (1061),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEG+GVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  338  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGSGVLVMESLEHAMKRGAPIIAEYLGGA  397

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEVN+INAHATSTL GDLAE+NA+KKV
Sbjct  398  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNHINAHATSTLAGDLAEINAIKKV  457

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS+IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  458  FKNTSDIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  517

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  518  VKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  548



>gb|KJB66777.1| hypothetical protein B456_010G165600 [Gossypium raimondii]
Length=473

 Score =   409 bits (1052),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  263  FVACRALSQRNDDPRTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  322

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADG GVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  323  VNCDAHHMTDPRADGFGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  382

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS+IK+NATKSMIGHCLGA+GGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  383  FKNTSDIKINATKSMIGHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  442

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  443  QKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  473



>ref|XP_010529153.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Tarenaya hassleriana]
Length=469

 Score =   409 bits (1051),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  259  FVACRALSQRNDDPETASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPR+DGLGVSSCI   LEDAGVS EEVNYINAHATSTLVGDLAE+NA+KKV
Sbjct  319  VNCDAHHMTDPRSDGLGVSSCIERCLEDAGVSHEEVNYINAHATSTLVGDLAEINAIKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEP+V+FDTVPN
Sbjct  379  FKNTSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPAVDFDTVPN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++H++NVAISNSFGFGGHNSVVAFSAF+P
Sbjct  439  QKKQHDVNVAISNSFGFGGHNSVVAFSAFRP  469



>ref|XP_004293525.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=469

 Score =   408 bits (1048),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 203/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAG+LVMESLEHAMKRGAPIIAEYLGGA
Sbjct  259  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGILVMESLEHAMKRGAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            + CDAYHMTDPRADGLGVS+CI  +LED+GVSPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  319  INCDAYHMTDPRADGLGVSTCIERSLEDSGVSPEEVNYINAHATSTLAGDLAEVNAIKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+T EIK+NATKSMIGHCLGA+GGLEAIATVKAI TGWLHP+INQFNPEPSVEFDTV N
Sbjct  379  FKNTKEIKINATKSMIGHCLGASGGLEAIATVKAIQTGWLHPSINQFNPEPSVEFDTVAN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  439  VKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  469



>gb|KEH43811.1| 3-oxoacyl-(acyl carrier) synthase II [Medicago truncatula]
Length=472

 Score =   407 bits (1047),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 203/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK RDGFVMGEG+GVLV+ESLEHAMKRGAPIIAEYLGGA
Sbjct  262  FVACRALSQRNDDPKTASRPWDKARDGFVMGEGSGVLVLESLEHAMKRGAPIIAEYLGGA  321

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVS+CI S+LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  322  VNCDAYHMTDPRSDGLGVSTCIQSSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  381

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTS IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEP+V+FDTV N
Sbjct  382  FKDTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPAVDFDTVAN  441

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HEINV ISNSFGFGGHNSVVAFSAF+P
Sbjct  442  VKQQHEINVGISNSFGFGGHNSVVAFSAFRP  472



>ref|XP_010538529.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Tarenaya hassleriana]
Length=469

 Score =   406 bits (1044),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 203/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHA+KRGAPIIAEYLGGA
Sbjct  259  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHALKRGAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            + CDAYHMTDPR+DGLGVSSCI   LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  319  INCDAYHMTDPRSDGLGVSSCIERCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEP+V+FDTV N
Sbjct  379  FKNTSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPAVDFDTVAN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVVAFSAF P
Sbjct  439  VKKQHEVNVAISNSFGFGGHNSVVAFSAFTP  469



>emb|CDX77646.1| BnaC07g19000D [Brassica napus]
Length=469

 Score =   406 bits (1044),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  259  FVACRALSQRNDDPQTASRPWDKQRDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI S LEDAGVSPEEVNYINAHATSTL GDLAE+NAVKKV
Sbjct  319  VNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHATSTLAGDLAEINAVKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPEP+V+FDTV N
Sbjct  379  FKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEPAVDFDTVAN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  439  EKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_011012842.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Populus euphratica]
Length=471

 Score =   406 bits (1044),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 203/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWD+DRDGFVMGEGAGVLVMESLEHAM+RGAPIIAEYLGGA
Sbjct  261  FVACRALSQRNDDPKTASRPWDRDRDGFVMGEGAGVLVMESLEHAMRRGAPIIAEYLGGA  320

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEVNYINAHA ST+ GDLAE+NA++KV
Sbjct  321  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHAPSTIAGDLAEINAIRKV  380

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS IK+NATKSMIGHCLGAAGGLEAIA+VKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  381  FKNTSGIKINATKSMIGHCLGAAGGLEAIASVKAITTGWLHPSINQFNPEPSVEFDTVAN  440

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVV FSAFKP
Sbjct  441  KKQQHEVNVAISNSFGFGGHNSVVVFSAFKP  471



>ref|XP_009101526.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Brassica rapa]
Length=470

 Score =   406 bits (1043),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  260  FVACRALSQRNDDPQTASRPWDKQRDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  319

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI S LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  320  VNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  379

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPEP+V+FDTV N
Sbjct  380  FKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEPAVDFDTVAN  439

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  440  EKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  470



>emb|CDY33467.1| BnaA06g36060D [Brassica napus]
Length=469

 Score =   406 bits (1043),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  259  FVACRALSQRNDDPQTASRPWDKQRDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI S LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  319  VNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPEP+V+FDTV N
Sbjct  379  FKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEPAVDFDTVAN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  439  EKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_003608492.1| Beta-ketoacyl-ACP synthase I [Medicago truncatula]
 gb|AES90689.1| 3-oxoacyl-(acyl carrier) synthase II [Medicago truncatula]
Length=470

 Score =   406 bits (1043),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 203/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  260  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  319

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI S+L DAGVSPEEVNYINAHATSTLVGDLAE+NA+KKV
Sbjct  320  VNCDAYHMTDPRSDGLGVSSCIQSSLVDAGVSPEEVNYINAHATSTLVGDLAEINAIKKV  379

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S IK+NATKSMIGHCLGAAGGLEAIAT+KAITTGWLHP+INQFNPEP+V+FDTV N
Sbjct  380  FKNPSGIKINATKSMIGHCLGAAGGLEAIATIKAITTGWLHPSINQFNPEPAVDFDTVAN  439

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HEINV ISNSFGFGGHNSVVAFSAF+P
Sbjct  440  VKQQHEINVGISNSFGFGGHNSVVAFSAFRP  470



>gb|KHN25892.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Glycine 
soja]
Length=664

 Score =   412 bits (1060),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  454  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  513

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVS+CI S+LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  514  VNCDAYHMTDPRSDGLGVSTCIQSSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  573

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTS IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEP+V+FDTV N
Sbjct  574  FKDTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPAVDFDTVAN  633

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HEINVAISNSFGFGGHNSVVAFSAF+P
Sbjct  634  VKQQHEINVAISNSFGFGGHNSVVAFSAFRP  664



>ref|XP_007211401.1| hypothetical protein PRUPE_ppa005228mg [Prunus persica]
 gb|EMJ12600.1| hypothetical protein PRUPE_ppa005228mg [Prunus persica]
Length=471

 Score =   405 bits (1041),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 203/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHA KRGAPIIAEYLGGA
Sbjct  261  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHATKRGAPIIAEYLGGA  320

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            + CDAYHMTDPRADGLGVS+CI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  321  INCDAYHMTDPRADGLGVSTCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  380

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+T +IK+NATKSMIGHCLGA+GGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  381  FKNTRDIKINATKSMIGHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  440

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  441  VKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  471



>ref|XP_010932377.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Elaeis guineensis]
Length=470

 Score =   405 bits (1041),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWD++RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  260  FVACRALSQRNDDPKTASRPWDRERDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  319

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEVNAVK+V
Sbjct  320  VNCDAYHMTDPRADGLGVSSCIEKSLEDAGVAPEEVNYINAHATSTLAGDLAEVNAVKQV  379

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ SEIKMNATKSMIGHCLGAAGGLEAIATVKA+TTGWLHPTINQFNPEP+VEFDTV N
Sbjct  380  FKNPSEIKMNATKSMIGHCLGAAGGLEAIATVKAMTTGWLHPTINQFNPEPAVEFDTVAN  439

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  440  KKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  470



>gb|AGH32916.1| ketoacyl-ACP synthase I [Camellia chekiangoleosa]
Length=469

 Score =   404 bits (1039),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK+RDGFVMGEG+GVLV+ESLEHAMKRGAPIIAEYLGGA
Sbjct  259  FVACRALSQRNDDPQTASRPWDKERDGFVMGEGSGVLVLESLEHAMKRGAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEVNYINAHATST  GD+AEVNA+KKV
Sbjct  319  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHATSTPAGDVAEVNAIKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIKMN+TKSMIGHCLGAAGGLEAIA+VKAI TGWLHPTINQFN EPSVEFDTV N
Sbjct  379  FKNTSEIKMNSTKSMIGHCLGAAGGLEAIASVKAINTGWLHPTINQFNLEPSVEFDTVAN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVV FS FKP
Sbjct  439  KKQQHEVNVAISNSFGFGGHNSVVVFSGFKP  469



>ref|XP_009128853.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Brassica rapa]
Length=472

 Score =   404 bits (1039),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  262  FVACRALSQRNDDPQTASRPWDKQRDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  321

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI S LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  322  VNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  381

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPEP+V+FDTV N
Sbjct  382  FKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEPAVDFDTVAN  441

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  442  EKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  472



>gb|KFK31480.1| hypothetical protein AALP_AA6G117600 [Arabis alpina]
Length=472

 Score =   404 bits (1038),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHA+KRGAPI+AEYLGGA
Sbjct  262  FVACRALSQRNDDPQTASRPWDKQRDGFVMGEGAGVLVMESLEHALKRGAPIVAEYLGGA  321

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI S LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  322  VNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  381

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPEP+V+FDTV N
Sbjct  382  FKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEPAVDFDTVAN  441

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVVAFSA+KP
Sbjct  442  EKKQHEVNVAISNSFGFGGHNSVVAFSAYKP  472



>gb|AFK43304.1| unknown [Medicago truncatula]
Length=470

 Score =   404 bits (1038),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 203/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLV+ESLEHAMKRGAPIIAEYLGGA
Sbjct  260  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVVESLEHAMKRGAPIIAEYLGGA  319

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI S+L DAGVSPEEVNYINAHATSTLVGDLAE+NA+KKV
Sbjct  320  VNCDAYHMTDPRSDGLGVSSCIQSSLVDAGVSPEEVNYINAHATSTLVGDLAEINAIKKV  379

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S IK+NATKSMIGHCLGAAGGLEAIAT+KAITTGWLHP+INQFNPEP+V+FDTV N
Sbjct  380  FKNPSGIKINATKSMIGHCLGAAGGLEAIATIKAITTGWLHPSINQFNPEPAVDFDTVAN  439

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HEINV ISNSFGFGGHNSVVAFSAF+P
Sbjct  440  VKQQHEINVGISNSFGFGGHNSVVAFSAFRP  470



>emb|CDY43962.1| BnaA02g24400D [Brassica napus]
Length=472

 Score =   404 bits (1038),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  262  FVACRALSQRNDDPQTASRPWDKQRDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  321

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI S LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  322  VNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  381

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPEP+V+FDTV N
Sbjct  382  FKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEPAVDFDTVAN  441

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  442  EKKQHEMNVAISNSFGFGGHNSVVAFSAFKP  472



>ref|XP_006398324.1| hypothetical protein EUTSA_v10000874mg [Eutrema salsugineum]
 gb|ESQ39777.1| hypothetical protein EUTSA_v10000874mg [Eutrema salsugineum]
Length=469

 Score =   404 bits (1037),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  259  FVACRALSQRNDDPQTASRPWDKQRDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVS+CI S L+DAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  319  VNCDAHHMTDPRADGLGVSTCIESCLQDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPEP+V+FDTV N
Sbjct  379  FKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEPAVDFDTVAN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  439  EKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_010917436.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Elaeis guineensis]
Length=469

 Score =   403 bits (1036),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRND+P+TASRPWDK RDGFVMGEGAGVLV+ESLEHAMKRGAPIIAEYLGGA
Sbjct  259  FVACRALSQRNDEPKTASRPWDKGRDGFVMGEGAGVLVLESLEHAMKRGAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEVNA+K+V
Sbjct  319  VNCDAYHMTDPRADGLGVSSCIQKSLEDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEP+VEFDTV N
Sbjct  379  FKNPSHIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPAVEFDTVAN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  439  KKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  469



>ref|XP_004504688.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Cicer arietinum]
Length=472

 Score =   403 bits (1036),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 204/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEG+GVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  262  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGSGVLVMESLEHAMKRGAPIIAEYLGGA  321

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPR+DGLGVS+CI S+L DAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  322  VNCDAHHMTDPRSDGLGVSTCIQSSLIDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  381

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS IK+NATKSMIGHCLGA+GGLEAIATVKAITTGWLHP+INQFNPEP+V+FDTVPN
Sbjct  382  FKNTSGIKINATKSMIGHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPAVDFDTVPN  441

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HEINV ISNSFGFGGHNSVVAFSAF+P
Sbjct  442  VKKQHEINVGISNSFGFGGHNSVVAFSAFRP  472



>ref|NP_001032018.1| beta-ketoacyl-[acyl carrier protein] synthase I  [Arabidopsis 
thaliana]
 gb|AED95364.1| beta-ketoacyl-[acyl carrier protein] synthase I [Arabidopsis 
thaliana]
Length=418

 Score =   401 bits (1031),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  208  FVACRALSQRNDDPQTASRPWDKARDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  267

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI   LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  268  VNCDAHHMTDPRADGLGVSSCIERCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  327

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPE +V+FDTVPN
Sbjct  328  FKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEQAVDFDTVPN  387

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE++VAISNSFGFGGHNSVVAFSAFKP
Sbjct  388  EKKQHEVDVAISNSFGFGGHNSVVAFSAFKP  418



>gb|KHG12107.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic -like 
protein [Gossypium arboreum]
Length=474

 Score =   403 bits (1036),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 204/211 (97%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  264  FVACRALSQRNDDPRTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  323

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADG GVSSCI  +LEDAGVS EEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  324  VNCDAHHMTDPRADGFGVSSCIERSLEDAGVSHEEVNYINAHATSTLAGDLAEINAIKKV  383

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS+IK+NATKSMIGHCLGA+GGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  384  FKNTSDIKINATKSMIGHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  443

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVVAFSAF+P
Sbjct  444  QKKQHEVNVAISNSFGFGGHNSVVAFSAFEP  474



>ref|XP_006845316.1| hypothetical protein AMTR_s00141p00029880 [Amborella trichopoda]
 gb|ERN06991.1| hypothetical protein AMTR_s00141p00029880 [Amborella trichopoda]
Length=468

 Score =   402 bits (1034),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  258  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  317

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR DGLGVS+CI  +LEDAGV+PEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  318  VNCDAYHMTDPRGDGLGVSTCIERSLEDAGVAPEEVNYINAHATSTLAGDLAEVNAIKKV  377

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTV N
Sbjct  378  FKNTSRIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVAN  437

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVVAF+ FKP
Sbjct  438  VKKQHEVNVGISNSFGFGGHNSVVAFAPFKP  468



>gb|ACJ07141.1| beta-ketoacyl-ACP synthase I-2 [Arachis hypogaea]
Length=470

 Score =   402 bits (1034),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEG+GVLVMESLEHAM+RGAPIIAEYLGGA
Sbjct  260  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGSGVLVMESLEHAMRRGAPIIAEYLGGA  319

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI S+LEDAGVSPEEVNYIN HATSTL GDLAE+NA+KK+
Sbjct  320  VNCDAYHMTDPRSDGLGVSSCIQSSLEDAGVSPEEVNYINCHATSTLAGDLAEINAIKKI  379

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK T  IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEP+V+FDTV N
Sbjct  380  FKKTDGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPAVDFDTVAN  439

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HEINV ISNSFGFGGHNSVVAFSAFKP
Sbjct  440  VKKQHEINVGISNSFGFGGHNSVVAFSAFKP  470



>gb|ACJ07140.1| beta-ketoacyl-ACP synthase I-1 [Arachis hypogaea]
Length=470

 Score =   402 bits (1034),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEG+GVLVMESLEHAM+RGAPIIAEYLGGA
Sbjct  260  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGSGVLVMESLEHAMRRGAPIIAEYLGGA  319

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI S+LEDAGVSPEEVNYIN HATSTL GDLAE+NA+KK+
Sbjct  320  VNCDAYHMTDPRSDGLGVSSCIQSSLEDAGVSPEEVNYINCHATSTLAGDLAEINAIKKI  379

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK T  IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEP+V+FDTV N
Sbjct  380  FKKTDGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPAVDFDTVAN  439

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HEINV ISNSFGFGGHNSVVAFSAFKP
Sbjct  440  VKKQHEINVGISNSFGFGGHNSVVAFSAFKP  470



>gb|ACZ06069.1| beta-ketoacyl-ACP synthetase I [Arachis hypogaea]
Length=470

 Score =   402 bits (1034),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEG+GVLVMESLEHAM+RGAPIIAEYLGGA
Sbjct  260  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGSGVLVMESLEHAMRRGAPIIAEYLGGA  319

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI S+LEDAGVSPEEVNYIN HATSTL GDLAE+NA+KK+
Sbjct  320  VNCDAYHMTDPRSDGLGVSSCIQSSLEDAGVSPEEVNYINCHATSTLAGDLAEINAIKKI  379

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK T  IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEP+V+FDTV N
Sbjct  380  FKKTDGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPAVDFDTVAN  439

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HEINV ISNSFGFGGHNSVVAFSAFKP
Sbjct  440  VKKQHEINVGISNSFGFGGHNSVVAFSAFKP  470



>ref|XP_008225453.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Prunus mume]
Length=471

 Score =   402 bits (1033),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHA KRGA IIAEYLGGA
Sbjct  261  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHATKRGAQIIAEYLGGA  320

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            + CDAYHMTDPRADGLGVS+CI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  321  INCDAYHMTDPRADGLGVSTCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  380

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+T +IK+NATKSMIGHCLGA+GGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  381  FKNTRDIKINATKSMIGHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  440

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  441  VKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  471



>ref|XP_002863412.1| kas I [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39671.1| kas I [Arabidopsis lyrata subsp. lyrata]
Length=473

 Score =   402 bits (1032),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  263  FVACRALSQRNDDPQTASRPWDKARDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  322

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI   LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  323  VNCDAHHMTDPRADGLGVSSCIERCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  382

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPE +V+FDTVPN
Sbjct  383  FKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEQAVDFDTVPN  442

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE++VAISNSFGFGGHNSVVAFSAFKP
Sbjct  443  QKKQHEVDVAISNSFGFGGHNSVVAFSAFKP  473



>ref|XP_009401483.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=463

 Score =   401 bits (1031),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  253  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  312

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSC+  +LEDAGV+PEEVNYINAHATSTL GDLAEVNA+K+V
Sbjct  313  VNCDAYHMTDPRADGLGVSSCVQKSLEDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQV  372

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD S +KMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFN EP+VEFDTV N
Sbjct  373  FKDPSAVKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNLEPAVEFDTVAN  432

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +KQ+HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  433  EKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  463



>gb|EAZ00014.1| hypothetical protein OsI_22012 [Oryza sativa Indica Group]
Length=321

 Score =   396 bits (1017),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWD+DRDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  111  FVACRALSQRNDDPKTASRPWDQDRDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  170

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +L DAGV+PEEVNYINAHATSTL GDLAEVNA+++V
Sbjct  171  VNCDAYHMTDPRSDGLGVSSCIKQSLADAGVAPEEVNYINAHATSTLAGDLAEVNAIRQV  230

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD SEIK+NATKSMIGHCLGAAGGLEAIATVKAITTGW+HP+INQFNPEP+VEFDTVPN
Sbjct  231  FKDPSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWVHPSINQFNPEPAVEFDTVPN  290

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ FKP
Sbjct  291  VKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  321



>ref|XP_010441599.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Camelina sativa]
Length=472

 Score =   401 bits (1031),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  262  FVACRALSQRNDDPQTASRPWDKARDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  321

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI   LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  322  VNCDAHHMTDPRADGLGVSSCIERCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  381

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPE +V+FDTVPN
Sbjct  382  FKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEQAVDFDTVPN  441

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE++VAISNSFGFGGHNSVVAFSAFKP
Sbjct  442  QKKQHEVDVAISNSFGFGGHNSVVAFSAFKP  472



>ref|NP_199441.1| beta-ketoacyl-[acyl carrier protein] synthase I  [Arabidopsis 
thaliana]
 sp|P52410.2|KASC1_ARATH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic; 
AltName: Full=Beta-ketoacyl-ACP synthase I; Short=KAS 
I; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB11084.1| 3-oxoacyl-[acyl-carrier-protein] synthase I precursor [Arabidopsis 
thaliana]
 gb|AAK59862.1| AT5g46290/MPL12_7 [Arabidopsis thaliana]
 gb|AAM16266.1| AT5g46290/MPL12_7 [Arabidopsis thaliana]
 gb|AAM65396.1| 3-oxoacyl-(acyl-carrier-protein) synthase I precursor (beta-ketoacyl-acp 
synthase I) (KAS I) [Arabidopsis thaliana]
 gb|AAM74493.1| AT5g46290/MPL12_7 [Arabidopsis thaliana]
 gb|AED95363.1| beta-ketoacyl-[acyl carrier protein] synthase I [Arabidopsis 
thaliana]
Length=473

 Score =   401 bits (1031),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  263  FVACRALSQRNDDPQTASRPWDKARDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  322

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI   LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  323  VNCDAHHMTDPRADGLGVSSCIERCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  382

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPE +V+FDTVPN
Sbjct  383  FKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEQAVDFDTVPN  442

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE++VAISNSFGFGGHNSVVAFSAFKP
Sbjct  443  EKKQHEVDVAISNSFGFGGHNSVVAFSAFKP  473



>gb|AAC49118.1| 3-ketoacyl-acyl carrier protein synthase I [Arabidopsis thaliana]
Length=473

 Score =   401 bits (1031),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  263  FVACRALSQRNDDPQTASRPWDKARDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  322

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI   LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  323  VNCDAHHMTDPRADGLGVSSCIERCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  382

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPE +V+FDTVPN
Sbjct  383  FKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEQAVDFDTVPN  442

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE++VAISNSFGFGGHNSVVAFSAFKP
Sbjct  443  EKKQHEVDVAISNSFGFGGHNSVVAFSAFKP  473



>emb|CDY03228.1| BnaC09g19280D [Brassica napus]
Length=470

 Score =   401 bits (1030),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  260  FVACRALSQRNDDPKTASRPWDKQRDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  319

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI S LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  320  VNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  379

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK T+ IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPEP+V+FDTV N
Sbjct  380  FKSTAGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEPAVDFDTVAN  439

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVVAFSAF P
Sbjct  440  EKKQHEVNVAISNSFGFGGHNSVVAFSAFTP  470



>emb|CDY35156.1| BnaA09g17930D [Brassica napus]
Length=470

 Score =   401 bits (1030),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  260  FVACRALSQRNDDPKTASRPWDKQRDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  319

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI S LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  320  VNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  379

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK T+ IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPEP+V+FDTV N
Sbjct  380  FKSTAGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEPAVDFDTVAN  439

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVVAFSAF P
Sbjct  440  EKKQHEVNVAISNSFGFGGHNSVVAFSAFTP  470



>ref|XP_008784346.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Phoenix dactylifera]
Length=469

 Score =   400 bits (1029),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  259  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEVNA+K+V
Sbjct  319  VNCDAYHMTDPRADGLGVSSCIRKSLEDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ SEIKMNATKS+IGHCLGA+GGLEAIATVKAITTGWLHP+INQFNPEP+VE DTV N
Sbjct  379  FKNPSEIKMNATKSIIGHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPAVEIDTVAN  438

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KK++HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  439  KKKQHEVNVAISNSFGFGGHNSVVVFAPFKP  469



>ref|XP_006280411.1| hypothetical protein CARUB_v10026344mg [Capsella rubella]
 gb|EOA13309.1| hypothetical protein CARUB_v10026344mg [Capsella rubella]
Length=471

 Score =   399 bits (1026),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAM RGAPI+AEYLGGA
Sbjct  261  FVACRALSQRNDDPQTASRPWDKARDGFVMGEGAGVLVMESLEHAMNRGAPIVAEYLGGA  320

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI   LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  321  VNCDAHHMTDPRADGLGVSSCIERCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  380

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPE +V+FDTVPN
Sbjct  381  FKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEQAVDFDTVPN  440

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE++VAISNSFGFGGHNSVVAFSAFKP
Sbjct  441  EKKQHEVDVAISNSFGFGGHNSVVAFSAFKP  471



>ref|NP_001152921.1| uncharacterized protein LOC100279917 [Zea mays]
 gb|ACL53726.1| unknown [Zea mays]
Length=321

 Score =   393 bits (1009),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  111  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  170

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +L+DAGV+PEEVNYINAHATSTL GDLAEVNA+K+V
Sbjct  171  VNCDAYHMTDPRSDGLGVSSCIKQSLKDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQV  230

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD S IK+NATKSMIGHCLGAAGGLEAIAT+KAITTGW+HP+INQFNPE +VEFDTVPN
Sbjct  231  FKDPSGIKINATKSMIGHCLGAAGGLEAIATIKAITTGWVHPSINQFNPEEAVEFDTVPN  290

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ FKP
Sbjct  291  VKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  321



>gb|EAZ36138.1| hypothetical protein OsJ_20447 [Oryza sativa Japonica Group]
Length=426

 Score =   396 bits (1018),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWD+DRDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  216  FVACRALSQRNDDPKTASRPWDQDRDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  275

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +L DAGV+PEEVNYINAHATSTL GDLAEVNA+++V
Sbjct  276  VNCDAYHMTDPRSDGLGVSSCIKQSLADAGVAPEEVNYINAHATSTLAGDLAEVNAIRQV  335

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD SEIK+NATKSMIGHCLGAAGGLEAIATVKAITTGW+HP+INQFNPEP+VEFDTVPN
Sbjct  336  FKDPSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWVHPSINQFNPEPAVEFDTVPN  395

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ FKP
Sbjct  396  VKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  426



>ref|XP_009114364.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Brassica rapa]
Length=470

 Score =   397 bits (1021),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRN+DP+TASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  260  FVACRALSQRNNDPKTASRPWDKQRDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  319

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI S LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  320  VNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  379

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK T+ IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQFNPEP+V+FDTV N
Sbjct  380  FKSTAGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEPAVDFDTVAN  439

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K+ HE+NVAISNSFGFGGHNSVVAFSAF P
Sbjct  440  EKKPHEVNVAISNSFGFGGHNSVVAFSAFTP  470



>ref|XP_008349175.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Malus domestica]
Length=472

 Score =   397 bits (1020),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRNDDP+TASRPWD+DRDGFV+GEGAGVLVMESLEHA KRGA IIAEYLGG 
Sbjct  262  FIACRALSQRNDDPKTASRPWDRDRDGFVIGEGAGVLVMESLEHATKRGATIIAEYLGGG  321

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            + CDAYHMTDPRADGLGVS+CI   LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  322  INCDAYHMTDPRADGLGVSTCIQKCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  381

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            F +T +IK+NATKSMIGHCLGA+GGLEAIA +KAITTGWLHP+INQFNPEPSVEFDTVPN
Sbjct  382  FTNTKDIKINATKSMIGHCLGASGGLEAIAVIKAITTGWLHPSINQFNPEPSVEFDTVPN  441

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HE+NVAISNSFGFGGHNSVVAFS FKP
Sbjct  442  VKQQHEVNVAISNSFGFGGHNSVVAFSPFKP  472



>ref|XP_008371590.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Malus domestica]
Length=472

 Score =   397 bits (1019),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  867  ACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGAVT  688
            ACRALSQRNDDP+TASRPWD+DRDGFVMGEGAGVLVMESLEHA KRGA IIAEYLGG + 
Sbjct  264  ACRALSQRNDDPKTASRPWDRDRDGFVMGEGAGVLVMESLEHATKRGATIIAEYLGGGIN  323

Query  687  CDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKVFK  508
            CDAYHMTDPRADGLGVS+CI   LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKVF 
Sbjct  324  CDAYHMTDPRADGLGVSTCIQRCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFT  383

Query  507  DTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPNKK  328
            +T +IK+NATKSMIGHCLGA+GGLEAIA +KAITTGWLHP+INQFNPEPSVEFDTVPN K
Sbjct  384  NTKDIKINATKSMIGHCLGASGGLEAIAVIKAITTGWLHPSINQFNPEPSVEFDTVPNVK  443

Query  327  QEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            Q+HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  444  QQHEVNVAISNSFGFGGHNSVVAFSAFKP  472



>ref|NP_001057053.1| Os06g0196600 [Oryza sativa Japonica Group]
 dbj|BAD35225.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplast 
precursor [Oryza sativa Japonica Group]
 dbj|BAF18967.1| Os06g0196600 [Oryza sativa Japonica Group]
 dbj|BAG87476.1| unnamed protein product [Oryza sativa Japonica Group]
Length=465

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWD+DRDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  255  FVACRALSQRNDDPKTASRPWDQDRDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  314

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +L DAGV+PEEVNYINAHATSTL GDLAEVNA+++V
Sbjct  315  VNCDAYHMTDPRSDGLGVSSCIKQSLADAGVAPEEVNYINAHATSTLAGDLAEVNAIRQV  374

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD SEIK+NATKSMIGHCLGAAGGLEAIATVKAITTGW+HP+INQFNPEP+VEFDTVPN
Sbjct  375  FKDPSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWVHPSINQFNPEPAVEFDTVPN  434

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ FKP
Sbjct  435  VKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  465



>ref|XP_008383499.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Malus domestica]
Length=472

 Score =   397 bits (1019),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRNDDP+TASRPWD+DRDGFV+GEGAGVLVMESLEHA KRGA IIAEYLGG 
Sbjct  262  FIACRALSQRNDDPKTASRPWDRDRDGFVIGEGAGVLVMESLEHATKRGATIIAEYLGGG  321

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            + CDAYHMTDPRADGLGVS+CI   LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  322  INCDAYHMTDPRADGLGVSTCIQKCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  381

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            F +T +IK+NATKSMIGHCLGA+GGLEAIA +KAITTGWLHP+INQFNPEPSVEFDTVPN
Sbjct  382  FTNTKDIKINATKSMIGHCLGASGGLEAIAVIKAITTGWLHPSINQFNPEPSVEFDTVPN  441

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HE+NVAISNSFGFGGHNSVVAFS FKP
Sbjct  442  VKQQHEVNVAISNSFGFGGHNSVVAFSPFKP  472



>ref|XP_010495756.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Camelina sativa]
Length=569

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  359  FVACRALSQRNDDPQTASRPWDKARDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  418

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI   LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  419  VNCDAHHMTDPRADGLGVSSCIERCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  478

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIA VKAI TGWLHP+INQFNPE +V+FDTVPN
Sbjct  479  FKSTSGIKINATKSMIGHCLGAAGGLEAIAVVKAINTGWLHPSINQFNPEQAVDFDTVPN  538

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE++VAISNSFGFGGHNSVVAFSAFKP
Sbjct  539  QKKQHEVDVAISNSFGFGGHNSVVAFSAFKP  569



>gb|KJB57279.1| hypothetical protein B456_009G156400 [Gossypium raimondii]
Length=515

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/253 (77%), Positives = 205/253 (81%), Gaps = 42/253 (17%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  263  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  322

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  323  VNCDAYHMTDPRSDGLGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  382

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  383  FKNTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  442

Query  333  KKQEHEINV------------------------------------------AISNSFGFG  280
            KKQ+HE+NV                                          AISNSFGFG
Sbjct  443  KKQQHEVNVGKTLYPFLGSTPSLSIYLHFDGYGSSRTCVFCNSNRLVLVDSAISNSFGFG  502

Query  279  GHNSVVAFSAFKP  241
            GHNSVVAFSAFKP
Sbjct  503  GHNSVVAFSAFKP  515



>ref|XP_010481467.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Camelina sativa]
Length=472

 Score =   396 bits (1018),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  262  FVACRALSQRNDDPQTASRPWDKARDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  321

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI   LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  322  VNCDAHHMTDPRADGLGVSSCIERCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  381

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATKSMIGHCLGAAGGLEAIA VKAI TGWLHP+INQFNPE +V+FDTV N
Sbjct  382  FKSTSGIKINATKSMIGHCLGAAGGLEAIAVVKAINTGWLHPSINQFNPEQAVDFDTVAN  441

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE++VAISNSFGFGGHNSVVAFSAFKP
Sbjct  442  QKKQHEVDVAISNSFGFGGHNSVVAFSAFKP  472



>ref|XP_009391220.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=468

 Score =   396 bits (1017),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWD  RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  258  FVACRALSQRNDDPKTASRPWDTGRDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  317

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGV+PEEV+YINAHATSTL GDLAEVNA+ +V
Sbjct  318  VNCDAYHMTDPRADGLGVSSCIRKSLEDAGVAPEEVSYINAHATSTLAGDLAEVNAINQV  377

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S IKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEP+VEFDTV N
Sbjct  378  FKNPSGIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPAVEFDTVAN  437

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+N+AISNSFGFGGHNSVV F+ FKP
Sbjct  438  KKQQHEVNIAISNSFGFGGHNSVVVFAPFKP  468



>ref|XP_009360871.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Pyrus x bretschneideri]
Length=472

 Score =   396 bits (1017),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRNDDP+TASRPWD+DRDGFV+GEGAGVLVMESLEHA KRGA IIAEYLGG 
Sbjct  262  FIACRALSQRNDDPKTASRPWDRDRDGFVIGEGAGVLVMESLEHATKRGATIIAEYLGGG  321

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            + CDAYHMTDPRADGLGVS+CI + LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  322  INCDAYHMTDPRADGLGVSTCIQTCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  381

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            F +T +IK+NATKSMIGHCLGA+GGLEAIA +KAITTGWLHP+INQFNPEPSVEFDTVPN
Sbjct  382  FTNTKDIKINATKSMIGHCLGASGGLEAIAVIKAITTGWLHPSINQFNPEPSVEFDTVPN  441

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HE+NVAISNSFGFGGHNSVVAFS FKP
Sbjct  442  VKQQHEVNVAISNSFGFGGHNSVVAFSPFKP  472



>gb|EPS68881.1| hypothetical protein M569_05881, partial [Genlisea aurea]
Length=494

 Score =   396 bits (1018),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 205/236 (87%), Gaps = 25/236 (11%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEG+GVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  259  FVACRALSQRNDDPRTASRPWDKERDGFVMGEGSGVLVMESLEHAMKRGAPIIAEYLGGA  318

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V+CDAYHMTDPRADGLGVSSCI +ALEDAGVS EEVNYINAHATST+VGDLAE+NA+KKV
Sbjct  319  VSCDAYHMTDPRADGLGVSSCIQNALEDAGVSAEEVNYINAHATSTVVGDLAEINAIKKV  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQF-------------  373
            FKDTS IK+NATKSMIGHCLGAAGGLEAIAT+KAITTGWLHPTINQF             
Sbjct  379  FKDTSGIKINATKSMIGHCLGAAGGLEAIATIKAITTGWLHPTINQFVTFYLVDRSHFVH  438

Query  372  ------------NPEPSVEFDTVPNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
                        NPEPSVEFDTVPN+KQ H++NVAISNSFGFGGHNSVVAFS F P
Sbjct  439  SPITLINGLLLQNPEPSVEFDTVPNQKQPHQVNVAISNSFGFGGHNSVVAFSGFNP  494



>ref|XP_002438009.1| hypothetical protein SORBIDRAFT_10g006430 [Sorghum bicolor]
 gb|EER89376.1| hypothetical protein SORBIDRAFT_10g006430 [Sorghum bicolor]
Length=461

 Score =   394 bits (1013),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESL+HAMKR APIIAEYLGGA
Sbjct  251  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLDHAMKRDAPIIAEYLGGA  310

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEVNA+K+V
Sbjct  311  VNCDAYHMTDPRADGLGVSSCIKQSLEDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQV  370

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD S IK+NATKSMIGHCLGAAGGLEAIAT+KAITTGW+HP+INQFNPE +VEFDTVPN
Sbjct  371  FKDPSGIKINATKSMIGHCLGAAGGLEAIATIKAITTGWVHPSINQFNPEEAVEFDTVPN  430

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ FKP
Sbjct  431  VKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  461



>ref|NP_001146139.1| uncharacterized protein LOC100279707 [Zea mays]
 gb|ACL53339.1| unknown [Zea mays]
Length=437

 Score =   393 bits (1010),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHA+KR APIIAEYLGGA
Sbjct  227  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAIKRDAPIIAEYLGGA  286

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEVNA+K+V
Sbjct  287  VNCDAYHMTDPRSDGLGVSSCIKQSLEDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQV  346

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD S IK+NATKSMIGHCLGAAGGLEAIATVKAITTGW+HP+INQFNPE +VEFDTVPN
Sbjct  347  FKDPSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWVHPSINQFNPEEAVEFDTVPN  406

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ FKP
Sbjct  407  VKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  437



>ref|XP_001762048.1| predicted protein [Physcomitrella patens]
 gb|EDQ73152.1| predicted protein, partial [Physcomitrella patens]
Length=431

 Score =   393 bits (1009),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALS RND PQTASRPWDKDR+GFVMGEGAGVLVMESLEHA+KRGAPI+AEYLGGA
Sbjct  221  FVACRALSTRNDSPQTASRPWDKDREGFVMGEGAGVLVMESLEHALKRGAPIVAEYLGGA  280

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDAYHMTDPR+DGLGVS+CI  +LEDAGV+ EEVNYINAHATSTLVGDLAEVNA+KKV
Sbjct  281  VTCDAYHMTDPRSDGLGVSTCIEKSLEDAGVATEEVNYINAHATSTLVGDLAEVNAIKKV  340

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMNATKSMIGHCLGAAGGLEAIAT+KAI TGWLHP+INQFNPE SV FDTVPN
Sbjct  341  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATIKAIQTGWLHPSINQFNPEESVTFDTVPN  400

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
             K++HE+NVAISNSFGFGGHNS V F+ ++
Sbjct  401  VKKQHEVNVAISNSFGFGGHNSCVVFAPYR  430



>gb|AFW85455.1| hypothetical protein ZEAMMB73_016804 [Zea mays]
Length=461

 Score =   394 bits (1012),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHA+KR APIIAEYLGGA
Sbjct  251  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAIKRDAPIIAEYLGGA  310

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEVNA+K+V
Sbjct  311  VNCDAYHMTDPRSDGLGVSSCIKQSLEDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQV  370

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD S IK+NATKSMIGHCLGAAGGLEAIATVKAITTGW+HP+INQFNPE +VEFDTVPN
Sbjct  371  FKDPSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWVHPSINQFNPEEAVEFDTVPN  430

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ FKP
Sbjct  431  VKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  461



>ref|NP_001149639.1| 3-oxoacyl-synthase I [Zea mays]
 gb|ACG36200.1| 3-oxoacyl-synthase I [Zea mays]
 gb|AFW76633.1| 3-oxoacyl-synthase I [Zea mays]
Length=461

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  251  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  310

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +L+DAGV+PEEVNYINAHATSTL GDLAEVNA+K+V
Sbjct  311  VNCDAYHMTDPRSDGLGVSSCIKQSLKDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQV  370

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD S IK+NATKSMIGHCLGAAGGLEAIAT+KAITTGW+HP+INQFNPE +VEFDTVPN
Sbjct  371  FKDPSGIKINATKSMIGHCLGAAGGLEAIATIKAITTGWVHPSINQFNPEEAVEFDTVPN  430

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ FKP
Sbjct  431  VKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  461



>gb|EAZ30871.1| hypothetical protein OsJ_14945 [Oryza sativa Japonica Group]
Length=408

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  198  FVACRALSQRNDDPETASRPWDKERDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  257

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEV A+K+V
Sbjct  258  VNCDAYHMTDPRSDGLGVSSCITQSLEDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQV  317

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S+IK+N+TKSMIGHCLGAAGGLEAIA VKAITTGW+HPTINQFNPEP V+FDTV N
Sbjct  318  FKNPSDIKINSTKSMIGHCLGAAGGLEAIAVVKAITTGWVHPTINQFNPEPEVDFDTVAN  377

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +KQ+HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  378  EKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  408



>ref|NP_001052904.1| Os04g0445700 [Oryza sativa Japonica Group]
 dbj|BAF14818.1| Os04g0445700 [Oryza sativa Japonica Group]
Length=442

 Score =   391 bits (1005),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  232  FVACRALSQRNDDPETASRPWDKERDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  291

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEV A+K+V
Sbjct  292  VNCDAYHMTDPRSDGLGVSSCITQSLEDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQV  351

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S+IK+N+TKSMIGHCLGAAGGLEAIA VKAITTGW+HPTINQFNPEP V+FDTV N
Sbjct  352  FKNPSDIKINSTKSMIGHCLGAAGGLEAIAVVKAITTGWVHPTINQFNPEPEVDFDTVAN  411

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +KQ+HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  412  EKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  442



>emb|CAD40964.2| OSJNBa0027P08.14 [Oryza sativa Japonica Group]
Length=442

 Score =   391 bits (1005),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  232  FVACRALSQRNDDPETASRPWDKERDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  291

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEV A+K+V
Sbjct  292  VNCDAYHMTDPRSDGLGVSSCITQSLEDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQV  351

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S+IK+N+TKSMIGHCLGAAGGLEAIA VKAITTGW+HPTINQFNPEP V+FDTV N
Sbjct  352  FKNPSDIKINSTKSMIGHCLGAAGGLEAIAVVKAITTGWVHPTINQFNPEPEVDFDTVAN  411

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +KQ+HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  412  EKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  442



>ref|XP_006656734.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Oryza brachyantha]
Length=438

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWD+ RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  228  FVACRALSQRNDDPKTASRPWDQARDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  287

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +L DAGV+PEEVNYINAHATSTL GDLAEVNA+++V
Sbjct  288  VNCDAYHMTDPRSDGLGVSSCIKQSLVDAGVAPEEVNYINAHATSTLAGDLAEVNAIRQV  347

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD S IK+NATKSMIGHCLGAAGGLEAIATVKAITTGW+HP+INQFNPEP+VEFDTVPN
Sbjct  348  FKDPSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWVHPSINQFNPEPAVEFDTVPN  407

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ FKP
Sbjct  408  VKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  438



>ref|XP_010917434.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Elaeis guineensis]
Length=477

 Score =   392 bits (1006),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  267  FVACRALSQRNDDPTTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  326

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMT PRADGLGVSSCI  +LE AGV+PEEVNYINAHATST  GDLAEVNA+K+V
Sbjct  327  VNCDAYHMTCPRADGLGVSSCIQKSLEHAGVAPEEVNYINAHATSTPAGDLAEVNAIKQV  386

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S++K+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHPTINQFNPEP+VEFDTV N
Sbjct  387  FKNPSDVKINATKSMIGHCLGAAGGLEAIATVKAIATGWLHPTINQFNPEPAVEFDTVAN  446

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            KKQ+HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  447  KKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  477



>emb|CAH67240.1| OSIGBa0140O07.8 [Oryza sativa Indica Group]
Length=442

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  232  FVACRALSQRNDDPETASRPWDKERDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  291

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEV A+K+V
Sbjct  292  VNCDAYHMTDPRSDGLGVSSCITQSLEDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQV  351

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S+IK+N+TKSMIGHCLGAAGGLEAIA +KAITTGW+HPTINQFNPEP V+FDTV N
Sbjct  352  FKNPSDIKINSTKSMIGHCLGAAGGLEAIAAIKAITTGWVHPTINQFNPEPEVDFDTVAN  411

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +KQ+HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  412  EKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  442



>gb|EMT32067.1| 3-oxoacyl-(acyl-carrier-protein) synthase I, chloroplastic [Aegilops 
tauschii]
Length=321

 Score =   386 bits (992),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  111  FVACRALSQRNDDPKTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  170

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +L+DAGV+PEEVNYINAHATSTL GDLAE+NA+K+V
Sbjct  171  VNCDAYHMTDPRADGLGVSSCIRQSLQDAGVAPEEVNYINAHATSTLAGDLAEMNAIKQV  230

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD S IK+NATKSMIGHCLGAAGGLEAIAT+KAI TG +HP+INQF+ EP+VEFDTVPN
Sbjct  231  FKDPSGIKVNATKSMIGHCLGAAGGLEAIATIKAINTGLVHPSINQFDREPAVEFDTVPN  290

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K EHEINV ISNSFGFGGHNSVV F+ FKP
Sbjct  291  VKVEHEINVGISNSFGFGGHNSVVVFAPFKP  321



>gb|ABR18442.1| unknown [Picea sitchensis]
Length=545

 Score =   394 bits (1012),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQ+ASRPWD+DRDGFVMGEGAGVLVMESLEHA KRGAPI+AEYLGGA
Sbjct  335  FVACRALSQRNDDPQSASRPWDRDRDGFVMGEGAGVLVMESLEHAKKRGAPILAEYLGGA  394

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            + CDAYHMTDPRADGLGVSSCI  +L DAGVSPEEVNYINAHATSTL GDLAEVNA+K V
Sbjct  395  INCDAYHMTDPRADGLGVSSCIERSLIDAGVSPEEVNYINAHATSTLAGDLAEVNAIKNV  454

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHPTINQFNPEPSVEFDTV N
Sbjct  455  FKNTSEIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPTINQFNPEPSVEFDTVRN  514

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HEI+VAISNSFGFGGHNSVV F+ ++P
Sbjct  515  VKKQHEIHVAISNSFGFGGHNSVVVFAPYRP  545



>dbj|BAH00228.1| unnamed protein product [Oryza sativa Japonica Group]
Length=462

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  252  FVACRALSQRNDDPETASRPWDKERDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  311

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEV A+K+V
Sbjct  312  VNCDAYHMTDPRSDGLGVSSCITQSLEDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQV  371

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S+IK+N+TKSMIGHCLGAAGGLEAIA VKAITTGW+HPTINQFNPEP V+FDTV N
Sbjct  372  FKNPSDIKINSTKSMIGHCLGAAGGLEAIAVVKAITTGWVHPTINQFNPEPEVDFDTVAN  431

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +KQ+HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  432  EKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  462



>ref|XP_003564149.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Brachypodium distachyon]
Length=463

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK+RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  253  FVACRALSQRNDDPQTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  312

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAE+NA+K+V
Sbjct  313  VNCDAYHMTDPRADGLGVSSCIRQSLEDAGVAPEEVNYINAHATSTLAGDLAEMNAIKQV  372

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD S IK+NATKSMIGHCLGAAGGLEAIAT+KAI TG +HP+INQFN EP+VEFDTVPN
Sbjct  373  FKDPSGIKVNATKSMIGHCLGAAGGLEAIATIKAINTGLVHPSINQFNREPAVEFDTVPN  432

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K EHE+NV ISNSFGFGGHNSVV F+ FKP
Sbjct  433  VKAEHEVNVGISNSFGFGGHNSVVVFAPFKP  463



>gb|EMS61772.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Triticum 
urartu]
Length=321

 Score =   386 bits (991),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  111  FVACRALSQRNDDPKTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  170

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +L+DAGV+PEEVNYINAHATSTL GDLAE+NA+K+V
Sbjct  171  VNCDAYHMTDPRADGLGVSSCIRQSLQDAGVAPEEVNYINAHATSTLAGDLAEMNAIKQV  230

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD S IK+NATKSMIGHCLGAAGGLEAIAT+KAI TG +HP+INQF  EP+VEFDTVPN
Sbjct  231  FKDPSGIKVNATKSMIGHCLGAAGGLEAIATIKAINTGLVHPSINQFEREPAVEFDTVPN  290

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K EHEINV ISNSFGFGGHNSVV F+ FKP
Sbjct  291  VKVEHEINVGISNSFGFGGHNSVVVFAPFKP  321



>ref|XP_004964587.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Setaria italica]
Length=462

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  252  FVACRALSQRNDDPKTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  311

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEVNA+K+V
Sbjct  312  VNCDAYHMTDPRSDGLGVSSCIKQSLEDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQV  371

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD S IK+NATKSMIGHCLGAAGGLEAIAT+KA+TTGW+HP+INQFNPE  VEFDTVPN
Sbjct  372  FKDPSGIKINATKSMIGHCLGAAGGLEAIATIKAMTTGWVHPSINQFNPEEVVEFDTVPN  431

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ FKP
Sbjct  432  VKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  462



>ref|NP_001190479.1| beta-ketoacyl-[acyl carrier protein] synthase I  [Arabidopsis 
thaliana]
 gb|AED95365.1| beta-ketoacyl-[acyl carrier protein] synthase I [Arabidopsis 
thaliana]
Length=489

 Score =   392 bits (1006),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/227 (83%), Positives = 201/227 (89%), Gaps = 16/227 (7%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  263  FVACRALSQRNDDPQTASRPWDKARDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  322

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI   LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  323  VNCDAHHMTDPRADGLGVSSCIERCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  382

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQF-------------  373
            FK TS IK+NATKSMIGHCLGAAGGLEAIATVKAI TGWLHP+INQF             
Sbjct  383  FKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFVRITGSQEKASLI  442

Query  372  ---NPEPSVEFDTVPNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
               NPE +V+FDTVPN+K++HE++VAISNSFGFGGHNSVVAFSAFKP
Sbjct  443  PLSNPEQAVDFDTVPNEKKQHEVDVAISNSFGFGGHNSVVAFSAFKP  489



>gb|EAY94286.1| hypothetical protein OsI_16057 [Oryza sativa Indica Group]
Length=462

 Score =   390 bits (1003),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  252  FVACRALSQRNDDPETASRPWDKERDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  311

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEV A+K+V
Sbjct  312  VNCDAYHMTDPRSDGLGVSSCITQSLEDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQV  371

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S+IK+N+TKSMIGHCLGAAGGLEAIA +KAITTGW+HPTINQFNPEP V+FDTV N
Sbjct  372  FKNPSDIKINSTKSMIGHCLGAAGGLEAIAAIKAITTGWVHPTINQFNPEPEVDFDTVAN  431

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +KQ+HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  432  EKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  462



>ref|XP_004975742.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X1 [Setaria italica]
Length=461

 Score =   390 bits (1001),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  251  FVACRALSQRNDDPTTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  310

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEV A+K+V
Sbjct  311  VNCDAYHMTDPRSDGLGVSSCITKSLEDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQV  370

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            F +TSEIK+N+TKSMIGHCLGAAGGLEAIATV+AITTGW+HPTINQFNPEP VEFDTV N
Sbjct  371  FNNTSEIKINSTKSMIGHCLGAAGGLEAIATVEAITTGWVHPTINQFNPEPEVEFDTVAN  430

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            +K++HE+NVAISNSFGFGGHNSVV F+ FK
Sbjct  431  EKKQHEVNVAISNSFGFGGHNSVVVFAPFK  460



>ref|XP_004975743.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X2 [Setaria italica]
Length=459

 Score =   389 bits (1000),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  249  FVACRALSQRNDDPTTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  308

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEV A+K+V
Sbjct  309  VNCDAYHMTDPRSDGLGVSSCITKSLEDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQV  368

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            F +TSEIK+N+TKSMIGHCLGAAGGLEAIATV+AITTGW+HPTINQFNPEP VEFDTV N
Sbjct  369  FNNTSEIKINSTKSMIGHCLGAAGGLEAIATVEAITTGWVHPTINQFNPEPEVEFDTVAN  428

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            +K++HE+NVAISNSFGFGGHNSVV F+ FK
Sbjct  429  EKKQHEVNVAISNSFGFGGHNSVVVFAPFK  458



>ref|XP_001776124.1| predicted protein [Physcomitrella patens]
 gb|EDQ59035.1| predicted protein [Physcomitrella patens]
Length=470

 Score =   390 bits (1001),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALS RND PQTASRPWDK+R+GFVMGEGAGVLVMESLEHA+KRGAPI+AEYLGGA
Sbjct  260  FVACRALSTRNDSPQTASRPWDKEREGFVMGEGAGVLVMESLEHALKRGAPIVAEYLGGA  319

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDAYHMTDPRADGLGVS+CI  +L DAGV+ EEVNYINAHATST+VGDLAEVNA+KKV
Sbjct  320  VTCDAYHMTDPRADGLGVSTCIEKSLADAGVATEEVNYINAHATSTVVGDLAEVNAIKKV  379

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIKMNATKSMIGHCLGAAGGLEAIAT+KAI TGWLHP+INQFNPE SV FDTVPN
Sbjct  380  FKNTSEIKMNATKSMIGHCLGAAGGLEAIATIKAIETGWLHPSINQFNPEESVTFDTVPN  439

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNS V F+ ++P
Sbjct  440  VKKQHEVNVAISNSFGFGGHNSCVVFAPYRP  470



>emb|CDX87726.1| BnaC02g32230D [Brassica napus]
Length=462

 Score =   389 bits (999),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 198/211 (94%), Gaps = 2/211 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDK RDGFVMGEGA VL+MESLEHAMKRGAPI+AEYLGGA
Sbjct  254  FVACRALSQRNDDPQTASRPWDKQRDGFVMGEGASVLMMESLEHAMKRGAPIVAEYLGGA  313

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADGLGVSSCI S LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  314  VNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  373

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK TS IK+NATK  I HCLGAAGGLEAIAT+KAI TGWLHP+INQFNPEP+V+FDTV N
Sbjct  374  FKSTSGIKINATK--IRHCLGAAGGLEAIATMKAINTGWLHPSINQFNPEPAVDFDTVAN  431

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVVAFSAFKP
Sbjct  432  EKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  462



>dbj|BAJ86549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   387 bits (994),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKRGAPI+AEYLGGA
Sbjct  253  FVACRALSQRNDDPKTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGA  312

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +L+DAGV+PEEVNYINAHATSTL GDLAE+NA+K+V
Sbjct  313  VNCDAYHMTDPRADGLGVSSCIRQSLQDAGVAPEEVNYINAHATSTLAGDLAEMNAIKQV  372

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD S IK+NATKSMIGHCLGAAGGLEAIAT+KAI TG +HP+INQF+ EP+VEFDTVPN
Sbjct  373  FKDPSGIKVNATKSMIGHCLGAAGGLEAIATIKAINTGLVHPSINQFDREPAVEFDTVPN  432

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K EHEINV ISNSFGFGGHNSVV F+ FKP
Sbjct  433  VKAEHEINVGISNSFGFGGHNSVVVFAPFKP  463



>ref|XP_002960175.1| hypothetical protein SELMODRAFT_229853 [Selaginella moellendorffii]
 ref|XP_002967530.1| hypothetical protein SELMODRAFT_231054 [Selaginella moellendorffii]
 gb|EFJ32129.1| hypothetical protein SELMODRAFT_231054 [Selaginella moellendorffii]
 gb|EFJ37714.1| hypothetical protein SELMODRAFT_229853 [Selaginella moellendorffii]
Length=430

 Score =   385 bits (988),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRN DPQTASRPWDK R+GFVMGEG+GVLVMESLEHAMKRGAPI  EYLGGA
Sbjct  220  FVACRALSQRNSDPQTASRPWDKGREGFVMGEGSGVLVMESLEHAMKRGAPIYGEYLGGA  279

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPRADGLGVS+CI  +LEDAGVSPEEVNYINAHATST+VGDLAE+NA+KKV
Sbjct  280  VTCDAHHMTDPRADGLGVSTCISKSLEDAGVSPEEVNYINAHATSTVVGDLAEINAIKKV  339

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            F ++S+IK+NATKSMIGHCLGAAGGLEAIA +KAITTGWLHP+INQF+PEPSV FD V N
Sbjct  340  FSESSDIKINATKSMIGHCLGAAGGLEAIAVIKAITTGWLHPSINQFDPEPSVPFDRVAN  399

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  400  VKKQHEVNVAISNSFGFGGHNSVVVFAPFKP  430



>ref|XP_010915981.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Elaeis guineensis]
Length=493

 Score =   385 bits (990),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+PQ ASRPWDKDRDGFVMGEG+GVL+MESLEHA KRGA IIAEYLGGA
Sbjct  283  FIACRALSQRNDEPQKASRPWDKDRDGFVMGEGSGVLIMESLEHARKRGAAIIAEYLGGA  342

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  343  ITCDAHHMTDPRSDGLGVSSCIVKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  402

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMN TKSMIGHCLGAAGGLEAIAT+KAITTGWLHPTINQ N EP V  DTVPN
Sbjct  403  FKDTSEMKMNGTKSMIGHCLGAAGGLEAIATIKAITTGWLHPTINQNNLEPDVTIDTVPN  462

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  463  VKKKHEVNVAISNSFGFGGHNSVVVFAPFMP  493



>sp|P23902.1|KASC1_HORVU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic; 
AltName: Full=Beta-ketoacyl-ACP synthase I; Short=KAS 
I; Flags: Precursor [Hordeum vulgare]
 gb|AAA32968.1| beta-ketoacyl-ACP synthase I [Hordeum vulgare]
 dbj|BAJ88844.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=462

 Score =   384 bits (987),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP TA RPWDK+RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  252  FVACRALSQRNDDPITACRPWDKERDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  311

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +L DAGV+PEEVNYINAHATSTL GDLAEV A+K+V
Sbjct  312  VNCDAYHMTDPRADGLGVSSCITMSLRDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQV  371

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ SEIK+N+TKSMIGHCLGAAGGLEAIAT+K+ITTGW+HPTINQFNPEP V+FDTV N
Sbjct  372  FKNPSEIKINSTKSMIGHCLGAAGGLEAIATIKSITTGWVHPTINQFNPEPEVDFDTVAN  431

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NV ISNSFGFGGHNSVV F+ FKP
Sbjct  432  EKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  462



>ref|XP_006653452.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Oryza brachyantha]
Length=450

 Score =   384 bits (985),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRN++P+TASRPWDK+RDGFVMGEGAGVLVMESL HAMKR APIIAEYLGGA
Sbjct  240  FVACRALSQRNENPETASRPWDKERDGFVMGEGAGVLVMESLHHAMKRDAPIIAEYLGGA  299

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI ++LEDAGV+PEEVNYINAHATSTL GDLAEV A+K+V
Sbjct  300  VNCDAYHMTDPRSDGLGVSSCITTSLEDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQV  359

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S+IK+N+TKSMIGHCLGAAGGLEAIA VKAITTGW+HPTINQFNPEP V+FDTV N
Sbjct  360  FKNPSDIKINSTKSMIGHCLGAAGGLEAIAAVKAITTGWVHPTINQFNPEPEVDFDTVAN  419

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  420  EKKQHEVNVAISNSFGFGGHNSVVVFAPFKP  450



>gb|AGJ84410.1| beta-ketoacyl-ACP synthase I [Cocos nucifera]
Length=494

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+PQ ASRPWDKDRDGFVMGEG+GVL+MESLEHA KRGA IIAEYLGGA
Sbjct  284  FIACRALSQRNDEPQKASRPWDKDRDGFVMGEGSGVLIMESLEHARKRGATIIAEYLGGA  343

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  344  ITCDAHHMTDPRSDGLGVSSCIVKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  403

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMN TKSMIGHCLGAAGGLEAIAT+KAITTGWLHPTINQ N EP V  DT+PN
Sbjct  404  FKDTSEMKMNGTKSMIGHCLGAAGGLEAIATIKAITTGWLHPTINQNNLEPDVTVDTIPN  463

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  464  VKKKHEVNVAISNSFGFGGHNSVVVFAPFMP  494



>ref|XP_003579824.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
isoform X2 [Brachypodium distachyon]
Length=462

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHA+KR APIIAEYLGGA
Sbjct  252  FVACRALSQRNDDPETASRPWDKERDGFVMGEGAGVLVMESLEHAIKRDAPIIAEYLGGA  311

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEV A+K+V
Sbjct  312  VNCDAYHMTDPRSDGLGVSSCIAKSLEDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQV  371

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ SE K+N+TKSMIGHCLGAAGGLEAIAT+K+IT GW+HPTINQFN EP V+FDTV N
Sbjct  372  FKNLSETKINSTKSMIGHCLGAAGGLEAIATIKSITNGWVHPTINQFNSEPEVDFDTVAN  431

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            +K++HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  432  EKKQHEVNVAISNSFGFGGHNSVVVFTPFKP  462



>ref|XP_001762687.1| predicted protein [Physcomitrella patens]
 gb|EDQ72486.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   382 bits (982),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALS RND PQTASRPWDK+R+GFVMGEGAGVLVMESLEHA+KRGAPI+AEYLGG 
Sbjct  250  FVACRALSTRNDSPQTASRPWDKEREGFVMGEGAGVLVMESLEHALKRGAPIVAEYLGGG  309

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDAYHMTDPRADGLGVSSCI  +LEDAGV+ EEVNYINAHATST+VGDLAEVNA+K V
Sbjct  310  VTCDAYHMTDPRADGLGVSSCIEMSLEDAGVAAEEVNYINAHATSTIVGDLAEVNALKNV  369

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMNATKSMIGHCLGAAGGLEAIAT+KAI TGWLHP+INQFN E  V FDTVPN
Sbjct  370  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATIKAIETGWLHPSINQFNAEEQVTFDTVPN  429

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
             K++HE+NVAISNSFGFGGHNS V F+ ++
Sbjct  430  VKKQHEVNVAISNSFGFGGHNSCVVFAPYR  459



>ref|XP_002964698.1| hypothetical protein SELMODRAFT_230451 [Selaginella moellendorffii]
 gb|EFJ33536.1| hypothetical protein SELMODRAFT_230451 [Selaginella moellendorffii]
Length=406

 Score =   380 bits (976),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRND+PQTASRPWDK R+GFVMGEGAGVLVMESLEHA KRGA I AEYLGGA
Sbjct  196  FVACRALSQRNDEPQTASRPWDKGREGFVMGEGAGVLVMESLEHAKKRGAHIFAEYLGGA  255

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPRADGLGVS+CI  +LEDAGVSPEEVNYINAHATST+VGDLAE+NA+KKV
Sbjct  256  VTCDAHHMTDPRADGLGVSTCIEKSLEDAGVSPEEVNYINAHATSTVVGDLAEINAIKKV  315

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            F ++S+IK+NATKSMIGHCLGAAGG+EAIA +KAITTGWLHPTINQF+PEPSV FD V N
Sbjct  316  FSESSDIKINATKSMIGHCLGAAGGMEAIAVIKAITTGWLHPTINQFDPEPSVNFDRVAN  375

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ + P
Sbjct  376  VKKQHEVNVAISNSFGFGGHNSVVVFAPYNP  406



>ref|XP_010111005.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Morus notabilis]
 gb|EXC29391.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Morus notabilis]
Length=457

 Score =   381 bits (979),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 192/211 (91%), Gaps = 14/211 (7%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  261  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  320

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI S+LEDAGVSPEEVNYINAHATSTL GDLAE+NA+K  
Sbjct  321  VNCDAYHMTDPRADGLGVSSCIESSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIK--  378

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
                        KSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEP+V+FDTV N
Sbjct  379  ------------KSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPAVDFDTVAN  426

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             KQ+HE+NVAISNSFGFGGHNSVVAFS+FKP
Sbjct  427  VKQQHEVNVAISNSFGFGGHNSVVAFSSFKP  457



>gb|ADE76842.1| unknown [Picea sitchensis]
Length=481

 Score =   377 bits (968),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+A RALS RNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  271  FIALRALSHRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  330

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVS CI  +LEDAGVSPEEVNYINAHATST  GDLAEVNA+KKV
Sbjct  331  VTCDAHHMTDPRSDGLGVSMCIRKSLEDAGVSPEEVNYINAHATSTRAGDLAEVNAIKKV  390

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            F +TS IKMN TKSMIGH  GAAG LEAIAT+KAITTGWLHPTINQFN EP V  DTVPN
Sbjct  391  FTNTSSIKMNGTKSMIGHSFGAAGALEAIATIKAITTGWLHPTINQFNTEPDVTIDTVPN  450

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE++V ISNSFGFGGHNSVV F+ F P
Sbjct  451  VKKQHEVHVGISNSFGFGGHNSVVTFAPFNP  481



>ref|XP_008783167.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Phoenix dactylifera]
Length=493

 Score =   377 bits (967),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P+ ASRPWD+ RDGFVMGEG+GVL+MESLEHA KRGA I+AEYLGGA
Sbjct  283  FIACRALSQRNDEPEKASRPWDRSRDGFVMGEGSGVLIMESLEHARKRGATIVAEYLGGA  342

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPR+DGLGVSSCI  +LEDAGVS EEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  343  ITCDAHHMTDPRSDGLGVSSCIVKSLEDAGVSTEEVNYVNAHATSTLAGDLAEVNAIKKV  402

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMN TKSMIGHCLGAAGGLEAIAT+KAITTGWLHPTINQ N EP V  DTVPN
Sbjct  403  FKDTSEMKMNGTKSMIGHCLGAAGGLEAIATIKAITTGWLHPTINQNNLEPDVTIDTVPN  462

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  463  VKKKHEVNVAISNSFGFGGHNSVVVFAPFMP  493



>ref|XP_002969875.1| hypothetical protein SELMODRAFT_171238 [Selaginella moellendorffii]
 ref|XP_002985208.1| hypothetical protein SELMODRAFT_446227 [Selaginella moellendorffii]
 gb|EFJ13702.1| hypothetical protein SELMODRAFT_446227 [Selaginella moellendorffii]
 gb|EFJ28999.1| hypothetical protein SELMODRAFT_171238 [Selaginella moellendorffii]
Length=439

 Score =   372 bits (955),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 194/210 (92%), Gaps = 1/210 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRN DPQTASRPWD+DRDGFV+GEGAG+LVMESL+HAM+R API+AEYLGGA
Sbjct  228  FVACRALSQRNSDPQTASRPWDRDRDGFVIGEGAGILVMESLDHAMRRNAPILAEYLGGA  287

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDAYHMTDPRADGLGVS+CI  AL+DAGV PEEVN+INAHATST VGD+AEVNA+KKV
Sbjct  288  VTCDAYHMTDPRADGLGVSTCITRALDDAGVHPEEVNFINAHATSTPVGDMAEVNAIKKV  347

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE-FDTVP  337
            FKDTSE+KMNATKSMIGH LGA GGLEAIAT+KAI TGW+HPTINQFN +P V  FDTVP
Sbjct  348  FKDTSEMKMNATKSMIGHSLGACGGLEAIATIKAIKTGWVHPTINQFNVDPLVTCFDTVP  407

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAF  247
            N K++HEINVAISNSFGFGGHNSVV F+ F
Sbjct  408  NVKKQHEINVAISNSFGFGGHNSVVVFAPF  437



>gb|AAC78479.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Capsicum chinense]
Length=488

 Score =   371 bits (952),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
             +ACRALSQRND+ + ASRPWD++RDGFV+GEG+GVLVME+LEHA+KRGAPIIAEYLGGA
Sbjct  278  LIACRALSQRNDEYEKASRPWDRNRDGFVIGEGSGVLVMENLEHALKRGAPIIAEYLGGA  337

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+H+TDPRADGLGVSSCI  +L DAGVSPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  338  ITCDAHHITDPRADGLGVSSCIVMSLVDAGVSPEEVNYINAHATSTLAGDLAEVNAIKKV  397

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGA+GGLEAIAT+KAITTGWLHPTINQ++ EP V  DTVPN
Sbjct  398  FKDTSEIKMNGTKSMIGHGLGASGGLEAIATIKAITTGWLHPTINQYDLEPQVTIDTVPN  457

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ +KP
Sbjct  458  VKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>gb|KHG12490.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Gossypium 
arboreum]
Length=497

 Score =   371 bits (952),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  263  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  322

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  323  VNCDAYHMTDPRSDGLGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  382

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS IK+NATKSMIGHCLGAAGGLEAIA+VKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  383  FKNTSGIKINATKSMIGHCLGAAGGLEAIASVKAITTGWLHPSINQFNPEPSVEFDTVAN  442

Query  333  KKQEHEINV  307
            KKQ+HE+NV
Sbjct  443  KKQQHEVNV  451



>gb|KJB34973.1| hypothetical protein B456_006G093400 [Gossypium raimondii]
Length=489

 Score =   370 bits (950),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRN+DPQTASRPWDK+RDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  263  FVACRALSQRNEDPQTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  322

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  323  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  382

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIK+NATKSMIGHCLGAAGGLEAIATVKAITTGW+HPTINQFNPEPSVEFDTV N
Sbjct  383  FKNTSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWVHPTINQFNPEPSVEFDTVAN  442

Query  333  KKQEHEINVA  304
            +KQ+HE+NV 
Sbjct  443  EKQQHEVNVG  452



>ref|XP_002299456.1| hypothetical protein POPTR_0001s10890g [Populus trichocarpa]
 gb|EEE84261.1| hypothetical protein POPTR_0001s10890g [Populus trichocarpa]
Length=495

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN+DP+ ASRPWDKDRDGFVMGEG+GVL+MESL+HAMKRGA IIAEYLGGA
Sbjct  285  FIACRALSQRNEDPKKASRPWDKDRDGFVMGEGSGVLIMESLDHAMKRGANIIAEYLGGA  344

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVS+CI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  345  VTCDAHHMTDPRSDGLGVSTCIAKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  404

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIKMN TKSMIGH LGAAG LEAIAT+KAI TGWLHPTINQ N E  V  DTVPN
Sbjct  405  FKNTSEIKMNGTKSMIGHGLGAAGALEAIATIKAINTGWLHPTINQDNIELDVTIDTVPN  464

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAF  247
             K++HE+NV ISNSFGFGGHNSVV F+ F
Sbjct  465  VKKQHEVNVGISNSFGFGGHNSVVVFAPF  493



>ref|XP_011026849.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Populus euphratica]
Length=493

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN+DP+ A RPWDKDRDGFVMGEG+GVL+MESLEHAMKRGA IIAEYLGGA
Sbjct  283  FIACRALSQRNEDPKKAPRPWDKDRDGFVMGEGSGVLIMESLEHAMKRGANIIAEYLGGA  342

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVS+CI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  343  VTCDAHHMTDPRSDGLGVSTCIVKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  402

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIKMN TKSMIGH LGAAG LEAIAT+KAI TGWLHPTINQ N E  V  DTVPN
Sbjct  403  FKNTSEIKMNGTKSMIGHGLGAAGALEAIATIKAINTGWLHPTINQDNIEHDVTIDTVPN  462

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAF  247
             K++HE+NV ISNSFGFGGHNSVV F+ F
Sbjct  463  VKKQHEVNVGISNSFGFGGHNSVVVFAPF  491



>ref|XP_007025114.1| 3-ketoacyl-acyl carrier protein synthase I isoform 2 [Theobroma 
cacao]
 gb|EOY27736.1| 3-ketoacyl-acyl carrier protein synthase I isoform 2 [Theobroma 
cacao]
Length=537

 Score =   368 bits (945),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/189 (91%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDPQTASRPWDKDRDGFVMGEG+GVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  338  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGSGVLVMESLEHAMKRGAPIIAEYLGGA  397

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPRADGLGVSSCI  +LEDAGVSPEEVN+INAHATSTL GDLAE+NA+KKV
Sbjct  398  VNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNHINAHATSTLAGDLAEINAIKKV  457

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TS+IK+NATKSMIGHCLGAAGGLEAIATVKAITTGWLHP+INQFNPEPSVEFDTV N
Sbjct  458  FKNTSDIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVAN  517

Query  333  KKQEHEINV  307
             KQ+HE+NV
Sbjct  518  VKQQHEVNV  526



>dbj|BAK03950.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=462

 Score =   365 bits (937),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP TASRPWDKDRDGFVMGEGAG+LVMESLEHAM+R API+AEYLGGA
Sbjct  251  FVACRALSQRNDDPGTASRPWDKDRDGFVMGEGAGILVMESLEHAMRRNAPILAEYLGGA  310

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V  DAYHMT+PR DG GVS CI  +LEDAGV+PEEVNYINAHATST  GDLAEVNA+K+V
Sbjct  311  VNSDAYHMTNPRPDGCGVSMCIRRSLEDAGVTPEEVNYINAHATSTPAGDLAEVNALKQV  370

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTVP  337
            F+D S IK+NATKSMIGH LGAAGGLEAIAT+KAITTGW+HPTINQFNPEP+V +FDTV 
Sbjct  371  FRDLSRIKLNATKSMIGHSLGAAGGLEAIATIKAITTGWVHPTINQFNPEPAVDQFDTVH  430

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            + KQ+HE++V ISNSFGFGG NSVV F++FKP
Sbjct  431  SVKQQHEVHVGISNSFGFGGQNSVVVFASFKP  462



>ref|XP_006343829.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Solanum tuberosum]
Length=485

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRNDD + ASRPWD +RDGFV+GEG+G+LVMESLEHA+KRGA IIAEYLGGA
Sbjct  275  FIACRALSQRNDDYEKASRPWDTNRDGFVVGEGSGILVMESLEHALKRGANIIAEYLGGA  334

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR DGLGVSSCI   L DA +SPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  335  VTCDAHHMTDPRPDGLGVSSCITKGLLDARISPEEVNYINAHATSTLAGDLAEVNAIKKV  394

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKS+IGH LGAAGG+EAIAT+KAI TGWLHPTINQ+  EP V  DTVPN
Sbjct  395  FKDTSEIKMNGTKSIIGHGLGAAGGIEAIATIKAIKTGWLHPTINQYELEPQVTIDTVPN  454

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ +KP
Sbjct  455  VKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  485



>gb|KEH21260.1| 3-oxoacyl-(acyl carrier) synthase II [Medicago truncatula]
Length=482

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN++P+ ASRPWDK RDGFV+GEG+GVL+MESLE A KRGA IIAEYLGGA
Sbjct  272  FIACRALSQRNEEPKKASRPWDKHRDGFVLGEGSGVLIMESLESATKRGARIIAEYLGGA  331

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPR+DGLGVSSCI+  LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+K+V
Sbjct  332  ITCDAHHMTDPRSDGLGVSSCINKGLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKQV  391

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMN TKSMIGHC+GAAG LEAI T+KAITTGWLHPTINQ N E  V  DTVPN
Sbjct  392  FKDTSELKMNGTKSMIGHCIGAAGALEAITTIKAITTGWLHPTINQDNLEEDVTIDTVPN  451

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ F P
Sbjct  452  FKKKHEVNVVISNSFGFGGHNSVVVFAPFTP  482



>gb|AGV54408.1| beta-ketoacyl-ACP synthetase I [Phaseolus vulgaris]
Length=467

 Score =   363 bits (931),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVA    SQRNDDP+TA RPWDK+R+GFVMGEGAGVLV ESLE  MKRGAPIIAE LGGA
Sbjct  257  FVAAGTHSQRNDDPKTACRPWDKEREGFVMGEGAGVLVRESLERGMKRGAPIIAEDLGGA  316

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V C AYHMTDPR+DGLGVSSCI S+LEDAGVSPEEVNYINAHATSTL GDLAE+ A+KKV
Sbjct  317  VNCGAYHMTDPRSDGLGVSSCIQSSLEDAGVSPEEVNYINAHATSTLAGDLAEIKAIKKV  376

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK T  IK+NATK MIGHCLGA GGLEAIATVKAITTGW HPTINQFNPEP+V+FDTV N
Sbjct  377  FKGTFGIKINATKFMIGHCLGAGGGLEAIATVKAITTGWGHPTINQFNPEPAVDFDTVAN  436

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K+E E+NVAISNSFGFGGHNSVVAF AFKP
Sbjct  437  VKREQEVNVAISNSFGFGGHNSVVAFFAFKP  467



>gb|EMS48560.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Triticum 
urartu]
Length=336

 Score =   357 bits (915),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 191/223 (86%), Gaps = 13/223 (6%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVL------------VMESLEHAMKR  730
            F ACRALSQRN DP TASRPWDKDRDGFV+GEGAG+L            VMESLEHAM+R
Sbjct  113  FFACRALSQRNVDPGTASRPWDKDRDGFVLGEGAGLLLKCLNFLTKNLQVMESLEHAMRR  172

Query  729  GAPIIAEYLGGAVTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLV  550
            GAPI+ EYLGGAV  DA+HMTDPR DGLGVSSCI  +LE+AGV+PEEVNYINAHATSTL 
Sbjct  173  GAPILVEYLGGAVNSDAHHMTDPRPDGLGVSSCIMRSLENAGVAPEEVNYINAHATSTLA  232

Query  549  GDLAEVNAVKKVFKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFN  370
            GDLAEV A+K+VFKD S+IKMNATKSMIGH LGAAG  EAIAT+KAITTGW+HPTINQFN
Sbjct  233  GDLAEVKALKQVFKDPSKIKMNATKSMIGHSLGAAGSFEAIATIKAITTGWVHPTINQFN  292

Query  369  PEPSV-EFDTVPNKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            PEP+V +FDTVPN KQ+H++NV ISNSFGFGGHNSVV F+ FK
Sbjct  293  PEPTVDQFDTVPNVKQQHKVNVGISNSFGFGGHNSVVVFAPFK  335



>ref|XP_010053160.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Eucalyptus grandis]
 ref|XP_010053161.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW77416.1| hypothetical protein EUGRSUZ_D01763 [Eucalyptus grandis]
Length=429

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN+DP+ ASRPWDKDRDGFVMGEGAGVL+MESLEHA+KRGA IIAEYLGGA
Sbjct  219  FIACRALSQRNEDPKRASRPWDKDRDGFVMGEGAGVLIMESLEHALKRGANIIAEYLGGA  278

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LEDA VSPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  279  VTCDAHHMTDPRSDGLGVSSCISKSLEDASVSPEEVNYINAHATSTLAGDLAEVNAIKKV  338

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ N EP V  DTVPN
Sbjct  339  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQDNIEPDVTIDTVPN  398

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ + P
Sbjct  399  VKKQHEVNVAISNSFGFGGHNSVVVFAPYTP  429



>ref|XP_002265207.2| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Vitis vinifera]
 emb|CBI34509.3| unnamed protein product [Vitis vinifera]
Length=488

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN+DPQ ASRPWDKDRDGFVMGEG+GVL+MESLEHAMKRGA IIAEYLGGA
Sbjct  278  FIACRALSQRNEDPQKASRPWDKDRDGFVMGEGSGVLIMESLEHAMKRGANIIAEYLGGA  337

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  338  ITCDAHHMTDPRSDGLGVSSCIAKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  397

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAITTGW+HPTINQ+N EP V  DTVPN
Sbjct  398  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWIHPTINQYNLEPDVTIDTVPN  457

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE++V ISNSFGFGGHNSVV F+ F P
Sbjct  458  VKKKHEVHVGISNSFGFGGHNSVVVFAPFNP  488



>ref|XP_007040574.1| 3-ketoacyl-acyl carrier protein synthase I [Theobroma cacao]
 gb|EOY25075.1| 3-ketoacyl-acyl carrier protein synthase I [Theobroma cacao]
Length=494

 Score =   360 bits (923),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN++P+ ASRPWDKDRDGFVMGEG+GVL+MESLEHAMKRGA IIAEYLGGA
Sbjct  284  FIACRALSQRNNEPKKASRPWDKDRDGFVMGEGSGVLIMESLEHAMKRGANIIAEYLGGA  343

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +L+DAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  344  VTCDAHHMTDPRSDGLGVSSCITKSLDDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  403

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ N EP V  DTVPN
Sbjct  404  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQDNLEPDVTIDTVPN  463

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ FKP
Sbjct  464  VKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  494



>emb|CDP12182.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   359 bits (921),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P+ ASRPWDKDRDGFV+GEG+GVL+MESLE+A KRGA IIAEYLGGA
Sbjct  280  FIACRALSQRNDEPEKASRPWDKDRDGFVIGEGSGVLIMESLENAEKRGANIIAEYLGGA  339

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  340  ITCDAHHMTDPRSDGLGVSSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  399

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMN TKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ+N EP V  DTVPN
Sbjct  400  FKDTSEMKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPN  459

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K+ HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  460  VKKRHEVNVAISNSFGFGGHNSVVVFAPFKP  490



>gb|KJB24182.1| hypothetical protein B456_004G131800 [Gossypium raimondii]
Length=491

 Score =   358 bits (919),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P+ ASRPWDKDRDGFVMGEG GVLV+ESL+HAM+RGA IIAEYLGGA
Sbjct  281  FIACRALSQRNDEPKRASRPWDKDRDGFVMGEGCGVLVIESLDHAMQRGANIIAEYLGGA  340

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  341  VTCDAHHMTDPRSDGLGVSSCISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  400

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIKMN TKSMIGH LGAAGGLEAIATVKAITTGWLHPTINQ N EP V  DTVPN
Sbjct  401  FKNTSEIKMNGTKSMIGHGLGAAGGLEAIATVKAITTGWLHPTINQDNLEPEVTIDTVPN  460

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  461  VKKQHEVNVAISNSFGFGGHNSVVVFAPFKP  491



>ref|XP_004245499.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Solanum lycopersicum]
Length=485

 Score =   358 bits (918),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRNDD + ASRPWD +RDGFV+GEG+G+LVMESLEHA+KRGA IIAEYLGGA
Sbjct  275  FIACRALSQRNDDYEKASRPWDTNRDGFVVGEGSGILVMESLEHALKRGASIIAEYLGGA  334

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+HMTDPR DGLGV SCI   L DA +SPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  335  ATCDAHHMTDPRPDGLGVWSCITKGLLDARISPEEVNYINAHATSTLAGDLAEVNAIKKV  394

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGG+EAI T+KAITTGWLHPTINQ   EP V  DTVPN
Sbjct  395  FKDTSEIKMNGTKSMIGHGLGAAGGIEAIVTIKAITTGWLHPTINQHELEPQVTIDTVPN  454

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ ++P
Sbjct  455  VKKQHEVNVGISNSFGFGGHNSVVVFAPYRP  485



>ref|XP_009590113.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=481

 Score =   357 bits (917),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P  ASRPWDK+RDGFVMGEG+GVLVMESLEHA+KRGA IIAEYLGGA
Sbjct  271  FIACRALSQRNDEPHKASRPWDKNRDGFVMGEGSGVLVMESLEHALKRGANIIAEYLGGA  330

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LED+GVSPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  331  VTCDAHHMTDPRSDGLGVSSCITKSLEDSGVSPEEVNYINAHATSTLAGDLAEVNAIKKV  390

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ++ EP V  DTVPN
Sbjct  391  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQYDLEPQVTIDTVPN  450

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ + P
Sbjct  451  VKKQHEVNVGISNSFGFGGHNSVVVFAPYNP  481



>ref|XP_006852603.1| hypothetical protein AMTR_s00021p00221400 [Amborella trichopoda]
 gb|ERN14070.1| hypothetical protein AMTR_s00021p00221400 [Amborella trichopoda]
Length=318

 Score =   351 bits (901),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P  ASRPWDK RDGFVMGEGAGVLVMESLEHA KRGA IIAEYLGGA
Sbjct  108  FIACRALSQRNDEPHRASRPWDKGRDGFVMGEGAGVLVMESLEHASKRGANIIAEYLGGA  167

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+K V
Sbjct  168  ITCDAHHMTDPRSDGLGVSSCIRKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKSV  227

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAI TGWLHPTINQ +PEP V  DTVPN
Sbjct  228  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAINTGWLHPTINQDDPEPEVTIDTVPN  287

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE++VAISNSFGFGGHNSVV F+ F P
Sbjct  288  VKKKHEVHVAISNSFGFGGHNSVVVFAPFLP  318



>gb|EYU23310.1| hypothetical protein MIMGU_mgv1a005480mg [Erythranthe guttata]
Length=482

 Score =   356 bits (914),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+PQ ASRPWDK+RDGFV+GEGAGVL+MESLEHAMKRGA I+AEYLGGA
Sbjct  272  FIACRALSQRNDEPQKASRPWDKNRDGFVIGEGAGVLIMESLEHAMKRGANIVAEYLGGA  331

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  332  TTCDAHHMTDPRSDGLGVSSCILKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  391

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIKMN TKSMIGH LGAAGGLEAIAT+KAI TGWLHPTINQ++ E  V+ DTVPN
Sbjct  392  FKNTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAINTGWLHPTINQYDLETDVDIDTVPN  451

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HEINVAISNSFGFGGHNSVV F+ FKP
Sbjct  452  VKKQHEINVAISNSFGFGGHNSVVVFAPFKP  482



>gb|AFW85456.1| hypothetical protein ZEAMMB73_016804 [Zea mays]
Length=481

 Score =   356 bits (914),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHA+KR APIIAEYLGGA
Sbjct  251  FVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAIKRDAPIIAEYLGGA  310

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEVNA+K+V
Sbjct  311  VNCDAYHMTDPRSDGLGVSSCIKQSLEDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQV  370

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKD S IK+NATKSMIGHCLGAAGGLEAIATVKAITTGW+HP+INQFNPE +VEFDTVPN
Sbjct  371  FKDPSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWVHPSINQFNPEEAVEFDTVPN  430

Query  333  KKQEHEINV  307
             K++HE+NV
Sbjct  431  VKKQHEVNV  439



>ref|XP_011082304.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=493

 Score =   357 bits (915),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALS RND+PQ ASRPWDK+RDGFV+GEGAGVL+MESLEHA+KRGA IIAEYLGGA
Sbjct  283  FIACRALSSRNDNPQEASRPWDKNRDGFVIGEGAGVLIMESLEHAVKRGANIIAEYLGGA  342

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR DGLGVSSCI  +L+DAGV+PEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  343  VTCDAHHMTDPRKDGLGVSSCIIKSLQDAGVAPEEVNYVNAHATSTLAGDLAEVNAIKKV  402

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ+  EP V  DTVPN
Sbjct  403  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQYELEPEVTIDTVPN  462

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  463  VKKQHEVNVAISNSFGFGGHNSVVVFAPFKP  493



>ref|XP_011082303.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=511

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALS RND+PQ ASRPWDK+RDGFV+GEGAGVL+MESLEHA+KRGA IIAEYLGGA
Sbjct  301  FIACRALSSRNDNPQEASRPWDKNRDGFVIGEGAGVLIMESLEHAVKRGANIIAEYLGGA  360

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR DGLGVSSCI  +L+DAGV+PEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  361  VTCDAHHMTDPRKDGLGVSSCIIKSLQDAGVAPEEVNYVNAHATSTLAGDLAEVNAIKKV  420

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ+  EP V  DTVPN
Sbjct  421  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQYELEPEVTIDTVPN  480

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  481  VKKQHEVNVAISNSFGFGGHNSVVVFAPFKP  511



>ref|XP_011022477.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Populus euphratica]
Length=493

 Score =   355 bits (911),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN+DP+ ASRPWDKDRDGFVMGEG+GVL+MESLEHAMKRGA IIAEYLGGA
Sbjct  283  FIACRALSQRNEDPKKASRPWDKDRDGFVMGEGSGVLIMESLEHAMKRGANIIAEYLGGA  342

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+HMTDPR+DGLGVS+CI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  343  ATCDAHHMTDPRSDGLGVSTCIAKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  402

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAI+TGWLHPTINQ N E  V  DTVPN
Sbjct  403  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAISTGWLHPTINQDNIELDVTIDTVPN  462

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  463  VKKQHEVNVAISNSFGFGGHNSVVVFAPFTP  493



>gb|KDP25270.1| hypothetical protein JCGZ_20426 [Jatropha curcas]
Length=489

 Score =   354 bits (909),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRNDDP+ ASRPWDK+RDGFVMGEGAGVL+MESL+HA+KRGA IIAEYLGGA
Sbjct  279  FIACRALSQRNDDPKRASRPWDKNRDGFVMGEGAGVLIMESLDHALKRGANIIAEYLGGA  338

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVS+CI  +LEDA VSPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  339  VTCDAHHMTDPRSDGLGVSTCITKSLEDAKVSPEEVNYINAHATSTLAGDLAEVNAIKKV  398

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEA+AT+KAITTGWLHPTINQ N EP V  DTVPN
Sbjct  399  FKDTSEIKMNGTKSMIGHGLGAAGGLEAVATIKAITTGWLHPTINQDNLEPDVTIDTVPN  458

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++H++NV ISNSFGFGGHNSVV F+ F P
Sbjct  459  LKKQHQVNVGISNSFGFGGHNSVVVFAPFTP  489



>ref|XP_002518849.1| 3-oxoacyl-[acyl-carrier-protein] synthase, putative [Ricinus 
communis]
 gb|EEF43382.1| 3-oxoacyl-[acyl-carrier-protein] synthase, putative [Ricinus 
communis]
Length=485

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN+DP+ ASRPWDK+RDGFVMGEGAGVL+MESL+HAMKRGA IIAEYLGGA
Sbjct  275  FIACRALSQRNEDPKRASRPWDKNRDGFVMGEGAGVLIMESLDHAMKRGANIIAEYLGGA  334

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVS+CI  +LEDA VSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  335  VTCDAHHMTDPRSDGLGVSTCISRSLEDAKVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  394

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMN TKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ N EP V  DTVPN
Sbjct  395  FKDTSEMKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQDNLEPDVTIDTVPN  454

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
             K++HE+NVAISNSFGFGGHNSVV F+ F+
Sbjct  455  VKKQHEVNVAISNSFGFGGHNSVVVFAPFR  484



>ref|XP_009803233.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nicotiana sylvestris]
Length=485

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P  ASRPWDK+RDGFVMGEG+GVLVMESLEHA+KRGA IIAEYLGGA
Sbjct  275  FIACRALSQRNDEPHKASRPWDKNRDGFVMGEGSGVLVMESLEHALKRGANIIAEYLGGA  334

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LED+G+SPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  335  VTCDAHHMTDPRSDGLGVSSCITKSLEDSGISPEEVNYINAHATSTLAGDLAEVNAIKKV  394

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ + EP V  DTVPN
Sbjct  395  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQDDLEPQVTIDTVPN  454

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ + P
Sbjct  455  VKKQHEVNVGISNSFGFGGHNSVVVFAPYNP  485



>gb|AIQ82743.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82744.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+ + ASRPWDK+RDGFV+GEG+GVLVMESLEHA+KRGAPIIAEYLGGA
Sbjct  278  FIACRALSQRNDEYEKASRPWDKNRDGFVIGEGSGVLVMESLEHALKRGAPIIAEYLGGA  337

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPRADGLGVSSC+  +L DAGVSPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  338  VTCDAHHMTDPRADGLGVSSCMVKSLVDAGVSPEEVNYINAHATSTLAGDLAEVNAIKKV  397

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ + EP V  DTVPN
Sbjct  398  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQHDLEPQVTIDTVPN  457

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ +KP
Sbjct  458  VKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>ref|XP_007160188.1| hypothetical protein PHAVU_002G300400g [Phaseolus vulgaris]
 gb|ESW32182.1| hypothetical protein PHAVU_002G300400g [Phaseolus vulgaris]
Length=495

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN+DP+ ASRPWDKDRDGFVMGEG+GVL+MESLE A KRGA I+AEYLGGA
Sbjct  285  FIACRALSQRNEDPKKASRPWDKDRDGFVMGEGSGVLIMESLESATKRGATIVAEYLGGA  344

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  345  ITCDAHHMTDPRSDGLGVSSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  404

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMNATKSMIGH LGAAGGLEAIAT+KAITTGW+HPTINQ N EPSV  DTVP 
Sbjct  405  FKDTSELKMNATKSMIGHGLGAAGGLEAIATIKAITTGWVHPTINQDNLEPSVTIDTVPY  464

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ F+P
Sbjct  465  VKKQHEVNVGISNSFGFGGHNSVVVFAPFRP  495



>gb|KHM99882.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Glycine 
soja]
Length=406

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALS RN+ P+ ASRPWDKDRDGFVMGEG+GVLVMESLE A KRGA IIAEYLGGA
Sbjct  196  FIACRALSHRNEGPKKASRPWDKDRDGFVMGEGSGVLVMESLESATKRGARIIAEYLGGA  255

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPRADGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  256  ITCDAHHMTDPRADGLGVSSCISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  315

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMNATKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ N E SV  DTVPN
Sbjct  316  FKDTSELKMNATKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQDNLEASVTIDTVPN  375

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ F+P
Sbjct  376  VKKKHEVNVGISNSFGFGGHNSVVVFAPFRP  406



>ref|XP_007209938.1| hypothetical protein PRUPE_ppa004714mg [Prunus persica]
 gb|EMJ11137.1| hypothetical protein PRUPE_ppa004714mg [Prunus persica]
Length=494

 Score =   353 bits (905),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P  ASRPWDKDRDGFVMGEGAGVLVMESLE A+ RGAPIIAEYLGGA
Sbjct  284  FIACRALSQRNDEPHRASRPWDKDRDGFVMGEGAGVLVMESLESALNRGAPIIAEYLGGA  343

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAE +A+KKV
Sbjct  344  VTCDAHHMTDPRSDGLGVSSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEFSAIKKV  403

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIK+N TKSMIGH LGAAGGLEAIAT+KAI TGWLHPTINQ N EP+V  DTVPN
Sbjct  404  FKDTSEIKINGTKSMIGHGLGAAGGLEAIATIKAINTGWLHPTINQDNLEPAVTIDTVPN  463

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  464  VKKQHEVNVAISNSFGFGGHNSVVVFAPFSP  494



>gb|AIQ82742.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   352 bits (904),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+ + ASRPWDK+RDGFV+GEG+GVLVMESLEHA+KRG+PIIAEYLGGA
Sbjct  278  FIACRALSQRNDEYEKASRPWDKNRDGFVIGEGSGVLVMESLEHALKRGSPIIAEYLGGA  337

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPRADGLGVSSC+  +L DAGVSPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  338  VTCDAHHMTDPRADGLGVSSCMVKSLVDAGVSPEEVNYINAHATSTLAGDLAEVNAIKKV  397

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ + EP V  DTVPN
Sbjct  398  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQHDLEPQVTIDTVPN  457

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ +KP
Sbjct  458  VKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>ref|XP_006439308.1| hypothetical protein CICLE_v10019855mg [Citrus clementina]
 gb|ESR52548.1| hypothetical protein CICLE_v10019855mg [Citrus clementina]
Length=494

 Score =   353 bits (905),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN+ P+ ASRPWDKDRDGFVMGEG G+LVMESLEHAMKRGA IIAEYLGGA
Sbjct  284  FIACRALSQRNEYPKRASRPWDKDRDGFVMGEGCGILVMESLEHAMKRGANIIAEYLGGA  343

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  344  VTCDAHHMTDPRSDGLGVSSCIAKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  403

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMN TKSMIGH LGAAGGLEAI T+KAITTGWLHPT+NQ N EP V  DTVPN
Sbjct  404  FKDTSEMKMNGTKSMIGHGLGAAGGLEAITTIKAITTGWLHPTLNQDNLEPEVTIDTVPN  463

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++H +NVAISNSFGFGGHNSVV F+ F P
Sbjct  464  VKKQHHVNVAISNSFGFGGHNSVVVFAPFSP  494



>ref|XP_006476353.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Citrus sinensis]
Length=498

 Score =   353 bits (905),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN+ P+ ASRPWDKDRDGFVMGEG G+LVMESLEHAMKRGA IIAEYLGGA
Sbjct  288  FIACRALSQRNEYPKRASRPWDKDRDGFVMGEGCGILVMESLEHAMKRGANIIAEYLGGA  347

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  348  VTCDAHHMTDPRSDGLGVSSCIAKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  407

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMN TKSMIGH LGAAGGLEAI T+KAITTGWLHPT+NQ N EP V  DTVPN
Sbjct  408  FKDTSEMKMNGTKSMIGHGLGAAGGLEAITTIKAITTGWLHPTLNQDNLEPEVTIDTVPN  467

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++H +NVAISNSFGFGGHNSVV F+ F P
Sbjct  468  VKKQHHVNVAISNSFGFGGHNSVVVFAPFSP  498



>gb|AIQ82747.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   352 bits (904),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+ + ASRPWDK+RDGFV+GEG+GVLVMESLEHA+KRG+PIIAEYLGGA
Sbjct  278  FIACRALSQRNDEYEKASRPWDKNRDGFVIGEGSGVLVMESLEHALKRGSPIIAEYLGGA  337

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPRADGLGVSSC+  +L DAGVSPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  338  VTCDAHHMTDPRADGLGVSSCMVKSLVDAGVSPEEVNYINAHATSTLAGDLAEVNAIKKV  397

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ + EP V  DTVPN
Sbjct  398  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQHDLEPQVTIDTVPN  457

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ +KP
Sbjct  458  VKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>gb|KDO76592.1| hypothetical protein CISIN_1g010896mg [Citrus sinensis]
Length=498

 Score =   353 bits (905),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN+ P+ ASRPWDKDRDGFVMGEG G+LVMESLEHAMKRGA IIAEYLGGA
Sbjct  288  FIACRALSQRNEYPKRASRPWDKDRDGFVMGEGCGILVMESLEHAMKRGANIIAEYLGGA  347

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  348  VTCDAHHMTDPRSDGLGVSSCIAKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  407

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMN TKSMIGH LGAAGGLEAI T+KAITTGWLHPT+NQ N EP V  DTVPN
Sbjct  408  FKDTSEMKMNGTKSMIGHGLGAAGGLEAITTIKAITTGWLHPTLNQDNLEPEVTIDTVPN  467

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++H +NVAISNSFGFGGHNSVV F+ F P
Sbjct  468  VKKQHHVNVAISNSFGFGGHNSVVVFAPFSP  498



>ref|XP_004987019.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Setaria italica]
Length=454

 Score =   351 bits (901),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 187/208 (90%), Gaps = 1/208 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F A  ALS+RN DP TASRPWD+DRDGFVMGEGAGVLVMESLEHAM+RGAP++AEYLGGA
Sbjct  242  FAALGALSRRNADPATASRPWDRDRDGFVMGEGAGVLVMESLEHAMRRGAPVLAEYLGGA  301

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T+ R DG  VS CI  +LEDAGVSPEEVNYINAHATS+  GDLAEV A+K+V
Sbjct  302  ATCDAHHVTNQRPDGRAVSLCIKRSLEDAGVSPEEVNYINAHATSSRAGDLAEVKALKQV  361

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTVP  337
            FKDTS+IKMNATKSMIGHCLGAAGGLEAIAT+KAITTGW+HPTINQFNP+P+V +FDTV 
Sbjct  362  FKDTSQIKMNATKSMIGHCLGAAGGLEAIATIKAITTGWVHPTINQFNPDPAVDQFDTVR  421

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFS  253
            + KQ HE+NV ISNSFGFGGHNSVVAF+
Sbjct  422  DVKQWHEVNVGISNSFGFGGHNSVVAFA  449



>gb|AIQ82734.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82735.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82736.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82737.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82738.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82739.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82740.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82741.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82749.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   352 bits (904),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+ + ASRPWDK+RDGFV+GEG+GVLVMESLEHA+KRG+PIIAEYLGGA
Sbjct  278  FIACRALSQRNDEYEKASRPWDKNRDGFVIGEGSGVLVMESLEHALKRGSPIIAEYLGGA  337

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPRADGLGVSSC+  +L DAGVSPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  338  VTCDAHHMTDPRADGLGVSSCMVKSLVDAGVSPEEVNYINAHATSTLAGDLAEVNAIKKV  397

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ + EP V  DTVPN
Sbjct  398  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQHDLEPQVTIDTVPN  457

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ +KP
Sbjct  458  VKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>ref|XP_004959862.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Setaria italica]
Length=463

 Score =   351 bits (901),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 186/208 (89%), Gaps = 1/208 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F A  ALS+RN DP TASRPWD+DRDGFVMGEGAGVLVMESLEHAM+RGAP++AEYLGGA
Sbjct  251  FAALGALSRRNADPATASRPWDRDRDGFVMGEGAGVLVMESLEHAMRRGAPVLAEYLGGA  310

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T+PR DG  VS CI  +LEDAGVSPEEVNYINAHATS+  GDLAE  A+K+V
Sbjct  311  ATCDAHHVTNPRPDGRAVSLCIKRSLEDAGVSPEEVNYINAHATSSRAGDLAEAKALKQV  370

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTVP  337
            FKDTS+IKMNATKSMIGHCLGAAGGLEAIAT+KAITTGW+HPTINQFNP+P+V +FDTV 
Sbjct  371  FKDTSQIKMNATKSMIGHCLGAAGGLEAIATIKAITTGWVHPTINQFNPDPAVDQFDTVR  430

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFS  253
            + KQ HE+NV ISNSFGFGGHNSVV F+
Sbjct  431  DVKQWHEVNVGISNSFGFGGHNSVVVFA  458



>gb|AIQ82745.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82748.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82750.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82751.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82752.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82753.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   352 bits (904),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+ + ASRPWDK+RDGFV+GEG+GVLVMESLEHA+KRG+PIIAEYLGGA
Sbjct  278  FIACRALSQRNDEYEKASRPWDKNRDGFVIGEGSGVLVMESLEHALKRGSPIIAEYLGGA  337

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPRADGLGVSSC+  +L DAGVSPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  338  VTCDAHHMTDPRADGLGVSSCMVKSLVDAGVSPEEVNYINAHATSTLAGDLAEVNAIKKV  397

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ + EP V  DTVPN
Sbjct  398  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQHDLEPQVTIDTVPN  457

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ +KP
Sbjct  458  VKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>ref|XP_008341776.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Malus domestica]
Length=493

 Score =   352 bits (904),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P  ASRPWDK+RDGFVMGEGAGVLVMESLE A+KRGAPIIAEYLGGA
Sbjct  283  FIACRALSQRNDEPHRASRPWDKNRDGFVMGEGAGVLVMESLESALKRGAPIIAEYLGGA  342

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAE NA+KKV
Sbjct  343  VTCDAHHMTDPRSDGLGVSSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEFNAIKKV  402

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+K+N TKSMIGH LGAAGGLEAIAT+KAI TGWLHPTINQ + EP+V  DTVPN
Sbjct  403  FKDTSEMKINGTKSMIGHGLGAAGGLEAIATIKAINTGWLHPTINQDDLEPAVTIDTVPN  462

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  463  VKKQHEVNVAISNSFGFGGHNSVVVFAPFSP  493



>gb|AIQ82746.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   352 bits (903),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+ + ASRPWDK+RDGFV+GEG+GVLVMESLEHA+KRG+PIIAEYLGGA
Sbjct  278  FIACRALSQRNDEYEKASRPWDKNRDGFVIGEGSGVLVMESLEHALKRGSPIIAEYLGGA  337

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPRADGLGVSSC+  +L DAGVSPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  338  VTCDAHHMTDPRADGLGVSSCMVKSLVDAGVSPEEVNYINAHATSTLAGDLAEVNAIKKV  397

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ + EP V  DTVPN
Sbjct  398  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQHDLEPQVTIDTVPN  457

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ +KP
Sbjct  458  VKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>ref|XP_002303661.2| hypothetical protein POPTR_0003s14190g [Populus trichocarpa]
 gb|EEE78640.2| hypothetical protein POPTR_0003s14190g [Populus trichocarpa]
Length=493

 Score =   352 bits (903),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN+DP+ ASRPWDKDRDGFVMGEG+GVL+MESLEHAMKRGA IIAEYLGGA
Sbjct  283  FIACRALSQRNEDPKKASRPWDKDRDGFVMGEGSGVLIMESLEHAMKRGANIIAEYLGGA  342

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+HMT+PR+DGLGVS+CI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  343  ATCDAHHMTNPRSDGLGVSTCIAKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  402

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAI TGWLHPTINQ N E  V  DTVPN
Sbjct  403  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAINTGWLHPTINQDNIELDVTIDTVPN  462

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  463  VKKQHEVNVAISNSFGFGGHNSVVVFAPFTP  493



>ref|XP_009341875.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Pyrus x bretschneideri]
Length=493

 Score =   352 bits (903),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P  ASRPWDK+RDGFVMGEGAGVLVMESLE A+KRGAPIIAEYLGGA
Sbjct  283  FIACRALSQRNDEPHRASRPWDKNRDGFVMGEGAGVLVMESLESALKRGAPIIAEYLGGA  342

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAE NA+KKV
Sbjct  343  VTCDAHHMTDPRSDGLGVSSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEFNAIKKV  402

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+K+N TKSMIGH LGAAGGLEAIAT+KAI TGWLHPTINQ + EP+V  DTVPN
Sbjct  403  FKDTSEMKINGTKSMIGHGLGAAGGLEAIATIKAINTGWLHPTINQDDLEPTVTIDTVPN  462

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  463  VKKQHEVNVAISNSFGFGGHNSVVVFAPFSP  493



>gb|ACC64615.1| beta ketoacyl-ACP synthase I [Chlorella sp. GHA-2008]
Length=213

 Score =   342 bits (876),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 182/211 (86%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQR D+PQ ASRPWDK+RDGFVMGEGAGVLVMESLEHAM RGA IIAEY+GGA
Sbjct  2    FVACRALSQRCDEPQRASRPWDKNRDGFVMGEGAGVLVMESLEHAMARGANIIAEYVGGA  61

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDP  DGLGVS+CI  ALED GV P+ VNYINAHATSTLVGD+AEV A+KKV
Sbjct  62   VTCDAHHMTDPHPDGLGVSTCIKLALEDGGVDPDAVNYINAHATSTLVGDIAEVKAIKKV  121

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE-FDTVP  337
              +T  IKMNATKSMIGHCLGAAGG+EAIAT++AI TGW+HPTIN  +P   V+  + VP
Sbjct  122  LTNTGNIKMNATKSMIGHCLGAAGGMEAIATIQAIRTGWVHPTINHEDPIDEVQDINVVP  181

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            N KQEH INV ISNSFGFGGHNSVVAF+ FK
Sbjct  182  NMKQEHNINVGISNSFGFGGHNSVVAFAPFK  212



>ref|XP_008352312.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X2 [Malus domestica]
Length=453

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P  ASRPWDK+RDGFVMGEGAGVLVMESLE A+KRGAPIIAEYLGGA
Sbjct  243  FIACRALSQRNDEPHRASRPWDKNRDGFVMGEGAGVLVMESLESALKRGAPIIAEYLGGA  302

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAE NA+KKV
Sbjct  303  VTCDAHHMTDPRSDGLGVSSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEFNAIKKV  362

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSE+K+N TKSMIGH LGAAGGLEAIAT+KAI TGWLHPTINQ + EP+V  DTVPN
Sbjct  363  FKNTSEMKINGTKSMIGHGLGAAGGLEAIATIKAINTGWLHPTINQDDLEPAVTIDTVPN  422

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  423  VKKQHEVNVAISNSFGFGGHNSVVVFAPFSP  453



>ref|XP_004503596.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Cicer arietinum]
Length=468

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 184/211 (87%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN +P+ ASRPWD  RDGFVMGEG+GVL+MESLE A KRGA IIAEYLGGA
Sbjct  258  FIACRALSQRNQNPKMASRPWDIHRDGFVMGEGSGVLIMESLESATKRGAKIIAEYLGGA  317

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPR+DG GV+SCI ++L DAGVSPEEVNY+NAHATSTL GDLAE+ A+KKV
Sbjct  318  ITCDAHHMTDPRSDGFGVASCIRNSLADAGVSPEEVNYLNAHATSTLAGDLAEICAIKKV  377

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMNATKSM GH LGAAG LEAI T+KAITTGWLHPTINQ N E  V  DTVP 
Sbjct  378  FKDTSELKMNATKSMTGHGLGAAGALEAIVTIKAITTGWLHPTINQDNLEEEVTIDTVPG  437

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  438  VKKKHEVNVAISNSFGFGGHNSVVVFAPFMP  468



>gb|EYU26414.1| hypothetical protein MIMGU_mgv1a024999mg, partial [Erythranthe 
guttata]
Length=452

 Score =   349 bits (895),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P  ASRPWD++RDGFVMGEGAGVLVMESLEHA KRGA IIAEYLGGA
Sbjct  242  FIACRALSQRNDEPDKASRPWDRNRDGFVMGEGAGVLVMESLEHASKRGANIIAEYLGGA  301

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V  DA+H+TDP +DGLGVSSC+   LE + VSPEEVNYINAHATST  GDLAEVNA+KKV
Sbjct  302  VNSDAHHITDPCSDGLGVSSCLIKGLEYSRVSPEEVNYINAHATSTPAGDLAEVNAIKKV  361

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIKMNATKSMIGH LGA+GGLEAIAT+KAI TGWLHPTINQ++ E  V  DTVPN
Sbjct  362  FKNTSEIKMNATKSMIGHGLGASGGLEAIATIKAINTGWLHPTINQYDLESDVTIDTVPN  421

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++H++NVAISNSFGFGGHNSV  F++F+P
Sbjct  422  VKKQHQVNVAISNSFGFGGHNSVAVFASFRP  452



>ref|XP_006584771.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X4 [Glycine max]
Length=492

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALS RN+DP+ ASRPWDKDRDGFVMGEG+GVLVMESLE A KRGA IIAEYLGGA
Sbjct  282  FIACRALSHRNEDPKKASRPWDKDRDGFVMGEGSGVLVMESLESATKRGAKIIAEYLGGA  341

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPRADGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  342  ITCDAHHMTDPRADGLGVSSCISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  401

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMNATKSMIGH LGAAGGLEAIAT+KAITTGWLHP+IN  N E SV  DTVPN
Sbjct  402  FKDTSELKMNATKSMIGHGLGAAGGLEAIATIKAITTGWLHPSINLDNLEASVTIDTVPN  461

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ F+P
Sbjct  462  VKKKHEVNVGISNSFGFGGHNSVVVFAPFRP  492



>ref|XP_006584772.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X5 [Glycine max]
Length=491

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALS RN+DP+ ASRPWDKDRDGFVMGEG+GVLVMESLE A KRGA IIAEYLGGA
Sbjct  281  FIACRALSHRNEDPKKASRPWDKDRDGFVMGEGSGVLVMESLESATKRGAKIIAEYLGGA  340

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPRADGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  341  ITCDAHHMTDPRADGLGVSSCISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  400

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMNATKSMIGH LGAAGGLEAIAT+KAITTGWLHP+IN  N E SV  DTVPN
Sbjct  401  FKDTSELKMNATKSMIGHGLGAAGGLEAIATIKAITTGWLHPSINLDNLEASVTIDTVPN  460

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ F+P
Sbjct  461  VKKKHEVNVGISNSFGFGGHNSVVVFAPFRP  491



>ref|XP_006584770.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X3 [Glycine max]
Length=492

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALS RN+DP+ ASRPWDKDRDGFVMGEG+GVLVMESLE A KRGA IIAEYLGGA
Sbjct  282  FIACRALSHRNEDPKKASRPWDKDRDGFVMGEGSGVLVMESLESATKRGAKIIAEYLGGA  341

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPRADGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  342  ITCDAHHMTDPRADGLGVSSCISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  401

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMNATKSMIGH LGAAGGLEAIAT+KAITTGWLHP+IN  N E SV  DTVPN
Sbjct  402  FKDTSELKMNATKSMIGHGLGAAGGLEAIATIKAITTGWLHPSINLDNLEASVTIDTVPN  461

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ F+P
Sbjct  462  VKKKHEVNVGISNSFGFGGHNSVVVFAPFRP  492



>ref|XP_003530435.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN16724.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Glycine 
soja]
Length=491

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALS RN+DP+ ASRPWDKDRDGFVMGEG+GVLVMESLE A KRGA IIAEYLGGA
Sbjct  281  FIACRALSHRNEDPKKASRPWDKDRDGFVMGEGSGVLVMESLESATKRGAKIIAEYLGGA  340

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPRADGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  341  ITCDAHHMTDPRADGLGVSSCISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  400

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMNATKSMIGH LGAAGGLEAIAT+KAITTGWLHP+IN  N E SV  DTVPN
Sbjct  401  FKDTSELKMNATKSMIGHGLGAAGGLEAIATIKAITTGWLHPSINLDNLEASVTIDTVPN  460

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ F+P
Sbjct  461  VKKKHEVNVGISNSFGFGGHNSVVVFAPFRP  491



>ref|XP_009358636.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Pyrus x bretschneideri]
Length=493

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P  ASRPWDK+RDGFVMGEGAGVLVMESLE A+KRGAPIIAEYLGGA
Sbjct  283  FIACRALSQRNDEPHRASRPWDKNRDGFVMGEGAGVLVMESLESALKRGAPIIAEYLGGA  342

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAE NA+KKV
Sbjct  343  VTCDAHHMTDPRSDGLGVSSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEFNAIKKV  402

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSE+K+N TKSMIGH LGAAGGLEAIAT+KAI TGWLHPTINQ + EP+V  DTVPN
Sbjct  403  FKNTSEMKINGTKSMIGHGLGAAGGLEAIATIKAINTGWLHPTINQDDLEPAVTIDTVPN  462

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  463  VKKQHEVNVAISNSFGFGGHNSVVVFAPFSP  493



>ref|XP_008352311.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X1 [Malus domestica]
Length=493

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P  ASRPWDK+RDGFVMGEGAGVLVMESLE A+KRGAPIIAEYLGGA
Sbjct  283  FIACRALSQRNDEPHRASRPWDKNRDGFVMGEGAGVLVMESLESALKRGAPIIAEYLGGA  342

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAE NA+KKV
Sbjct  343  VTCDAHHMTDPRSDGLGVSSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEFNAIKKV  402

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSE+K+N TKSMIGH LGAAGGLEAIAT+KAI TGWLHPTINQ + EP+V  DTVPN
Sbjct  403  FKNTSEMKINGTKSMIGHGLGAAGGLEAIATIKAINTGWLHPTINQDDLEPAVTIDTVPN  462

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  463  VKKQHEVNVAISNSFGFGGHNSVVVFAPFSP  493



>ref|XP_006584769.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X2 [Glycine max]
Length=493

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALS RN+DP+ ASRPWDKDRDGFVMGEG+GVLVMESLE A KRGA IIAEYLGGA
Sbjct  283  FIACRALSHRNEDPKKASRPWDKDRDGFVMGEGSGVLVMESLESATKRGAKIIAEYLGGA  342

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPRADGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  343  ITCDAHHMTDPRADGLGVSSCISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  402

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMNATKSMIGH LGAAGGLEAIAT+KAITTGWLHP+IN  N E SV  DTVPN
Sbjct  403  FKDTSELKMNATKSMIGHGLGAAGGLEAIATIKAITTGWLHPSINLDNLEASVTIDTVPN  462

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ F+P
Sbjct  463  VKKKHEVNVGISNSFGFGGHNSVVVFAPFRP  493



>gb|ADZ05697.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   350 bits (897),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+ + ASRPWDK+RDGFV+GEG+GVLVMESLEHA+KRG+PIIAEYLGGA
Sbjct  278  FIACRALSQRNDEYEKASRPWDKNRDGFVIGEGSGVLVMESLEHALKRGSPIIAEYLGGA  337

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPRADGLGVSSC+  +L DAGVSPEEVNYINAHATSTL GDLAEVNA+KKV
Sbjct  338  VTCDAHHMTDPRADGLGVSSCMVMSLVDAGVSPEEVNYINAHATSTLAGDLAEVNAIKKV  397

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIKMN TKSMIGH LGAAGGLEAIAT+KAIT GWLHPTINQ + EP V  DTVPN
Sbjct  398  FKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAITAGWLHPTINQHDLEPQVTIDTVPN  457

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ +KP
Sbjct  458  VKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>ref|XP_006579443.1| PREDICTED: uncharacterized protein LOC100808453 isoform X2 [Glycine 
max]
 ref|XP_006579444.1| PREDICTED: uncharacterized protein LOC100808453 isoform X3 [Glycine 
max]
Length=430

 Score =   347 bits (891),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALS RN+ P+ ASRPWDKDRDGFVMGEG+GVLVMESLE A KRGA IIAEYLGGA
Sbjct  220  FIACRALSHRNEGPKKASRPWDKDRDGFVMGEGSGVLVMESLESATKRGARIIAEYLGGA  279

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCD +HMTDPRADGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  280  ITCDDHHMTDPRADGLGVSSCISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  339

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMNATKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ N E SV  DTVPN
Sbjct  340  FKDTSELKMNATKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQDNLEASVTIDTVPN  399

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ F+P
Sbjct  400  VKKKHEVNVGISNSFGFGGHNSVVVFAPFRP  430



>ref|XP_002463312.1| hypothetical protein SORBIDRAFT_02g041620 [Sorghum bicolor]
 gb|EER99833.1| hypothetical protein SORBIDRAFT_02g041620 [Sorghum bicolor]
Length=471

 Score =   348 bits (894),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 186/212 (88%), Gaps = 1/212 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F A RALS+RN+DP  ASRPWD+DRDGFV+GEGAG+LVMESLEHA +RGAPI AEYLGG+
Sbjct  257  FAALRALSRRNEDPGAASRPWDRDRDGFVLGEGAGILVMESLEHARRRGAPIFAEYLGGS  316

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+ D R DG G ++CI  +LEDAGV+PEEVNY+NAHATS+L GDLAEV A+K+V
Sbjct  317  ATCDAHHLMDARPDGRGAAACIRRSLEDAGVAPEEVNYVNAHATSSLAGDLAEVKALKQV  376

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTVP  337
            FK+ S+IKMNATKSMIGHCLGAAGGLEAIATVKAITTGW+HPTINQFNPEP+V EFDTV 
Sbjct  377  FKNPSQIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWVHPTINQFNPEPAVGEFDTVR  436

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
              KQ HE++V ISNSFGFGGHNSV  F+ FKP
Sbjct  437  GVKQLHEVHVGISNSFGFGGHNSVAVFAPFKP  468



>gb|AAK58535.1| beta-ketoacyl-ACP synthetase I [Coriandrum sativum]
Length=456

 Score =   348 bits (892),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 182/212 (86%), Gaps = 4/212 (2%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F +CRA+SQRND+P+ ASRPWDKDRDG VMGEGAGVLVMESL HAMKRGAPIIAEYLGGA
Sbjct  248  FTSCRAMSQRNDNPKAASRPWDKDRDGLVMGEGAGVLVMESLVHAMKRGAPIIAEYLGGA  307

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAG-VSPEEVNYINAHATSTLVGDLAEVNAVKK  517
            VTCDA+HMTDPR DG GVS CI S L++AG VSPEEVNYINAHATSTL GDL EV A+K+
Sbjct  308  VTCDAHHMTDPRPDGGGVSMCIQSGLQEAGVVSPEEVNYINAHATSTLAGDLKEVTAIKQ  367

Query  516  VFKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVP  337
            V     +IK NATKSM  HCLGAA GLEA+ATVKAI TGWLHPTINQ N EP V+FDTV 
Sbjct  368  VL---GQIKANATKSMNAHCLGAASGLEAVATVKAIATGWLHPTINQVNLEPEVDFDTVA  424

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            NKKQ+HE+NV ISNSFGFGGHNSVV FSAF P
Sbjct  425  NKKQQHEVNVGISNSFGFGGHNSVVVFSAFNP  456



>ref|XP_006579442.1| PREDICTED: uncharacterized protein LOC100808453 isoform X1 [Glycine 
max]
Length=491

 Score =   348 bits (893),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALS RN+ P+ ASRPWDKDRDGFVMGEG+GVLVMESLE A KRGA IIAEYLGGA
Sbjct  281  FIACRALSHRNEGPKKASRPWDKDRDGFVMGEGSGVLVMESLESATKRGARIIAEYLGGA  340

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCD +HMTDPRADGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  341  ITCDDHHMTDPRADGLGVSSCISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  400

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMNATKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ N E SV  DTVPN
Sbjct  401  FKDTSELKMNATKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQDNLEASVTIDTVPN  460

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ F+P
Sbjct  461  VKKKHEVNVGISNSFGFGGHNSVVVFAPFRP  491



>ref|XP_008239156.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Prunus mume]
Length=494

 Score =   348 bits (893),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P  ASRPWDKDRDGFVMGEGAGVLVMESLE A+ RGAPIIAEYLGGA
Sbjct  284  FIACRALSQRNDEPHRASRPWDKDRDGFVMGEGAGVLVMESLESALNRGAPIIAEYLGGA  343

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LEDAGVS EEVNY+NAHATSTL GDLAE +A+KKV
Sbjct  344  VTCDAHHMTDPRSDGLGVSSCITKSLEDAGVSHEEVNYVNAHATSTLAGDLAEFSAIKKV  403

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSEIK+N TKSMIGH LGAAGGLEAIAT+KAI TGWLHPTINQ N EP+V  DTVPN
Sbjct  404  FKDTSEIKINGTKSMIGHGLGAAGGLEAIATIKAINTGWLHPTINQDNLEPAVTIDTVPN  463

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  464  VKKQHEVNVAISNSFGFGGHNSVVVFAPFSP  494



>ref|NP_001241906.1| uncharacterized protein LOC100808453 [Glycine max]
 gb|ACU19800.1| unknown [Glycine max]
Length=490

 Score =   348 bits (893),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALS RN+ P+ ASRPWDKDRDGFVMGEG+GVLVMESLE A KRGA IIAEYLGGA
Sbjct  280  FIACRALSHRNEGPKKASRPWDKDRDGFVMGEGSGVLVMESLESATKRGARIIAEYLGGA  339

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCD +HMTDPRADGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  340  ITCDDHHMTDPRADGLGVSSCISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  399

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMNATKSMIGH LGAAGGLEAIAT+KAITTGWLHPTINQ N E SV  DTVPN
Sbjct  400  FKDTSELKMNATKSMIGHGLGAAGGLEAIATIKAITTGWLHPTINQDNLEASVTIDTVPN  459

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NV ISNSFGFGGHNSVV F+ F+P
Sbjct  460  VKKKHEVNVGISNSFGFGGHNSVVVFAPFRP  490



>ref|XP_004301818.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=489

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P  ASRPWDK+RDGFVMGEGAGVLVMESLE A+KRGAPIIAEYLGGA
Sbjct  278  FIACRALSQRNDEPHRASRPWDKNRDGFVMGEGAGVLVMESLESALKRGAPIIAEYLGGA  337

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LEDAGVSPEEVNY+NAHATSTL GDLAE NA+KKV
Sbjct  338  VTCDAHHMTDPRSDGLGVSSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEFNAIKKV  397

Query  513  F-KDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVP  337
            F K+TSE+K+N TKSMIGH LGAAGGLEAIAT+KAI TGWLHPTINQ + EP+V  DTVP
Sbjct  398  FGKNTSEMKINGTKSMIGHGLGAAGGLEAIATIKAINTGWLHPTINQDDLEPAVTIDTVP  457

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            N K++HE+NVAISNSFGFGGHNSVV F+ + P
Sbjct  458  NVKKKHEVNVAISNSFGFGGHNSVVVFAPYNP  489



>gb|EMS63377.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Triticum 
urartu]
Length=532

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP TASRPWDK+RDGFVMGEGAGVLVMESLEHAMKR APIIAEYLGGA
Sbjct  205  FVACRALSQRNDDPITASRPWDKERDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGA  264

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +L DAGV+PEEVNYINAHATSTL GDLAEV A+K+V
Sbjct  265  VNCDAYHMTDPRSDGLGVSSCITMSLRDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQV  324

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ SEIK+N+TKSMIGHCLGAAGGLEAIAT+K+ITTGW+HPTINQF PEP V+FDTV N
Sbjct  325  FKNPSEIKINSTKSMIGHCLGAAGGLEAIATIKSITTGWVHPTINQFKPEPEVDFDTVAN  384

Query  333  KKQEHEINV  307
            +K++HE+NV
Sbjct  385  EKKQHEVNV  393



>ref|XP_010239948.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
isoform X1 [Brachypodium distachyon]
Length=493

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDK+RDGFVMGEGAGVLVMESLEHA+KR APIIAEYLGGA
Sbjct  252  FVACRALSQRNDDPETASRPWDKERDGFVMGEGAGVLVMESLEHAIKRDAPIIAEYLGGA  311

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDAYHMTDPR+DGLGVSSCI  +LEDAGV+PEEVNYINAHATSTL GDLAEV A+K+V
Sbjct  312  VNCDAYHMTDPRSDGLGVSSCIAKSLEDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQV  371

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ SE K+N+TKSMIGHCLGAAGGLEAIAT+K+IT GW+HPTINQFN EP V+FDTV N
Sbjct  372  FKNLSETKINSTKSMIGHCLGAAGGLEAIATIKSITNGWVHPTINQFNSEPEVDFDTVAN  431

Query  333  KKQEHEINV  307
            +K++HE+NV
Sbjct  432  EKKQHEVNV  440



>gb|KHG26930.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic -like 
protein [Gossypium arboreum]
Length=486

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 189/211 (90%), Gaps = 5/211 (2%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P+ ASRPWDKDRDGFVMGEG GVLVMESL+HAM+RGA IIAEYLGGA
Sbjct  281  FIACRALSQRNDEPKRASRPWDKDRDGFVMGEGCGVLVMESLDHAMQRGANIIAEYLGGA  340

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVSSCI  +LEDAGV     NY+NAHATSTL GDLAEVNA+K V
Sbjct  341  VTCDAHHMTDPRSDGLGVSSCISKSLEDAGV-----NYVNAHATSTLAGDLAEVNAIKMV  395

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIKMN TKSMIGH LGAAGGLEAIATVKAITTGWLHPTINQ N EP V  DTVPN
Sbjct  396  FKNTSEIKMNGTKSMIGHGLGAAGGLEAIATVKAITTGWLHPTINQDNLEPEVTIDTVPN  455

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ FKP
Sbjct  456  VKKQHEVNVAISNSFGFGGHNSVVVFAPFKP  486



>gb|KIZ02816.1| hypothetical protein MNEG_5138 [Monoraphidium neglectum]
Length=273

 Score =   333 bits (853),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 178/211 (84%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALS RND+PQ ASRPWD DRDGFVMGEGAGV V ESLEHA  RGA I+AEYLGGA
Sbjct  62   FVACRALSTRNDEPQKASRPWDVDRDGFVMGEGAGVFVFESLEHAQARGATILAEYLGGA  121

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPRADGLGVS+CI  AL+DAG+  E+VNYINAHATSTLVGD+AEV A+KKV
Sbjct  122  VTCDAHHMTDPRADGLGVSTCIELALKDAGIEREQVNYINAHATSTLVGDVAEVKAIKKV  181

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE-FDTVP  337
            F DTS +KMNATKS+IGHCLGAA G+EA+A VKAI TGWLHPT+NQ N    V   DTVP
Sbjct  182  FTDTSNLKMNATKSLIGHCLGAAAGIEAVAVVKAIQTGWLHPTLNQHNLVDEVAGIDTVP  241

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            N+K++  +  A+SNSFGFGGHNS V F+ FK
Sbjct  242  NEKKQLAVTAAVSNSFGFGGHNSAVVFAPFK  272



>gb|EYU26415.1| hypothetical protein MIMGU_mgv1a006855mg [Erythranthe guttata]
Length=429

 Score =   338 bits (867),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRND+P  ASRPWDK+RDGFV+GEGAGVL+MESLEHAMKRGA I+AE+LGGA
Sbjct  219  FIACRALSQRNDEPHKASRPWDKNRDGFVIGEGAGVLIMESLEHAMKRGAKIVAEFLGGA  278

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T PR DGLGVSSCI  AL DAGVSPEEVNY+NAHATST  GDLAE+NA+K V
Sbjct  279  ATCDAHHLTTPRLDGLGVSSCIIKALYDAGVSPEEVNYVNAHATSTPAGDLAEINAIKNV  338

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+TSEIKMN TKSM GH LGAAGGLEAIAT+KAI TGWLHPTINQ++ EP+V  DTVPN
Sbjct  339  FKNTSEIKMNGTKSMTGHGLGAAGGLEAIATIKAINTGWLHPTINQYDLEPAVTIDTVPN  398

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++H++NVAISNSFGFGGHNSVV F+ FKP
Sbjct  399  VKKQHQVNVAISNSFGFGGHNSVVVFAPFKP  429



>ref|XP_010109776.1| hypothetical protein L484_003136 [Morus notabilis]
 gb|EXC24694.1| hypothetical protein L484_003136 [Morus notabilis]
Length=511

 Score =   341 bits (874),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 192/227 (85%), Gaps = 16/227 (7%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN++PQ ASRPWDKDRDGFV+GEG GVL+MESLE AMKRGA IIAEYLGGA
Sbjct  285  FIACRALSQRNEEPQKASRPWDKDRDGFVIGEGCGVLIMESLESAMKRGAKIIAEYLGGA  344

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPR DGLGVSSCI  +L+DAGVSPEEVNY+NAHATSTL GDLAEVNA+KKV
Sbjct  345  ITCDAHHMTDPRPDGLGVSSCITKSLQDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKV  404

Query  513  FKDTSEIKMNATK----------------SMIGHCLGAAGGLEAIATVKAITTGWLHPTI  382
            FKDTSE+KMN TK                SMIGH LGAAGGLEA+AT+KAITTGWLHPTI
Sbjct  405  FKDTSELKMNGTKARKPKRLKNDIIPLDFSMIGHGLGAAGGLEAVATIKAITTGWLHPTI  464

Query  381  NQFNPEPSVEFDTVPNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            NQ N EP V  DTVPN K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  465  NQDNLEPDVTIDTVPNVKKKHEVNVAISNSFGFGGHNSVVVFAPFSP  511



>ref|XP_005843858.1| hypothetical protein CHLNCDRAFT_27559 [Chlorella variabilis]
 gb|EFN51756.1| hypothetical protein CHLNCDRAFT_27559 [Chlorella variabilis]
Length=464

 Score =   339 bits (869),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRND+PQ ASRPWD DRDGFVMGEGAGVL+MESLEHA KRGA IIAEYLGGA
Sbjct  254  FVACRALSQRNDEPQRASRPWDTDRDGFVMGEGAGVLIMESLEHAQKRGATIIAEYLGGA  313

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDP  +GLGVS+CI  AL+D+G+  +EVNYINAHATSTLVGD AEV A+KKV
Sbjct  314  VTCDAHHMTDPHPEGLGVSTCIELALKDSGIERDEVNYINAHATSTLVGDKAEVKAIKKV  373

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            F D S IKMNATKSMIGHCLGAAGG+EAIAT++AI TGW+HPTIN    E     D VPN
Sbjct  374  FSDLSHIKMNATKSMIGHCLGAAGGMEAIATIQAIQTGWVHPTINHSPIEEVDGIDVVPN  433

Query  333  KKQEHEINVAISNSFGFGGHNSVVAF  256
            KKQ+H +NV ISNSFGFGGHNSV AF
Sbjct  434  KKQQHTVNVGISNSFGFGGHNSVCAF  459



>gb|KEH21263.1| 3-oxoacyl-[acyl-carrier] synthase I [Medicago truncatula]
Length=394

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 182/211 (86%), Gaps = 5/211 (2%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
             +ACRALSQRN++P+ ASRPWDK RDG+V+ +     +MESLE A+KRGA I+AEYLGGA
Sbjct  189  LIACRALSQRNEEPKKASRPWDKHRDGYVIDK-----IMESLESAVKRGARILAEYLGGA  243

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMT+P  DGLG SSCI  +L+DAGVSP+EVNY+NAHATS+L+GDLAEVNA+K+V
Sbjct  244  ITCDAHHMTNPMPDGLGQSSCISKSLQDAGVSPQEVNYVNAHATSSLIGDLAEVNAIKQV  303

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FKDTSE+KMN TKS+IGHC+GAAG LEAI T+KAITTGWLHPTINQ N E  V  DTVPN
Sbjct  304  FKDTSELKMNGTKSIIGHCIGAAGALEAITTIKAITTGWLHPTINQDNLEDDVTIDTVPN  363

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ F P
Sbjct  364  VKKKHEVNVAISNSFGFGGHNSVVVFAPFMP  394



>gb|EMT20383.1| 3-oxoacyl-(acyl-carrier-protein) synthase I, chloroplastic [Aegilops 
tauschii]
Length=450

 Score =   333 bits (855),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F ACRALSQRN DP TASRPWDKDRDGFV+GEGAGVLVMESLEHAM+RGAPI+AEYLGGA
Sbjct  251  FFACRALSQRNVDPGTASRPWDKDRDGFVLGEGAGVLVMESLEHAMRRGAPILAEYLGGA  310

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V  DA+HMTDPR DGLGVSSCI  +LE+AGV+ EEVNYINAHATSTL GDLAEV A+K+V
Sbjct  311  VNSDAHHMTDPRPDGLGVSSCIRRSLENAGVALEEVNYINAHATSTLAGDLAEVKALKQV  370

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE-FDTVP  337
            FKD S+IK+NATKSMIGH LGAAG LEAIAT+KAITTGWLHPTINQFNPEP+V+ FDTVP
Sbjct  371  FKDPSQIKLNATKSMIGHSLGAAGALEAIATIKAITTGWLHPTINQFNPEPAVDRFDTVP  430

Query  336  NKKQEHEINV  307
            N KQ+HE+NV
Sbjct  431  NVKQQHEVNV  440



>ref|XP_002961627.1| hypothetical protein SELMODRAFT_230041 [Selaginella moellendorffii]
 gb|EFJ36887.1| hypothetical protein SELMODRAFT_230041 [Selaginella moellendorffii]
Length=384

 Score =   328 bits (840),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 176/211 (83%), Gaps = 22/211 (10%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRND+PQT SRPWDK R+GFVMGEGAGVLV+                     
Sbjct  196  FVACRALSQRNDEPQTVSRPWDKGREGFVMGEGAGVLVL---------------------  234

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+HMTDPRADGLGVS+CI  +LEDAG+SPEEVNYINAHATST+VGDLAE+NA+KKV
Sbjct  235  -TCDAHHMTDPRADGLGVSTCIEKSLEDAGLSPEEVNYINAHATSTVVGDLAEINAIKKV  293

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            F ++S+IK+NATKSMIGHCLGAAGG+EAIA +KAITTGWLHPTINQF+PEPSV FD V N
Sbjct  294  FSESSDIKINATKSMIGHCLGAAGGMEAIAVIKAITTGWLHPTINQFDPEPSVNFDRVAN  353

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             K++HE+NVAISNSFGFGGHNSVV F+ + P
Sbjct  354  VKKQHEVNVAISNSFGFGGHNSVVVFAPYNP  384



>gb|AEF13159.1| beta-ketoacyl acyl carrier protein synthase [Haematococcus pluvialis]
Length=462

 Score =   328 bits (841),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 176/211 (83%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALS RND P  ASRPWD DRDGFVMGEGAGVLV+ESLEHA KRGA IIAEY+GGA
Sbjct  251  FVACRALSTRNDSPAKASRPWDVDRDGFVMGEGAGVLVLESLEHATKRGAKIIAEYMGGA  310

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPRADGLGVS+CI  AL+D+ +  E+VNYINAHATSTLVGD+AEV AV+KV
Sbjct  311  VTCDAHHMTDPRADGLGVSTCIELALKDSRMEKEQVNYINAHATSTLVGDVAEVKAVRKV  370

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFN-PEPSVEFDTVP  337
            F D   IKMN+TKSMIGHCLGAAGGLEAIA +KAI TGW+HPT+NQ N  E     DTV 
Sbjct  371  FTDFGHIKMNSTKSMIGHCLGAAGGLEAIAVIKAIETGWVHPTLNQDNLVEEVAGIDTVA  430

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            N+K++H I   ISNSFGFGGHNSV  F+ FK
Sbjct  431  NEKKQHAITAGISNSFGFGGHNSVCVFAPFK  461



>ref|XP_002956811.1| hypothetical protein VOLCADRAFT_83790 [Volvox carteri f. nagariensis]
 gb|EFJ42114.1| hypothetical protein VOLCADRAFT_83790 [Volvox carteri f. nagariensis]
Length=461

 Score =   327 bits (839),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 179/217 (82%), Gaps = 7/217 (3%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALS RND+P  ASRPWD DRDGFVMGEGAGVLVMESLEHA KRGA I AEYLGGA
Sbjct  244  FVACRALSTRNDEPVRASRPWDCDRDGFVMGEGAGVLVMESLEHATKRGAKIYAEYLGGA  303

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHAT------STLVGDLAEV  532
            VTCDA+HMTDPR+DGLGVS+CI  AL+DA +  E+VNYINAHAT       TLVGD+AEV
Sbjct  304  VTCDAHHMTDPRSDGLGVSTCIELALKDARIEREQVNYINAHATRHVATRRTLVGDIAEV  363

Query  531  NAVKKVFKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNP-EPSV  355
             A+KKVF DT  +KMN TKSMIGHCLGAA G+EAIAT+KAI TGW+HPT+NQ N  E  V
Sbjct  364  KAIKKVFHDTKHLKMNGTKSMIGHCLGAAAGVEAIATLKAIETGWVHPTLNQHNLIEEVV  423

Query  354  EFDTVPNKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
              DTVPN+K++H I  AISNSFGFGGHNSVV F+ F+
Sbjct  424  GIDTVPNEKKQHNITAAISNSFGFGGHNSVVVFAPFR  460



>ref|XP_001416469.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94762.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=422

 Score =   325 bits (834),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 178/211 (84%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQ NDDP+ ASRPWDK RDGFVMGEGAGVL+ME+LE A KRGA I AEYLGGA
Sbjct  211  FVACRALSQNNDDPEGASRPWDKSRDGFVMGEGAGVLIMETLESAKKRGARIHAEYLGGA  270

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPRADGLGVS+CI  +++DAG+S  ++NYINAHATSTLVGD+AEVNAV+KV
Sbjct  271  ITCDAHHMTDPRADGLGVSTCIELSIKDAGISVSDINYINAHATSTLVGDVAEVNAVRKV  330

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE-FDTVP  337
            FKD   +KMNATKSMIGHCLGAAGG+EAIA + AI TG LHPT+NQ   EP VE  DT  
Sbjct  331  FKDVQNVKMNATKSMIGHCLGAAGGMEAIACIMAIKTGMLHPTLNQNELEPIVEGIDTCA  390

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            N+K+ H +  AISNSFGFGGHNS V F+ F+
Sbjct  391  NEKKAHTVTAAISNSFGFGGHNSCVIFAPFE  421



>ref|XP_005643461.1| 3-oxoacyl-synth [Coccomyxa subellipsoidea C-169]
 gb|EIE18917.1| 3-oxoacyl-synth [Coccomyxa subellipsoidea C-169]
Length=473

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 178/213 (84%), Gaps = 3/213 (1%)
 Frame = -1

Query  873  FVACRALSQ--RNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLG  700
            FVACRALS      +PQ ASRPWDKDRDGFVMGEGAGVLVMESLEHA  RGA I+AEY+G
Sbjct  260  FVACRALSSGGLTGEPQKASRPWDKDRDGFVMGEGAGVLVMESLEHAQARGANILAEYMG  319

Query  699  GAVTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVK  520
            G +TCDAYHMTDPRADGLGVS+CI  AL+DAG+  E+VNYINAHATSTLVGD+AEV A+K
Sbjct  320  GGITCDAYHMTDPRADGLGVSTCIEIALKDAGIEREQVNYINAHATSTLVGDVAEVKAIK  379

Query  519  KVFKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDT  343
            KVF   + IK+N TKS+IGHCLGAAGGLEA+AT++AI TGWLHPT+NQ N    V + DT
Sbjct  380  KVFPSMAGIKVNGTKSLIGHCLGAAGGLEAVATIQAIRTGWLHPTLNQDNLVDEVADIDT  439

Query  342  VPNKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            VPN K +HE+  AISNSFGFGGHNSVV F+ +K
Sbjct  440  VPNVKSQHEVTAAISNSFGFGGHNSVVVFAPYK  472



>gb|KJB66776.1| hypothetical protein B456_010G165600 [Gossypium raimondii]
Length=455

 Score =   325 bits (833),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/167 (91%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP+TASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA
Sbjct  263  FVACRALSQRNDDPRTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  322

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V CDA+HMTDPRADG GVSSCI  +LEDAGVSPEEVNYINAHATSTL GDLAE+NA+KKV
Sbjct  323  VNCDAHHMTDPRADGFGVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKV  382

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQF  373
            FK+TS+IK+NATKSMIGHCLGA+GGLEAIATVKAITTGWLHP+INQF
Sbjct  383  FKNTSDIKINATKSMIGHCLGASGGLEAIATVKAITTGWLHPSINQF  429



>ref|XP_003074998.1| beta-ketoacyl-ACP synthase (ISS) [Ostreococcus tauri]
Length=453

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 178/211 (84%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQ NDDP+ ASRPWDK RDGFVMGEGAGVL+MESLE A KRGA I AEYLGGA
Sbjct  242  FVACRALSQNNDDPEGASRPWDKSRDGFVMGEGAGVLIMESLESARKRGARIHAEYLGGA  301

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPRADGLGVS+CI  +++DAG++  ++NYINAHATSTLVGD+AEVNA++KV
Sbjct  302  ITCDAHHMTDPRADGLGVSTCIELSIKDAGITVSDINYINAHATSTLVGDVAEVNAIRKV  361

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE-FDTVP  337
            FKD   +KMNATKSMIGHCLGAAGG+EAIA + AI TG LHPT+NQ   EP V   DT  
Sbjct  362  FKDVENVKMNATKSMIGHCLGAAGGMEAIACIMAIKTGSLHPTLNQQEQEPIVNGIDTCA  421

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            N+K+ H++  AISNSFGFGGHNS V F+ F+
Sbjct  422  NEKKAHKVTAAISNSFGFGGHNSCVIFAPFE  452



>emb|CEG00998.1| Beta-ketoacyl synthase, active site [Ostreococcus tauri]
Length=454

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 178/211 (84%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQ NDDP+ ASRPWDK RDGFVMGEGAGVL+MESLE A KRGA I AEYLGGA
Sbjct  243  FVACRALSQNNDDPEGASRPWDKSRDGFVMGEGAGVLIMESLESARKRGARIHAEYLGGA  302

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPRADGLGVS+CI  +++DAG++  ++NYINAHATSTLVGD+AEVNA++KV
Sbjct  303  ITCDAHHMTDPRADGLGVSTCIELSIKDAGITVSDINYINAHATSTLVGDVAEVNAIRKV  362

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE-FDTVP  337
            FKD   +KMNATKSMIGHCLGAAGG+EAIA + AI TG LHPT+NQ   EP V   DT  
Sbjct  363  FKDVENVKMNATKSMIGHCLGAAGGMEAIACIMAIKTGSLHPTLNQQEQEPIVNGIDTCA  422

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            N+K+ H++  AISNSFGFGGHNS V F+ F+
Sbjct  423  NEKKAHKVTAAISNSFGFGGHNSCVIFAPFE  453



>ref|XP_007509323.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19780.1| predicted protein [Bathycoccus prasinos]
Length=464

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 180/211 (85%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQ N DP+ ASRPWDK RDGFVMGEGAG+LVMESLEHA+ RGA I AEY+GGA
Sbjct  253  FVACRALSQNNIDPEGASRPWDKARDGFVMGEGAGLLVMESLEHALARGARIHAEYMGGA  312

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPRADGLGVS+CI  A++DAG+S E++NYINAHATSTLVGD+AE+ AV+KV
Sbjct  313  ITCDAHHMTDPRADGLGVSTCIELAIKDAGISVEDINYINAHATSTLVGDVAEIAAVRKV  372

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE-FDTVP  337
            FKD + +KMNATKSMIGHCLGAAGG+EAIA++ AI TGWLHP+INQ   E  V   DT  
Sbjct  373  FKDMTNVKMNATKSMIGHCLGAAGGMEAIASIMAIKTGWLHPSINQNECEEVVTGIDTCA  432

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            N K+EH++  AISNSFGFGGHNS V F+ ++
Sbjct  433  NVKKEHKVTAAISNSFGFGGHNSCVIFAPYE  463



>ref|XP_011398280.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM25387.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Auxenochlorella 
protothecoides]
Length=446

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 170/211 (81%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALS RN +P  ASRPWD  RDGFVMGEGAGVLV+ESLEHA  RGA I+AEYLGGA
Sbjct  234  FVACRALSTRNFEPWRASRPWDAGRDGFVMGEGAGVLVLESLEHAQARGATILAEYLGGA  293

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+HMTDP  +GLGVS+CI  AL DAGV  +EVNYINAHATSTLVGD AE+ AV+ V
Sbjct  294  FTCDAHHMTDPHPEGLGVSTCIRLALADAGVDRDEVNYINAHATSTLVGDKAEIKAVRGV  353

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE-FDTVP  337
            F D    KMNATKSMIGHCLGAAGGLEAIAT++AI TGW+HPTIN  +P P VE  D VP
Sbjct  354  FGDMRGTKMNATKSMIGHCLGAAGGLEAIATIQAIRTGWVHPTINHDDPIPEVEGIDIVP  413

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            N K  H++ V ISNSFGFGGHNS VAF  +K
Sbjct  414  NVKARHDVRVGISNSFGFGGHNSAVAFGPYK  444



>ref|WP_032125192.1| 3-oxoacyl-ACP synthase [Chlamydia sp. 'Diamant']
Length=415

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F AC+ALSQRND+P  ASRPWD  RDGFVMGEGAGVLVMESLEHA+ RGAPI+AEYLGG 
Sbjct  206  FCACKALSQRNDEPSRASRPWDLGRDGFVMGEGAGVLVMESLEHALARGAPILAEYLGGG  265

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            ++CDAYHMT+PRADG GV+ CI  AL+DAG+ PE++NYINAHATST  GD+AEVNA+K+V
Sbjct  266  LSCDAYHMTEPRADGAGVALCIRHALQDAGIKPEDINYINAHATSTPAGDMAEVNALKQV  325

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ + IKMNATKSMIGH LGAAGG+EAIAT+KAI    +HPTIN  NPEP++ FD V  
Sbjct  326  FKNPAAIKMNATKSMIGHLLGAAGGVEAIATIKAILDHRIHPTINLENPEPNLGFD-VST  384

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            K +E E+  AISNSFGFGGHN+ +  + +K
Sbjct  385  KAEEFEVKHAISNSFGFGGHNASIVLARYK  414



>gb|EMS48559.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Triticum 
urartu]
Length=486

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP TASRPWDKDRDGFVMGEGAG+LVMESLEHAM+R API+AEYLGGA
Sbjct  113  FVACRALSQRNDDPGTASRPWDKDRDGFVMGEGAGILVMESLEHAMRRDAPILAEYLGGA  172

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            V  DAYHMT+PR DG GVS CI  +LE+AGV+PEEVNYINAHATST  GDLAEVNA+K+V
Sbjct  173  VNSDAYHMTNPRPDGCGVSVCIRQSLENAGVTPEEVNYINAHATSTPAGDLAEVNALKQV  232

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTV  340
            FKD S IK+NATKSMIGH LGAAGGLEAIAT+KAITTGW+HPTINQFNPEP V +F+TV
Sbjct  233  FKDPSRIKLNATKSMIGHSLGAAGGLEAIATIKAITTGWVHPTINQFNPEPEVDQFNTV  291



>emb|CAF23962.1| probable beta-ketoacyl-ACP synthetase [Candidatus Protochlamydia 
amoebophila UWE25]
 gb|KIC71331.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Candidatus 
Protochlamydia amoebophila]
Length=418

 Score =   311 bits (797),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 177/211 (84%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F AC+ALSQRN++P  ASRPWD+ RDGFV+GEGAGVLVMESL+HA+ R API+AEYLGG 
Sbjct  209  FCACKALSQRNENPAKASRPWDQGRDGFVLGEGAGVLVMESLDHALAREAPILAEYLGGG  268

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            ++CDAYHMT+PR+DG GV+ CI  AL+DAG+ PEE+NYINAHATST  GD+AEVNA+KKV
Sbjct  269  LSCDAYHMTEPRSDGEGVALCIRRALQDAGIQPEEINYINAHATSTPAGDMAEVNALKKV  328

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S IKMNATKSMIGH LGAAGG+EAIAT+KAI    +HPTIN  NPEP++EFD V +
Sbjct  329  FKNPSSIKMNATKSMIGHLLGAAGGVEAIATIKAILEHQIHPTINLENPEPNLEFD-VSS  387

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            + Q   +  AISNSFGFGGHN+ V F+ ++P
Sbjct  388  EAQRFIVKRAISNSFGFGGHNASVIFAPYEP  418



>ref|WP_039359465.1| 3-oxoacyl-ACP synthase [Candidatus Protochlamydia amoebophila]
Length=415

 Score =   311 bits (796),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 177/211 (84%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F AC+ALSQRN++P  ASRPWD+ RDGFV+GEGAGVLVMESL+HA+ R API+AEYLGG 
Sbjct  206  FCACKALSQRNENPAKASRPWDQGRDGFVLGEGAGVLVMESLDHALAREAPILAEYLGGG  265

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            ++CDAYHMT+PR+DG GV+ CI  AL+DAG+ PEE+NYINAHATST  GD+AEVNA+KKV
Sbjct  266  LSCDAYHMTEPRSDGEGVALCIRRALQDAGIQPEEINYINAHATSTPAGDMAEVNALKKV  325

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S IKMNATKSMIGH LGAAGG+EAIAT+KAI    +HPTIN  NPEP++EFD V +
Sbjct  326  FKNPSSIKMNATKSMIGHLLGAAGGVEAIATIKAILEHQIHPTINLENPEPNLEFD-VSS  384

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            + Q   +  AISNSFGFGGHN+ V F+ ++P
Sbjct  385  EAQRFIVKRAISNSFGFGGHNASVIFAPYEP  415



>ref|WP_042282680.1| 3-oxoacyl-ACP synthase [Candidatus Protochlamydia sp. R18]
Length=415

 Score =   311 bits (796),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 177/211 (84%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F AC+ALSQRN++P  ASRPWD+ RDGFV+GEGAGVLVMESL+HA+ R API+AEYLGG 
Sbjct  206  FCACKALSQRNENPAKASRPWDQGRDGFVLGEGAGVLVMESLDHALAREAPILAEYLGGG  265

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            ++CDAYHMT+PR+DG GV+ CI  AL+DAG+ PEE+NYINAHATST  GD+AEVNA+KKV
Sbjct  266  LSCDAYHMTEPRSDGEGVALCIRRALQDAGIQPEEINYINAHATSTPAGDMAEVNALKKV  325

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S IKMNATKSMIGH LGAAGG+EAIAT+KAI    +HPTIN  NPEP++EFD V +
Sbjct  326  FKNPSSIKMNATKSMIGHLLGAAGGVEAIATIKAILEHQIHPTINLENPEPNLEFD-VSS  384

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            + Q   +  AISNSFGFGGHN+ V F+ ++P
Sbjct  385  EAQRFIVKRAISNSFGFGGHNASVIFAPYEP  415



>ref|XP_005715183.1| Beta-ketoacyl synthase [Chondrus crispus]
 emb|CDF35364.1| Beta-ketoacyl synthase [Chondrus crispus]
Length=266

 Score =   299 bits (765),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 166/211 (79%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALS R D+P  ASRPWDK RDGFVMGEGAG++V+ESLEHA++RGAPI+AEY GGA
Sbjct  55   FIACRALSSRKDNPTGASRPWDKTRDGFVMGEGAGLIVLESLEHALERGAPIVAEYFGGA  114

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             +CDA+H+T+PR DG GV  CI  AL DAG+  E+V YINAHATST  GDLAE  AV+ V
Sbjct  115  QSCDAHHITEPRQDGGGVRKCIEDALADAGIVKEQVEYINAHATSTPAGDLAEFRAVRSV  174

Query  513  FK-DTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVP  337
            F  D S +KMNATKSMIGH LGAAGGLEA+ATVKAI  G +HPTIN    EP V+ D V 
Sbjct  175  FNGDVSRLKMNATKSMIGHALGAAGGLEAVATVKAIERGQIHPTINVHEQEPEVDIDIVA  234

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            NK QE +I V ISNSFGFGGHNS V F+ ++
Sbjct  235  NKMQEADIGVGISNSFGFGGHNSTVVFAKYE  265



>ref|WP_039384131.1| 3-oxoacyl-ACP synthase [Neochlamydia sp. TUME1]
 gb|KIC76638.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Neochlamydia sp. 
TUME1]
Length=415

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 172/211 (82%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F +C+ALSQRND+P+ ASRPWD+ RDGF+MGEGAG  ++ESLEHA+ RGAPIIAEYLGG 
Sbjct  206  FCSCKALSQRNDEPEKASRPWDRGRDGFLMGEGAGTFIIESLEHALARGAPIIAEYLGGG  265

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            ++CDAYH+T+PRAD  GV+ C+ +AL DAG+  EEV+YINAH TST  GD+AEV A+KKV
Sbjct  266  MSCDAYHITEPRADSEGVALCVRNALADAGIKAEEVDYINAHGTSTPAGDMAEVRALKKV  325

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S I MN+TKSMIGHCLGAAG +EA+ T KAI +GW+HP+IN  +PEP +EF  +P 
Sbjct  326  FKEPSSIIMNSTKSMIGHCLGAAGAMEAVVTAKAIESGWVHPSINLEDPEPDLEFH-IPT  384

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
              ++ +IN+AISN+FGFGGHN+ +   A+ P
Sbjct  385  VAEKKDINIAISNTFGFGGHNATIVLGAYHP  415



>gb|KDD75769.1| beta-ketoacyl synthase [Helicosporidium sp. ATCC 50920]
Length=464

 Score =   302 bits (774),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 172/212 (81%), Gaps = 2/212 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRND PQ ASRPWD+DRDGFV+GEGAGVLVMESLEHA++RGAPI+AEYLGGA
Sbjct  252  FVACRALSQRNDAPQRASRPWDRDRDGFVIGEGAGVLVMESLEHALERGAPILAEYLGGA  311

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVS-PEEVNYINAHATSTLVGDLAEVNAVKK  517
            +TCDA+H T P  +GLGV  C+  AL++AGVS PE VNYINAHATST  GD+AEV A++ 
Sbjct  312  LTCDAHHTTQPHPEGLGVGRCVALALQNAGVSDPEAVNYINAHATSTGQGDVAEVKALRA  371

Query  516  VFKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE-FDTV  340
                   +KMNATKSMIGH LGAAGGLEA+A ++A+ TGW+HPT+N  N  P  E    V
Sbjct  372  ALPHLPSVKMNATKSMIGHALGAAGGLEAVAVIQAMRTGWVHPTLNLDNVMPEAEGLQLV  431

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            P+KK+  ++NVA+SNSFGFGGHNSVV F+ +K
Sbjct  432  PHKKERLDVNVALSNSFGFGGHNSVVVFAPYK  463



>ref|WP_042239744.1| 3-oxoacyl-ACP synthase [Neochlamydia sp. S13]
Length=415

 Score =   298 bits (764),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 171/211 (81%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F +C+ALSQRND+P+ ASRPWD+ RDGF+MGEGAG  ++ESLEHA+ RGAPIIAEYLGG 
Sbjct  206  FCSCKALSQRNDEPEKASRPWDRGRDGFLMGEGAGTFIIESLEHALARGAPIIAEYLGGG  265

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            ++CDAYH+T+PRAD  GV+ C+ +AL DA +  EEV+YINAH TST  GD+AEV A+KKV
Sbjct  266  MSCDAYHITEPRADSEGVALCVRNALADADIKAEEVDYINAHGTSTPAGDMAEVRALKKV  325

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S I MN+TKSMIGHCLGAAG +EA+ T KAI +GW+HP+IN  +PEP +EF  +P 
Sbjct  326  FKEPSSIIMNSTKSMIGHCLGAAGAMEAVVTAKAIESGWVHPSINLEDPEPDLEFH-IPT  384

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
              ++ +IN+AISN+FGFGGHN+ +   A+ P
Sbjct  385  VAEKKDINIAISNTFGFGGHNATIVLGAYHP  415



>ref|WP_042103505.1| 3-oxoacyl-ACP synthase [Parachlamydiaceae bacterium HS-T3]
Length=416

 Score =   298 bits (762),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 173/211 (82%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F AC+ALS+RND+PQ ASRPWDK RDGFVMGEGAGV+V+E LEHA+ R A I AEYLGG 
Sbjct  207  FCACKALSERNDEPQKASRPWDKGRDGFVMGEGAGVIVLEELEHALARNATIFAEYLGGG  266

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            ++CDAYHMT+PR+DG GV++C+ +AL++AG++ E+VNYINAHATST +GD+AE+NA+KKV
Sbjct  267  ISCDAYHMTEPRSDGEGVAACVRNALQNAGITAEDVNYINAHATSTPLGDMAEINALKKV  326

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            F    +I +N+TKSMIGHCLGAAGG+EAIAT+KAIT    HPTIN  NPE ++ F  +P 
Sbjct  327  FAKPEKIVINSTKSMIGHCLGAAGGIEAIATIKAITDKVAHPTINLENPEENIGFH-IPT  385

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
            K +  EI  AISNSFGFGGHN+ V F+ + P
Sbjct  386  KAEPVEIKAAISNSFGFGGHNATVIFAPYHP  416



>gb|KIC73224.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Neochlamydia 
sp. EPS4]
Length=415

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 170/211 (81%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F +C+ALSQRND+P+ ASRPWD  RDGF+MGEGAG  ++ESLEHA+ RGAPIIAEYLGG 
Sbjct  206  FCSCKALSQRNDEPEKASRPWDLGRDGFLMGEGAGTFIIESLEHALARGAPIIAEYLGGG  265

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            ++CDAYH+T+PRAD  GV+ C+ +AL DA +  EEV+YINAH TST  GD+AEV A+KKV
Sbjct  266  MSCDAYHITEPRADSEGVALCVRNALADADIKAEEVDYINAHGTSTPAGDMAEVRALKKV  325

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            FK+ S I MN+TKSMIGHCLGAAG +EA+ T KAI +GW+HP+IN  +PEP +EF  +P 
Sbjct  326  FKEPSSIIMNSTKSMIGHCLGAAGAMEAVVTAKAIESGWVHPSINLEDPEPDLEFH-IPT  384

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
              ++ +IN+AISN+FGFGGHN+ +   A+ P
Sbjct  385  VAEKKDINIAISNTFGFGGHNATIVLGAYHP  415



>ref|WP_006340838.1| 3-oxoacyl-ACP synthase [Parachlamydia acanthamoebae]
 gb|EFB41814.1| hypothetical protein pah_c022o107 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB86299.1| 3-oxoacyl-[acyl-carrier-protein] synthase I,chloroplastic [Parachlamydia 
acanthamoebae UV-7]
 gb|KIA77957.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Parachlamydia acanthamoebae]
Length=419

 Score =   295 bits (756),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 172/211 (82%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F AC+ALS+RND+P  ASRPWDKDRDGFV+GEGAGVLV+ESLEHA+ RGA I AEYLGG+
Sbjct  206  FSACKALSERNDEPTKASRPWDKDRDGFVLGEGAGVLVLESLEHALARGATIYAEYLGGS  265

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             +CDA+H+T+PR DG GV+ CI  AL+DAG+S E++NY+NAHATST VGD+AEVNA+K +
Sbjct  266  SSCDAHHITEPRPDGKGVALCIKKALKDAGISAEDINYVNAHATSTPVGDMAEVNALKLI  325

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
              + S++ MNATKS+IGHCLGAAGG+EAI TVKAI  G +HPT+N  NPEP ++F  VP 
Sbjct  326  LPNPSKVVMNATKSIIGHCLGAAGGVEAIVTVKAIAEGKVHPTLNLENPEPGLDFH-VPR  384

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
              +E  I  A+SNSFGFGGHN+ + F+ + P
Sbjct  385  TAEELTIKAALSNSFGFGGHNATLVFAPYNP  415



>ref|XP_001701199.1| 3-ketoacyl-CoA-synthase [Chlamydomonas reinhardtii]
 gb|EDO97709.1| 3-ketoacyl-CoA-synthase [Chlamydomonas reinhardtii]
Length=553

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 159/187 (85%), Gaps = 1/187 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALS RNDDP  ASRPWD DRDGFVMGEGAGVLVMESLEHA KRGA I AEYLGGA
Sbjct  208  FVACRALSTRNDDPVKASRPWDCDRDGFVMGEGAGVLVMESLEHATKRGAKIYAEYLGGA  267

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR+DGLGVS+CI  AL+D+ +  E+VNYIN HATSTLVGD+AEV A+KKV
Sbjct  268  VTCDAHHMTDPRSDGLGVSTCIELALKDSRIPKEQVNYINCHATSTLVGDIAEVKAIKKV  327

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNP-EPSVEFDTVP  337
            F DT  +K+N TKSMIGHCLGAA G+EAIAT+KAI TGWLHPT+NQ N  E     DTVP
Sbjct  328  FTDTKHLKVNGTKSMIGHCLGAAAGVEAIATLKAIETGWLHPTLNQHNLIEEVAGIDTVP  387

Query  336  NKKQEHE  316
            N+K++H+
Sbjct  388  NEKKQHQ  394



>ref|XP_002504288.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65546.1| predicted protein [Micromonas sp. RCC299]
Length=514

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 174/212 (82%), Gaps = 2/212 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALS  ND+   ASRPWDK+RDGFVMGEGAG+LV+ESLE A+KRGA I AEYLGGA
Sbjct  302  FVACRALSSNNDNFAAASRPWDKNRDGFVMGEGAGLLVLESLESALKRGARIHAEYLGGA  361

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            +TCDA+HMTDPR DG GV  CI  A+EDAG+  +E+NYINAHATSTLVGD+AE+NAVKK 
Sbjct  362  ITCDAHHMTDPRPDGSGVGLCIEKAVEDAGIDIKEINYINAHATSTLVGDVAEINAVKKA  421

Query  513  FK-DTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE-FDTV  340
            FK D + +KMN TKSM+GHCLGAA G+EA+AT+ AI TGW+HPTINQ +P   VE  DTV
Sbjct  422  FKGDLTGVKMNGTKSMVGHCLGAAAGVEAVATIMAIKTGWVHPTINQEDPIDEVEGIDTV  481

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            PN K EH+I+ AISNSFGFGGHNS   F  ++
Sbjct  482  PNVKAEHKISAAISNSFGFGGHNSCCIFGPYE  513



>ref|WP_013182436.1| 3-oxoacyl-ACP synthase [Waddlia chondrophila]
 gb|ADI38725.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Waddlia chondrophila 
WSU 86-1044]
 emb|CCB92260.1| 3-oxoacyl-[acyl-carrier-protein] synthase I,chloroplastic [Waddlia 
chondrophila 2032/99]
Length=416

 Score =   288 bits (738),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 168/210 (80%), Gaps = 1/210 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F AC+ALS+RND P+ ASRPWDK+RDGFVMGEGAG+LV+E LEHA++RGA I+AEY+G  
Sbjct  207  FNACKALSKRNDAPEKASRPWDKERDGFVMGEGAGILVLERLEHALERGASIVAEYMGHG  266

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            ++CDA+HMT+PR DG G++ C+ SAL+DAG+ PEE++YINAHATST  GD+ EVNA+K+V
Sbjct  267  ISCDAHHMTEPRPDGKGIAKCMLSALKDAGLKPEEISYINAHATSTPAGDMVEVNALKQV  326

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
              D S++ MNATKSMIGH LGAA G+EA+ T KAI  G +HPTIN  NPEP + F T P 
Sbjct  327  IPDPSKVVMNATKSMIGHGLGAAAGIEAVVTAKAIQEGKVHPTINLENPEPDLGFHT-PT  385

Query  333  KKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            +  E E+ VA+SNSFGFGGHNS +    +K
Sbjct  386  EALEMEVKVAVSNSFGFGGHNSSIILGKYK  415



>ref|XP_005642959.1| 3-ketoacyl-ACP-synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE18415.1| 3-ketoacyl-ACP-synthase [Coccomyxa subellipsoidea C-169]
Length=464

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 168/211 (80%), Gaps = 2/211 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALSQRN+DP  ASRPWD++RDGFVMGEGAGVLV+E LEHA  RGAPI+AE+LGG+
Sbjct  254  FIACRALSQRNEDPARASRPWDRNRDGFVMGEGAGVLVLEELEHAKARGAPILAEFLGGS  313

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+HMT+P+  G GV  CI  +LE AG+SPEEVNY+NAHATST  GDLAE  A++  
Sbjct  314  CTCDAHHMTEPQPQGKGVLLCIQKSLEQAGISPEEVNYVNAHATSTQAGDLAEYRAIRAA  373

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVPN  334
            F   S++++N TKSMIGH LGAAG +EAIAT++AI TG+LHPTIN  +PE  V+   +  
Sbjct  374  FPG-SDLRINGTKSMIGHLLGAAGAVEAIATIQAIRTGYLHPTINVEDPEDEVDMGVIVG  432

Query  333  -KKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
              KQ  ++NVA+SNSFGFGGHNS + F A+K
Sbjct  433  ASKQAMDVNVALSNSFGFGGHNSSILFRAYK  463



>tpg|DAA41443.1| TPA: hypothetical protein ZEAMMB73_227409 [Zea mays]
Length=237

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 165/211 (78%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRN DP  ASRPWD  RDGFVMGEGAGVLV+E LEHA +RGA I AE+LGG+
Sbjct  18   FVACRALSQRNSDPTKASRPWDMGRDGFVMGEGAGVLVLEELEHAKERGATIYAEFLGGS  77

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDAYHMT+P  +G G++ CI  AL DAGV+ EE+NY+NAHATST  GDL E  A+ + 
Sbjct  78   FTCDAYHMTEPHPEGRGITLCIEKALADAGVAREEINYVNAHATSTQAGDLKEYEAIVRC  137

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDT-VP  337
            F+   ++++N+TKSM GH +GAAGG+EA+A+++AI TGW+HP +N  NPE +V+    V 
Sbjct  138  FRQNPQLRVNSTKSMTGHLIGAAGGIEAVASIQAIRTGWVHPNLNLENPEDTVDVGILVG  197

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            ++K+  E+ VA+SNSFGFGGHNS + F+ FK
Sbjct  198  SQKERCEVKVALSNSFGFGGHNSSILFAPFK  228



>ref|WP_013712221.1| 3-oxoacyl-ACP synthase [Chlamydia pecorum]
 gb|AEB41143.1| acyl carrier protein synthase [Chlamydophila pecorum E58]
 gb|AGW38281.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia pecorum 
PV3056/3]
 gb|AGW39206.1| 3-oxoacyl-(acyl-carrier-protein) synthase II [Chlamydia pecorum 
W73]
 gb|AGW40132.1| 3-oxoacyl-(acyl-carrier-protein) synthase II [Chlamydia pecorum 
P787]
 gb|ETF38499.1| acyl carrier protein synthase [Chlamydia pecorum VR629]
 gb|ETF39004.1| acyl carrier protein synthase [Chlamydia pecorum DBDeUG]
 gb|ETF39681.1| acyl carrier protein synthase [Chlamydia pecorum MC/MarsBar]
 gb|ETF40730.1| acyl carrier protein synthase [Chlamydia pecorum IPTaLE]
Length=416

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 172/213 (81%), Gaps = 2/213 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+A RALS+RND P+ ASRPWD+DRDGFVMGEGAG+LV+E+LE+A++R API AE LGG 
Sbjct  204  FIANRALSERNDAPEKASRPWDRDRDGFVMGEGAGILVLETLENALRREAPIFAEMLGGY  263

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T PR DG G+++C+  ALE AG++ E VNYINAH TST +GD++EV A+KK 
Sbjct  264  TTCDAFHITAPRDDGEGITACVLGALESAGIAKERVNYINAHGTSTPLGDISEVLAMKKA  323

Query  513  F-KDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE-FDTV  340
            F      ++MN+TKS+IGHCLGAAGG+EAIAT++AI TG LHPTIN  NP   +E FD V
Sbjct  324  FGSHVKNLRMNSTKSLIGHCLGAAGGVEAIATIQAILTGRLHPTINLENPIAEIEDFDVV  383

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             NK Q+ +I+VA+SNSFGFGGHNS + FS ++P
Sbjct  384  ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYEP  416



>ref|XP_005707986.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Galdieria sulphuraria]
 gb|EME31466.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Galdieria sulphuraria]
Length=482

 Score =   288 bits (737),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+ACRALS+RN+DP  A RPWD +RDGFVMGEG GVLV+ESLEHA++R API+ EYLGGA
Sbjct  271  FIACRALSKRNEDPTKACRPWDTERDGFVMGEGCGVLVLESLEHALRREAPILCEYLGGA  330

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDAYH+T+P  +G GV  C+  A++D+G++  +V+YINAHATST +GD+AE  A++ +
Sbjct  331  HTCDAYHITEPHPEGHGVIKCMELAVQDSGINIADVDYINAHATSTPLGDIAEFRAIRSI  390

Query  513  FKDTSE-IKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVP  337
            FKD  + +K+N+TKS+IGH LGAAG LEAIATVKAI TG LHPT+N    +P V+ D VP
Sbjct  391  FKDYKDRVKLNSTKSLIGHGLGAAGALEAIATVKAIQTGKLHPTLNVEKLDPEVDMDVVP  450

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAF  247
            N  +EH + VA+SNSFGFGGHNSVV F A+
Sbjct  451  NVAKEHRVRVAMSNSFGFGGHNSVVVFGAY  480



>ref|WP_011457720.1| 3-oxoacyl-ACP synthase [Chlamydophila felis]
 dbj|BAE80935.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Chlamydophila felis 
Fe/C-56]
Length=416

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 170/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+A RALS+RND PQ ASRPWD+DRDGFV+GEGAGVLV+E+LE+A+KRGAPI AE LG  
Sbjct  204  FIANRALSERNDAPQEASRPWDRDRDGFVIGEGAGVLVLETLENALKRGAPIYAEILGSY  263

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T PR DG G++SCI  ALE +G+  E VNYINAH TST +GD++EV AVKK 
Sbjct  264  TTCDAFHITAPRDDGEGITSCILGALESSGIPKERVNYINAHGTSTPLGDISEVLAVKKA  323

Query  513  F-KDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTV  340
            F      ++MN+TKS+IGHCLGAAGG+EA+AT++AI TG LHPTIN  NP   + +FD V
Sbjct  324  FGSHVKNLRMNSTKSLIGHCLGAAGGVEAVATIQAIQTGKLHPTINLENPIAEIDDFDVV  383

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             NK Q+ +I+VA+SNSFGFGGHNS + FS + P
Sbjct  384  ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYIP  416



>tpg|DAA41444.1| TPA: hypothetical protein ZEAMMB73_227409 [Zea mays]
 tpg|DAA41445.1| TPA: hypothetical protein ZEAMMB73_227409 [Zea mays]
Length=306

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 165/211 (78%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRN DP  ASRPWD  RDGFVMGEGAGVLV+E LEHA +RGA I AE+LGG+
Sbjct  87   FVACRALSQRNSDPTKASRPWDMGRDGFVMGEGAGVLVLEELEHAKERGATIYAEFLGGS  146

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDAYHMT+P  +G G++ CI  AL DAGV+ EE+NY+NAHATST  GDL E  A+ + 
Sbjct  147  FTCDAYHMTEPHPEGRGITLCIEKALADAGVAREEINYVNAHATSTQAGDLKEYEAIVRC  206

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDT-VP  337
            F+   ++++N+TKSM GH +GAAGG+EA+A+++AI TGW+HP +N  NPE +V+    V 
Sbjct  207  FRQNPQLRVNSTKSMTGHLIGAAGGIEAVASIQAIRTGWVHPNLNLENPEDTVDVGILVG  266

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            ++K+  E+ VA+SNSFGFGGHNS + F+ FK
Sbjct  267  SQKERCEVKVALSNSFGFGGHNSSILFAPFK  297



>ref|WP_006344425.1| 3-oxoacyl-ACP synthase [Chlamydophila abortus]
 gb|EGK69553.1| 3-oxoacyl-(acyl-carrier-protein) synthase II [Chlamydophila abortus 
LLG]
Length=416

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 171/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+A RALS+RND PQ ASRPWD+DRDGFV+GEGAG+LV+E+LE+A+KRGAPI AE LG  
Sbjct  204  FIANRALSERNDAPQEASRPWDRDRDGFVIGEGAGILVLETLENALKRGAPIYAEILGAY  263

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T PR DG G++SCI  ALE +G+  E VNYINAH TST +GD++EV A+KK 
Sbjct  264  TTCDAFHITAPRDDGEGITSCILGALESSGIPKERVNYINAHGTSTPLGDISEVLALKKA  323

Query  513  F-KDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTV  340
            F     +++MN+TKS+IGHCLGAAGG+EA+AT++AI TG LHPTIN  NP   + +FD V
Sbjct  324  FGSHVKKLRMNSTKSLIGHCLGAAGGVEAVATIQAIQTGKLHPTINLENPITEIDDFDVV  383

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             NK Q+ +I+VA+SNSFGFGGHNS + FS + P
Sbjct  384  ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYIP  416



>ref|WP_011097353.1| 3-oxoacyl-ACP synthase [Chlamydophila abortus]
 emb|CAH64260.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Chlamydophila abortus 
S26/3]
 emb|CED80865.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Chlamydophila abortus]
Length=416

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 171/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+A RALS+RND PQ ASRPWD+DRDGFV+GEGAG+LV+E+LE+A+KRGAPI AE LG  
Sbjct  204  FIANRALSERNDAPQEASRPWDRDRDGFVIGEGAGILVLETLENALKRGAPIYAEILGAY  263

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T PR DG G++SCI  ALE +G+  E VNYINAH TST +GD++EV A+KK 
Sbjct  264  TTCDAFHITAPRDDGEGITSCILGALESSGIPKERVNYINAHGTSTPLGDISEVLALKKA  323

Query  513  F-KDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTV  340
            F     +++MN+TKS+IGHCLGAAGG+EA+AT++AI TG LHPTIN  NP   + +FD V
Sbjct  324  FGSHVKKLRMNSTKSLIGHCLGAAGGVEAVATIQAIQTGKLHPTINLENPITEIDDFDVV  383

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             NK Q+ +I+VA+SNSFGFGGHNS + FS + P
Sbjct  384  ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYIP  416



>ref|XP_003060067.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56019.1| predicted protein [Micromonas pusilla CCMP1545]
Length=467

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 170/212 (80%), Gaps = 2/212 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALS  ND+ + ASRPWDK RDGFVMGEGAG+LV+ESLE A KRGA I AEYLGGA
Sbjct  255  FVACRALSSNNDNYKGASRPWDKGRDGFVMGEGAGLLVLESLESAQKRGARIHAEYLGGA  314

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
            VTCDA+HMTDPR DG GV  CI  A+EDAG+   E+NYINAHATSTLVGD+AEVNAVKK 
Sbjct  315  VTCDAHHMTDPRPDGSGVGLCITKAVEDAGIDISEINYINAHATSTLVGDVAEVNAVKKA  374

Query  513  FKDTSE-IKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTV  340
            F +  + +KMN TKSM+GHCLGAA G+EA+AT+ AI TGWLHPTINQ +    V + DT 
Sbjct  375  FNNKLDGVKMNGTKSMVGHCLGAAAGVEAVATIMAIKTGWLHPTINQEDSIDEVADIDTC  434

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            PN K EHE+ VAISNSFGFGGHNS   F+ F+
Sbjct  435  PNVKVEHEVKVAISNSFGFGGHNSSCVFAPFE  466



>ref|WP_011006808.1| 3-oxoacyl-ACP synthase [Chlamydophila caviae]
 gb|AAP05594.1| 3-oxoacyl-(acyl-carrier-protein) synthase II [Chlamydophila caviae 
GPIC]
Length=416

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 170/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+A RALS+RND PQ ASRPWD+DRDGFV+GEGAGVLV+E+LE+A+KRGAPI AE LG  
Sbjct  204  FIANRALSERNDAPQEASRPWDRDRDGFVIGEGAGVLVLETLENALKRGAPIYAEILGSY  263

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T PR DG G++SCI  ALE +G+  E VNYINAH TST +GD++EV A+KK 
Sbjct  264  TTCDAFHITAPRDDGEGITSCILGALESSGIPKERVNYINAHGTSTPLGDISEVLALKKA  323

Query  513  F-KDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTV  340
            F      ++MN+TKS+IGHCLGAAGG+EA+AT++AI TG LHPTIN  NP   + +FD V
Sbjct  324  FGSHVKNLRMNSTKSLIGHCLGAAGGVEAVATIQAIQTGKLHPTINLENPIAEIDDFDVV  383

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             NK Q+ +I+VA+SNSFGFGGHNS + FS + P
Sbjct  384  ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYIP  416



>gb|AAA33872.1| chloroplast beta-ketoacyl-ACP synthase precursor [Ricinus communis]
 gb|ABR01158.1| plastid 3-keto-acyl-ACP synthase II [Ricinus communis]
Length=535

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 164/211 (78%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP  ASRPWD +RDGFVMGEGAGVL++E LEHA KRGA I AE+LGG+
Sbjct  325  FVACRALSQRNDDPTKASRPWDMNRDGFVMGEGAGVLLLEELEHAKKRGANIYAEFLGGS  384

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDAYHMT+PR DG+GV  CI  AL  +GVS EEVNYINAHATST  GDL E  A+ + 
Sbjct  385  FTCDAYHMTEPRPDGVGVILCIEKALARSGVSKEEVNYINAHATSTPAGDLKEYEALMRC  444

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDT-VP  337
            F    ++++N+TKSMIGH LGAAG +EAIAT++AI TGW+HP IN  NPE  V+    V 
Sbjct  445  FSQNPDLRVNSTKSMIGHLLGAAGAVEAIATIQAIRTGWVHPNINLENPEEGVDTKVLVG  504

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
             KK+  +I VA+SNSFGFGGHNS + F+ +K
Sbjct  505  PKKERLDIKVALSNSFGFGGHNSSIIFAPYK  535



>emb|CBI27767.3| unnamed protein product [Vitis vinifera]
Length=517

 Score =   286 bits (732),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 165/211 (78%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRN+DP  ASRPWD +RDGFVMGEGAGVL++E LEHA KRGA I AE+LGG+
Sbjct  307  FVACRALSQRNNDPTKASRPWDTNRDGFVMGEGAGVLLLEELEHAKKRGAKIYAEFLGGS  366

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDAYHMT+P  DG GV  CI SAL  +GVS E+VNYINAHATSTL GD  E  A+ + 
Sbjct  367  FTCDAYHMTEPHPDGAGVILCIESALARSGVSREDVNYINAHATSTLAGDFREYQALVRC  426

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFD-TVP  337
            F    E+K+N+TKSMIGH LGAAG +EAIAT++AI TGW+HP IN  +PE  V+ D  V 
Sbjct  427  FGQNPELKVNSTKSMIGHLLGAAGAVEAIATIQAIRTGWVHPNINLESPEEGVDTDLLVG  486

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            +KK+  +I VA+SNSFGFGGHNS + F+ +K
Sbjct  487  SKKERLDIKVALSNSFGFGGHNSSIIFAPYK  517



>ref|WP_014945306.1| 3-oxoacyl-ACP synthase [Chlamydia psittaci]
 gb|AFS24626.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Chlamydia psittaci 
M56]
Length=416

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 171/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+A RALS+RND PQ ASRPWD+DRDGFV+GEGAG+LV+E+LE+A+KRGAPI AE LG  
Sbjct  204  FIANRALSERNDAPQEASRPWDRDRDGFVIGEGAGILVLETLENALKRGAPIYAEILGSY  263

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T PR DG G++SC+  ALE +G+  E VNYINAH TST +GD++EV A+KK 
Sbjct  264  TTCDAFHITAPRDDGEGITSCVLGALESSGIPKERVNYINAHGTSTPLGDISEVLALKKA  323

Query  513  F-KDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTV  340
            F     +++MN+TKS+IGHCLGAAGG+EA+AT++AI TG LHPTIN  NP   + +FD V
Sbjct  324  FGSHVKKLRMNSTKSLIGHCLGAAGGVEAVATIQAIQTGKLHPTINLENPIAEIDDFDVV  383

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             NK Q+ +I+VA+SNSFGFGGHNS + FS + P
Sbjct  384  ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYIP  416



>ref|WP_006343509.1| 3-oxoacyl-ACP synthase [Chlamydia psittaci]
 ref|YP_004064777.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Chlamydia psittaci 
RD1]
 emb|CBY17345.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Chlamydia psittaci 
RD1]
 gb|ADZ18497.1| 3-oxoacyl-(acyl-carrier-protein) synthase 2 [Chlamydia psittaci 
6BC]
 gb|EGF84725.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Chlamydia psittaci 
Cal10]
 gb|AEB55859.1| 3-oxoacyl-(acyl-carrier-protein) synthase II [Chlamydia psittaci 
6BC]
 gb|AEG85876.1| 3-oxoacyl-(acyl-carrier-protein) synthase 2 [Chlamydia psittaci 
C19/98]
 gb|AEG86851.1| 3-oxoacyl-(acyl-carrier-protein) synthase 2 [Chlamydia psittaci 
01DC11]
 gb|AEG87829.1| 3-oxoacyl-(acyl-carrier-protein) synthase 2 [Chlamydia psittaci 
02DC15]
 gb|AEG88802.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Chlamydia psittaci 
08DC60]
 gb|AFS19921.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Chlamydia psittaci 
84/55]
 gb|AFS20975.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Chlamydia psittaci 
GR9]
 gb|AFS21407.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Chlamydia psittaci 
MN]
 gb|AFS23108.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Chlamydia psittaci 
VS225]
 gb|AFS23632.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Chlamydia psittaci 
WS/RT/E30]
 gb|AFS25571.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Chlamydia psittaci 
WC]
 gb|AFS27353.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Chlamydia psittaci 
CP3]
 gb|AFS28410.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Chlamydia psittaci 
NJ1]
 emb|CCO02331.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Chlamydia psittaci 
01DC12]
 gb|AGE75427.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia psittaci 
Mat116]
 gb|EPJ13947.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
02DC15]
 gb|EPJ14482.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
02DC16]
 gb|EPJ16460.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
02DC18]
 gb|EPJ17459.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
02DC22]
 gb|EPJ18617.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
01DC11]
 gb|EPJ20371.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
02DC23]
 gb|EPJ21573.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
02DC21]
 gb|EPJ22803.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
04DC42]
 gb|EPJ23514.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
08DC60]
 gb|EPJ25734.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
09DC77]
 gb|EPJ27124.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
09DC80]
 gb|EPJ28784.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
99DC5]
 gb|EPJ28924.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
C19/98]
 gb|EPJ30907.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
09DC78]
 gb|EPJ31963.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
03DC35]
 gb|EPJ99006.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
02DC24]
 gb|EPL00084.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
02DC14]
 gb|EPL00870.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
09DC79]
 gb|EPP29435.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
08-2626_L3]
 gb|EPP31183.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
C1/97]
 gb|EPP34163.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
C6/98]
Length=416

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 171/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+A RALS+RND PQ ASRPWD+DRDGFV+GEGAG+LV+E+LE+A+KRGAPI AE LG  
Sbjct  204  FIANRALSERNDAPQEASRPWDRDRDGFVIGEGAGILVLETLENALKRGAPIYAEILGSY  263

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T PR DG G++SC+  ALE +G+  E VNYINAH TST +GD++EV A+KK 
Sbjct  264  TTCDAFHITAPRDDGEGITSCVLGALESSGIPKERVNYINAHGTSTPLGDISEVLALKKA  323

Query  513  F-KDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTV  340
            F     +++MN+TKS+IGHCLGAAGG+EA+AT++AI TG LHPTIN  NP   + +FD V
Sbjct  324  FGSHVKKLRMNSTKSLIGHCLGAAGGVEAVATIQAIQTGKLHPTINLENPIAEIDDFDVV  383

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             NK Q+ +I+VA+SNSFGFGGHNS + FS + P
Sbjct  384  ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYIP  416



>ref|XP_002516228.1| 46 kDa ketoavyl-ACP synthase [Ricinus communis]
 gb|EEF46230.1| 46 kDa ketoavyl-ACP synthase [Ricinus communis]
Length=554

 Score =   287 bits (734),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 164/211 (78%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRNDDP  ASRPWD +RDGFVMGEGAGVL++E LEHA KRGA I AE+LGG+
Sbjct  344  FVACRALSQRNDDPTKASRPWDMNRDGFVMGEGAGVLLLEELEHAKKRGANIYAEFLGGS  403

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDAYHMT+PR DG+GV  CI  AL  +GVS EEVNYINAHATST  GDL E  A+ + 
Sbjct  404  FTCDAYHMTEPRPDGVGVILCIEKALARSGVSKEEVNYINAHATSTPAGDLKEYEALMRC  463

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDT-VP  337
            F    ++++N+TKSMIGH LGAAG +EAIAT++AI TGW+HP IN  NPE  V+    V 
Sbjct  464  FSQNPDLRVNSTKSMIGHLLGAAGAVEAIATIQAIRTGWVHPNINLENPEEGVDTKVLVG  523

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
             KK+  +I VA+SNSFGFGGHNS + F+ +K
Sbjct  524  PKKERLDIKVALSNSFGFGGHNSSIIFAPYK  554



>ref|XP_002276214.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Vitis vinifera]
 ref|XP_010656091.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Vitis vinifera]
Length=555

 Score =   286 bits (733),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 165/211 (78%), Gaps = 1/211 (0%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            FVACRALSQRN+DP  ASRPWD +RDGFVMGEGAGVL++E LEHA KRGA I AE+LGG+
Sbjct  345  FVACRALSQRNNDPTKASRPWDTNRDGFVMGEGAGVLLLEELEHAKKRGAKIYAEFLGGS  404

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDAYHMT+P  DG GV  CI SAL  +GVS E+VNYINAHATSTL GD  E  A+ + 
Sbjct  405  FTCDAYHMTEPHPDGAGVILCIESALARSGVSREDVNYINAHATSTLAGDFREYQALVRC  464

Query  513  FKDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFD-TVP  337
            F    E+K+N+TKSMIGH LGAAG +EAIAT++AI TGW+HP IN  +PE  V+ D  V 
Sbjct  465  FGQNPELKVNSTKSMIGHLLGAAGAVEAIATIQAIRTGWVHPNINLESPEEGVDTDLLVG  524

Query  336  NKKQEHEINVAISNSFGFGGHNSVVAFSAFK  244
            +KK+  +I VA+SNSFGFGGHNS + F+ +K
Sbjct  525  SKKERLDIKVALSNSFGFGGHNSSIIFAPYK  555



>ref|WP_021828618.1| MULTISPECIES: beta-ketoacyl-acyl-carrier-protein synthase II 
[Bacteria]
 gb|ERL53596.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia gallinacea 
08-1274/3]
 gb|EYE60771.1| beta-ketoacyl-acyl-carrier-protein synthase II [Bacteroides fragilis 
str. S6L5]
Length=416

 Score =   282 bits (722),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 169/213 (79%), Gaps = 2/213 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+A RALS+RND PQ ASRPWD+DRDGFV+GEGAGVLV+E+LE+A+KR API AE LG  
Sbjct  204  FIANRALSERNDAPQEASRPWDRDRDGFVIGEGAGVLVLETLENALKRDAPIFAEILGSY  263

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T PR DG G++SCI  AL+ AG++ E VNYINAH TST +GD++EV AVKK 
Sbjct  264  TTCDAFHITAPRDDGEGITSCILGALQQAGIARERVNYINAHGTSTPLGDISEVLAVKKA  323

Query  513  F-KDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTV  340
            F      ++MN+TKS+IGHCLGAAGG+EA+ T++AI TG LHPTIN  NP   + EFD V
Sbjct  324  FGSHVKNLRMNSTKSLIGHCLGAAGGVEAVVTIQAIQTGKLHPTINLENPIVEIDEFDVV  383

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             NK Q+ +I+VA+SNSFGFGGHNS + FS + P
Sbjct  384  ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYIP  416



>ref|WP_020370551.1| MULTISPECIES: beta-ketoacyl-acyl-carrier-protein synthase II 
[Chlamydia]
 gb|EPP34910.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia psittaci 
10_1398_11]
 gb|EQM62372.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia ibidis 
10-1398/6]
Length=416

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 169/213 (79%), Gaps = 2/213 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+A RALS+RND P+ ASRPWD+DRDGFV+GEGAGVLV+E+LE+A KRGAPI AE LGG 
Sbjct  204  FIANRALSERNDAPEQASRPWDRDRDGFVIGEGAGVLVLETLENAQKRGAPIFAEILGGY  263

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T PR DG G++SCI  ALE AG+  E VNYINAH TST +GD++EV AVKK 
Sbjct  264  TTCDAFHITAPRDDGEGITSCILGALESAGIERERVNYINAHGTSTPLGDISEVLAVKKA  323

Query  513  F-KDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE-FDTV  340
            F      ++MN+TKS+IGHCLGAAGG+EAIAT++AI TG LHPTIN  NP   +E  D V
Sbjct  324  FGSHIKNMRMNSTKSLIGHCLGAAGGVEAIATIQAIQTGKLHPTINLENPIIEIEGLDLV  383

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP  241
             +K Q+ +I+VA+SNSFGFGGHNS + FS + P
Sbjct  384  AHKAQDWDIDVAMSNSFGFGGHNSTILFSRYIP  416



>ref|WP_010229532.1| 3-oxoacyl-ACP synthase [Chlamydia muridarum]
 gb|AAF39028.1| 3-oxoacyl-(acyl-carrier-protein) synthase II [Chlamydia muridarum 
str. Nigg]
 gb|AHH22543.1| 3-oxoacyl-ACP synthase [Chlamydia muridarum str. Nigg3 CMUT3-5]
 gb|AHH23467.1| 3-oxoacyl-ACP synthase [Chlamydia muridarum str. Nigg CM972]
 gb|KDU80284.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia muridarum]
 gb|KDU81145.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia muridarum]
 gb|KDU82440.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia muridarum]
 gb|KDU83097.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia muridarum]
 gb|KDU84255.1| beta-ketoacyl-acyl-carrier-protein synthase II [Chlamydia muridarum]
 gb|AID37694.1| 3-oxoacyl-ACP synthase [Chlamydia muridarum str. Nigg 2 MCR]
 gb|AIT90379.1| 3-oxoacyl-ACP synthase [Chlamydia muridarum]
 gb|AIT91267.1| 3-oxoacyl-ACP synthase [Chlamydia muridarum]
 gb|AIW23142.1| 3-oxoacyl-ACP synthase [Chlamydia muridarum]
 gb|AJR10247.1| 3-oxoacyl-ACP synthase [Chlamydia muridarum]
Length=418

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 171/215 (80%), Gaps = 2/215 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+A RALS+RND P+ ASRPWD+DRDGFV+GEGAGVLV+E+L++A+KRGAPI AE LG  
Sbjct  204  FIANRALSERNDAPEQASRPWDRDRDGFVLGEGAGVLVLETLDNALKRGAPIFAEVLGTY  263

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T PR DG G+++CI  AL  AG+  E VNYINAH TST +GDL+EV A+KK 
Sbjct  264  TTCDAFHITAPRDDGEGITACILGALNKAGIPKERVNYINAHGTSTPLGDLSEVLALKKA  323

Query  513  F-KDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTV  340
            F      ++MN+TKS+IGHCLGAAGG+EA+AT++AI TG LHPTIN  NP   + EFD V
Sbjct  324  FGSHIKNLRMNSTKSLIGHCLGAAGGVEAVATIQAIQTGKLHPTINIENPIAEIEEFDVV  383

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP*L  235
             NK Q+ +++VA+SNSFGFGGHNS + FS ++P L
Sbjct  384  ANKSQDWDVDVAMSNSFGFGGHNSTILFSRYEPSL  418



>ref|WP_011324861.1| 3-oxoacyl-ACP synthase [Chlamydia trachomatis]
 gb|AAX51050.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
A/HAR-13]
Length=418

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 171/215 (80%), Gaps = 2/215 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+A RALS+RND P+ ASRPWD+DRDGFV+GEGAG+LV+E+L++A+KRGAPI AE LG  
Sbjct  204  FIANRALSERNDAPEQASRPWDRDRDGFVLGEGAGILVLETLDNALKRGAPIFAEVLGTY  263

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T PR DG G+++CI  AL  AG+  E VNYINAH TST +GDL+EV A+KK 
Sbjct  264  TTCDAFHITAPRDDGEGITACILGALNKAGIPKERVNYINAHGTSTPLGDLSEVLALKKA  323

Query  513  F-KDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTV  340
            F      ++MN+TKS+IGHCLGAAGG+EA+AT++AI TG LHPTIN  NP   + EFD V
Sbjct  324  FGSHVKNLRMNSTKSLIGHCLGAAGGVEAVATIQAIQTGKLHPTINVENPIAEIEEFDVV  383

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP*L  235
             NK Q+ +++VA+SNSFGFGGHNS + FS ++P L
Sbjct  384  ANKAQDWDVDVAMSNSFGFGGHNSTILFSRYEPSL  418



>ref|WP_009872915.1| 3-oxoacyl-ACP synthase [Chlamydia trachomatis]
 ref|NP_220289.1| 3-oxoacyl-ACP synthase [Chlamydia trachomatis D/UW-3/CX]
 ref|YP_008635284.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
E/C599]
 ref|YP_008655940.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
F/SWFPminus]
 gb|AAC68365.1| Acyl Carrier Protein Synthase [Chlamydia trachomatis D/UW-3/CX]
 emb|CBJ15295.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
Sweden2]
 gb|ADH17570.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
E/150]
 gb|ADH19418.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
G/11222]
 gb|ADH21262.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
E/11023]
 gb|ADI51446.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
D-EC]
 gb|ADI52458.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
D-LC]
 emb|CCE14833.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
F/SW5]
 emb|CCE13944.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
F/SW4]
 emb|CCE13055.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
E/SW3]
 emb|CCP50949.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
K/SotonK1]
 emb|CCP52966.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
D/SotonD1]
 emb|CCP53858.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
D/SotonD5]
 emb|CCP54749.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
D/SotonD6]
 emb|CCP55639.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
E/SotonE4]
 emb|CCP56539.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
E/SotonE8]
 emb|CCP57456.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
F/SotonF3]
 emb|CCP58349.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
G/SotonG1]
 emb|CCP61032.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
E/Bour]
 emb|CCP28569.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
IU824]
 emb|CCP29470.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
IU888]
 gb|AGT64739.1| 3-oxoacyl-ACP synthase [Chlamydia trachomatis]
 gb|AGT65669.1| 3-oxoacyl-ACP synthase [Chlamydia trachomatis]
 gb|AGT66595.1| 3-oxoacyl-ACP synthase [Chlamydia trachomatis]
 gb|AGT67524.1| 3-oxoacyl-ACP synthase [Chlamydia trachomatis F/11-96]
 gb|AGT68446.1| 3-oxoacyl-ACP synthase [Chlamydia trachomatis]
 gb|AGT69377.1| 3-oxoacyl-ACP synthase [Chlamydia trachomatis]
 gb|AGT70299.1| 3-oxoacyl-ACP synthase [Chlamydia trachomatis]
 gb|AGT72138.1| 3-oxoacyl-ACP synthase [Chlamydia trachomatis]
 emb|CDG43672.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
E/C599]
 emb|CDG42783.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
F/SWFPminus]
Length=418

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 171/215 (80%), Gaps = 2/215 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+A RALS+RND P+ ASRPWD+DRDGFV+GEGAG+LV+E+L++A+KRGAPI AE LG  
Sbjct  204  FIANRALSERNDAPEQASRPWDRDRDGFVLGEGAGILVLETLDNALKRGAPIFAEVLGTY  263

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T PR DG G+++CI  AL  AG+  E VNYINAH TST +GDL+EV A+KK 
Sbjct  264  TTCDAFHITAPRDDGEGITACILGALNKAGIPKERVNYINAHGTSTPLGDLSEVLALKKA  323

Query  513  F-KDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTV  340
            F      ++MN+TKS+IGHCLGAAGG+EA+AT++AI TG LHPTIN  NP   + EFD V
Sbjct  324  FGSHVKNLRMNSTKSLIGHCLGAAGGVEAVATIQAIQTGKLHPTINVENPIAEIEEFDVV  383

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP*L  235
             NK Q+ +++VA+SNSFGFGGHNS + FS ++P L
Sbjct  384  ANKAQDWDVDVAMSNSFGFGGHNSTILFSRYEPSL  418



>ref|WP_009872150.1| 3-oxoacyl-ACP synthase [Chlamydia trachomatis]
 emb|CAX10336.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
B/TZ1A828/OT]
 emb|CAX11229.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
B/Jali20/OT]
 gb|ADH18493.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
G/9768]
 gb|ADH20339.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
G/11074]
 gb|ADH97437.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
G/9301]
 gb|AEP35662.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
A2497]
 emb|CAX09442.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Chlamydia trachomatis 
A2497]
 emb|CCP49965.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
A/7249]
 emb|CCP49067.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
A/5291]
 emb|CCP48168.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
A/363]
 emb|CCP59243.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
Ia/SotonIa1]
 emb|CCP60137.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
Ia/SotonIa3]
 gb|AGR96099.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
RC-F(s)/852]
 gb|AGR99815.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
RC-F(s)/342]
 gb|AGS00751.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
RC-J(s)/122]
 gb|AGS02633.1| 3-oxoacyl-(acyl carrier protein) synthase II [Chlamydia trachomatis 
J/6276tet1]
 gb|AGT73065.1| 3-oxoacyl-ACP synthase [Chlamydia trachomatis]
Length=418

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 171/215 (80%), Gaps = 2/215 (1%)
 Frame = -1

Query  873  FVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGA  694
            F+A RALS+RND P+ ASRPWD+DRDGFV+GEGAG+LV+E+L++A+KRGAPI AE LG  
Sbjct  204  FIANRALSERNDAPEQASRPWDRDRDGFVLGEGAGILVLETLDNALKRGAPIFAEVLGTY  263

Query  693  VTCDAYHMTDPRADGLGVSSCIHSALEDAGVSPEEVNYINAHATSTLVGDLAEVNAVKKV  514
             TCDA+H+T PR DG G+++CI  AL  AG+  E VNYINAH TST +GDL+EV A+KK 
Sbjct  264  TTCDAFHITAPRDDGEGITACILGALNKAGIPKERVNYINAHGTSTPLGDLSEVLALKKA  323

Query  513  F-KDTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSV-EFDTV  340
            F      ++MN+TKS+IGHCLGAAGG+EA+AT++AI TG LHPTIN  NP   + EFD V
Sbjct  324  FGSHVKNLRMNSTKSLIGHCLGAAGGVEAVATIQAIQTGKLHPTINVENPIAEIEEFDVV  383

Query  339  PNKKQEHEINVAISNSFGFGGHNSVVAFSAFKP*L  235
             NK Q+ +++VA+SNSFGFGGHNS + FS ++P L
Sbjct  384  ANKAQDWDVDVAMSNSFGFGGHNSTILFSRYEPSL  418



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1889938564800